1BITA

The crystal structure of anionic salmon trypsin in a second crystal form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
222
structure length
222
Chain Sequence
IVGGYECKAYSQAHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of anionic salmon trypsin in a second crystal form.
pubmed doi rcsb
source organism Salmo salar
molecule tags Serine proteinase
molecule keywords TRYPSIN
total genus 55
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bitA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bitA02
2FZZA 5F6MA 4X6PA 3E90B 4XBCA 4NZQA 4ABHA 1AE8H 3KHVA 4LZ1H 1O3EA 7LPRA 3BTDE 3U8TH 1WTGH 1GVKB 3ATLA 1O3JA 4GLYA 4B73A 1K9OE 1EXFA 2QGRA 1HFDA 1QRXA 2FIRH 3ESTA 1RTLA 3V13A 1GHXH 1IQIA 3UY9A 1GBMA 1MKXK 2FDAA 3A82A 4ZHAA 4Y11E 5BRRE 1HAXB 3RMOH 1K2I1 3SNEA 1W7GH 3QWCH 2Q6FA 1J9CH 4CREA 1O35A 1EB2A 1O3PB 4I31A 1A0LA 2GMTC 5JBCS 1AFQC 4D9QA 1AKSA 2QAAA 6CHAC 5EW2H 7KMEH 4FUEA 1BBRH 1EOJA 2IJOB 3LONA 1EZXC 3MNSA 6ESTA 4X1QU 1VJAU 3JZ1B 1PPEE 2PUQH 2Z9LA 3M61U 4MPXA 1QR3E 1P2IA 1GMDG 4ISIH 1NFYA 1WQSA 2H6MA 1CHOF 3RXPA 8LPRA 1C5ZB 4HFPB 5FHTA 2BY7X 2FPZA 2VJ1A 4MPUA 1V2TT 3SJKA 1ANCA 2B0FA 3HGNA 4QT8C 4LK4A 3AW0A 5TCCA 1AD8H 1XUIA 3PROA 4E05H 1MBMA 2BDCA 2F9NA 5AFYH 2G81E 5A8ZA 2AMQA 5E0HA 1Y5BT 2QF3A 1ELFA 3RC5A 3NCLA 1NU7B 3S9AA 1C1QA 4A7IB 4WF8A 3UOPA 3ZV9A 2J34A 3KQCA 4ISOA 5DP7A 1LVMA 2BMGB 1RIWC 2G4TA 4E7NA 6CHAB 2VVVA 2EA3A 1DY8A 4DVAU 3BG4B 5FPYA 1MUEB 1C2HA 3BEFB 3SJOA 2ZF0H 1H9IE 5JB8S 1O37A 2FI3E 2QV1A 3ATKA 2QA9E 1B5GH 2ZG0H 3LGTA 2BDIA 3AW1A 2TGTA 2BHGA 3ELAH 1LHEH 5I46H 1GI4A 2C90B 5C1XA 1AWFH 3SU5A 3CS0A 1IQGA 8ESTE 1E34B 3K6YA 2WV5A 3H7TA 4IN2A 1C5NH 1GL0E 1AGJA 3SQEE 3F9FA 4YT6H 1L2EA 3FZZA 1TOMH 4INHA 3MO6A 1KXDA 5E2PA 2GGVB 4B74A 2BLQA 4HGCA 1LDTT 1FMGA 4A1XA 3PV4A 2ZTYA 3KF2A 1K1OA 2OLGA 1CGIE 4SGAE 2ZCLP 4CH2B 1E0FD 1YF4A 3OYPA 1SVPA 3LJJA 5FX6A 1IQEA 2BZ6H 2EI6A 2FWWA 4GHQA 2BXUH 5DP8A 1V2QT 1GBJA 3ZZDA 1UJ1A 2NU4E 3O8DA 1YPLH 3MWIU 1ETTH 1SLVB 1DUEA 1O33A 1V3XA 5DK1A 1DS2E 1VCWA 2AIQA 2PKAB 2Y7ZA 1HCGA 2PGQB 3M37A 5C5NA 1AE5A 3FP8E 1TABE 1KLJH 3A81A 3F9HA 2F91A 1QCPA 5A0CA 1E38B 1TMBH 1W14U 1S83A 2BDBA 1G3CA 4BTUB 4MG3A 1YKTA 3SUFA 1W11U 1ELTA 1OWKA 3B23B 1CVWH 3D62A 1UTLM 4IS5A 2ZDVH 2PKAA 5FPTA 2NU3E 2QF0A 4BXSA 1MZDA 1NESE 1X7AC 2QCYA 1IQJA 4MLFB 1OP8A 1G36A 2BQ6B 3PLPA 4UD9H 1KTSB 3LT3A 4ZXXH 1MCTA 4RKJB 2ANMH 2BD8A 4Y7AA 3T2NA 4TY6A 3CP7A 2PV9B 4KELA 2CHAB 2AEIH 5CMXH 3ZZ4A 1JMOH 4ASHA 1OP2A 3M5MA 1S6FA 1Z8GA 3QO6A 4IBLH 5ESBA 5T6FA 4ABGA 2TBSA 2Z9IA 1Y8TA 2AMPA 1GDQA 3FP7E 1PPBH 1P9SA 1INCA 1P10A 1BUIA 1GHZA 1L0ZA 1FY3A 4RN6A 4YOIA 1ESBA 1MMJN 3RXBA 4Z6AH 4ZKRU 1GBLA 2XW9A 4OS2A 2JH0D 2XXLA 2FI4E 3QN7A 4Y0YE 1TRNA 5EQSA 4DW2U 3ZVBA 4U32A 2KAIA 4D76A 1P03A 1C2KA 3EDXB 2WUCA 3ITIA 2GX4A 1MTVA 1O5BB 2BLOA 1PQAA 1ZJKA 4I8KA 3IITA 1BZXE 1CA0B 3RXDA 2ZGXH 4JCNA 3UWIA 3OTJE 2FOGA 5EXLA 2A5IA 5F03A 2A45B 1HAOH 5AFZH 1F5LA 1GI6A 1HNEE 3Q76A 1BRUP 3PMAB 3T62A 3SNBA 4K2YA 1OPHB 1C1WH 2WINI 3OU0A 1MKWK 1QBNA 1UTJA 4MTBA 2G55A 4WY3A 2R9PA 2TGPZ 4AG1A 3I78A 1GGDB 2ZPQA 1XUKA 2JH5D 2FM2A 1GMHG 1SOTA 4X1RU 2BVRH 3RXKA 4ZKNU 1T32A 2STBE 2J92A 4JYTA 1NRPH 1YPJH 1ZSLA 2F83A 3A83A 1K1LA 3M5NA 3ZVGA 1OSSA 1JBUH 1N8OB 2ULLA 1VGCC 1NTPA 1FY4A 3SI4H 3SU1A 4JYUH 2GTBA 3M7UA 1MCVA 1GI9B 1K1PA 3MU8A 3V0XA 1GBIA 2ALVA 1ANDA 4ZKOU 3BF6H 2B8OH 2Z7FE 1BRBE 1P06A 1TGTA 2UWLA 1UHBA 1EJAA 2P8OC 2FXRA 7GCHF 3SGAE 2VH0A 2YNBA 3MNXA 1PPCE 1O3AA 3SV7A 1RXPA 1E36B 3ATIA 1ELVA 2Y80A 1TRMA 2P3UB 3A84A 1TALA 3URCA 1Z1IA 7ESTE 2A2QH 3O8CA 1GMCF 1QIXB 1XXFA 1SGPE 2CJIA 1VITF 2XCNA 3OX7U 3SU3A 4CRCA 1V2RT 1YPGH 1GG6C 3TJVA 2QYIA 3RLWH 2BX4A 5DP5A 4O9VA 3QZQA 3STJA 3LGYA 5IDKA 2ZO3H 1TGSZ 1P2QA 3RU4T 1P2KA 2HPQH 4JZ1A 2XC0A 2W5EA 1A2CH 1ELAA 2ZPSA 3MU5A 2FOFA 1DWEH 2NWNA 1A1RA 3K65B 5FX5A 4BNRA 2XCFA 1AUJA 1LHCH 3HK3B 2C93B 1UVUH 1FLEE 2PTCE 8GCHF 3S0NA 3RM0H 5C3NA 4KTUA 1LQDB 1SGRE 4UEHH 4X1SU 5FBIA 4UDWH 2HNTC 4X8VH 1A5IA 3TNSA 1C2JA 5L2YH 5SGAE 1HDTH 1BQYA 1F0TA 3AAVA 3NXPA 1GCTC 4X1NU 1C1SA 2B7DH 1AUTC 2H5DA 5EQQA 4D7GA 1O39A 2R0LA 1H9LB 4FUFA 3LPRA 1GMDF 2C8WB 1TIOA 2TPIZ 5GDSH 4MNXA 1Z1JA 1Z8IB 1Q3XA 2BVXH 1O5EH 1D4PB 3EA7A 1O3CA 3SV9A 1NM6A 1ELEE 2Z3DA 3BV9B 1SLWB 5EQRA 3SHCH 2ANKH 3F9GA 2ZHDA 5F8XA 4AGJA 2A0QB 3PMHB 4I7YH 1O30A 1O3KA 1GHYH 3ZZAA 5DP9A 4IMZA 2QXJA 4B76A 1F2SE 2FOHA 4NWKA 3VFEA 1IQFA 4CR5A 4JYVH 4O3UA 2UWOA 2Q1JA 1XVOA 2ZDLA 1G3DA 1NRNH 1EUFA 2J9NA 1T4VH 1CU1A 4CH8B 2Q6GA 2AMDA 1GL1A 1EASA 1NRSH 2LNCA 1GI2A 4A6LA 3NWUA 3MU0A 3EAJA 3PMBB 1IQNA 2VGCC 3EQ0H 1C2LA 2OCVB 3BTFE 3MOCA 3AAUA 1D6RA 2A4OA 3PO1C 1SPJA 1GBTA 3A85A 1IAUA 1G2LA 2VNTA 1TA2A 2HNTF 1WSSH 1O32A 5FPSA 4U30A 1O3HA 2Z9GA 3RXFA 5JBAS 4LXBH 2ZA5A 5HXFA 1ORFA 5DP3A 4ISNA 1AVGH 5AVDA 3B8JA 1DITH 1MTUA 2PWXA 1GHAF 1YM0A 1SGEE 2A4RA 4BAMB 5JBBS 3MU1A 2FTMA 4JZDH 1O3OA 3UOUA 1VITG 1AWHB 2R3YA 1NRRH 5A0BA 2ZC9H 3S9BA 4K5ZA 1V2VT 2XBYA 2A31A 2V3OH 1F7ZA 1PPGE 4NCYA 1F92A 4AG2A 2EI7A 1P2JA 2AFQB 1YPMH 4WMDA 3GOVB 1V2UT 3RXTA 2ASUB 5K0HA 5GXPA 2H1UA 4I8HA 1GVLA 2ZGBH 4GUXA 3BIUH 1OWHA 2BD5A 1FY5A 1UVTH 1C4Y2 4OS5A 4ABAA 4TYDA 1O2TA 1QFKH 1OKXA 1Z71A 4AFUA 1BTZA 1YCPH 4XBBA 1SQOA 5LPFA 3VB5A 5A09A 4ABFA 1AVWA 1JIMA 1Y3UA 2O8WA 1JRSA 3BG4C 1MTNB 1O2UA 3SU0A 1UK3A 1JXPA 1W0ZU 3VXFH 1D3TB 1LCYA 1S85A 1RIWB 2OC0A 3A7TA 1ESAA 1FJSA 3Q3KA 5GCHG 1UHBB 5EU8A 1S0RA 1ABIH 1O2IA 2IOTA 1SMFE 5EOKA 4J2YB 1FIWA 1WOFA 1SLXB 1EP5A 2Z94A 1ZMLA 1B0FA 1O3LA 3I77A 1IQHA 1QJ1B 4CRFA 1W0YH 1Z6JH 1LVOA 1N6YA 1C1NA 2ZGJA 1DX5M 1J17T 1Y3VA 1NC6A 2SGPE 1D9IA 2HNTE 4IC6A 4NIXA 2TRMA 4O97A 4GPGA 4O03A 2B9LA 3A7ZA 4WMEA 1N1LA 2A1DB 4K69A 1VCQA 2Y5GA 1O5AB 1LHGH 1XX9A 2OBQA 4HI3A 1YCPK 2R2MB 4K8YA 4WXIA 4K3JA 2H9TH 3HATH 3RXAA 1HXFH 1J8AA 1MZAA 1S82A 3L33A 8GCHG 4CRAA 2PW8H 5LH8A 2PSXA 4X1PU 1KXCA 2WPKS 2FI5E 3H7OA 1P04A 4Y76A 2P95A 2O8TA 1Q31A 4JZEH 1YLCA 1SGNE 2EI8A 1A3BH 5LGOA 2P94A 1ZTKA 4AFQA 1UTPA 1UK4A 2FX4A 1MKXH 1HRTH 1LPKB 2VWNA 3RU4D 1P9UA 3SUEA 3SBKA 3IG6B 1C5QA 2AGEX 3RMNH 3TIUA 3VEQB 4Y7BA 1LHFH 2BD7A 2FOAA 4NA9H 1QA7A 4FU8A 4ZUHA 1GGDC 3RMMH 2I6SA 2VGCB 3QUMP 3FVFB 3GY3A 4MDSA 1ZMJA 2ZU1A 1DOJA 3DT0H 3QGJA 1SGFG 2RG3A 2J38A 1GJCB 2PKSB 2PLXA 3ZVCA 1EAXA 2SGDE 3U8RH 2G52A 1TX7A 1EQ9A 3RXCA 1L4ZA 3SNCA 1Y5UT 2ZU3A 4DG4A 1T8LA 1OXGA 1BBRE 4DT7B 1V2LT 1MU6B 4ISLA 1D3DB 1WU1A 4FVBA 3PTBA 3P17H 1P0SH 1V2ST 3LH3A 3SJ8A 2ZWLH 4Z0KA 4B2AA 3TK9A 1DM4B 2F9OA 1QJ7B 1BCUH 2ZIQH 2OC1A 1OWEA 1UTQA 1WCZA 1P12E 7GCHG 3PYHA 4D7FA 1AO5A 1O5CB 3NZIA 3A8BA 1LTOA 1LKBA 1PQ8A 3MYWA 3A7VA 3EYDA 1W2KH 4I8JA 4AOQA 1S81A 3V3MA 3RXUA 3ZZ5A 2BOKA 4X0WU 2A7CA 1H4WA 2FEQH 1GJAB 2F9BH 3SZNA 4AORA 1C1PA 3C1KA 1EZQA 1C2IA 1ZRKA 3MHWU 3Q00A 5FBEA 2OQ5A 2Y6TA 1QQUA 2XNIA 3SJ9A 5L2ZH 2GCTC 3FFGA 3A80A 4JK6A 1C2FA 4B2BA 2VIWA 1SHHB 1HJAB 3UQOA 3TNTA 1AVXA 2ZECA 3HKJB 3KGPA 1DXPA 1VR1H 3RXOA 3DD2H 1BRCE 2ESTE 3ZVEA 1GBDA 1NS3A 1GG6B 1TPAE 1C5PA 4AYVB 4NIVA 1DLKB 1ACBE 1Q2WA 2D26C 4WXVA 5JPMH 9LPRA 2P59A 4YLUA 2SFAA 1OYQA 2OINA 2XBXA 1K22H 2ZFTA 1NN6A 2ZPRA 4MNYA 2O8UA 1A0HB 3LKWA 3MH4A 4D9RA 5A2MH 5JBTA 1C5YB 1O2LA 2GDDA 5C20A 4IGDA 1L1NA 2ZNKH 3ZVFA 5JB9S 2XTTB 2Z3CA 3RXSA 1YCPM 3IWMA 2VIPA 4AZ2B 1FPHH 3RLYH 4IN1A 4CBOA 1HAPH 1CBWC 2F3CE 3A8CA 2ZDNA 4X8UH 1TNLA 2BY9X 3TLOA 1O2WA 4UE7H 1O2KA 3TGIE 5LPEA 4X6MA 3GISB 5HYOA 4ZHLU 1PPHE 1HB0B 3BTHE 1Z6EA 4YO9A 4BANB 4DOQA 3BTQE 3PLKA 1O3DA 1G2MA 4WH8A 2JKHA 4BOHA 1HAGE 1A4WH 3JZ2B 1KLIH 3P8GA 4F49A 4ABBA 2F9UA 1WYKA 1RS0A 2ANYA 2GD4B 1MTNC 1PPFE 2NU2E 4BXWA 1SOZA 1DICA 1UMAH 2TGAA 2VWLA 3MH5A 1BMAA 1T7CA 2JETB 1PFXC 3E0NB 1YYY1 5HM2A 3L3TA 2O8MA 3QK1A 2GZ8A 2A5KA 3KIDU 2QC2A 3ODDA 1LVYA 1QB9A 2Y7XA 4X2YA 1GHAG 1OOKB 4NIYA 3G01A 1ID5H 2WPHS 4ZMAH 4PROA 1AZZA 1MTSA 4B2CA 1XUGA 1ZRBA 1FNIA 2VWMA 3GCHB 4AGKA 1NFXA 1ZTJA 1MQ6A 1QNJA 1O2HA 2G51A 3I29A 3LIWA 3STIA 1TPPA 1GJ9B 3QGNB 5E0GA 1MBQA 1GMHF 2BY5X 3TGKE 1CT4E 1SHYA 1YPHC 3A7WA 3T26A 2OD3B 4FUJA 1TNHA 3GCNA 3RU4E 2BDGA 1C5LH 1THSH 3MMGA 1NO9H 1A46H 2ZFSA 1BMLA 1ZR0A 2GCHF 1CGHA 2HALA 3SNDA 4HZHA 2AH4X 1AFQB 4NG9H 3BEIB 2ZCKP 4FVDA 2SGQE 1O2QA 5T6GA 3U8OH 1QJ6B 4JZFH 1UO6A 3FAOA 2G00A 1P02A 3A7YA 3F9EA 1BHXB 4ABIA 1D6WA 2P3FH 2SGAA 1WBGB 1SGYE 2UWPA 1DWBH 1QA0A 1EX3A 1O2JA 4GCHF 3S7HB 1LKAA 4YOGA 1EPTB 1AN1E 4YESB 3LC3A 1HAVA 1GCDA 3M7TA 3ZZ3A 1K1NA 1E35B 1UVOA 3K6ZA 1Y3WA 5EGMA 2BLWA 3QTOH 4UFDH 1YBWA 5E0JA 1CBWB 1TQ0B 4TY7A 2RDLA 1EB1H 1NPMA 4Y8YA 4K1EA 1TNGA 5EXMA 5C5OA 1ABJH 2D1JA 1TYNA 5T3HA 4Q7YA 1C5RA 2CMYA 1ZPCA 1C9TA 2TGDA 2H9HA 2ODYB 2ODPA 1GI7B 2PTNA 4Q80A 5FCRA 2EC9H 1LQEA 2OXSA 1VZQH 1P09A 1GBHA 1UVPA 3PM3A 1C2GA 4YTAA 4R8TB 4DIIH 1TPOA 2ZFPH 4IMQA 4ABDA 1EPTA 2J95A 5HM9A 2F9VA 1JRTA 3GDUA 2VIQA 4RSPA 3UWJH 1GBFA 1SGFA 1GHBF 3UTUH 5IYTA 4GSOA 5AHGH 2ZGHA 3GY5A 2A32A 2FS8A 1AB9B 2RCEA 1TWXB 4XBDA 1O34A 4WH6A 1UTMA 1ZHPA 1BMNH 1HAVB 1QL7A 3ZZ8A 1W13U 1KDQB 2FOMB 3UNQA 5GIBA 4ISHH 3U98H 3KL6A 1T8NA 4MPVA 1ZHMA 3HGPA 3T5FH 1O2VA 1O3FA 2R3UA 2ZTZA 2ZTXA 4AFZA 2HOBA 1J14A 1K1JA 3BTEE 2Q6DA 3HKIB 3M36A 1KSNA 2OTVA 3GY8A 3CS7A 2P3TB 6GCHG 2D8WA 3V12A 1S5SA 3GICB 2WV4A 1A5HA 1XUFA 5EODA 1C2MA 4DURA 3NUMA 1KIGH 2UUKB 1GWAA 3PWCA 3BIVH 1EAWA 1ETRH 1Y3XA 2ZDMA 1PYTC 3AASA 1ZSJA 3TGJE 4NWLA 1CSOE 1V2JT 2V3HH 2ZU4A 2AERH 2EEKA 5DO4H 3VPKA 3LH1A 4NZLA 3OSYA 2NU0E 2TIOA 4JK5A 3QDZB 1BJVA 4R0IA 4CRDA 3TVJB 1K28D 1ZSKA 2SNVA 1GI1A 5K7RA 2FLBH 3D65E 4NFEA 2GZ9A 3ZV8A 2HVXA 2FYRA 3GCOA 5A8XA 1ZTLA 3EA8A 2ZP0H 1AY6H 1MH0A 1BA8B 1O2GH 1PQ5A 1S84A 3KQBA 3FP6E 4O3TA 2M5TA 3ATMA 1MD8A 1CA8B 1TAWA 4FXGH 1P8VC 1DWDH 1W7XH 1EZSC 1NRQH 2PSYA 3AVZA 3TITA 4GHTA 4I8GA 1QQ4A 1BTHH 3O8BA 1DT2A 3TPIZ 1KY9A 1O2RA 2W3KA 1O2YA 1SGIB 1H8IH 1HJAC 1UTOA 5FXLA 1G3BA 1P2NA 1K1IA 3SN8A 1V2NT 1CA0C 1TFXA 2HWLB 3P6ZB 4K60A 1JIRA 2A4QA 3SI3H 2ZQ2A 4HTCH 5EPNA 3P92A 1BBRK 2DE9A 3RC6A 3RXGA 3LDXH 1DPOA 1GJDB 3LGWA 1LHDH 2BD4A 3LGVA 4VGCB 3R3GB 2CN0H 5J4QA 2A7JA 2WPMS 1ELBA 1QB6A 1WTHD 3QZRA 3P95A 3TH3H 2FYQA 4AN7A 1BOQA 1IOEA 2QXHA 5F8TA 5GJ4B 3SV2H 4WVPE 4OS7A 4H42U 2DE8A 1TE0A 5DKMA 4CRBA 1RD3B 2Y82A 4X6NA 4MQAA 2BQWB 1RFNA 2ZI2H 5T6DA 1A7SA 2BY8X 3MTYA 1ZPBA 3LGIA 1XM1A 1T8MA 4RKOB 2R0KA 3PMJA 1TQ7B 4BAQB 4Y8XA 1ZOMA 4YLQH 2DUCA 2PR3A 3OY5U 4ZKSU 2BOHB 2XRCA 1UTKA 3MO9A 3P8NA 1GBKA 1OS8A 2CF9H 2BTCE 2ZHWH 4FUHA 4Y10E 1V6DA 2O8LA 2JETC 2NU1E 3RMLH 5B6OA 1XMNB 3EGKH 3SU2A 2Z9JA 3RXEA 4CHAC 4OS6A 3VXEH 2XBVA 1GJ6A 1BTWA 2XWBI 3M3VA 2OQUA 3PO1B 4Y6DA 2BYAX 1DFPA 2CV3A 4YM9A 2V0BA 1V2PT 2ZDAH 1SGDE 2ZZUH 2J2UA 9ESTA 1JOUB 2BD3A 1O3IA 1ELGA 2STAE 3LJOA 3BN9A 1VCPA 2BY6X 1AB9C 1Y59T 1ZHRA 3BTME 1IQLA 5FCKA 1G30B 3SW2B 1QBOA 3KNXA 1TX6A 2WYGA 3ZYDA 4BAHB 3T27A 5C1YA 4CR9A 3GCTG 1AIXH 5DP4A 1MAYA 1BRAA 2GZ7A 3M35A 5TCAA 3E3TA 2J94A 2HLCA 1MTWA 4YOJA 2F9PA 4H6TA 2A2XH 2W3IA 3RXHA 5ABWA 4LOYH 1F5KU 5DP6A 2BDHA 2QY0B 3L6PA 2ZFFH 2ZHEH 4J1YA 1EAUA 5E8EH 1RRKA 4WWYA 1EAIA 2FODA 1P57B 1IHSH 2WYJA 3A87A 3E0PB 4INLA 2W7SA 1XUHA 1XVMA 3VGCC 3RP2A 2VINA 3SHAH 1EOLA 1S0QA 2PKSC 1C5SA 1TGNA 1ELCA 3SGQE 3KQEA 4A92A 2GKVE 1NY22 1O31A 1THPB 1HPGA 1CO7E 4DGJA 1ZLRA 4K1SA 5TJXA 2IN2A 1BMMH 3VB7A 1TRYA 3H5CB 1PPZA 4Q7XA 1C1VH 3SO3A 4FUIA 1O3NA 1KXBA 3E91A 4A1TA 2ZCHP 1PJPA 3S69A 3M3SA 3ZZBA 3RXJA 1FV9A 2KAIB 2GCTB 1D3PB 2SGFE 3DFLA 2I6QA 3WY8A 1BT7A 1N6XA 1OWJA 1GMCG 1V2MT 2IPHA 3RXLA 1S6HA 1XKBC 4CRGA 4ABEA 3UPEA 1L1GA 1NFWA 2C3SA 3SQHE 5A8YA 2PGBB 4CBNA 1G32B 1O2NA 1G9IE 1GDNA 5CE1A 1PYTD 3A88A 4ZROA 1FAXA 1O2OA 3T25A 1KYNA 3S7KB 1TLDA 1BTPA 3SOSA 1DY9A 1LPZB 3SU4A 1ZPZA 3M5LA 1HV7A 1O3MA 1BITA 5DPAA 1GBCA 1P01A 2AYWA 5I25A 1CE5A 2ZFQH 1C2DA 1DWCH 1W8BH 2OP9A 4XOJA 2QXIA 1AI8H 1SGTA 1THRH 5EW1H 3BTGE 4JZIA 3TJUA 1HYLA 1LVBA 4GAWA 4Y0ZE 5DG6A 4BTIB 1O2SA 3A89A 1MD7A 1FI8A 1QB1A 3PTNA 1DSUA 4NGAH 1EKBB 3PLBA 2XC5A 4X8TH 4TPIZ 2B5TB 1GHBG 4B75A 5C1UA 3UREA 1T31A 4FU7A 1CGJE 4KTSA 2JH6D 3DFJA 1AKSB 2BZAA 1HBTH 1TBQH 1HIAB 1DDJA 1FN6A 3EE0B 2BDYA 2SNWA 1MU8B 3UQVA 3RC4A 2FOBA 1GJ8B 1WV7H 3FANA 1XXDA 1C9PA 4XE4A 1YPEH 2FTLE 3QLPH 1BB0B 3R0FA 2XBWA 1YPKH 2G8TA 3FZDA 2OC8A 1HAYB 3F6UH 3GDVA 2A5AA 2UUYA 2VB0A 1AFEH 1TGBA 1FONA 3P70B 1FUJA 2G5NA 1GHVH 1ARBA 3BTWE 3BG8A 4GVUA 5EXNA 5JDUB 5GWZA 3LC5A 1GBAA 1Y5AT 2H5CA 2ILNA 5CHAC 1RJXB 1C1MA 1TBZH 3GY7A 2G5VA 2BB4A 1FQ3A 1HIAA 2ZGCA 1P3EA 1OWIA 3HK6B 1O5GH 1FAKH 2HRVA 1TA6A 3EA9A 2ZHQH 3TJOA 4UFFH 1AQ7A 3MU4A 1DXWA 2C8XB 2A4GA 1SFIA 1EJMA 1N8OC 1SSXA 1VGCB 4DJZB 1C2EA 2VH6A 4I32A 4YZUA 1J15A 3B9FH 1GPZA 1UTNA 1CT2E 2QXGA 3KCGH 1HXEH 2C4FH 3BTKE 2Z3EA 3U1IB 2Y5HA 1EPTC 2P16A 1PQ7A 4NA7A 3BSQA 2GV6A 2ZEBA 2H2ZA 1NT1A 4KGAA 5DJ7A 1SC8U 1SR5C 2OUAA 2K1QA 1ANBA 3TU7H 3PB1E 3A86A 3V7TA 1TGCA 2SGEE 1QL9A 1YGCH 1BDAA 4ABJA 3NPSA 1ZMNA 1YLDA 4NIWA 1QRWA 1O0DH 2QIQA 2V35A 2VVCA 1HAHH 4WMFA 1C1UH 2Y5FA 4CHAB 1QTFA 1KXEA 2CHAC 1A0JA 1C5OH 3SV6A 4I8LA 1GI0A 3UNRA 2R2WU 1LPGB 3M7QA 4JMYA 3GDSA 2CXVA 4OS4A 1GJBB 3RXRA 3O8RA 2FLRH 3KQDA 3TK6A 4E06H 3QTVH 4ESTE 2BVSH 1O5DH 1L1JA 1TMUH 2FP7B 2VIOA 1GDUA 1AMHA 1F5RA 1C5MD 1RGQA 3ZZCA 3TJNA 4DCDA 1UVSH 1ARCA 1AU8A 3U1JB 1P05A 3ZZ6A 1EZUC 3N7OA 4TWYA 4Q7ZA 5GPIB 1GJ4H 1SBWA 3D23A 1F0SA 1NZQH 2WPIS 3SU6A 2Z6BD 1A5GH 1ETSH 1SGQE 4GCHG 1CT0E 3MH7A 1KXAA 1SGCA 2Y81A 4KTCA 4ZHMU 1D3QB 2THFB 1P3CA 3GYLB 4NA8A 2YOLA 1O3BA 1TX8A 1TNIA 3UFAA 1MKWH 4I33A 3GY4A 6LPRA 3E6PH 2ODQA 5FAHA 1DUAA 1FDPA 1FXYA 5PTPA 4ZXYH 1HUTH 2GT7A 2C8ZB 1HLTH 2AGIX 2VIVA 1Z8RA 1CHGA 1GJ5H 4UFGH 4U2WA 1BTUA 2CF8H 3LGUA 3Q3YA 3TH2H 2FS9A 4KP0A 1SQTA 4B1TA 1GI8B 1ZGVA 4ZH8A 4MPWA 3SGBE 1BHXF 2HGTH 3ZZ9A 1L4DA 1EATA 1DE7H 4AX9H 4M7GA 2A7HA 5C67A 4FUDA 1LMWB 4BAOB 1SB1H 4FU9A 4OS1A 1W10U 5BPEA 3RUOA 2ZQ1A 2P93A 3GY6A 2WUBA 1J16A 1HJ8A 1FN8A 1M9UA 2O9QA 4NFFA 5DGJA 5C2ZA 4IW4E 1GJ7B 3VB3A 4FUCA 1OP0A 4VGCC 1NFUA 5EG4A 3K2UA 2BLVA 3RXVA 1QGFA 1CHOG 4AYYB 4WJG2 3DUXH 1O5FH 1CQQA 1O2XA 1C1RA 3TK5A 4BTTB 3SJIA 2XYAA 1C1TA 2UUJB 4THNH 2QN5T 3ZYEA 1F0UA 1MAXA 1XKAC 2BXTH 4MVNA 3UR9A 3SNAA 3RXIA 4H6SB 1FPCH 2XC4A 3UIRA 4AB8A 1H8DH 3W95A 2AGGX 4BAKB 1WAYB 1ZGIA 3UR6A 1UCYK 1SLUB 4TPYA 2CGAA 1FY8E 2C8YB 1MQ5A 3E1XB 1ESTA 1LO6A 1EP6A 4OGYA 2H9EH 1H9HE 2ZDKA 5G4BA 2GDEH 3M3TA 1HAZB 5H4IB 2ZU2A 1SFQB 2HPPH 2YNAA 2GCHG 3E16B 1BTXA 1DVAH 1HGTH 1OYTH 4Y71A 2ZKSA 8KME2 3S9CA 3Q77A 3DHKH 5GCHF 1TNJA 2OBOA 2PHBA 3RDZA 4A5TS 1QL8A 3PWBA 3MNCA 1SG8B 2FMJA 1A3EH 1WQVH 4XFQA 4YT7H 1BJUA 4AFSA 2ZU5A 2FOEA 1C5TA 3GCTF 4MNWA 2BDAA 4TWWA 2W26A 3A8AA 3RXMA 4LZ4B 1FIZA 1F0RA 2ANWA 2FOCA 3CENA 4DIHH 1O2PA 2J4IA 1K21H 1TBRH 2VU8E 1YP9A 3P8OA 1YC0A 1RTKA 1ZYOA 3KN2A 2PFEA 3VB6A 1C4V2 2Z9KA 3F1SB 3ENSB 1QY6A 3UNSA 1C5WB 5L6NH 1V2OT 3OY6U 2GT8A 2BM2A 2P8OB 2W7UA 2FO9A 1P11E 1ANEA 4NSVA 4FUGA 1TONA 1ZZZA 2FX6A 2GMTB 4ZAEA 1E37B 1TPSA 2VVUA 4X8SH 3M5OA 3SUGA 1C5UA 3U69H 3SORA 2PUXB 1P2OA 1B7XB 4UFEH 3ZZ7A 5HGGA 4K8BA 3GY2A 2RA3A 4FUBA 1P2MA 1KTTB 1Z7KA 3F68H 2GP9B 1V2WT 4SGBE 1Z8JB 5F8ZA 1G3EA 4X2WA 3W94A 3RM2H 1TNKA 5E2OA 2G4UA 2D2DA 3E8LA 2BD2A 1DSTA 1QHRB 2WPLS 1U6QA 3LU9B 3VGCB 2FESH 1O38A 1IQMA 3T29A 3TH4H 4MNVA 1QBVH 3ODFA 4Q2KA 1GVZA 3A7XA 1NROH 3MNBA 4B71A 3A8DA 1SL3A 1AZ8A 1W3CA 3C27B 3DA9B 4NSYA 1TB6H 4Y79A 1GHWH 4XDEA 1AHTH 4INKA 1QURH 3MH6A 1GCTB 4X2VA 5ETXA 1G37A 3T28A 2LPRA 3ATWA 3BTTE 4KKDA 1ELDE 1KXFA 3GCHC 2UUFB 1BTYA 5A0AE 3NKKA 2RA0A 2BD9A 1UCYE 1IQKA 1FY1A 3SV8A 3ZVDA 1C5XB 2AS9A 4F4OC 3SUDA 3GYMA 1O3GA 1GBBA 1FZZA 1KLTA 1RTFB 2ALPA 1ZJDA 5JYIA 2VIDA 4IC5A 1HAIH 3ZVAA 2VWOA 4A1VA 1GI5A 1UCYH 4D8NA 1GBEA 2GVFA 1O2ZA 1DLEA 1OWDA 4X6OA 3KEEA 1C4U2 3QX5H 4DY7B 1VJ9U 1H1BA 1T4UH 3RXQA 4X2XA 4OGXA 5L30H 1EJNA 4H4FA 1B0EA 3P8FA 3UUZA 6GCHF 2OC7A 1K1MA 1O36A 1JWTA 2ZHFH 1SI5H 1C1OA 3VB4A 4UONA 1BIOA 5LPRA 3LOXA 1OX1A 3Q3XA 4AB9A 2WPJS 1KDQA 1IHTH 4U01A 1C5VA 1GI3A 3HPTB 1WUNH 3MI4A 3K9XB 1SQAA 4E7RG 3U9AH 1TMTH 3D49H 3URDA 1VITH 1W12U 1O2MA 1HJ9A 4K1TA 1UK2A 1T8OA 1Y3YA 3MFJA 5J4SA 2XWAA 2BQ7B 2BX3A 3NK8A 4Y8ZA 1TOCB 5CHAB 5HMAA 1YPHE 1NU9A 1V2KT 1XUJA 5ESTE 2AIPA 3BEUA 2V6NA 1QRZA 2GV7A 1A61H 5AF9H 5EPYA 1DANH 3MO3A 4XSKU 2ZFRH
chains in the Genus database with same CATH superfamily
2FZZA 5F6MA 4X6PA 3E90B 4XBCA 4NZQA 4ABHA 1AE8H 3KHVA 4LZ1H 1O3EA 7LPRA 3BTDE 3U8TH 1E1QD 1WTGH 1GVKB 3ATLA 1O3JA 4GLYA 4B73A 1H8HD 1K9OE 1EXFA 2QGRA 1HFDA 1QRXA 2FIRH 3ESTA 1RTLA 3V13A 1GHXH 1IQIA 3UY9A 1GBMA 1MKXK 2FDAA 3A82A 4ZHAA 4Y11E 5BRRE 1HAXB 3RMOH 1K2I1 3SNEA 1W7GH 3QWCH 2Q6FA 1J9CH 3OAAD 4CREA 1O35A 1EB2A 1O3PB 4I31A 1A0LA 1YWUA 2GMTC 5JBCS 1AFQC 4D9QA 1AKSA 2QAAA 6CHAC 5EW2H 7KMEH 4FUEA 1BBRH 1EOJA 4Z1MD 2IJOB 3LONA 1EZXC 3MNSA 6ESTA 4X1QU 1VJAU 3JZ1B 1PPEE 2PUQH 5KECA 2Z9LA 3M61U 4MPXA 1QR3E 1P2IA 1GMDG 4ISIH 4FOUC 1NFYA 1WQSA 2H6MA 1CHOF 3RXPA 8LPRA 1C5ZB 4HFPB 5FHTA 2BY7X 2V7QD 2FPZA 2VJ1A 4MPUA 2GJGA 1V2TT 2WZQA 3SJKA 1ANCA 2B0FA 3HGNA 4QT8C 4LK4A 3AW0A 5TCCA 1AD8H 1XUIA 3PROA 1NBME 4E05H 1MBMA 2BDCA 2F9NA 5AFYH 2G81E 5A8ZA 2AMQA 5E0HA 1Y5BT 2QF3A 2J98A 1ELFA 3RC5A 3NCLA 1NU7B 3S9AA 1C1QA 4A7IB 4WF8A 3UOPA 3ZV9A 2J34A 3KQCA 4ISOA 5DP7A 3NRLA 1LVMA 2BMGB 1RIWC 2G4TA 4E7NA 6CHAB 2VVVA 2EA3A 1DY8A 4DVAU 3BG4B 5FPYA 3ZIAD 3UAIC 1MUEB 1C2HA 3BEFB 3SJOA 2ZF0H 1H9IE 5JB8S 1O37A 2FI3E 2QV1A 3ATKA 2QA9E 2JJ1D 1B5GH 2ZG0H 3LGTA 2BDIA 3AW1A 2TGTA 2BHGA 3ELAH 1LHEH 5I46H 1GI4A 2C90B 5C1XA 1AWFH 3SU5A 3CS0A 1IQGA 8ESTE 5B6LA 1E34B 3K6YA 2WV5A 3H7TA 4IN2A 1C5NH 1GL0E 1AGJA 3SQEE 3F9FA 4YT6H 1L2EA 3FZZA 1TOMH 4INHA 3MO6A 1KXDA 5E2PA 2GGVB 4B74A 2BLQA 4HGCA 1LDTT 1FMGA 4A1XA 3PV4A 2ZTYA 3KF2A 1K1OA 2OLGA 1CGIE 4SGAE 2ZCLP 4CH2B 1E0FD 1YF4A 3OYPA 1SVPA 3LJJA 5FX6A 1IQEA 2BZ6H 2EI6A 2FWWA 4GHQA 2BXUH 5DP8A 1V2QT 1GBJA 3ZZDA 1UJ1A 5F53A 2NU4E 3O8DA 1YPLH 3MWIU 1ETTH 1SLVB 1DUEA 1O33A 1V3XA 5DK1A 1DS2E 1VCWA 2AIQA 2PKAB 2Y7ZA 1HCGA 2PGQB 3M37A 5C5NA 1AE5A 3FP8E 1TABE 1KLJH 3A81A 3F9HA 2F91A 2IPQX 1QCPA 5A0CA 1E38B 1TMBH 1W14U 1S83A 2BDBA 1G3CA 4BTUB 4MG3A 1YKTA 3SUFA 1W11U 5KEDA 1ELTA 1OWKA 3B23B 1CVWH 3D62A 1UTLM 4IS5A 3AK5A 2ZDVH 2PKAA 5FPTA 2NU3E 2QF0A 4BXSA 1MZDA 3OE7D 1NESE 1X7AC 2QCYA 1IQJA 4MLFB 1OP8A 1G36A 2BQ6B 3PLPA 4UD9H 1KTSB 3LT3A 4ZXXH 1MCTA 4RKJB 2ANMH 2BD8A 4Y7AA 3T2NA 4TY6A 3CP7A 2PV9B 4KELA 2CHAB 2AEIH 5CMXH 3ZZ4A 1JMOH 4ASHA 1OP2A 3M5MA 1S6FA 1Z8GA 3QO6A 4IBLH 5ESBA 5T6FA 4ABGA 2TBSA 2Z9IA 1Y8TA 2AMPA 1GDQA 3DSGA 3FP7E 1PPBH 1P9SA 1INCA 1P10A 1BUIA 1GHZA 1L0ZA 1FY3A 4RN6A 4YOIA 1ESBA 1MMJN 3RXBA 4Z6AH 4ZKRU 1GBLA 2XW9A 4OS2A 2JH0D 2XXLA 2FI4E 3QN7A 4Y0YE 1TRNA 5EQSA 4DW2U 3ZVBA 4U32A 2KAIA 4D76A 1P03A 1C2KA 3EDXB 2WUCA 3ITIA 2WV9A 2GX4A 1MTVA 2RDEA 1O5BB 2BLOA 1PQAA 1ZJKA 4I8KA 3IITA 1BZXE 1CA0B 3RXDA 2ZGXH 4JCNA 3UWIA 3OTJE 2FOGA 5EXLA 2A5IA 2W6JD 5F03A 2A45B 1HAOH 5AFZH 1F5LA 1GI6A 1HNEE 3Q76A 1BRUP 3PMAB 3T62A 3SNBA 4K2YA 1OPHB 1C1WH 2WINI 3OU0A 1MKWK 1QBNA 1UTJA 4MTBA 2G55A 4WY3A 2R9PA 2TGPZ 4AG1A 3I78A 1GGDB 2ZPQA 1XUKA 2JH5D 2FM2A 1GMHG 1SOTA 3DCLA 4X1RU 2BVRH 3RXKA 4ZKNU 1T32A 2STBE 2J92A 4JYTA 1NRPH 1YPJH 1ZSLA 2F83A 2VBCA 3A83A 1K1LA 3M5NA 3ZVGA 1OSSA 1JBUH 1N8OB 2ULLA 1VGCC 1NTPA 1FY4A 3SI4H 3SU1A 4JYUH 2GTBA 3M7UA 4OM9A 1MCVA 1GI9B 3KYGA 1K1PA 3MU8A 3V0XA 1GBIA 2ALVA 1ANDA 4ZKOU 3BF6H 2B8OH 2Z7FE 1BRBE 1P06A 1TGTA 2UWLA 1UHBA 5HIYA 1EJAA 2P8OC 2FXRA 7GCHF 3SGAE 2XNDD 4Q4LA 2VH0A 2YNBA 3MNXA 1PPCE 1O3AA 3SV7A 1RXPA 1E36B 2M2AA 3ATIA 1ELVA 2Y80A 1TRMA 2P3UB 3A84A 1TALA 3URCA 1Z1IA 7ESTE 2A2QH 3O8CA 1GMCF 1QIXB 1XXFA 1SGPE 2CJIA 1VITF 2XCNA 3OX7U 3SU3A 4CRCA 1V2RT 1YPGH 1GG6C 3TJVA 2QYIA 3RLWH 2BX4A 5DP5A 4O9VA 3QZQA 3STJA 3LGYA 5IDKA 2ZO3H 1TGSZ 1P2QA 3RU4T 1P2KA 2HPQH 4JZ1A 2XC0A 2W5EA 1A2CH 1ELAA 2ZPSA 3MU5A 2FOFA 1DWEH 2NWNA 1A1RA 2J98B 3K65B 5FX5A 4BNRA 2XCFA 1AUJA 1LHCH 3HK3B 2C93B 3OEHD 1UVUH 1FLEE 2PTCE 8GCHF 3S0NA 3RM0H 5C3NA 2PP6A 4KTUA 1LQDB 1SGRE 4UEHH 4X1SU 5FBIA 4UDWH 2HNTC 4X8VH 1A5IA 3TNSA 1C2JA 5L2YH 3EE7A 5SGAE 1HDTH 1BQYA 1F0TA 3AAVA 3NXPA 1GCTC 4X1NU 1C1SA 2B7DH 1AUTC 2H5DA 5EQQA 4D7GA 1O39A 2R0LA 1H9LB 4FUFA 3LPRA 1GMDF 2C8WB 1TIOA 2TPIZ 5GDSH 4MNXA 1Z1JA 1Z8IB 1Q3XA 2BVXH 1O5EH 1D4PB 2F43B 3EA7A 1O3CA 3SV9A 1NM6A 1ELEE 2Z3DA 1VKYA 3BV9B 5EJLA 1SLWB 5EQRA 3SHCH 2ANKH 3F9GA 2ZHDA 5F8XA 4AGJA 3MQKC 2A0QB 3PMHB 4I7YH 1O30A 1O3KA 1GHYH 3ZZAA 5DP9A 4IMZA 2QXJA 4B76A 1F2SE 2FOHA 4NWKA 3VFEA 1IQFA 4CR5A 4JYVH 4O3UA 2UWOA 2Q1JA 1XVOA 2ZDLA 1G3DA 1NRNH 1EUFA 2J9NA 1T4VH 1CU1A 4CH8B 2Q6GA 2AMDA 1GL1A 1EASA 5IK2D 1NRSH 2LNCA 1GI2A 4A6LA 3NWUA 3MU0A 3EAJA 3PMBB 1IQNA 2VGCC 3EQ0H 1C2LA 2V3MA 2OCVB 3BTFE 3MOCA 3AAUA 1D6RA 2A4OA 3PO1C 1SPJA 1GBTA 2LELA 3A85A 1IAUA 1G2LA 2VNTA 3FKSD 1TA2A 2HNTF 1WSSH 1O32A 5FPSA 4U30A 1O3HA 2Z9GA 3RXFA 5JBAS 4LXBH 2ZA5A 5HXFA 5HIZA 1ORFA 5DP3A 4ISNA 1AVGH 5AVDA 3B8JA 1DITH 1MTUA 1YLNA 2PWXA 1GHAF 1YM0A 4YXWD 1SGEE 2A4RA 4BAMB 5JBBS 3MU1A 2FTMA 4JZDH 1O3OA 3UOUA 1VITG 1AWHB 2R3YA 1NRRH 5A0BA 2ZC9H 1WXRA 3S9BA 4K5ZA 1V2VT 2XBYA 2A31A 2V3OH 1F7ZA 1PPGE 4NCYA 1F92A 4AG2A 2EI7A 1P2JA 2AFQB 1YPMH 1E79D 3H09A 4WMDA 3GOVB 1V2UT 3RXTA 2ASUB 5K0HA 5GXPA 2H1UA 4I8HA 1GVLA 2ZGBH 4GUXA 3BIUH 1OWHA 2BD5A 1FY5A 1UVTH 1C4Y2 4OS5A 4ABAA 4TYDA 1O2TA 1QFKH 1OKXA 1Z71A 4AFUA 1BTZA 1YCPH 4XBBA 1SQOA 5LPFA 3VB5A 5A09A 4ABFA 1AVWA 1JIMA 1Y3UA 2O8WA 1JRSA 3BG4C 1MTNB 1O2UA 3SU0A 1UK3A 1JXPA 1W0ZU 3VXFH 1D3TB 1LCYA 1S85A 1RIWB 2OC0A 3A7TA 1ESAA 1FJSA 3Q3KA 5GCHG 1UHBB 5EU8A 1S0RA 1ABIH 1O2IA 2IOTA 1SMFE 5EOKA 4J2YB 1FIWA 1WOFA 1SLXB 1EP5A 2Z94A 1ZMLA 1B0FA 1O3LA 3I77A 1IQHA 1QJ1B 4CRFA 2JDID 5DN6D 3F3BA 1W0YH 1Z6JH 1LVOA 1N6YA 1C1NA 2ZGJA 1DX5M 1J17T 1Y3VA 1NC6A 2SGPE 2WPDD 1D9IA 2HNTE 4IC6A 4NIXA 2TRMA 4O97A 4GPGA 4O03A 2B9LA 3A7ZA 4WMEA 1N1LA 2A1DB 4K69A 1VCQA 2Y5GA 1W0JD 1O5AB 1LHGH 1XX9A 2OBQA 4HI3A 1YCPK 1UW7A 2R2MB 4K8YA 4WXIA 4K3JA 2H9TH 3HATH 3RXAA 1HXFH 1J8AA 1MZAA 1S82A 3L33A 8GCHG 4CRAA 2PW8H 5LH8A 2PSXA 4X1PU 1KXCA 2WPKS 2FI5E 3H7OA 1P04A 4Y76A 2P95A 2O8TA 1NBMD 1Q31A 4JZEH 1YLCA 1SGNE 2EI8A 1A3BH 5LGOA 3N7DA 2P94A 1ZTKA 5C94A 4AFQA 1UTPA 1UK4A 2FX4A 1MKXH 1HRTH 1LPKB 2VWNA 1WDIA 3RU4D 1P9UA 3SUEA 3SBKA 3IG6B 1C5QA 2AGEX 3RMNH 3TIUA 3VEQB 3PRDA 4Y7BA 1LHFH 2BD7A 2FOAA 4NA9H 1QA7A 4FU8A 4ZUHA 1GGDC 3RMMH 2I6SA 2VGCB 3QUMP 3FVFB 3GY3A 4MDSA 1ZMJA 2ZU1A 1DOJA 3DT0H 3QGJA 1SGFG 2RG3A 2J38A 1GJCB 2PKSB 2PLXA 3ZVCA 1EAXA 2SGDE 3U8RH 2G52A 1TX7A 1EQ9A 3RXCA 1L4ZA 3SNCA 2J97A 1Y5UT 2ZU3A 4DG4A 1T8LA 1OXGA 1BBRE 4DT7B 1V2LT 1MU6B 4ISLA 1D3DB 1WU1A 4FVBA 3PTBA 3P17H 1P0SH 1V2ST 3LH3A 3SJ8A 2ZWLH 4Z0KA 4B2AA 4XD7D 3TK9A 1DM4B 2F9OA 2RFKC 1QJ7B 1BCUH 1E1RD 2ZIQH 2OC1A 2JJ2D 1OWEA 1UTQA 1WCZA 1EFRD 1P12E 7GCHG 3PYHA 4D7FA 1K0HA 1AO5A 1O5CB 3NZIA 3A8BA 1LTOA 1LKBA 1PQ8A 3MYWA 3A7VA 3EYDA 1W2KH 4I8JA 4AOQA 1S81A 3V3MA 3RXUA 3ZZ5A 2BOKA 4X0WU 2A7CA 1H4WA 2FEQH 1GJAB 2F9BH 3SZNA 4AORA 1C1PA 3C1KA 1EZQA 1C2IA 1ZRKA 3MHWU 3Q00A 5FBEA 2OQ5A 2Y6TA 1QQUA 2XNIA 3SJ9A 5L2ZH 2GCTC 3FFGA 3A80A 4JK6A 1C2FA 4B2BA 2VIWA 1SHHB 1HJAB 3UQOA 3TNTA 1AVXA 2J5UA 5EJZA 2ZECA 3HKJB 3KGPA 2QF5A 1DXPA 4Q63A 1VR1H 3RXOA 3DD2H 1BRCE 2ESTE 3ZVEA 1GBDA 1NS3A 2K8IA 1GG6B 1TPAE 1C5PA 4AYVB 4NIVA 1DLKB 1ACBE 1Q2WA 2D26C 2KX4A 4WXVA 9LPRA 2P59A 5JPMH 4YLUA 5T1VA 2SFAA 1OYQA 2OINA 2XBXA 1K22H 2ZFTA 1NN6A 2ZPRA 4MNYA 2O8UA 3W1EA 1A0HB 3LKWA 3MH4A 4D9RA 5A2MH 5JBTA 1C5YB 1O2LA 2GDDA 5C20A 4IGDA 1L1NA 2ZNKH 3ZVFA 5JB9S 2XTTB 2Z3CA 3RXSA 1YCPM 3IWMA 4XRNA 2VIPA 4AZ2B 1FPHH 3RLYH 4IN1A 4CBOA 1HAPH 1CBWC 2F3CE 3A8CA 2ZDNA 4X8UH 3F0PA 1TNLA 2BY9X 3TLOA 1O2WA 4UE7H 2EY4C 1O2KA 3TGIE 5LPEA 4X6MA 3GISB 2KCAA 5HYOA 4ZHLU 1PPHE 1HB0B 3BTHE 1Z6EA 4YO9A 4BANB 4DOQA 3BTQE 3PLKA 1O3DA 1G2MA 4WH8A 2JKHA 3N7EA 4BOHA 1HAGE 1A4WH 3JZ2B 1KLIH 3P8GA 4F49A 4ABBA 2F9UA 1WYKA 1RS0A 2ANYA 2GD4B 1MTNC 1PPFE 2NU2E 4BXWA 1SOZA 2YMSC 1DICA 1UMAH 2TGAA 2QF4A 2VWLA 3MH5A 1BMAA 1T7CA 2JETB 1PFXC 3E0NB 1YYY1 5HM2A 3L3TA 2O8MA 3QK1A 2GZ8A 2A5KA 3KIDU 2QC2A 3ODDA 1LVYA 1QB9A 2Y7XA 4X2YA 1GHAG 1OOKB 4NIYA 3G01A 1ID5H 2WPHS 4ZMAH 4PROA 1AZZA 1MTSA 4B2CA 1XUGA 1ZRBA 1FNIA 2VWMA 3GCHB 4AGKA 1NFXA 1ZTJA 1MQ6A 1QNJA 2EQNA 1O2HA 2G51A 3I29A 3LIWA 3STIA 1TPPA 1GJ9B 3QGNB 5E0GA 5EJ1A 1MBQA 1GMHF 2BY5X 3TGKE 1CT4E 1SHYA 1YPHC 3A7WA 3T26A 2OD3B 4FUJA 1TNHA 3GCNA 3RU4E 2BDGA 1C5LH 1THSH 4B6EA 3FOAA 3MMGA 1NO9H 1A46H 2ZFSA 1BMLA 1ZR0A 2GCHF 1CGHA 2HALA 3SNDA 4HZHA 2AH4X 1AFQB 4NG9H 3BEIB 2ZCKP 4FVDA 2SGQE 1O2QA 5T6GA 3U8OH 1QJ6B 4JZFH 1UO6A 3FAOA 2G00A 1P02A 3A7YA 3F9EA 1BHXB 4ABIA 1D6WA 2P3FH 2SGAA 1WBGB 1SGYE 2UWPA 1DWBH 1QA0A 1EX3A 1O2JA 3F0OA 4GCHF 3S7HB 2XOKD 1LKAA 4YOGA 1EPTB 1AN1E 4YESB 3LC3A 1HAVA 1GCDA 3PV2A 3M7TA 3ZZ3A 1K1NA 1E35B 1UVOA 3K6ZA 1Y3WA 5EGMA 2BLWA 3QTOH 4UFDH 1YBWA 5E0JA 1CBWB 1TQ0B 4TY7A 5EIYA 2RDLA 1EB1H 1NPMA 4Y8YA 4K1EA 1TNGA 5EXMA 5C5OA 1ABJH 2D1JA 4AC9A 1TYNA 5T3HA 3SYJA 4Q7YA 1C5RA 2CMYA 1ZPCA 1C9TA 2TGDA 2H9HA 2ODYB 2ODPA 1GI7B 2PTNA 4Q80A 5FCRA 2EC9H 1LQEA 2OXSA 1VZQH 1P09A 1GBHA 1UVPA 3PM3A 1C2GA 4YTAA 4R8TB 4DIIH 2IJD1 1TPOA 2ZFPH 4IMQA 4ABDA 1EPTA 2J95A 5HM9A 2F9VA 1JRTA 1SKYE 3GDUA 2VIQA 4RSPA 3UWJH 1GBFA 1SGFA 1GHBF 3UTUH 5IYTA 4GSOA 1SQRA 5AHGH 2ZGHA 3GY5A 2A32A 2FS8A 1AB9B 2RCEA 1TWXB 4XBDA 1O34A 4WH6A 1UTMA 1ZHPA 1BMNH 1HAVB 1QL7A 3ZZ8A 1W13U 1KDQB 2FOMB 3UNQA 5GIBA 3F2FA 4ISHH 3U98H 3KL6A 1T8NA 4MPVA 1ZHMA 3HGPA 5C0UA 3T5FH 1O2VA 1O3FA 2R3UA 2ZTZA 2ZTXA 4AFZA 2HOBA 1J14A 1K1JA 3BTEE 2Q6DA 3HKIB 3M36A 1KSNA 2OTVA 3GY8A 3CS7A 2P3TB 6GCHG 2D8WA 3V12A 1S5SA 3GICB 2WV4A 1A5HA 1XUFA 5EODA 1C2MA 4DURA 3NUMA 1KIGH 2UUKB 1GWAA 3PWCA 3BIVH 1EAWA 1ETRH 1Y3XA 2ZDMA 1PYTC 3AASA 1ZSJA 3TGJE 4NWLA 1CSOE 1V2JT 2V3HH 5HKKD 2ZU4A 3PV5A 2AERH 2EEKA 5DO4H 3VPKA 3LH1A 4NZLA 3OSYA 2NU0E 2TIOA 4JK5A 3QDZB 1BJVA 3DSOA 4R0IA 4CRDA 3TVJB 1K28D 1ZSKA 2SNVA 1GI1A 5K7RA 2FLBH 3D65E 4NFEA 2GZ9A 3ZV8A 2HVXA 2FYRA 3GCOA 5A8XA 1ZTLA 3EA8A 2ZP0H 1AY6H 1MH0A 2KZ4A 1BA8B 1O2GH 1PQ5A 1S84A 3KQBA 3FP6E 4O3TA 2M5TA 3ATMA 1MD8A 1CA8B 1TAWA 4FXGH 1P8VC 1DWDH 1W7XH 1EZSC 1NRQH 2PSYA 3AVZA 3TITA 4GHTA 4I8GA 1QQ4A 1BTHH 3O8BA 1DT2A 3TPIZ 1KY9A 1O2RA 2W3KA 1O2YA 2L74A 1SGIB 1H8IH 1HJAC 1UTOA 5FXLA 1G3BA 1P2NA 1K1IA 3SN8A 1V2NT 1CA0C 3F2GA 1TFXA 2HWLB 3P6ZB 4K60A 1JIRA 2A4QA 3SI3H 2ZQ2A 4HTCH 5EPNA 3P92A 1BBRK 2DE9A 3RC6A 3RXGA 4RT1A 3LDXH 1DPOA 1GJDB 2KR7A 3LGWA 5CDFE 1LHDH 2BD4A 3LGVA 4VGCB 3R3GB 2CN0H 5J4QA 2A7JA 2WPMS 1ELBA 1QB6A 1WTHD 3QZRA 3P95A 3TH3H 2FYQA 4AN7A 1BOQA 1IOEA 2QXHA 5F8TA 5GJ4B 3SV2H 4WVPE 4OS7A 1QZ8A 4H42U 2DE8A 1TE0A 5DKMA 4CRBA 1RD3B 2Y82A 4X6NA 4MQAA 2BQWB 1RFNA 2ZI2H 5T6DA 1A7SA 2BY8X 3MTYA 1ZPBA 3LGIA 1XM1A 1T8MA 4RKOB 2R0KA 3PMJA 1TQ7B 4BAQB 4Y8XA 1ZOMA 4YLQH 2DUCA 2PR3A 3OY5U 4ZKSU 2BOHB 2XRCA 1UTKA 3MO9A 3P8NA 1GBKA 1OS8A 2CF9H 2BTCE 2ZHWH 4FUHA 4Y10E 1V6DA 2O8LA 2JETC 2NU1E 3RMLH 5B6OA 1XMNB 3EGKH 3SU2A 2Z9JA 3RXEA 4CHAC 4OS6A 3CNRA 3VXEH 2XBVA 1GJ6A 1BTWA 2XWBI 3M3VA 2OQUA 3PO1B 4Y6DA 2BYAX 1DFPA 1MABB 2CV3A 4YM9A 2V0BA 1V2PT 2ZDAH 1SGDE 2ZZUH 2J2UA 9ESTA 1JOUB 2BD3A 3N99A 1O3IA 1ELGA 2STAE 3LJOA 3BN9A 1VCPA 2BY6X 1AB9C 1Y59T 1ZHRA 3BTME 1IQLA 5FCKA 1G30B 3SW2B 1QBOA 3KNXA 1TX6A 2WYGA 3ZYDA 4BAHB 3T27A 5C1YA 4CR9A 3GCTG 1AIXH 5DP4A 1MAYA 1BRAA 2GZ7A 4FETA 3M35A 5TCAA 3E3TA 2J94A 2HLCA 1MTWA 4YOJA 2KFWA 2F9PA 4H6TA 2A2XH 2W3IA 3RXHA 5ABWA 4LOYH 1F5KU 5DP6A 2BDHA 2QY0B 3L6PA 2ZFFH 2ZHEH 4J1YA 1EAUA 5E8EH 1RRKA 4WWYA 1EAIA 2FODA 1P57B 1IHSH 2WYJA 3A87A 3E0PB 4HG6A 4INLA 2W7SA 1XUHA 1XVMA 3VGCC 3RP2A 2VINA 3SHAH 1EOLA 1S0QA 2PKSC 1C5SA 1TGNA 1ELCA 3SGQE 3KQEA 4A92A 2GKVE 1NY22 1O31A 1THPB 1HPGA 1CO7E 4DGJA 1ZLRA 4K1SA 5TJXA 2IN2A 1BMMH 3VB7A 1TRYA 3H5CB 1PPZA 4Q7XA 1C1VH 3SO3A 4FUIA 1O3NA 1KXBA 3E91A 4A1TA 2ZCHP 1PJPA 3S69A 3M3SA 3ZZBA 3RXJA 1FV9A 2KAIB 2GCTB 1D3PB 2SGFE 3DFLA 2I6QA 3WY8A 1BT7A 1N6XA 1OWJA 1GMCG 1V2MT 2IPHA 3RXLA 1S6HA 1XKBC 4CRGA 4ABEA 3UPEA 1L1GA 1NFWA 2C3SA 3SQHE 5A8YA 2PGBB 4CBNA 1G32B 1O2NA 1G9IE 1GDNA 5CE1A 1PYTD 3A88A 4ZROA 1FAXA 1O2OA 3T25A 1KYNA 3S7KB 1TLDA 1BTPA 2HLDD 3SOSA 1DY9A 1LPZB 3SU4A 1ZPZA 3M5LA 1HV7A 1O3MA 1BITA 5DPAA 1GBCA 1P01A 2AYWA 5I25A 1CE5A 1W0KD 2ZFQH 1C2DA 1DWCH 1W8BH 2OP9A 4M9FA 4XOJA 5C0TA 2QXIA 1AI8H 1SGTA 1THRH 5EW1H 3BTGE 3PRBA 4JZIA 3TJUA 1HYLA 3OTPA 1LVBA 5CHBA 4GAWA 4Y0ZE 5DG6A 4BTIB 1O2SA 3A89A 1MD7A 1FI8A 1QB1A 3PTNA 1DSUA 4NGAH 1EKBB 4ACBA 3PLBA 2XC5A 4X8TH 4TPIZ 2B5TB 1GHBG 4B75A 5C1UA 3UREA 1T31A 4FU7A 1CGJE 4KTSA 2JH6D 3DFJA 4I86A 1AKSB 2BZAA 1HBTH 1TBQH 3FN8A 4P02A 1HIAB 1DDJA 3DSPA 1FN6A 3EE0B 2BDYA 2SNWA 1MU8B 3UQVA 2L6OA 3RC4A 2FOBA 1GJ8B 1WV7H 3FANA 1XXDA 2CK3D 1C9PA 4XE4A 1YPEH 2FTLE 3QLPH 1BB0B 3R0FA 2XBWA 1YPKH 2G8TA 3FZDA 2OC8A 1HAYB 3F6UH 3GDVA 3VG8A 2A5AA 2UUYA 2VB0A 1AFEH 1TGBA 1FONA 3P70B 1FUJA 2G5NA 1GHVH 1ARBA 3BTWE 3BG8A 4GVUA 5EXNA 4ASUD 5JDUB 5GWZA 3LC5A 1GBAA 1Y5AT 2H5CA 2ILNA 5CHAC 1RJXB 1C1MA 1TBZH 3GY7A 2G5VA 2BB4A 1FQ3A 1HIAA 2ZGCA 1P3EA 1OWIA 3HK6B 1FX0B 1O5GH 1FAKH 2HRVA 2WSSD 1TA6A 3EA9A 2ZHQH 3TJOA 4UFFH 1AQ7A 3MU4A 1DXWA 2C8XB 2A4GA 1SFIA 1EJMA 1N8OC 1SSXA 1VGCB 4DJZB 4B6FA 4TSFD 1C2EA 2VH6A 4I32A 4YZUA 1J15A 3B9FH 1GPZA 1UTNA 1CT2E 2QXGA 3KCGH 1HXEH 2C4FH 3BTKE 2Z3EA 3U1IB 2Y5HA 1EPTC 2P16A 1PQ7A 4NA7A 3BSQA 2GV6A 2ZEBA 2H2ZA 1NT1A 4KGAA 5DJ7A 1SC8U 1SR5C 2OUAA 2K1QA 1ANBA 3TU7H 3PB1E 2WHXA 3A86A 3V7TA 1TGCA 2SGEE 1QL9A 1YGCH 1BDAA 4ABJA 3NPSA 1ZMNA 1YLDA 4NIWA 1QRWA 1O0DH 2QIQA 2V35A 2VVCA 1HAHH 4WMFA 1C1UH 2Y5FA 4CHAB 1QTFA 1KXEA 2CHAC 1A0JA 1C5OH 3SV6A 4I8LA 1GI0A 3UNRA 2R2WU 1LPGB 3M7QA 4JMYA 3GDSA 2CXVA 4OS4A 1GJBB 3RXRA 3O8RA 3WW7A 2FLRH 3KQDA 3TK6A 4E06H 3QTVH 4ESTE 2BVSH 1O5DH 1L1JA 1TMUH 2FP7B 2VIOA 3KQ5A 1GDUA 1AMHA 1F5RA 1C5MD 1RGQA 3ZZCA 1OHHD 3TJNA 4DCDA 1UVSH 1ARCA 1AU8A 3U1JB 1P05A 3ZZ6A 1EZUC 3N7OA 4TWYA 4Q7ZA 5GPIB 1GJ4H 1SBWA 3D23A 1F0SA 1NZQH 2WPIS 3SU6A 2Z6BD 1A5GH 1ETSH 1SGQE 4GCHG 1CT0E 3MH7A 1KXAA 1SGCA 2Y81A 4KTCA 4ZHMU 1D3QB 2THFB 1P3CA 3GYLB 4NA8A 2YOLA 1O3BA 1TX8A 1TNIA 3UFAA 2YMSB 1MKWH 4I33A 3GY4A 6LPRA 3E6PH 2ODQA 5FAHA 1DUAA 1FDPA 3SZEA 1FXYA 5PTPA 4ZXYH 1HUTH 2GT7A 2C8ZB 1HLTH 2AGIX 2VIVA 1Z8RA 1CHGA 1GJ5H 1S6LA 4UFGH 4U2WA 1BTUA 2CF8H 3LGUA 3Q3YA 3TH2H 2FS9A 4KP0A 1SQTA 4B1TA 1GI8B 1ZGVA 4ZH8A 4MPWA 3SGBE 1BHXF 2HGTH 3ZZ9A 5GNDA 1L4DA 1EATA 4P00A 1DE7H 4AX9H 4M7GA 5KGOA 2A7HA 5C17A 5C67A 4FUDA 1LMWB 2W6ID 4BAOB 1SB1H 4FU9A 4OS1A 1W10U 5BPEA 3RUOA 2ZQ1A 2P93A 2KM0A 3GY6A 2WUBA 1J16A 1HJ8A 1FN8A 1M9UA 2O9QA 4NFFA 5DGJA 5C2ZA 1BMFD 4IW4E 1GJ7B 3VB3A 4FUCA 1OP0A 4VGCC 1NFUA 5EG4A 3K2UA 2BLVA 3RXVA 1QGFA 1CHOG 4AYYB 4WJG2 3DUXH 2LP6A 1O5FH 1CQQA 3FO8D 1O2XA 1C1RA 2AHME 3TK5A 4BTTB 3SJIA 2XYAA 1C1TA 2UUJB 4THNH 2QN5T 3ZYEA 1F0UA 1MAXA 1XKAC 2BXTH 4MVNA 3UR9A 3SNAA 3OFND 3RXIA 4H6SB 1FPCH 2XC4A 3UIRA 4AB8A 1H8DH 3W95A 2AGGX 4F48B 4BAKB 1WAYB 1ZGIA 3UR6A 2KCYA 1UCYK 1SLUB 4TPYA 2CGAA 1FY8E 2C8YB 1MQ5A 3E1XB 1ESTA 1LO6A 1EP6A 4OGYA 2H9EH 1H9HE 2ZDKA 5G4BA 2GDEH 3M3TA 1HAZB 5H4IB 2ZU2A 1SFQB 2HPPH 2YNAA 2GCHG 3E16B 1BTXA 1DVAH 1HGTH 1OYTH 4Y71A 2ZKSA 8KME2 3S9CA 3Q77A 3DHKH 5GCHF 1TNJA 2OBOA 2PHBA 3RDZA 4A5TS 1QL8A 3PWBA 3MNCA 1SG8B 2FMJA 1A3EH 1KMHB 1WQVH 4XFQA 4YT7H 1BJUA 4AFSA 2ZU5A 2FOEA 1C5TA 3GCTF 4MNWA 2BDAA 4TWWA 2W26A 3A8AA 3RXMA 4LZ4B 1FIZA 1F0RA 2ANWA 2FOCA 3CENA 4DIHH 1O2PA 2J4IA 1COWD 1K21H 1TBRH 2KCOA 2VU8E 1YP9A 2JIZD 3P8OA 1YC0A 1RTKA 1ZYOA 3KN2A 4DT4A 2PFEA 3VB6A 1C4V2 2OK5A 2Z9KA 3F1SB 3ENSB 1YY3A 1QY6A 3UNSA 1C5WB 5L6NH 1V2OT 3OY6U 2GT8A 2BM2A 2P8OB 2W7UA 2FO9A 1P11E 2QE7D 1ANEA 4NSVA 4FUGA 1TONA 1ZZZA 2FX6A 2GMTB 4ZAEA 1E37B 1TPSA 2VVUA 4X8SH 3M5OA 3SUGA 3F2HA 1C5UA 3U69H 3SORA 2PUXB 1P2OA 1B7XB 4UFEH 3ZZ7A 5HGGA 4K8BA 3GY2A 2RA3A 4FUBA 1P2MA 1KTTB 5DSFA 2K0QA 1Z7KA 3F68H 2YMSD 2GP9B 1V2WT 4SGBE 1Z8JB 5F8ZA 1G3EA 3OEED 4X2WA 3W94A 3UB0A 3RM2H 1TNKA 5E2OA 2G4UA 2D2DA 3E8LA 2BD2A 1DSTA 1QHRB 2WPLS 1U6QA 3WWBA 3LU9B 4RT0A 2FESH 1O38A 3VGCB 1IQMA 3T29A 3TH4H 4RI0A 4ZCNA 4MNVA 1QBVH 3ODFA 4Q2KA 1GVZA 3A7XA 1NROH 3MNBA 4B71A 1H8ED 3A8DA 1SL3A 1AZ8A 1W3CA 3C27B 3DA9B 4NSYA 1TB6H 4Y79A 1GHWH 4XDEA 1AHTH 4INKA 4ACAA 1QURH 3MH6A 1GCTB 4X2VA 5ETXA 1G37A 3T28A 2LPRA 3ATWA 3BTTE 4KKDA 1ELDE 1KXFA 3GS9A 3KYFA 3GCHC 2UUFB 1BTYA 5A0AE 3NKKA 2RA0A 2BD9A 1UCYE 1IQKA 1FY1A 3SV8A 3ZVDA 1C5XB 2AS9A 4F4OC 3SUDA 3GYMA 1O3GA 1GBBA 2F4LA 1FZZA 1KLTA 1RTFB 2ALPA 1ZJDA 5JYIA 2VIDA 4IC5A 1HAIH 3ZVAA 2VWOA 4A1VA 1GI5A 1UCYH 4D8NA 1GBEA 2GVFA 1O2ZA 1DLEA 1OWDA 4X6OA 3KEEA 5FL7D 1C4U2 3QX5H 4DY7B 1VJ9U 1H1BA 1T4UH 3RXQA 4X2XA 4OGXA 5L30H 1EJNA 4H4FA 1B0EA 3P8FA 3UUZA 6GCHF 2OC7A 1K1MA 3WWFA 1O36A 1JWTA 2ZHFH 1SI5H 2KCPA 1C1OA 3VB4A 4UONA 1BIOA 5LPRA 3LOXA 1OX1A 3Q3XA 4AB9A 2WPJS 1KDQA 1IHTH 4U01A 1C5VA 1GI3A 3HPTB 2HVYB 1WUNH 3MI4A 4TT3D 3K9XB 1SQAA 3U28C 3U9AH 4E7RG 1TMTH 3D49H 3URDA 1VITH 1W12U 1O2MA 1HJ9A 4K1TA 1UK2A 1T8OA 1Y3YA 4F55A 3MFJA 5J4SA 2XWAA 2BQ7B 2BX3A 3NK8A 4Y8ZA 1TOCB 5CHAB 5HMAA 1YPHE 1NU9A 1V2KT 1XUJA 5ESTE 2AIPA 3BEUA 2V6NA 1QRZA 2GV7A 1A61H 5AF9H 5EPYA 1DANH 3MO3A 4XSKU 2ZFRH
chains in the Genus database with same CATH topology
2FZZA 5F6MA 4X6PA 3E90B 4XBCA 4NZQA 4ABHA 1AE8H 3KHVA 4LZ1H 1O3EA 7LPRA 3BTDE 3U8TH 1WTGH 1GVKB 3ATLA 1O3JA 4GLYA 4B73A 1K9OE 1EXFA 2QGRA 1HFDA 1QRXA 2FIRH 3ESTA 1RTLA 3V13A 1GHXH 1IQIA 3UY9A 1GBMA 1MKXK 2FDAA 3A82A 4ZHAA 4Y11E 5BRRE 1HAXB 3RMOH 1K2I1 3SNEA 1W7GH 3QWCH 2Q6FA 1J9CH 4CREA 1O35A 1EB2A 1O3PB 4I31A 1A0LA 2GMTC 5JBCS 1AFQC 4D9QA 1AKSA 2QAAA 6CHAC 5EW2H 7KMEH 4FUEA 1BBRH 1EOJA 2IJOB 3LONA 1EZXC 3MNSA 6ESTA 4X1QU 1VJAU 3JZ1B 1PPEE 2PUQH 2Z9LA 3M61U 4MPXA 1QR3E 1P2IA 1GMDG 4ISIH 1NFYA 1WQSA 2H6MA 1CHOF 3RXPA 8LPRA 1C5ZB 4HFPB 5FHTA 2BY7X 2FPZA 2VJ1A 4MPUA 1V2TT 3SJKA 1ANCA 2B0FA 3HGNA 4QT8C 4LK4A 3AW0A 5TCCA 1AD8H 1XUIA 3PROA 4E05H 1MBMA 2BDCA 2F9NA 5AFYH 2G81E 5A8ZA 2AMQA 5E0HA 1Y5BT 2QF3A 1ELFA 3RC5A 3NCLA 1NU7B 3S9AA 1C1QA 4A7IB 4WF8A 3UOPA 3ZV9A 2J34A 3KQCA 4ISOA 5DP7A 1LVMA 2BMGB 1RIWC 2G4TA 4E7NA 6CHAB 2VVVA 2EA3A 1DY8A 4DVAU 3BG4B 5FPYA 1MUEB 1C2HA 3BEFB 3SJOA 2ZF0H 1H9IE 5JB8S 1O37A 2FI3E 2QV1A 3ATKA 2QA9E 1B5GH 2ZG0H 3LGTA 2BDIA 3AW1A 2TGTA 2BHGA 3ELAH 1LHEH 5I46H 1GI4A 2C90B 5C1XA 1AWFH 3SU5A 3CS0A 1IQGA 8ESTE 1E34B 3K6YA 2WV5A 3H7TA 4IN2A 1C5NH 1GL0E 1AGJA 3SQEE 3F9FA 4YT6H 1L2EA 3FZZA 1TOMH 4INHA 3MO6A 1KXDA 5E2PA 2GGVB 4B74A 2BLQA 4HGCA 1LDTT 1FMGA 4A1XA 3PV4A 2ZTYA 3KF2A 1K1OA 2OLGA 1CGIE 4SGAE 2ZCLP 4CH2B 1E0FD 1YF4A 3OYPA 1SVPA 3LJJA 5FX6A 1IQEA 2BZ6H 2EI6A 2FWWA 4GHQA 2BXUH 5DP8A 1V2QT 1GBJA 3ZZDA 1UJ1A 2NU4E 3O8DA 1YPLH 3MWIU 1ETTH 1SLVB 1DUEA 1O33A 1V3XA 5DK1A 1DS2E 1VCWA 2AIQA 2PKAB 2Y7ZA 1HCGA 2PGQB 3M37A 5C5NA 1AE5A 3FP8E 1TABE 1KLJH 3A81A 3F9HA 2F91A 1QCPA 5A0CA 1E38B 1TMBH 1W14U 1S83A 2BDBA 1G3CA 4BTUB 4MG3A 1YKTA 3SUFA 1W11U 1ELTA 1OWKA 3B23B 1CVWH 3D62A 1UTLM 4IS5A 2ZDVH 2PKAA 5FPTA 2NU3E 2QF0A 4BXSA 1MZDA 1NESE 1X7AC 2QCYA 1IQJA 4MLFB 1OP8A 1G36A 2BQ6B 3PLPA 4UD9H 1KTSB 3LT3A 4ZXXH 1MCTA 4RKJB 2ANMH 2BD8A 4Y7AA 3T2NA 4TY6A 3CP7A 2PV9B 4KELA 2CHAB 2AEIH 5CMXH 3ZZ4A 1JMOH 4ASHA 1OP2A 3M5MA 1S6FA 1Z8GA 3QO6A 4IBLH 5ESBA 5T6FA 4ABGA 2TBSA 2Z9IA 1Y8TA 2AMPA 1GDQA 3FP7E 1PPBH 1P9SA 1INCA 1P10A 1BUIA 1GHZA 1L0ZA 1FY3A 4RN6A 4YOIA 1ESBA 1MMJN 3RXBA 4Z6AH 4ZKRU 1GBLA 2XW9A 4OS2A 2JH0D 2XXLA 2FI4E 3QN7A 4Y0YE 1TRNA 5EQSA 4DW2U 3ZVBA 4U32A 2KAIA 4D76A 1P03A 1C2KA 3EDXB 2WUCA 3ITIA 2GX4A 1MTVA 1O5BB 2BLOA 1PQAA 1ZJKA 4I8KA 3IITA 1BZXE 1CA0B 3RXDA 2ZGXH 4JCNA 3UWIA 3OTJE 2FOGA 5EXLA 2A5IA 5F03A 2A45B 1HAOH 5AFZH 1F5LA 1GI6A 1HNEE 3Q76A 1BRUP 3PMAB 3T62A 3SNBA 4K2YA 1OPHB 1C1WH 2WINI 3OU0A 1MKWK 1QBNA 1UTJA 4MTBA 2G55A 4WY3A 2R9PA 2TGPZ 4AG1A 3I78A 1GGDB 2ZPQA 1XUKA 2JH5D 2FM2A 1GMHG 1SOTA 4X1RU 2BVRH 3RXKA 4ZKNU 1T32A 2STBE 2J92A 4JYTA 1NRPH 1YPJH 1ZSLA 2F83A 3A83A 1K1LA 3M5NA 3ZVGA 1OSSA 1JBUH 1N8OB 2ULLA 1VGCC 1NTPA 1FY4A 3SI4H 3SU1A 4JYUH 2GTBA 3M7UA 1MCVA 1GI9B 1K1PA 3MU8A 3V0XA 1GBIA 2ALVA 1ANDA 4ZKOU 3BF6H 2B8OH 2Z7FE 1BRBE 1P06A 1TGTA 2UWLA 1UHBA 1EJAA 2P8OC 2FXRA 7GCHF 3SGAE 2VH0A 2YNBA 3MNXA 1PPCE 1O3AA 3SV7A 1RXPA 1E36B 3ATIA 1ELVA 2Y80A 1TRMA 2P3UB 3A84A 1TALA 3URCA 1Z1IA 7ESTE 2A2QH 3O8CA 1GMCF 1QIXB 1XXFA 1SGPE 2CJIA 1VITF 2XCNA 3OX7U 3SU3A 4CRCA 1V2RT 1YPGH 1GG6C 3TJVA 2QYIA 3RLWH 2BX4A 5DP5A 4O9VA 3QZQA 3STJA 3LGYA 5IDKA 2ZO3H 1TGSZ 1P2QA 3RU4T 1P2KA 2HPQH 4JZ1A 2XC0A 2W5EA 1A2CH 1ELAA 2ZPSA 3MU5A 2FOFA 1DWEH 2NWNA 1A1RA 3K65B 5FX5A 4BNRA 2XCFA 1AUJA 1LHCH 3HK3B 2C93B 1UVUH 1FLEE 2PTCE 8GCHF 3S0NA 3RM0H 5C3NA 4KTUA 1LQDB 1SGRE 4UEHH 4X1SU 5FBIA 4UDWH 2HNTC 4X8VH 1A5IA 3TNSA 1C2JA 5L2YH 5SGAE 1HDTH 1BQYA 1F0TA 3AAVA 3NXPA 1GCTC 4X1NU 1C1SA 2B7DH 1AUTC 2H5DA 5EQQA 4D7GA 1O39A 2R0LA 1H9LB 4FUFA 3LPRA 1GMDF 2C8WB 1TIOA 2TPIZ 5GDSH 4MNXA 1Z1JA 1Z8IB 1Q3XA 2BVXH 1O5EH 1D4PB 3EA7A 1O3CA 3SV9A 1NM6A 1ELEE 2Z3DA 3BV9B 1SLWB 5EQRA 3SHCH 2ANKH 3F9GA 2ZHDA 5F8XA 4AGJA 2A0QB 3PMHB 4I7YH 1O30A 1O3KA 1GHYH 3ZZAA 5DP9A 4IMZA 2QXJA 4B76A 1F2SE 2FOHA 4NWKA 3VFEA 1IQFA 4CR5A 4JYVH 4O3UA 2UWOA 2Q1JA 1XVOA 2ZDLA 1G3DA 1NRNH 1EUFA 2J9NA 1T4VH 1CU1A 4CH8B 2Q6GA 2AMDA 1GL1A 1EASA 1NRSH 2LNCA 1GI2A 4A6LA 3NWUA 3MU0A 3EAJA 3PMBB 1IQNA 2VGCC 3EQ0H 1C2LA 2OCVB 3BTFE 3MOCA 3AAUA 1D6RA 2A4OA 3PO1C 1SPJA 1GBTA 3A85A 1IAUA 1G2LA 2VNTA 1TA2A 2HNTF 1WSSH 1O32A 5FPSA 4U30A 1O3HA 2Z9GA 3RXFA 5JBAS 4LXBH 2ZA5A 5HXFA 1ORFA 5DP3A 4ISNA 1AVGH 5AVDA 3B8JA 1DITH 1MTUA 2PWXA 1GHAF 1YM0A 1SGEE 2A4RA 4BAMB 5JBBS 3MU1A 2FTMA 4JZDH 1O3OA 3UOUA 1VITG 1AWHB 2R3YA 1NRRH 5A0BA 2ZC9H 3S9BA 4K5ZA 1V2VT 2XBYA 2A31A 2V3OH 1F7ZA 1PPGE 4NCYA 1F92A 4AG2A 2EI7A 1P2JA 2AFQB 1YPMH 4WMDA 3GOVB 1V2UT 3RXTA 2ASUB 5K0HA 5GXPA 2H1UA 4I8HA 1GVLA 2ZGBH 4GUXA 3BIUH 1OWHA 2BD5A 1FY5A 1UVTH 1C4Y2 4OS5A 4ABAA 4TYDA 1O2TA 1QFKH 1OKXA 1Z71A 4AFUA 1BTZA 1YCPH 4XBBA 1SQOA 5LPFA 3VB5A 5A09A 4ABFA 1AVWA 1JIMA 1Y3UA 2O8WA 1JRSA 3BG4C 1MTNB 1O2UA 3SU0A 1UK3A 1JXPA 1W0ZU 3VXFH 1D3TB 1LCYA 1S85A 1RIWB 2OC0A 3A7TA 1ESAA 1FJSA 3Q3KA 5GCHG 1UHBB 5EU8A 1S0RA 1ABIH 1O2IA 2IOTA 1SMFE 5EOKA 4J2YB 1FIWA 1WOFA 1SLXB 1EP5A 2Z94A 1ZMLA 1B0FA 1O3LA 3I77A 1IQHA 1QJ1B 4CRFA 1W0YH 1Z6JH 1LVOA 1N6YA 1C1NA 2ZGJA 1DX5M 1J17T 1Y3VA 1NC6A 2SGPE 1D9IA 2HNTE 4IC6A 4NIXA 2TRMA 4O97A 4GPGA 4O03A 2B9LA 3A7ZA 4WMEA 1N1LA 2A1DB 4K69A 1VCQA 2Y5GA 1O5AB 1LHGH 1XX9A 2OBQA 4HI3A 1YCPK 2R2MB 4K8YA 4WXIA 4K3JA 2H9TH 3HATH 3RXAA 1HXFH 1J8AA 1MZAA 1S82A 3L33A 8GCHG 4CRAA 2PW8H 5LH8A 2PSXA 4X1PU 1KXCA 2WPKS 2FI5E 3H7OA 1P04A 4Y76A 2P95A 2O8TA 1Q31A 4JZEH 1YLCA 1SGNE 2EI8A 1A3BH 5LGOA 2P94A 1ZTKA 4AFQA 1UTPA 1UK4A 2FX4A 1MKXH 1HRTH 1LPKB 2VWNA 3RU4D 1P9UA 3SUEA 3SBKA 3IG6B 1C5QA 2AGEX 3RMNH 3TIUA 3VEQB 4Y7BA 1LHFH 2BD7A 2FOAA 4NA9H 1QA7A 4FU8A 4ZUHA 1GGDC 3RMMH 2I6SA 2VGCB 3QUMP 3FVFB 3GY3A 4MDSA 1ZMJA 2ZU1A 1DOJA 3DT0H 3QGJA 1SGFG 2RG3A 2J38A 1GJCB 2PKSB 2PLXA 3ZVCA 1EAXA 2SGDE 3U8RH 2G52A 1TX7A 1EQ9A 3RXCA 1L4ZA 3SNCA 1Y5UT 2ZU3A 4DG4A 1T8LA 1OXGA 1BBRE 4DT7B 1V2LT 1MU6B 4ISLA 1D3DB 1WU1A 4FVBA 3PTBA 3P17H 1P0SH 1V2ST 3LH3A 3SJ8A 2ZWLH 4Z0KA 4B2AA 3TK9A 1DM4B 2F9OA 1QJ7B 1BCUH 2ZIQH 2OC1A 1OWEA 1UTQA 1WCZA 1P12E 7GCHG 3PYHA 4D7FA 1AO5A 1O5CB 3NZIA 3A8BA 1LTOA 1LKBA 1PQ8A 3MYWA 3A7VA 3EYDA 1W2KH 4I8JA 4AOQA 1S81A 3V3MA 3RXUA 3ZZ5A 2BOKA 4X0WU 2A7CA 1H4WA 2FEQH 1GJAB 2F9BH 3SZNA 4AORA 1C1PA 3C1KA 1EZQA 1C2IA 1ZRKA 3MHWU 3Q00A 5FBEA 2OQ5A 2Y6TA 1QQUA 2XNIA 3SJ9A 5L2ZH 2GCTC 3FFGA 3A80A 4JK6A 1C2FA 4B2BA 2VIWA 1SHHB 1HJAB 3UQOA 3TNTA 1AVXA 2ZECA 3HKJB 3KGPA 1DXPA 1VR1H 3RXOA 3DD2H 1BRCE 2ESTE 3ZVEA 1GBDA 1NS3A 1GG6B 1TPAE 1C5PA 4AYVB 4NIVA 1DLKB 1ACBE 1Q2WA 2D26C 4WXVA 5JPMH 9LPRA 2P59A 4YLUA 2SFAA 1OYQA 2OINA 2XBXA 1K22H 2ZFTA 1NN6A 2ZPRA 4MNYA 2O8UA 1A0HB 3LKWA 3MH4A 4D9RA 5A2MH 5JBTA 1C5YB 1O2LA 2GDDA 5C20A 4IGDA 1L1NA 2ZNKH 3ZVFA 5JB9S 2XTTB 2Z3CA 3RXSA 1YCPM 3IWMA 2VIPA 4AZ2B 1FPHH 3RLYH 4IN1A 4CBOA 1HAPH 1CBWC 2F3CE 3A8CA 2ZDNA 4X8UH 1TNLA 2BY9X 3TLOA 1O2WA 4UE7H 1O2KA 3TGIE 5LPEA 4X6MA 3GISB 5HYOA 4ZHLU 1PPHE 1HB0B 3BTHE 1Z6EA 4YO9A 4BANB 4DOQA 3BTQE 3PLKA 1O3DA 1G2MA 4WH8A 2JKHA 4BOHA 1HAGE 1A4WH 3JZ2B 1KLIH 3P8GA 4F49A 4ABBA 2F9UA 1WYKA 1RS0A 2ANYA 2GD4B 1MTNC 1PPFE 2NU2E 4BXWA 1SOZA 1DICA 1UMAH 2TGAA 2VWLA 3MH5A 1BMAA 1T7CA 2JETB 1PFXC 3E0NB 1YYY1 5HM2A 3L3TA 2O8MA 3QK1A 2GZ8A 2A5KA 3KIDU 2QC2A 3ODDA 1LVYA 1QB9A 2Y7XA 4X2YA 1GHAG 1OOKB 4NIYA 3G01A 1ID5H 2WPHS 4ZMAH 4PROA 1AZZA 1MTSA 4B2CA 1XUGA 1ZRBA 1FNIA 2VWMA 3GCHB 4AGKA 1NFXA 1ZTJA 1MQ6A 1QNJA 1O2HA 2G51A 3I29A 3LIWA 3STIA 1TPPA 1GJ9B 3QGNB 5E0GA 1MBQA 1GMHF 2BY5X 3TGKE 1CT4E 1SHYA 1YPHC 3A7WA 3T26A 2OD3B 4FUJA 1TNHA 3GCNA 3RU4E 2BDGA 1C5LH 1THSH 3MMGA 1NO9H 1A46H 2ZFSA 1BMLA 1ZR0A 2GCHF 1CGHA 2HALA 3SNDA 4HZHA 2AH4X 1AFQB 4NG9H 3BEIB 2ZCKP 4FVDA 2SGQE 1O2QA 5T6GA 3U8OH 1QJ6B 4JZFH 1UO6A 3FAOA 2G00A 1P02A 3A7YA 3F9EA 1BHXB 4ABIA 1D6WA 2P3FH 2SGAA 1WBGB 1SGYE 2UWPA 1DWBH 1QA0A 1EX3A 1O2JA 4GCHF 3S7HB 1LKAA 4YOGA 1EPTB 1AN1E 4YESB 3LC3A 1HAVA 1GCDA 3M7TA 3ZZ3A 1K1NA 1E35B 1UVOA 3K6ZA 1Y3WA 5EGMA 2BLWA 3QTOH 4UFDH 1YBWA 5E0JA 1CBWB 1TQ0B 4TY7A 2RDLA 1EB1H 1NPMA 4Y8YA 4K1EA