1BITA

The crystal structure of anionic salmon trypsin in a second crystal form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
222
structure length
222
Chain Sequence
IVGGYECKAYSQAHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of anionic salmon trypsin in a second crystal form.
pubmed doi rcsb
source organism Salmo salar
molecule tags Serine proteinase
molecule keywords TRYPSIN
total genus 55
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bitA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bitA02
1MMJN 1L4DA 2FX4A 4NZQA 5JB9S 1YPLH 1O2MA 1PQAA 2GDEH 1GCDA 2G81E 5FHTA 1KIGH 4UFDH 3HKIB 5C1XA 1C5PA 2PUQH 1UK4A 1FN8A 1A1RA 1J16A 2J95A 3T62A 1V2UT 1Z6JH 3ZV8A 4A92A 2F83A 1TRYA 1F2SE 1BCUH 4Z0KA 3QN7A 2WYGA 1NT1A 4NSVA 3S9AA 3KGPA 1P2MA 1SGFG 2CXVA 4BAHB 2ZTXA 1O2XA 1O2QA 1Z8GA 3A7ZA 3SNBA 3EA9A 4H6TA 1QQUA 5H4IB 2FX6A 1ZR0A 2BXTH 4UE7H 3PTNA 2WPKS 2ZGJA 1NU9A 1BTPA 1WCZA 1MCVA 4I33A 1NRSH 1O5GH 1DT2A 1GCTB 1HV7A 2BYAX 6CHAC 4ZUHA 1C2LA 1OP2A 1O2NA 2O8MA 2WINI 5SGAE 3MNSA 5TCCA 1P05A 3ATWA 1C2JA 1GPZA 1UTJA 2HNTF 2P3UB 1E34B 3ZVAA 1XXDA 2Z3CA 4CR9A 1UTKA 1O37A 3G01A 1UVOA 1SGQE 2B9LA 1ARCA 4DG4A 1GJ4H 2Y82A 1SSXA 4GCHG 3JZ1B 3U8OH 3LH3A 1MAXA 1GJ5H 1CHOF 1JWTA 4TWWA 2PUXB 4ESTE 2SGQE 3O8RA 3E1XB 1GHYH 4KTUA 1W7GH 1QA7A 3BTFE 1O3OA 1RTKA 1TNLA 1SGYE 1DICA 5FAHA 3HATH 1DM4B 1S0RA 2WV4A 3A82A 5EQRA 1THPB 4XBDA 3OYPA 4GVUA 4ZROA 3SGQE 1SGFA 2C93B 3GY5A 1TA6A 1OOKB 1IQIA 3TK9A 2XCNA 2FOGA 1V2VT 4ABEA 1LHCH 1HAVA 3SHAH 1U6QA 1OWDA 1YYY1 4AFUA 4DIHH 1DLEA 2FDAA 2J34A 1O2HA 3PO1C 3D65E 3PB1E 4DT7B 4JK5A 3PMAB 3RU4T 1P03A 3ZYDA 5ABWA 3JZ2B 1BDAA 5A8ZA 3BN9A 1WAYB 3TJNA 3GOVB 1GMCG 3Q00A 1S83A 2VB0A 1ABJH 1JBUH 2FS9A 2BM2A 4ISOA 4KELA 2Y7XA 2BD4A 5GXPA 3BTDE 3QLPH 4D7GA 1B7XB 5HGGA 1THRH 4AFQA 3UR9A 3PO1B 1RD3B 1UVUH 2P8OB 1UK3A 1RIWC 1EJAA 2O8TA 2Y81A 5TJXA 1SG8B 2H5CA 2G4TA 2XWAA 1PQ8A 3A8AA 1GBBA 3SU1A 4Y76A 4IMQA 1D3TB 3ITIA 2RA0A 3GY3A 3A84A 1RS0A 3GISB 2AYWA 3VB7A 1P2OA 1N8OC 2F3CE 1MD7A 2GVFA 4RSPA 2FYQA 5HYOA 3HK6B 2Z9KA 3P8GA 3RXUA 4K8BA 4U32A 5A0BA 1FY8E 2GKVE 3ODFA 2VGCC 1HAYB 2D2DA 1G3DA 2HRVA 3LGUA 1G2LA 4X2WA 1F0RA 3MU5A 2R2MB 2C8WB 1KXAA 1XUIA 3QWCH 4MPWA 1UTMA 2FI5E 3LC3A 1GGDC 1GDNA 3K6ZA 2C3SA 1ANCA 1F0UA 1O3BA 1PPBH 2PKSB 4MNYA 4I8JA 1SLUB 1BMAA 1JMOH 1BTYA 2H9EH 2ZFPH 1P06A 1V2KT 1VGCB 3M3VA 3SBKA 1W14U 2XTTB 3MI4A 1V2JT 4OS4A 3E0NB 2ZFRH 4ZKRU 1HJAB 1A3BH 1ZTJA 4FUFA 5ETXA 4ZH8A 2LPRA 2A2XH 2O9QA 2ANWA 5FXLA 5A8YA 1VJAU 1P3CA 2ZHWH 1ZTLA 1YLCA 2Y7ZA 1AN1E 3A7XA 1LVOA 1QA0A 1TB6H 4YO9A 4YTAA 3E91A 5FPYA 5A2MH 1JOUB 3A8BA 2FWWA 5BRRE 2A1DB 2PTCE 3RXMA 1C2IA 2GT8A 3QGJA 4VGCC 2GV7A 3ZZ6A 1XM1A 4HI3A 3LU9B 1ELBA 3SUEA 1J8AA 1O30A 2NU1E 1SQAA 1YBWA 2W3IA 1MBMA 3A81A 5IYTA 3HK3B 2VIQA 3TH3H 3VFEA 2GCHG 1BBRH 3SV7A 3P70B 3A7WA 3PMHB 3IG6B 5LPRA 2RG3A 4HTCH 2ZNKH 4NFEA 3HGNA 4Y11E 1P57B 1FAXA 2ZGCA 1W7XH 3KNXA 1L1JA 2ZHFH 1DY8A 1N6XA 3SO3A 4K60A 4FU7A 1C9TA 3GY6A 1ZPBA 2F91A 5BPEA 8KME2 2ZFTA 3GYMA 2EI6A 4K8YA 3T25A 2FOHA 3P17H 3H7OA 2BDGA 3LC5A 4Q2KA 1TOCB 4U30A 5FPSA 2CF9H 3BTEE 2JH5D 5FPTA 1QR3E 1F92A 3QZQA 4YT7H 7GCHG 2VIPA 1O2JA 4FU9A 2XNIA 1T8OA 5DO4H 2FMJA 1BTWA 1BA8B 1GI6A 1XUGA 4OS5A 1FI8A 4GPGA 1OYQA 3ATMA 4ABGA 1S84A 1CVWH 1H4WA 4X8SH 1A0JA 4X6OA 2BOKA 1SC8U 1H8DH 3S69A 1SQOA 2TGPZ 5JBAS 2P93A 1FMGA 2R9PA 2BLOA 2GTBA 3EA8A 3K6YA 1GI7B 2QA9E 3DFLA 2BDHA 3MU1A 2EI7A 1EZUC 1WV7H 2Q1JA 2GZ8A 2GD4B 4ABFA 4B2CA 1XUHA 3T5FH 2ZDMA 3SV6A 4O03A 3MNXA 4AB8A 1JRSA 3MYWA 4Y8XA 4R8TB 3ZZ3A 1GVKB 3S0NA 5DKMA 4FVBA 1HJ9A 4X1RU 2QY0B 4CRFA 1C1SA 2ZDLA 5DPAA 2GCHF 3MNBA 4UONA 1C5OH 3DA9B 4X1QU 1MTSA 1ANBA 1AQ7A 2TGTA 3M5LA 3OY6U 3NWUA 1ETTH 3RC5A 3FZDA 1P0SH 1ZHMA 3S7KB 2QAAA 3QTOH 1ANEA 3UPEA 5CMXH 5LH8A 2EI8A 2QF3A 4OS6A 1DSTA 2OUAA 3I77A 1D4PB 2UUJB 5EPNA 5EXLA 2PKSC 1V2TT 1SLWB 4HGCA 1GI4A 4DVAU 3V3MA 1CHOG 3ZVEA 4OGYA 2ZU1A 3SU5A 1BBRK 5A8XA 3H7TA 1ZZZA 1E35B 2BD5A 2ZFFH 1Y8TA 4IC5A 2PKAB 1AFQB 1BJVA 2QV1A 5T3HA 2KAIA 1HBTH 2A7HA 4NIYA 1ZTKA 4BAKB 1VR1H 3GY7A 2ANMH 1AUTC 2CHAB 1O2PA 2ZTYA 1OKXA 1NU7B 1S85A 5FCRA 3FAOA 4TPYA 4ZKSU 3RLYH 3R3GB 1GVLA 1BTHH 1JXPA 4D7FA 5L6NH 3A7YA 1ZRBA 2A32A 2ZGBH 1SGCA 2AGEX 3M36A 3UQVA 1YCPK 2F9PA 2AS9A 1AVGH 1LKBA 1GJDB 3B23B 5A0AE 5DP6A 4YESB 1H9HE 1O32A 1HAOH 4JYUH 3GICB 1V2QT 1WQVH 4A1VA 1TQ0B 2R3YA 3BG8A 2C90B 1F5KU 1GI9B 1MD8A 3PWCA 2HGTH 3P8FA 3UREA 1KY9A 1QL9A 5F6MA 1XUJA 1BRUP 1L1NA 1TBZH 2ZHQH 1YPGH 4E06H 1P2QA 2HNTC 1AY6H 4U2WA 5CHAC 5A0CA 1LTOA 1F0SA 4B1TA 2FI3E 2GZ7A 4O3UA 3RXTA 4CHAB 4CRBA 2M5TA 1LQEA 1RJXB 1NN6A 1GBTA 2GMTB 3BTHE 1UK2A 1P2IA 1GHBF 1EP5A 1MZAA 2F9BH 1HAVB 1Q3XA 5FBIA 5TCAA 1SGNE 1GI0A 3RXJA 4THNH 2JH0D 2W5EA 3AASA 1SFQB 4AG1A 2FPZA 4Y0YE 4M7GA 3TJVA 1XKBC 3SUDA 1SQTA 2H6MA 1B5GH 1O3AA 3MH7A 3UY9A 2ZU4A 1TLDA 5T6FA 3SW2B 2ZKSA 4UDWH 4ZKNU 4A1TA 4ZHAA 1Z8IB 1ESBA 1L0ZA 1NRRH 1QCPA 1G32B 3AW0A 1TPAE 1BMMH 4JZDH 1UMAH 2FS8A 4UEHH 3SQEE 1C5XB 4IN2A 3SNEA 1PYTC 1V2WT 1O3MA 1KDQB 4IN1A 1OXGA 1O2RA 4GLYA 4X8UH 1MCTA 2C8ZB 2HPPH 3MOCA 2BY9X 4B75A 1HXEH 4I8LA 4DCDA 4MTBA 1DWBH 1DSUA 5LPFA 1PJPA 3PWBA 1V2ST 3RLWH 3NK8A 1EATA 1GHAG 3LOXA 1KYNA 1XKAC 2NU4E 1BRCE 1RRKA 2PGQB 3RXIA 3ZZ7A 5EPYA 2BDBA 4BTUB 4CRDA 1O3IA 1TE0A 3V0XA 1IQNA 1QJ7B 1O36A 1B0FA 1IHTH 3KIDU 1TNHA 2QXIA 1QB1A 3FVFB 1GI2A 1ZGVA 3W94A 1MTVA 3RXOA 2BDIA 1FDPA 1SR5C 3RDZA 1O3KA 1GJBB 1C1PA 1GMHG 1WYKA 1SMFE 1J14A 2CMYA 4ISNA 3RXGA 3KF2A 1S0QA 2ZQ1A 2UUKB 2PWXA 1TPOA 3TLOA 5K0HA 4QT8C 3HGPA 2OBOA 2ODYB 4X2XA 5F8TA 7ESTE 4XE4A 2I6SA 4NIWA 3P95A 1C5RA 1INCA 2KAIB 2G4UA 1P10A 1NTPA 5ESTE 1S81A 1C2MA 1Y5BT 1ELAA 1DITH 1GI1A 5DJ7A 3MO3A 1TBRH 1YPJH 2XWBI 1SGDE 1W8BH 1GHXH 1QB9A 1E0FD 1GVZA 4BAQB 4E7RG 4DIIH 1O2GH 1QHRB 2Y5FA 7GCHF 3S9CA 3A88A 1LDTT 4FUDA 1GBCA 2OC0A 5ESBA 1VITF 2IPHA 2ULLA 4FUJA 1CA0B 1EP6A 1C5LH 1IOEA 1BBRE 1FONA 3V7TA 1BQYA 1JRTA 4ZAEA 1TMBH 1AMHA 4NGAH 1EASA 3QZRA 3E6PH 1IHSH 2CJIA 1QTFA 4GAWA 3LH1A 3L3TA 4MG3A 4I32A 2ZQ2A 1MUEB 2GV6A 1QBOA 2PTNA 2O8LA 1C2GA 3RC4A 5E2OA 2TBSA 3A7VA 2Z94A 1YPHE 1UHBA 3GCTG 4CH8B 1WSSH 4J1YA 1QJ1B 1AB9B 1GJ9B 1CT2E 3T27A 3EDXB 1P02A 2V0BA 2A5AA 2CHAC 1G36A 4I8HA 1AFQC 2I6QA 2ILNA 4RKJB 3KQCA 3PMJA 1LPZB 1L4ZA 1UTNA 1JIMA 3STJA 1G3CA 1NFWA 3GY4A 2DUCA 1AFEH 2ODQA 2FZZA 2WV5A 1AZZA 1YPKH 2VVUA 2ZCLP 1P8VC 2YNAA 2NWNA 3I29A 2D26C 1BHXB 1GJ7B 1UVSH 3MFJA 1O2IA 1GGDB 3U9AH 3AVZA 2QCYA 6GCHF 1EPTB 3GY8A 2WPJS 4A6LA 5DP3A 2G51A 3ZYEA 3EGKH 2ZP0H 1HRTH 2BX4A 1ZGIA 3E3TA 1LO6A 1YCPM 4R0IA 5FCKA 1DY9A 1O3NA 4XFQA 1OWIA 2AERH 3LGTA 1TA2A 3T28A 3MTYA 3TJUA 2FIRH 1MZDA 1TYNA 1TOMH 5AFZH 2SNWA 3B8JA 1TRNA 1PPFE 5C1YA 1DOJA 1EAIA 2NU0E 4A5TS 1YCPH 1HCGA 1ANDA 3LKWA 1XUFA 5AF9H 1VITH 1QNJA 3LGIA 3VGCC 1MTUA 1C2EA 3TJOA 3ELAH 4IS5A 3UNQA 2R0LA 3E8LA 2Q6GA 3HKJB 1FV9A 1C1TA 4WMEA 4ABJA 2RA3A 1C1RA 2BD9A 2GMTC 2GGVB 9LPRA 2ALVA 1O3HA 1YC0A 4B74A 3F9FA 1GBFA 3EAJA 2FOBA 4TPIZ 4F49A 4H6SB 4AFSA 1XX9A 1DFPA 4BTTB 1W2KH 5C5NA 3PLKA 2HPQH 1BIOA 3RXHA 1N8OB 5IDKA 4MLFB 3BIVH 1UO6A 2BDAA 1O5AB 2PW8H 2VWOA 3H5CB 1CSOE 3E90B 1CA8B 3M7UA 3KN2A 4KP0A 4KTCA 3SJKA 1UTPA 3VPKA 1CGIE 2NU3E 1C5UA 1T8LA 3P8OA 1ARBA 3EE0B 4AFZA 4AGJA 2AIQA 7KMEH 4K2YA 1J15A 1ZMLA 1GI3A 3ZVGA 1NC6A 1ID5H 2WPHS 1P2NA 1O3DA 2Q6DA 5B6OA 1G37A 1TNJA 3L6PA 5C1UA 4X6MA 1SVPA 5J4QA 4JMYA 4JZ1A 3TNSA 1O2TA 2GX4A 5C67A 2J38A 2V3HH 1C2FA 1TGNA 2OQ5A 1A7SA 4UD9H 1P12E 2HWLB 2FLRH 8LPRA 3UWJH 3OSYA 1AE5A 1IQGA 1GMHF 3UIRA 1C2KA 3F68H 3MU0A 3E0PB 1QL7A 1UTOA 4MNXA 2VWMA 4WH8A 1D3QB 1ZOMA 1UHBB 1NO9H 2H2ZA 2A5KA 2Z9IA 4B2BA 2AGIX 4WJG2 1GBLA 1HLTH 4CRGA 1ESTA 1C9PA 1THSH 2OC1A 2OC8A 3TU7H 1L2EA 3U69H 1W11U 1C1UH 1GDUA 1TAWA 4LZ4B 4K69A 1GHZA 4PROA 1HB0B 2VNTA 2CV3A 1IQEA 3TPIZ 3QGNB 5E2PA 2AMPA 1K9OE 2PKAA 4LZ1H 3RM2H 2ZCHP 1O3EA 4WVPE 2FOCA 3M61U 2XBVA 4NA8A 1K21H 1LPGB 2W7SA 1LQDB 3LPRA 3DFJA 1AKSB 2A4GA 3LGVA 3SU0A 1GHBG 4GSOA 1RIWB 1A5GH 3SORA 3UFAA 4ZXXH 2GCTB 4KKDA 1LPKB 1C1OA 3LIWA 4I8GA 4Y71A 5C5OA 2HOBA 2H9HA 3FANA 4Y7AA 2ALPA 5GCHG 1TIOA 2SGDE 1Y3YA 1DDJA 4Y8YA 1T32A 3A8CA 1O5DH 2ZIQH 4TY7A 3KEEA 3GCHC 2LNCA 1DWCH 5EG4A 3UOPA 4X1NU 1GBHA 2XBXA 3LONA 1IQKA 1XVOA 1NZQH 2ZDKA 2F9OA 4JYTA 4O9VA 3MU4A 5I46H 5T6GA 1KXDA 2OD3B 1FAKH 4KGAA 1K1OA 2DE9A 3KHVA 1NS3A 1YPHC 2OBQA 1QGFA 1GJCB 1FPHH 1EX3A 4BXWA 5JYIA 1ELEE 2ESTE 3NUMA 3ZVFA 2BQWB 1H8IH 1MQ6A 1SGTA 1Y3XA 1RFNA 5E0JA 4RN6A 4K1SA 4AN7A 4MPUA 2XC5A 4TYDA 1P01A 4DY7B 3CS7A 4AYYB 3STIA 3CENA 1G3EA 2BD2A 3U8RH 1SLVB 5I25A 2THFB 1F7ZA 2V35A 3BG4B 3P6ZB 9ESTA 4H42U 1AHTH 2OTVA 5HMAA 1BZXE 4WXIA 5EU8A 4A7IB 1C4Y2 3URCA 4XSKU 2FOAA 3SQHE 2A7CA 1ELCA 1GBDA 3A80A 1N6YA 1C1MA 2BVRH 1SGPE 1MKWK 1SB1H 2P8OC 4UFEH 4UFFH 2W7UA 5E0HA 1ETSH 1YF4A 1BTXA 4Y6DA 2B8OH 5C2ZA 2OLGA 2XRCA 3KQBA 3RUOA 2VH6A 1FIWA 1XVMA 2QN5T 1YKTA 2A7JA 2Z7FE 1GBMA 3ZVDA 1ACBE 1F5LA 2EC9H 1GWAA 2ZCKP 2PV9B 3SI4H 1DWEH 2BD8A 5C20A 3RM0H 1ZHRA 3SU3A 1TX6A 1ELVA 1PQ7A 2AIPA 2STBE 5FX6A 3IWMA 1H9IE 4X8VH 2DE8A 2B7DH 2W3KA 3PMBB 1C5MD 2G8TA 3FFGA 4NA7A 2HALA 1IQLA 1FIZA 4BXSA 1KTTB 2R3UA 1O5FH 3NKKA 4Q7ZA 2VWLA 4D8NA 3VXFH 2F9UA 3T26A 4BNRA 1K28D 2VINA 2FI4E 4GHQA 3U98H 2R2WU 1SHYA 1DANH 2YNBA 3RXCA 3UTUH 1VGCC 4WY3A 1GHAF 1SPJA 1KXEA 1MBQA 1P9SA 2VWNA 1GJ8B 5GWZA 1FN6A 4IBLH 1C2HA 1FZZA 4GUXA 1A61H 1ORFA 1V2NT 3E16B 3ZZCA 4JCNA 2TRMA 5DG6A 3RU4E 1HIAA 3NXPA 1G30B 4MPXA 1GI5A 1GJ6A 1H9LB 2VIDA 4ISIH 4Z6AH 4AOQA 3QO6A 1E37B 2XBWA 1TGSZ 1FY1A 4B73A 1Y59T 3BTQE 1KSNA 3QDZB 1PPHE 3M3TA 3NZIA 1K1MA 1DWDH 1EB2A 4WF8A 3W95A 1Y3UA 4X2YA 3KL6A 2J92A 4FUBA 5DP5A 1PFXC 2ASUB 2A45B 2HLCA 3M5MA 1UVPA 6ESTA 2EA3A 1BRAA 3V13A 1WQSA 3VB3A 3K2UA 5J4SA 1BITA 2BMGB 1OWJA 2VVVA 2ZDNA 1G9IE 2VH0A 1SGEE 1ZRKA 1NPMA 1OP8A 3ZZ5A 3ZZAA 2J9NA 3TVJB 3EYDA 2BQ6B 4FUIA 1DLKB 4FUGA 5K7RA 3QX5H 2ZU3A 3PLPA 2VIOA 2XC0A 5GJ4B 3TITA 3N7OA 1YPEH 1TBQH 1HGTH 2ZO3H 1OX1A 1DXPA 1DUAA 1E38B 2ZDVH 2YOLA 1SI5H 1QB6A 3BEFB 1YP9A 1Z71A 3GYLB 1CA0C 1UCYH 4YZUA 2GCTC 4BAOB 1ABIH 4X8TH 1G2MA 2BD3A 3TK5A 1Z1JA 1GBIA 5GIBA 1IQFA 1FY3A 1QRXA 1GHWH 3DHKH 4MPVA 5DK1A 2PFEA 2SGAA 6GCHG 1KDQA 2Y5GA 2ZFSA 5JBBS 1TNGA 5EQQA 3VXEH 5F8ZA 1XMNB 2WUBA 5L2YH 1OWHA 2TIOA 4K1TA 1H1BA 3BTTE 1J17T 3VB4A 1WUNH 3L33A 3ATIA 1LVYA 3M7QA 1ZSJA 2BXUH 3O8DA 4ABAA 3MO9A 1A5HA 1QBNA 4DJZB 5HXFA 1D6WA 2BY6X 2XW9A 1GBAA 4A1XA 4AGKA 1UCYE 1QJ6B 2QGRA 1TMTH 2BY8X 2BD7A 4D76A 2CGAA 2A5IA 4F4OC 2FYRA 5GCHF 1FY4A 2WPIS 4IGDA 4YT6H 2A2QH 4O97A 1G3BA 4BOHA 3GCNA 4H4FA 2OP9A 3TGIE 1GDQA 1P3EA 5DP7A 1AU8A 3A83A 1BRBE 3A86A 2H9TH 1Z8RA 1OWEA 5G4BA 2J4IA 1JIRA 2D8WA 1TPPA 1RXPA 1V2MT 3RXVA 4NIXA 2C8YB 1D3PB 2P16A 2A4RA 2SNVA 2ZHEH 3MU8A 5CHAB 1SBWA 5L30H 1FJSA 1PPGE 3VEQB 1EAWA 1HPGA 3NCLA 4I8KA 4DURA 3I78A 4K5ZA 1K2I1 2UWPA 4X6PA 4KTSA 1TGCA 3SNDA 2HVXA 2RDLA 1B0EA 2G52A 2ZI2H 1X7AC 2ZPQA 3OTJE 1MTNB 2OXSA 2A4OA 1EB1H 1D9IA 2IN2A 1QIXB 3EQ0H 5EXNA 1GBEA 4YOJA 2G5VA 4X0WU 3MWIU 1C1NA 1FXYA 4X2VA 1IQJA 3SV8A 1UTLM 3BF6H 1F5RA 2ZEBA 4YM9A 1V2LT 3ZZDA 2Z6BD 3KQEA 3LGWA 1AO5A 2V6NA 3SGBE 1OPHB 5F8XA 3UNSA 1O5EH 2CF8H 3CS0A 1O2LA 4CH2B 4OGXA 1NRNH 2O8UA 4J2YB 4I7YH 4DW2U 3FP6E 3ZZ4A 1AUJA 4AG2A 1FUJA 2G00A 3ODDA 1MTWA 2R0KA 4ABDA 4XBBA 2OCVB 1O2WA 1L1GA 1GBJA 3DD2H 1P2KA 3EA7A 1AWFH 1IQHA 3SNCA 2BDYA 3BV9B 4E7NA 1UVTH 8ESTE 4YOIA 6LPRA 1FPCH 2BQ7B 2BY5X 2NU2E 4NIVA 3Q76A 2SGFE 1C5WB 2Y5HA 4XOJA 2G5NA 1Q31A 2BDCA 4OS1A 3SU2A 3SGAE 4LXBH 1C4U2 4NFFA 1VZQH 1CBWB 2GZ9A 3M3SA 4LOYH 4TY6A 4AZ2B 1EPTA 1SLXB 2CN0H 1K1IA 3GDUA 1HXFH 4X1SU 2HNTE 4Q7YA 1HAIH 3C27B 4DOQA 1V2RT 1O3GA 2BVSH 2ZG0H 1TONA 1AWHB 1K1PA 2SGEE 1A2CH 1EOJA 2ZA5A 3GCTF 1GHVH 1AVWA 4CRCA 3SV9A 2A4QA 3SUGA 1GG6C 3O8CA 3TH2H 2PGBB 3A7TA 3TH4H 4ZHLU 1K1NA 1O33A 2PSYA 2AFQB 5EW1H 2ZHDA 2ZTZA 1GJAB 2VIWA 3R0FA 2BVXH 2C4FH 8GCHG 3LGYA 2Z9GA 1T8MA 3M35A 1M9UA 1T4VH 1KTSB 2IOTA 2BTCE 1VCQA 3ZVBA 1V2OT 1SGRE 4YOGA 3FP7E 1J9CH 1NRQH 4FUHA 2FP7B 1XUKA 1F0TA 2WPMS 2FOEA 2XCFA 2F9NA 3GY2A 1A0LA 1FY5A 3MHWU 1W10U 4AX9H 3SOSA 4ISHH 4CBNA 3D62A 2SGPE 1K22H 2FM2A 4Y10E 4JZEH 4VGCB 1KLTA 3SUFA 4D9RA 1O2KA 3MH4A 1LHFH 3M37A 3SHCH 4MNVA 5CE1A 3M7TA 2C8XB 5LPEA 1BB0B 3PROA 5AVDA 3RXRA 1S6HA 1DE7H 3F9EA 4FU8A 1IQMA 1AE8H 3GCHB 4NG9H 3BEUA 2UWOA 3A89A 3NPSA 3Q3KA 3UWIA 5DGJA 1ELDE 5F03A 4FUCA 1C2DA 3SJIA 1FQ3A 1HNEE 4FUEA 2BLQA 1PPZA 2JETB 3ESTA 8GCHF 5AHGH 3K9XB 2A31A 2VU8E 1HAPH 3PM3A 3LDXH 3BTME 1TX7A 2J94A 5AFYH 4RKOB 3V12A 3RXSA 3C1KA 1O2VA 4IC6A 4UFGH 1HFDA 2K1QA 3TNTA 2ANKH 2ZF0H 1PYTD 1C1VH 1HAGE 4NWKA 2ZDAH 4Q7XA 2P59A 1GI8B 1P9UA 2QIQA 1DX5M 1TGTA 4Y7BA 1W13U 1WU1A 2Z9JA 1CGJE 2B5TB 3PLBA 3SI3H 2UUYA 4DGJA 2W26A 2XYAA 1NESE 1RTFB 2IJOB 4ABBA 2VVCA 1C5NH 1C1WH 3A8DA 1V3XA 4Q80A 1HIAB 1P04A 3TGJE 7LPRA 1NM6A 5EXMA 3RXDA 2OQUA 3MH6A 3BEIB 3AAVA 1D3DB 1O2OA 3D23A 3TK6A 1NFYA 1AB9C 1A0HB 1C5VA 1RTLA 1C5TA 3RXBA 4B2AA 3IITA 3RU4D 1EAUA 1N1LA 3UR6A 3UUZA 4WMDA 4IMZA 2AMDA 3SNAA 1LHGH 4JYVH 2SFAA 5EOKA 4AORA 3Q3YA 2AMQA 1C5ZB 5T6DA 1AKSA 1AVXA 5DP9A 3MH5A 4SGBE 1NRPH 1GMDF 5JB8S 3SU6A 2QXHA 1BTUA 3RMMH 2ANYA 2WYJA 4SGAE 3ZV9A 2ODPA 3UOUA 3WY8A 4ZXYH 1SL3A 4AYVB 2OC7A 1CQQA 1DVAH 1Q2WA 3VB5A 1MU6B 3AAUA 1BT7A 1GBKA 1Y5UT 4JK6A 1LVMA 5HM2A 1HJ8A 1ESAA 1AIXH 3TGKE 4Y8ZA 5DP4A 2ZECA 3RMNH 1QRZA 4X1PU 1TQ7B 2FO9A 1O3LA 4FVDA 4ZMAH 1P09A 1MAYA 1A46H 2Y80A 4NA9H 3QUMP 1HUTH 1P11E 4INKA 1S5SA 3CP7A 1FLEE 1EPTC 1ZLRA 3O8BA 1BMNH 2BLWA 2BLVA 1Z7KA 1O38A 4D9QA 1CE5A 3P92A 5JDUB 4HFPB 2H1UA 1VCWA 2TGAA 1MKXH 1DPOA 1NFXA 1EQ9A 2XXLA 1WBGB 4FXGH 4JZFH 3HPTB 1O0DH 2UUFB 4ABHA 1QURH 3RMLH 1T7CA 1W12U 1TX8A 1GG6B 3ZZ8A 1CHGA 1E36B 3RXEA 1O2ZA 1HAZB 4MVNA 4NSYA 2JKHA 3QTVH 1YM0A 6CHAB 4MDSA 2EEKA 1TGBA 4ABIA 5EGMA 1CT4E 3RC6A 1ZPCA 1YGCH 2P94A 3F9HA 1SOZA 3SJ9A 3KQDA 4Y0ZE 2FOMB 2UWLA 4INHA 1DS2E 2BZ6H 1ZHPA 4WXVA 1A3EH 2XBYA 1O34A 4E05H 1BUIA 2A0QB 2XC4A 3A87A 4B76A 4ZKOU 2P3FH 2TGDA 1O2UA 1CO7E 2PLXA 2JH6D 4X6NA 3URDA 2PHBA 1TALA 1SHHB 1MKWH 2QC2A 5JBCS 3DT0H 3F6UH 2AEIH 3RXFA 3RXPA 4XBCA 3GCOA 2ZGXH 1BTZA 1SOTA 4ASHA 1LVBA 3RMOH 2ZZUH 1OP0A 5E8EH 3DUXH 4OS7A 4WMFA 1AGJA 1V2PT 1ZJKA 1LCYA 5HM9A 3ATKA 4GCHF 5JPMH 3BIUH 1ELFA 4ZHMU 4BTIB 1Z6EA 1BJUA 2Z3DA 3SZNA 3MO6A 2J2UA 1S82A 1TNIA 1ZJDA 1OYTH 3QK1A 4CBOA 2P3TB 2GT7A 1QY6A 5FBEA 4WWYA 1KXFA 1TABE 1KLJH 1C4V2 1C5QA 1EJMA 1DXWA 1GMCF 1NY22 1OS8A 5EQSA 4NZLA 2BOHB 3ZVCA 2FOFA 1YLDA 1KLIH 1MQ5A 4GHTA 3RP2A 2WPLS 1XXFA 3GDVA 1GCTC 1ELTA 3BTGE 1BOQA 1A4WH 2VIVA 1HAXB 1PPEE 1YPMH 2Z3EA 4WH6A 1VJ9U 1ZPZA 3BTWE 4K1EA 4IW4E 3OU0A 1EZXC 2GP9B 3T29A 5JBTA 4JZIA 1MU8B 3OX7U 3S9BA 1VCPA 2B0FA 3ATLA 3BSQA 1TPSA 3PV4A 1LHEH 2WUCA 1EJNA 1LHDH 1TRMA 1EZSC 1S6FA 2FODA 1TMUH 3M5NA 1OWKA 1Z8JB 3FZZA 2RCEA 2FXRA 1ETRH 1O3JA 3KCGH 4Y79A 2FEQH 3SJ8A 1Y5AT 4B71A 2QYIA 4MQAA 3BG4C 1UTQA 2JETC 2G55A 5FX5A 2ZWLH 3LJJA 3UNRA 3FP8E 4U01A 2ZPSA 3GDSA 1PQ5A 2ZU2A 2AH4X 5GPIB 3MNCA 2PR3A 1P2JA 1CT0E 1K1LA 1AI8H 2AGGX 3M5OA 3PTBA 2V3OH 2H5DA 1TNKA 3U1JB 3A85A 1O3CA 1V6DA 5E0GA 3OY5U 1O3PB 2ZGHA 3VB6A 4BAMB 4K3JA 5C3NA 1EXFA 3ZZBA 1EZQA 4I31A 1CU1A 1TWXB 4YLUA 1QQ4A 1KXCA 1QRWA 1PPCE 1EAXA 1C5SA 2FESH 3U1IB 1UCYK 1QL8A 2TPIZ 2OINA 1BMLA 2QXGA 1D6RA 1RGQA 3AW1A 5L2ZH 1GL0E 1EOLA 2GDDA 3ENSB 3RXKA 1VITG 3PYHA 5EW2H 2FTMA 1W0ZU 2ZU5A 2Z9LA 4AB9A 3RXQA 1O3FA 1O5CB 2PSXA 1EKBB 5PTPA 1QBVH 3LJOA 1DUEA 3RXLA 2STAE 3SN8A 1FNIA 1QFKH 3T2NA 2QF0A 4CHAC 2O8WA 1MH0A 3SJOA 1Y3WA 2Y6TA 1GMDG 1O35A 1Z1IA 4ISLA 1MKXK 2BHGA 5DP8A 4HZHA 1ZSLA 1ELGA 4YLQH 5A09A 3TIUA 3S7HB 1ZYOA 1IAUA 2VJ1A 3Q3XA 1ZMNA 2VGCB 4LK4A 1HJAC 3LT3A 4BANB 2P95A 1CGHA 1LKAA 1T31A 4CRAA 3RXAA 1OSSA 1W0YH 2F9VA 1CBWC 3UQOA 3SU4A 1AZ8A 2Q6FA 4MNWA 3K65B 1K1JA 1NFUA 3B9FH 4NCYA 1BHXF 1HAHH 2QXJA 3F1SB 4XDEA 3VGCB 1ZMJA 5LGOA 1T8NA 1EUFA 1GL1A 1LMWB 1NROH 1SGIB 2FLBH 1KXBA 3F9GA 5EODA 1O2YA 1W3CA 1A5IA 3BTKE 3U8TH 1O39A 1AD8H 1Y3VA 1MTNC 5GDSH 3D49H 4OS2A 2BZAA 4CREA 1O2SA 1O5BB 2ZC9H 1WOFA 1UJ1A 2ZPRA 1C1QA 2FTLE 1HYLA 1ZSKA 3SV2H 2BB4A 1WTHD 1T4UH 1TFXA 4NWLA 3Q77A 2BY7X 3ZZ9A 4O3TA 1WTGH 1HDTH 3MMGA 2ZFQH 4INLA 2BX3A 4CR5A 1O31A 1SFIA 1C5YB 3P8NA 4TWYA 2D1JA
chains in the Genus database with same CATH superfamily
1MMJN 1L4DA 2FX4A 4NZQA 5JB9S 1NBME 1YPLH 1O2MA 1PQAA 2GDEH 1GCDA 2G81E 5FHTA 1KIGH 4UFDH 3HKIB 5C1XA 1C5PA 2PUQH 1UK4A 1FN8A 1A1RA 1J16A 2J95A 3T62A 1V2UT 1Z6JH 3ZV8A 4A92A 2F83A 1TRYA 1F2SE 1BCUH 4Z0KA 3QN7A 2WYGA 1NT1A 4NSVA 3S9AA 3KGPA 1P2MA 1SGFG 2CXVA 4BAHB 2ZTXA 1O2XA 1O2QA 1Z8GA 3A7ZA 3SNBA 3EA9A 4H6TA 1QQUA 5H4IB 2FX6A 1ZR0A 2BXTH 2AHME 4UE7H 3PTNA 2WPKS 2ZGJA 1NU9A 1BTPA 1WCZA 1MCVA 4I33A 1NRSH 1O5GH 1DT2A 1GCTB 1HV7A 2BYAX 6CHAC 4ZUHA 1C2LA 1OP2A 1O2NA 3OEED 2O8MA 1W0JD 2GJGA 3F2FA 2WINI 5SGAE 3MNSA 5TCCA 1P05A 3ATWA 1C2JA 1GPZA 1UTJA 2HNTF 2P3UB 1E34B 3ZVAA 1XXDA 2Z3CA 4CR9A 1UTKA 1O37A 3G01A 1UVOA 1SGQE 2B9LA 1ARCA 4DG4A 1GJ4H 2Y82A 1SSXA 4GCHG 3JZ1B 3U8OH 3LH3A 3PV5A 1MAXA 1GJ5H 1CHOF 1JWTA 4TWWA 2PUXB 4ESTE 2SGQE 3O8RA 3WW7A 3E1XB 4B6EA 1GHYH 4KTUA 1W7GH 1QA7A 3BTFE 1O3OA 1RTKA 1TNLA 1SGYE 1DICA 5FAHA 3HATH 1DM4B 1S0RA 2WV4A 3A82A 5EQRA 1THPB 4XBDA 3OYPA 4GVUA 4ZROA 3SGQE 1SGFA 2C93B 3GY5A 1TA6A 3OFND 1OOKB 1IQIA 3TK9A 2XCNA 2FOGA 1V2VT 1W0KD 1LHCH 4ABEA 5HKKD 1HAVA 3SHAH 1U6QA 1OWDA 3MQKC 1YYY1 4AFUA 3UAIC 4DIHH 1DLEA 2FDAA 2J34A 1O2HA 3PO1C 3D65E 3PB1E 4DT7B 4JK5A 3PMAB 3RU4T 1P03A 3ZYDA 5ABWA 3JZ2B 1BDAA 5A8ZA 3BN9A 1WAYB 3TJNA 3GOVB 1GMCG 3Q00A 1S83A 2VB0A 1ABJH 1JBUH 2FS9A 2BM2A 4ISOA 4FOUC 4KELA 2Y7XA 2BD4A 5GXPA 3BTDE 3SYJA 3QLPH 4D7GA 1B7XB 5HGGA 1THRH 4AFQA 3UR9A 5KGOA 3PRBA 3PO1B 1RD3B 1UVUH 2P8OB 1UK3A 1RIWC 1EJAA 2O8TA 2Y81A 2V3MA 5TJXA 1SG8B 2H5CA 2G4TA 2XWAA 1PQ8A 3A8AA 1GBBA 3SU1A 4Y76A 4IMQA 1D3TB 3ITIA 2RA0A 3GY3A 3A84A 1RS0A 3GISB 2AYWA 3VB7A 1P2OA 1N8OC 2F3CE 1MD7A 2GVFA 4RSPA 2FYQA 5HYOA 3HK6B 2Z9KA 3P8GA 3RXUA 4K8BA 4U32A 5A0BA 1FY8E 2GKVE 3ODFA 2VGCC 4F55A 1YWUA 1HAYB 2D2DA 1G3DA 2HRVA 3LGUA 1G2LA 4X2WA 1F0RA 3MU5A 2R2MB 2C8WB 1KXAA 1XUIA 3QWCH 4MPWA 1UTMA 2FI5E 3LC3A 1GGDC 1GDNA 3K6ZA 2C3SA 1ANCA 1F0UA 1O3BA 1PPBH 2PKSB 4MNYA 4I8JA 1SLUB 1BMAA 1JMOH 1BTYA 2H9EH 2ZFPH 1P06A 1V2KT 1VGCB 2CK3D 3M3VA 1W14U 3SBKA 2XTTB 3MI4A 1V2JT 4OS4A 3E0NB 2ZFRH 4ZKRU 1HJAB 1A3BH 1ZTJA 4FUFA 5ETXA 4ZH8A 2LPRA 2A2XH 2O9QA 2ANWA 5FXLA 5A8YA 1VJAU 1P3CA 2ZHWH 1ZTLA 1YLCA 2Y7ZA 1AN1E 3A7XA 1LVOA 1QA0A 1TB6H 4YO9A 4YTAA 3E91A 5FPYA 5A2MH 1JOUB 3A8BA 2FWWA 5BRRE 2A1DB 2PTCE 3RXMA 1C2IA 2GT8A 3QGJA 4VGCC 2GV7A 4OM9A 3ZZ6A 1XM1A 4HI3A 3LU9B 1ELBA 2KR7A 3SUEA 1J8AA 1O30A 5B6LA 2NU1E 1SQAA 1YBWA 2W3IA 1MBMA 3A81A 5IYTA 3HK3B 2VIQA 3OE7D 3TH3H 3VFEA 2GCHG 1BBRH 3SV7A 3P70B 3A7WA 3PMHB 3IG6B 5LPRA 2RG3A 4HTCH 2ZNKH 4NFEA 3HGNA 4Y11E 1P57B 1FAXA 1FX0B 2ZGCA 1W7XH 3KNXA 1L1JA 2ZHFH 1DY8A 1N6XA 5F53A 3SO3A 4K60A 4YXWD 4FU7A 2KCPA 1C9TA 3GY6A 1ZPBA 2F91A 5BPEA 8KME2 2ZFTA 3GYMA 2EI6A 4K8YA 3T25A 2FOHA 3P17H 3H7OA 2BDGA 3LC5A 4Q2KA 1TOCB 4U30A 5FPSA 2CF9H 3BTEE 2JH5D 4Q4LA 5FPTA 1QR3E 1F92A 3QZQA 4YT7H 7GCHG 2VIPA 1O2JA 4FU9A 2XNIA 2J98B 1T8OA 2V7QD 5DO4H 2FMJA 1BTWA 1BA8B 1GI6A 1XUGA 4OS5A 1FI8A 4GPGA 1OYQA 3ATMA 4ABGA 1S84A 1CVWH 1H4WA 4X8SH 5KEDA 1KMHB 1A0JA 4X6OA 2BOKA 1SC8U 1H8DH 3S69A 1SQOA 2TGPZ 5JBAS 2P93A 2OK5A 1FMGA 2R9PA 2BLOA 2GTBA 3EA8A 3K6YA 1GI7B 2QA9E 1E79D 3DFLA 2BDHA 3MU1A 2EI7A 1EZUC 1WV7H 2Q1JA 2GZ8A 2GD4B 4ABFA 4B2CA 1XUHA 4M9FA 3T5FH 1EFRD 2ZDMA 3SV6A 4O03A 3MNXA 4AB8A 1JRSA 3MYWA 4Y8XA 4R8TB 3ZZ3A 1GVKB 3S0NA 5DKMA 4FVBA 1HJ9A 4X1RU 2QY0B 4CRFA 1C1SA 2ZDLA 5DPAA 2GCHF 3MNBA 4UONA 4XD7D 1C5OH 3DA9B 4X1QU 1MTSA 1ANBA 1AQ7A 2TGTA 3M5LA 3OY6U 5C94A 3NWUA 1ETTH 3RC5A 3FZDA 1P0SH 1ZHMA 3S7KB 2QAAA 3QTOH 1ANEA 3UPEA 5CMXH 5LH8A 2EI8A 2QF3A 4OS6A 1DSTA 2OUAA 3I77A 1D4PB 2UUJB 5EPNA 5EXLA 2PKSC 1V2TT 1SLWB 4HGCA 3SZEA 1GI4A 4DVAU 3V3MA 1CHOG 3CNRA 3ZVEA 4OGYA 2ZU1A 3SU5A 1BBRK 5A8XA 3H7TA 1ZZZA 1E35B 2BD5A 2ZFFH 1Y8TA 4IC5A 2PKAB 1AFQB 1BJVA 2QV1A 5T3HA 2KAIA 1HBTH 2A7HA 4NIYA 3VG8A 1ZTKA 4BAKB 1VR1H 3GY7A 2ANMH 1AUTC 2CHAB 1O2PA 2ZTYA 1OKXA 1NU7B 1S85A 5FCRA 3FAOA 4TPYA 4ZKSU 3RLYH 3R3GB 1GVLA 5GNDA 1BTHH 1JXPA 4D7FA 5L6NH 3A7YA 1ZRBA 2A32A 2ZGBH 1SGCA 2AGEX 3M36A 3UQVA 1YCPK 2F9PA 2AS9A 1AVGH 1LKBA 1GJDB 3B23B 5A0AE 5DP6A 4YESB 1H9HE 1O32A 1HAOH 1OHHD 4JYUH 3GICB 1V2QT 1WQVH 4A1VA 1TQ0B 2R3YA 3BG8A 2IJD1 2C90B 4XRNA 5EJ1A 1F5KU 1GI9B 1MD8A 3PWCA 2HGTH 3P8FA 2WSSD 3UREA 1KY9A 1QL9A 5F6MA 1XUJA 1BRUP 1L1NA 4Z1MD 1TBZH 2ZHQH 1YPGH 4E06H 1P2QA 2HNTC 1AY6H 4U2WA 5CHAC 5A0CA 1LTOA 1F0SA 4B1TA 2FI3E 2GZ7A 4O3UA 3RXTA 4CHAB 4CRBA 3FN8A 2M5TA 1LQEA 1RJXB 1NN6A 1GBTA 1WXRA 2GMTB 3KQ5A 3BTHE 1UK2A 1P2IA 1GHBF 1EP5A 1MZAA 2F9BH 3NRLA 1HAVB 1Q3XA 5FBIA 5TCAA 1SGNE 1GI0A 2K8IA 3RXJA 4THNH 2JH0D 2W5EA 3AASA 1SFQB 4AG1A 2FPZA 4Y0YE 4M7GA 3TJVA 1XKBC 2LELA 3SUDA 2RFKC 1SQTA 2H6MA 1B5GH 1O3AA 3MH7A 3UY9A 2ZU4A 1TLDA 5T6FA 3SW2B 2ZKSA 4UDWH 4ZKNU 4A1TA 4ZHAA 1Z8IB 1ESBA 1L0ZA 1NRRH 1QCPA 1G32B 3AW0A 1TPAE 1BMMH 4JZDH 2HVYB 1UMAH 2FS8A 4UEHH 3SQEE 1C5XB 4IN2A 3SNEA 1PYTC 1V2WT 1O3MA 1KDQB 2JJ1D 4IN1A 1OXGA 2W6ID 1O2RA 4GLYA 4X8UH 2JIZD 1MCTA 4HG6A 2C8ZB 2HPPH 3MOCA 2BY9X 4B75A 1HXEH 4I8LA 4DCDA 2WV9A 4MTBA 1DWBH 1DSUA 5LPFA 1PJPA 3PWBA 1V2ST 3RLWH 3NK8A 1EATA 1GHAG 3LOXA 1KYNA 1XKAC 2NU4E 1BRCE 1RRKA 2PGQB 3RXIA 3ZZ7A 5EPYA 2BDBA 4BTUB 4CRDA 1O3IA 1TE0A 3V0XA 1IQNA 1QJ7B 1O36A 1B0FA 1IHTH 3KIDU 1TNHA 2QXIA 1QB1A 3FVFB 1GI2A 1ZGVA 3W94A 1MTVA 3RXOA 2BDIA 1FDPA 1SR5C 3RDZA 1O3KA 1GJBB 1C1PA 1GMHG 1WYKA 1SMFE 1J14A 2CMYA 4ISNA 3RXGA 3KF2A 1S0QA 2ZQ1A 2UUKB 2PWXA 1TPOA 3TLOA 5K0HA 4QT8C 3HGPA 2OBOA 2ODYB 4X2XA 5F8TA 7ESTE 4XE4A 2I6SA 4NIWA 3P95A 4AC9A 1C5RA 1INCA 2KAIB 2G4UA 1P10A 1NTPA 5ESTE 1S81A 1C2MA 1Y5BT 1ELAA 1DITH 1GI1A 5DJ7A 3MO3A 1TBRH 1YPJH 2XWBI 1SGDE 1W8BH 1GHXH 1QB9A 1E0FD 1GVZA 4BAQB 4E7RG 4DIIH 1O2GH 1QHRB 2Y5FA 7GCHF 3S9CA 3A88A 1LDTT 4FUDA 1GBCA 2OC0A 5ESBA 1VITF 2IPHA 2ULLA 4FUJA 1CA0B 1EP6A 1C5LH 1IOEA 1BBRE 1FONA 3V7TA 1BQYA 1JRTA 4ZAEA 3N7DA 1TMBH 1AMHA 4NGAH 1EASA 3QZRA 2JDID 3E6PH 4ASUD 1IHSH 2CJIA 1QTFA 4GAWA 3LH1A 3L3TA 4MG3A 4I32A 2ZQ2A 1MUEB 2GV6A 1QBOA 2PTNA 2O8LA 1C2GA 3RC4A 5E2OA 2TBSA 3A7VA 2Z94A 1YPHE 1UHBA 3GCTG 4CH8B 1WSSH 4J1YA 1QJ1B 1AB9B 1GJ9B 1CT2E 3T27A 3EDXB 1P02A 2V0BA 2A5AA 2CHAC 1G36A 4I8HA 1AFQC 2I6QA 2ILNA 4RKJB 3KQCA 3PMJA 1LPZB 1L4ZA 1UTNA 1JIMA 3STJA 1G3CA 1NFWA 3GY4A 2DUCA 1AFEH 2ODQA 2FZZA 2WV5A 1AZZA 1YPKH 1SKYE 2VVUA 2ZCLP 1P8VC 2YNAA 2NWNA 3I29A 2D26C 1BHXB 1GJ7B 1UVSH 3MFJA 1O2IA 1GGDB 3U9AH 3AVZA 2QCYA 6GCHF 2EY4C 1EPTB 3GY8A 2WPJS 4A6LA 3DSPA 5DP3A 2G51A 3ZYEA 3EGKH 2ZP0H 1HRTH 2BX4A 1ZGIA 3E3TA 1LO6A 1YCPM 4R0IA 5FCKA 1DY9A 1O3NA 4XFQA 1OWIA 2AERH 3LGTA 1TA2A 3T28A 3MTYA 3TJUA 2FIRH 1MZDA 1TYNA 1TOMH 5AFZH 2SNWA 2K0QA 2HLDD 3B8JA 1TRNA 1PPFE 5C1YA 1DOJA 1EAIA 2NU0E 4A5TS 1YCPH 1HCGA 4RI0A 1ANDA 3LKWA 1XUFA 5AF9H 1VITH 1QNJA 3LGIA 3VGCC 1MTUA 1C2EA 3TJOA 3ELAH 4IS5A 3UNQA 2R0LA 3E8LA 2Q6GA 3HKJB 1YY3A 1FV9A 1C1TA 4WMEA 4ABJA 2RA3A 1C1RA 2BD9A 2GMTC 2GGVB 3FKSD 9LPRA 2ALVA 1O3HA 1YC0A 4B74A 3F9FA 1GBFA 3EAJA 2FOBA 4TPIZ 4F49A 4H6SB 4AFSA 1XX9A 1DFPA 4BTTB 1W2KH 5C5NA 3PLKA 2HPQH 1BIOA 3RXHA 1N8OB 5IDKA 4MLFB 3BIVH 1UO6A 2BDAA 3PRDA 2EQNA 1O5AB 2PW8H 2VWOA 3H5CB 1CSOE 3E90B 1CA8B 3M7UA 3KN2A 4KP0A 4KTCA 3SJKA 1UTPA 3VPKA 1CGIE 2NU3E 1C5UA 1T8LA 3P8OA 1ARBA 2IPQX 3EE0B 5EJZA 4AFZA 4AGJA 2AIQA 7KMEH 4K2YA 1J15A 1ZMLA 1GI3A 2J5UA 3ZVGA 1NC6A 1ID5H 2WPHS 1P2NA 1O3DA 2Q6DA 5B6OA 1G37A 1TNJA 2KZ4A 3L6PA 5C1UA 4X6MA 1SVPA 5J4QA 4JMYA 4JZ1A 3TNSA 1O2TA 2GX4A 5C67A 2J38A 2V3HH 1C2FA 1TGNA 2OQ5A 1A7SA 4UD9H 1P12E 2HWLB 2FLRH 8LPRA 3UWJH 3OSYA 1AE5A 1IQGA 1GMHF 3UIRA 1C2KA 3F68H 3MU0A 3N7EA 3E0PB 1QL7A 1UTOA 4MNXA 2VWMA 4WH8A 1D3QB 1ZOMA 1UHBB 1NO9H 2H2ZA 2A5KA 2Z9IA 4B2BA 2AGIX 4WJG2 1GBLA 1HLTH 4CRGA 1ESTA 2YMSD 1C9PA 1THSH 2OC1A 2OC8A 3TU7H 1L2EA 3U69H 5CDFE 1W11U 1UW7A 1C1UH 1GDUA 1TAWA 4LZ4B 4K69A 1GHZA 4PROA 1HB0B 2VNTA 2CV3A 1IQEA 3TPIZ 3QGNB 5E2PA 2AMPA 1K9OE 2PKAA 4LZ1H 2XNDD 3RM2H 2ZCHP 1O3EA 4WVPE 2FOCA 3M61U 2XBVA 4NA8A 1K21H 1LPGB 2W7SA 1LQDB 3LPRA 4Q63A 3DFJA 1AKSB 2A4GA 3LGVA 3SU0A 1GHBG 4GSOA 1RIWB 1A5GH 3SORA 3UFAA 4ZXXH 2GCTB 4KKDA 1LPKB 1C1OA 3LIWA 4I8GA 3GS9A 4Y71A 5C5OA 3F0OA 2HOBA 2H9HA 3FANA 4Y7AA 5DN6D 2ALPA 5GCHG 1TIOA 2SGDE 1Y3YA 1DDJA 4Y8YA 1T32A 3A8CA 3DSGA 1O5DH 2ZIQH 4P02A 4TY7A 3KEEA 3GCHC 2LNCA 1DWCH 5EG4A 1VKYA 3UOPA 4X1NU 1GBHA 2XBXA 3LONA 1IQKA 1XVOA 3OEHD 1NZQH 2ZDKA 2F9OA 4JYTA 4O9VA 3MU4A 5I46H 5T6GA 2KX4A 2JJ2D 1KXDA 2OD3B 1FAKH 4KGAA 1K1OA 2DE9A 3KHVA 1NS3A 1YPHC 3AK5A 2OBQA 2KFWA 1QGFA 1GJCB 1FPHH 1EX3A 4BXWA 5JYIA 1ELEE 2ESTE 3NUMA 3ZVFA 2BQWB 1H8IH 4B6FA 1MQ6A 1SGTA 1Y3XA 1RFNA 5E0JA 4RN6A 4K1SA 4AN7A 4MPUA 2XC5A 4TYDA 1P01A 4DY7B 3CS7A 4AYYB 3STIA 3CENA 1G3EA 2BD2A 3U8RH 1SLVB 5I25A 2THFB 1F7ZA 2V35A 3BG4B 3P6ZB 9ESTA 4TT3D 4H42U 1AHTH 2OTVA 5HMAA 1BZXE 4WXIA 5EU8A 4A7IB 1C4Y2 3URCA 4XSKU 2FOAA 3SQHE 2A7CA 1ELCA 1GBDA 3A80A 3KYFA 3UB0A 1N6YA 1C1MA 2BVRH 1SGPE 1MKWK 1SB1H 2P8OC 4UFEH 4UFFH 2W7UA 5E0HA 1ETSH 1YF4A 1BTXA 4Y6DA 2B8OH 5C2ZA 2OLGA 2XRCA 3KQBA 3RUOA 2VH6A 1FIWA 1XVMA 2QN5T 1YKTA 2A7JA 2Z7FE 1GBMA 3ZVDA 1ACBE 1F5LA 2EC9H 1GWAA 2ZCKP 2PV9B 3SI4H 1DWEH 2BD8A 5C20A 3RM0H 1ZHRA 3SU3A 1TX6A 1ELVA 1PQ7A 2AIPA 2STBE 5FX6A 3IWMA 1H9IE 4X8VH 2DE8A 2B7DH 2W3KA 3PMBB 1C5MD 2G8TA 3FFGA 4NA7A 2HALA 1IQLA 1FIZA 4BXSA 1KTTB 2R3UA 1O5FH 3NKKA 5C17A 4Q7ZA 2VWLA 4D8NA 3VXFH 2F9UA 3T26A 4BNRA 1K28D 2VINA 3N99A 2FI4E 4GHQA 3U98H 2R2WU 5C0UA 1SHYA 1DANH 2YNBA 3RXCA 3UTUH 1VGCC 4WY3A 1GHAF 1SPJA 1KXEA 1MBQA 1P9SA 2VWNA 1GJ8B 5GWZA 1FN6A 4IBLH 1C2HA 1FZZA 4GUXA 1A61H 1ORFA 1V2NT 3E16B 3ZZCA 4JCNA 2TRMA 5DG6A 3RU4E 1HIAA 2PP6A 3NXPA 1G30B 4MPXA 1GI5A 1GJ6A 1H9LB 2VIDA 4ISIH 1SQRA 4Z6AH 4AOQA 3QO6A 1E37B 2XBWA 1TGSZ 1FY1A 4B73A 1Y59T 3BTQE 1KSNA 3QDZB 4RT1A 1PPHE 3M3TA 3NZIA 1K1MA 1DWDH 1EB2A 4WF8A 3EE7A 3W95A 1Y3UA 4X2YA 3KL6A 2J92A 4FUBA 5DP5A 2L6OA 1PFXC 2ASUB 2A45B 2HLCA 3M5MA 1UVPA 6ESTA 2EA3A 1BRAA 3V13A 1WQSA 3VB3A 3K2UA 5J4SA 1BITA 2BMGB 1OWJA 2VVVA 2ZDNA 1G9IE 2VH0A 1SGEE 1ZRKA 1NPMA 1OP8A 3ZZ5A 3ZZAA 2J9NA 3TVJB 3EYDA 2BQ6B 4FUIA 1DLKB 4FUGA 5K7RA 3QX5H 2ZU3A 3PLPA 2VIOA 2XC0A 5GJ4B 3TITA 3N7OA 1YPEH 1TBQH 1HGTH 2ZO3H 1OX1A 1DXPA 1DUAA 1E38B 2ZDVH 2YOLA 4I86A 1SI5H 1QB6A 3BEFB 1YP9A 1Z71A 3GYLB 1CA0C 1UCYH 4YZUA 2GCTC 4BAOB 5KECA 1ABIH 3F0PA 4X8TH 1G2MA 2BD3A 3TK5A 1Z1JA 1GBIA 5GIBA 2QF5A 1IQFA 1FY3A 1QRXA 1GHWH 3DHKH 4MPVA 5DK1A 2PFEA 2SGAA 6GCHG 1KDQA 2Y5GA 2ZFSA 5JBBS 1TNGA 5EQQA 3VXEH 5F8ZA 1XMNB 2WUBA 5L2YH 1OWHA 2TIOA 4K1TA 1H1BA 2QE7D 1J17T 3BTTE 3VB4A 1WUNH 3L33A 5EIYA 3ATIA 1LVYA 3M7QA 1ZSJA 2BXUH 2M2AA 3O8DA 4ABAA 3MO9A 1A5HA 1QBNA 4DJZB 5HXFA 1D6WA 2BY6X 2XW9A 1BMFD 1GBAA 4A1XA 4AGKA 1UCYE 1QJ6B 2QGRA 1TMTH 2BY8X 2BD7A 4D76A 2CGAA 2A5IA 4F4OC 2FYRA 5GCHF 1FY4A 2WPIS 4IGDA 4YT6H 2A2QH 4O97A 1G3BA 4BOHA 3GCNA 4H4FA 2OP9A 3TGIE 1GDQA 1P3EA 5DP7A 1AU8A 3A83A 1BRBE 3A86A 2H9TH 1Z8RA 1OWEA 5G4BA 3F2GA 2J4IA 1JIRA 2D8WA 1TPPA 1RXPA 1V2MT 3RXVA 4NIXA 2C8YB 1D3PB 2P16A 2A4RA 2SNVA 2ZHEH 3MU8A 5CHAB 1SBWA 5L30H 1FJSA 1PPGE 3VEQB 1EAWA 1HPGA 3NCLA 4I8KA 4DURA 3I78A 4K5ZA 1QZ8A 1K2I1 2UWPA 4X6PA 4KTSA 1TGCA 3SNDA 3OTPA 2HVXA 2RDLA 1B0EA 2G52A 2ZI2H 3U28C 1X7AC 2ZPQA 3OTJE 1MTNB 2OXSA 2A4OA 5C0TA 1EB1H 1D9IA 2IN2A 1QIXB 3EQ0H 5EXNA 1GBEA 4YOJA 2G5VA 4X0WU 3MWIU 1C1NA 1FXYA 4X2VA 1IQJA 3SV8A 1UTLM 3BF6H 1F5RA 2ZEBA 4YM9A 1V2LT 4RT0A 3ZZDA 2Z6BD 3KQEA 3LGWA 1AO5A 2V6NA 3SGBE 1OPHB 5F8XA 3UNSA 1O5EH 2CF8H 2WHXA 3CS0A 1O2LA 4CH2B 4OGXA 1NRNH 2O8UA 3DCLA 4J2YB 4I7YH 4DW2U 3FP6E 3ZZ4A 1AUJA 4AG2A 1FUJA 2G00A 3ODDA 1MTWA 2R0KA 4ABDA 4XBBA 2OCVB 1O2WA 1L1GA 1GBJA 3DD2H 1P2KA 3EA7A 1AWFH 1IQHA 3SNCA 2BDYA 3BV9B 4E7NA 1YLNA 1UVTH 8ESTE 4YOIA 6LPRA 1FPCH 2BQ7B 2BY5X 2NU2E 4NIVA 3Q76A 2SGFE 1C5WB 2Y5HA 4XOJA 2G5NA 1Q31A 2BDCA 4OS1A 3SU2A 3SGAE 4LXBH 1C4U2 4NFFA 1VZQH 5FL7D 1CBWB 2GZ9A 3M3SA 5T1VA 4LOYH 4TY6A 4AZ2B 1EPTA 1SLXB 2CN0H 1K1IA 3GDUA 2J97A 1HXFH 4X1SU 2HNTE 4Q7YA 2QF4A 1HAIH 3C27B 4DOQA 5CHBA 1K0HA 1V2RT 1O3GA 2BVSH 2ZG0H 1TONA 1AWHB 1K1PA 2SGEE 1A2CH 1EOJA 2ZA5A 3GCTF 1GHVH 1AVWA 2F4LA 4CRCA 2A4QA 3SV9A 3SUGA 1GG6C 3O8CA 3TH2H 2PGBB 3A7TA 3TH4H 4ZHLU 1K1NA 1O33A 2PSYA 2AFQB 5EW1H 2J98A 2ZHDA 2ZTZA 1GJAB 2VIWA 3R0FA 2BVXH 2C4FH 8GCHG 3LGYA 2KCOA 2Z9GA 1T8MA 3M35A 1M9UA 1T4VH 2BTCE 2IOTA 1KTSB 1VCQA 3ZVBA 1V2OT 1SGRE 4YOGA 3FP7E 1J9CH 1NRQH 4FUHA 2FP7B 4TSFD 1XUKA 2RDEA 1F0TA 2WPMS 2FOEA 2XCFA 2F9NA 3GY2A 1A0LA 1FY5A 3MHWU 1W10U 4AX9H 3SOSA 4ISHH 4CBNA 3D62A 2SGPE 3H09A 1K22H 2FM2A 4Y10E 4JZEH 4VGCB 3F3BA 1KLTA 3SUFA 4D9RA 1O2KA 3MH4A 1LHFH 3M37A 3SHCH 4MNVA 5CE1A 3M7TA 2C8XB 5LPEA 1BB0B 3PROA 5AVDA 3RXRA 1S6HA 1DE7H 3F9EA 4FU8A 1IQMA 1AE8H 3GCHB 4NG9H 3BEUA 2UWOA 3A89A 3NPSA 3Q3KA 3UWIA 5DGJA 1ELDE 5F03A 4FUCA 1C2DA 3SJIA 1FQ3A 1HNEE 4FUEA 2BLQA 1PPZA 2JETB 3ESTA 8GCHF 5AHGH 3K9XB 2A31A 5IK2D 4FETA 2VU8E 1HAPH 3PM3A 3LDXH 3BTME 1TX7A 2J94A 5AFYH 4RKOB 3V12A 3RXSA 3C1KA 1O2VA 4IC6A 4UFGH 1HFDA 2K1QA 3TNTA 2ANKH 2ZF0H 1PYTD 1C1VH 1HAGE 4NWKA 2ZDAH 1NBMD 4Q7XA 2P59A 1GI8B 1P9UA 2QIQA 1DX5M 1TGTA 4Y7BA 2LP6A 1W13U 1WU1A 2Z9JA 1CGJE 2B5TB 3PLBA 3SI3H 2UUYA 4DGJA 2WPDD 2W26A 2XYAA 1NESE 1RTFB 2IJOB 4ABBA 2VVCA 1C5NH 1C1WH 3A8DA 1V3XA 4Q80A 1HIAB 1P04A 3TGJE 7LPRA 1NM6A 5EXMA 3RXDA 2OQUA 3MH6A 4ACAA 2WZQA 3FOAA 3BEIB 3KYGA 3AAVA 1D3DB 1O2OA 3D23A 3TK6A 1NFYA 1AB9C 1A0HB 1C5VA 1RTLA 1C5TA 3RXBA 4B2AA 3IITA 3RU4D 3PV2A 1EAUA 1N1LA 3UR6A 3UUZA 4WMDA 4IMZA 2AMDA 3SNAA 1LHGH 4JYVH 2SFAA 5EOKA 4AORA 3Q3YA 2AMQA 1C5ZB 5T6DA 1AKSA 1AVXA 5DP9A 3MH5A 4SGBE 1NRPH 1GMDF 5JB8S 3SU6A 2QXHA 1BTUA 2F43B 3RMMH 1E1QD 2ANYA 2WYJA 4SGAE 3WWFA 3ZV9A 2ODPA 3UOUA 3WY8A 4ZXYH 1SL3A 4AYVB 2OC7A 1CQQA 1DVAH 1Q2WA 3VB5A 1MU6B 3AAUA 1BT7A 1GBKA 1Y5UT 4JK6A 1LVMA 5HM2A 1HJ8A 1ESAA 1AIXH 2YMSB 3TGKE 4Y8ZA 5DP4A 2ZECA 3RMNH 1QRZA 4X1PU 1TQ7B 2FO9A 1O3LA 4FVDA 4ZMAH 1P09A 1MAYA 1A46H 2Y80A 3F2HA 4NA9H 3QUMP 1HUTH 1P11E 4INKA 1S5SA 3CP7A 1FLEE 1EPTC 1ZLRA 3O8BA 1BMNH 2BLWA 2BLVA 1Z7KA 1O38A 4D9QA 1CE5A 3P92A 5JDUB 4HFPB 2H1UA 1VCWA 2TGAA 1MKXH 1DPOA 1NFXA 1EQ9A 1WBGB 2XXLA 4FXGH 4JZFH 3HPTB 1O0DH 2UUFB 3OAAD 4ABHA 1QURH 3RMLH 1T7CA 1W12U 1TX8A 1GG6B 3ZZ8A 1CHGA 1E36B 3RXEA 1O2ZA 1HAZB 4MVNA 4NSYA 2JKHA 3WWBA 3QTVH 1YM0A 6CHAB 4MDSA 2EEKA 1TGBA 4ABIA 5EGMA 1CT4E 3RC6A 1ZPCA 1YGCH 2P94A 3F9HA 1SOZA 3SJ9A 3KQDA 4Y0ZE 2FOMB 2UWLA 4INHA 1DS2E 2BZ6H 1ZHPA 4WXVA 1A3EH 2XBYA 2VBCA 1O34A 4E05H 1BUIA 2A0QB 4F48B 2XC4A 3A87A 4B76A 4ZKOU 2P3FH 4ACBA 2TGDA 1O2UA 1CO7E 2PLXA 2JH6D 1E1RD 4X6NA 3URDA 2PHBA 1TALA 1SHHB 3DSOA 1MKWH 2QC2A 5JBCS 3DT0H 3F6UH 2AEIH 3RXFA 3RXPA 4XBCA 3GCOA 2ZGXH 1BTZA 1SOTA 4ASHA 1LVBA 3RMOH 2ZZUH 1OP0A 5E8EH 3DUXH 4OS7A 4WMFA 5EJLA 1AGJA 1V2PT 1ZJKA 1LCYA 5HM9A 3ATKA 4GCHF 5JPMH 1H8HD 3BIUH 1ELFA 4ZHMU 4BTIB 1Z6EA 1BJUA 2Z3DA 3SZNA 3MO6A 2J2UA 1S82A 1TNIA 1ZJDA 1OYTH 3QK1A 5HIYA 4CBOA 2P3TB 2GT7A 1QY6A 5FBEA 4WWYA 1KXFA 1TABE 1KLJH 1C4V2 1C5QA 1EJMA 1DXWA 1GMCF 1NY22 1OS8A 5EQSA 4NZLA 2BOHB 3ZIAD 3ZVCA 2FOFA 1YLDA 1KLIH 1MQ5A 4GHTA 3RP2A 2WPLS 1XXFA 3GDVA 1GCTC 1ELTA 3BTGE 4ZCNA 1BOQA 1A4WH 2VIVA 1HAXB 1PPEE 1YPMH 2Z3EA 2W6JD 2XOKD 1VJ9U 4WH6A 1ZPZA 3BTWE 4K1EA 4IW4E 3OU0A 1EZXC 2GP9B 3T29A 5JBTA 4JZIA 1MU8B 1MABB 3OX7U 3S9BA 1VCPA 2B0FA 3ATLA 3BSQA 1TPSA 3PV4A 1LHEH 2WUCA 1EJNA 1LHDH 1TRMA 1EZSC 1S6FA 2FODA 1TMUH 3M5NA 1OWKA 1Z8JB 3FZZA 2RCEA 2FXRA 1ETRH 1O3JA 3KCGH 4Y79A 5DSFA 2FEQH 3SJ8A 1Y5AT 4B71A 2QYIA 4MQAA 3BG4C 1UTQA 2JETC 2G55A 5FX5A 2ZWLH 3LJJA 3UNRA 3FP8E 4U01A 2ZPSA 3GDSA 1PQ5A 2ZU2A 2AH4X 5GPIB 3MNCA 2PR3A 1P2JA 1CT0E 2KM0A 1K1LA 1AI8H 2AGGX 3M5OA 3PTBA 3W1EA 2V3OH 2H5DA 1TNKA 3U1JB 3A85A 1O3CA 1V6DA 5E0GA 3OY5U 1O3PB 2ZGHA 3VB6A 4BAMB 4K3JA 5C3NA 1EXFA 1COWD 3ZZBA 1EZQA 4I31A 1CU1A 1TWXB 4YLUA 1QQ4A 1KXCA 1QRWA 2L74A 1PPCE 1EAXA 1C5SA 2FESH 3U1IB 1UCYK 1QL8A 2TPIZ 2OINA 1BMLA 2QXGA 5HIZA 1D6RA 1RGQA 3AW1A 5L2ZH 1GL0E 1EOLA 2GDDA 3ENSB 3RXKA 1VITG 2KCAA 3PYHA 5EW2H 2FTMA 1W0ZU 2ZU5A 2Z9LA 4AB9A 2KCYA 3RXQA 1O3FA 1O5CB 2PSXA 3FO8D 1EKBB 2YMSC 5PTPA 1QBVH 3LJOA 1DUEA 3RXLA 2STAE 3SN8A 1FNIA 1QFKH 3T2NA 2QF0A 4CHAC 2O8WA 1MH0A 3SJOA 1Y3WA 2Y6TA 1GMDG 1O35A 1Z1IA 4ISLA 1MKXK 2BHGA 5DP8A 4HZHA 1ZSLA 1ELGA 4YLQH 5A09A 3TIUA 3S7HB 1ZYOA 1IAUA 2VJ1A 3Q3XA 1ZMNA 2VGCB 4LK4A 1HJAC 3LT3A 4BANB 2P95A 1CGHA 1LKAA 1T31A 4CRAA 3RXAA 1OSSA 1W0YH 2F9VA 1CBWC 3UQOA 3SU4A 1S6LA 1AZ8A 2Q6FA 4MNWA 3K65B 1K1JA 1NFUA 3B9FH 4NCYA 1BHXF 1HAHH 2QXJA 3F1SB 4XDEA 3VGCB 1ZMJA 5LGOA 1H8ED 1T8NA 1EUFA 1GL1A 1LMWB 1NROH 1SGIB 2FLBH 1KXBA 3F9GA 5EODA 1O2YA 1W3CA 1A5IA 3BTKE 3U8TH 1O39A 1AD8H 1Y3VA 1MTNC 5GDSH 3D49H 4OS2A 2BZAA 4CREA 1O2SA 1O5BB 2ZC9H 1WOFA 1UJ1A 2ZPRA 4P00A 1C1QA 2FTLE 1HYLA 1ZSKA 3SV2H 2BB4A 1WTHD 4DT4A 1T4UH 1TFXA 4NWLA 3Q77A 2BY7X 3ZZ9A 4O3TA 1WTGH 1HDTH 3MMGA 2ZFQH 4INLA 2BX3A 4CR5A 1O31A 1SFIA 1WDIA 1C5YB 3P8NA 4TWYA 2D1JA
chains in the Genus database with same CATH topology
1MMJN 1L4DA 2FX4A 4NZQA 5JB9S 1YPLH 1O2MA 1PQAA 2GDEH 1GCDA 2G81E 5FHTA 1KIGH 4UFDH 3HKIB 5C1XA 1C5PA 2PUQH 1UK4A 1FN8A 1A1RA 1J16A 2J95A 3T62A 1V2UT 1Z6JH 3ZV8A 4A92A 2F83A 1TRYA 1F2SE 1BCUH 4Z0KA 3QN7A 2WYGA 1NT1A 4NSVA 3S9AA 3KGPA 1P2MA 1SGFG 2CXVA 4BAHB 2ZTXA 1O2XA 1O2QA 1Z8GA 3A7ZA 3SNBA 3EA9A 4H6TA 1QQUA 5H4IB 2FX6A 1ZR0A 2BXTH 4UE7H 3PTNA 2WPKS 2ZGJA 1NU9A 1BTPA 1WCZA 1MCVA 4I33A 1NRSH 1O5GH 1DT2A 1GCTB 1HV7A 2BYAX 6CHAC 4ZUHA 1C2LA 1OP2A 1O2NA 2O8MA 2WINI 5SGAE 3MNSA 5TCCA 1P05A 3ATWA 1C2JA 1GPZA 1UTJA 2HNTF 2P3UB 1E34B 3ZVAA 1XXDA 2Z3CA 4CR9A 1UTKA 1O37A 3G01A 1UVOA 1SGQE 2B9LA 1ARCA 4DG4A 1GJ4H 2Y82A 1SSXA 4GCHG 3JZ1B 3U8OH 3LH3A 1MAXA 1GJ5H 1CHOF 1JWTA 4TWWA 2PUXB 4ESTE 2SGQE 3O8RA 3E1XB 1GHYH 4KTUA 1W7GH 1QA7A 3BTFE 1O3OA 1RTKA 1TNLA 1SGYE 1DICA 5FAHA 3HATH 1DM4B 1S0RA 2WV4A 3A82A 5EQRA 1THPB 4XBDA 3OYPA 4GVUA 4ZROA 3SGQE 1SGFA 2C93B 3GY5A 1TA6A 1OOKB 1IQIA 3TK9A 2XCNA 2FOGA 1V2VT 4ABEA 1LHCH 1HAVA 3SHAH 1U6QA 1OWDA 1YYY1 4AFUA 4DIHH 1DLEA 2FDAA 2J34A 1O2HA 3PO1C 3D65E 3PB1E 4DT7B 4JK5A 3PMAB 3RU4T 1P03A 3ZYDA 5ABWA 3JZ2B 1BDAA 5A8ZA 3BN9A 1WAYB 3TJNA 3GOVB 1GMCG 3Q00A 1S83A 2VB0A 1ABJH 1JBUH 2FS9A 2BM2A 4ISOA 4KELA 2Y7XA 2BD4A 5GXPA 3BTDE 3QLPH 4D7GA 1B7XB 5HGGA 1THRH 4AFQA 3UR9A 3PO1B 1RD3B 1UVUH 2P8OB 1UK3A 1RIWC 1EJAA 2O8TA 2Y81A 5TJXA 1SG8B 2H5CA 2G4TA 2XWAA 1PQ8A 3A8AA 1GBBA 3SU1A 4Y76A 4IMQA 1D3TB 3ITIA 2RA0A 3GY3A 3A84A 1RS0A 3GISB 2AYWA 3VB7A 1P2OA 1N8OC 2F3CE 1MD7A 2GVFA 4RSPA 2FYQA 5HYOA 3HK6B 2Z9KA 3P8GA 3RXUA 4K8BA 4U32A 5A0BA 1FY8E 2GKVE 3ODFA 2VGCC 1HAYB 2D2DA 1G3DA 2HRVA 3LGUA 1G2LA 4X2WA 1F0RA 3MU5A 2R2MB 2C8WB 1KXAA 1XUIA 3QWCH 4MPWA 1UTMA 2FI5E 3LC3A 1GGDC 1GDNA 3K6ZA 2C3SA 1ANCA 1F0UA 1O3BA 1PPBH 2PKSB 4MNYA 4I8JA 1SLUB 1BMAA 1JMOH 1BTYA 2H9EH 2ZFPH 1P06A 1V2KT 1VGCB 3M3VA 3SBKA 1W14U 2XTTB 3MI4A 1V2JT 4OS4A 3E0NB 2ZFRH 4ZKRU 1HJAB 1A3BH 1ZTJA 4FUFA 5ETXA 4ZH8A 2LPRA 2A2XH 2O9QA 2ANWA 5FXLA 5A8YA 1VJAU 1P3CA 2ZHWH 1ZTLA 1YLCA 2Y7ZA 1AN1E 3A7XA 1LVOA 1QA0A 1TB6H 4YO9A 4YTAA 3E91A 5FPYA 5A2MH 1JOUB 3A8BA 2FWWA 5BRRE 2A1DB 2PTCE 3RXMA 1C2IA 2GT8A 3QGJA 4VGCC 2GV7A 3ZZ6A 1XM1A 4HI3A 3LU9B 1ELBA 3SUEA 1J8AA 1O30A 2NU1E 1SQAA 1YBWA 2W3IA 1MBMA 3A81A 5IYTA 3HK3B 2VIQA 3TH3H 3VFEA 2GCHG 1BBRH 3SV7A 3P70B 3A7WA 3PMHB 3IG6B 5LPRA 2RG3A 4HTCH 2ZNKH 4NFEA 3HGNA 4Y11E 1P57B 1FAXA 2ZGCA 1W7XH 3KNXA 1L1JA 2ZHFH 1DY8A 1N6XA 3SO3A 4K60A 4FU7A 1C9TA 3GY6A 1ZPBA 2F91A 5BPEA 8KME2 2ZFTA 3GYMA 2EI6A 4K8YA 3T25A 2FOHA 3P17H 3H7OA 2BDGA 3LC5A 4Q2KA 1TOCB 4U30A 5FPSA 2CF9H 3BTEE 2JH5D 5FPTA 1QR3E 1F92A 3QZQA 4YT7H 7GCHG 2VIPA 1O2JA 4FU9A 2XNIA 1T8OA 5DO4H 2FMJA 1BTWA 1BA8B 1GI6A 1XUGA 4OS5A 1FI8A 4GPGA 1OYQA 3ATMA 4ABGA 1S84A 1CVWH 1H4WA 4X8SH 1A0JA 4X6OA 2BOKA 1SC8U 1H8DH 3S69A 1SQOA 2TGPZ 5JBAS 2P93A 1FMGA 2R9PA 2BLOA 2GTBA 3EA8A 3K6YA 1GI7B 2QA9E 3DFLA 2BDHA 3MU1A 2EI7A 1EZUC 1WV7H 2Q1JA 2GZ8A 2GD4B 4ABFA 4B2CA 1XUHA 3T5FH 2ZDMA 3SV6A 4O03A 3MNXA 4AB8A 1JRSA 3MYWA 4Y8XA 4R8TB 3ZZ3A 1GVKB 3S0NA 5DKMA 4FVBA 1HJ9A 4X1RU 2QY0B 4CRFA 1C1SA 2ZDLA 5DPAA 2GCHF 3MNBA 4UONA 1C5OH 3DA9B 4X1QU 1MTSA 1ANBA 1AQ7A 2TGTA 3M5LA 3OY6U 3NWUA 1ETTH 3RC5A 3FZDA 1P0SH 1ZHMA 3S7KB 2QAAA 3QTOH 1ANEA 3UPEA 5CMXH 5LH8A 2EI8A 2QF3A 4OS6A 1DSTA 2OUAA 3I77A 1D4PB 2UUJB 5EPNA 5EXLA 2PKSC 1V2TT 1SLWB 4HGCA 1GI4A 4DVAU 3V3MA 1CHOG 3ZVEA 4OGYA 2ZU1A 3SU5A 1BBRK 5A8XA 3H7TA 1ZZZA 1E35B 2BD5A 2ZFFH 1Y8TA 4IC5A 2PKAB 1AFQB 1BJVA 2QV1A 5T3HA 2KAIA 1HBTH 2A7HA 4NIYA 1ZTKA 4BAKB 1VR1H 3GY7A 2ANMH 1AUTC 2CHAB 1O2PA 2ZTYA 1OKXA 1NU7B 1S85A 5FCRA 3FAOA 4TPYA 4ZKSU 3RLYH 3R3GB 1GVLA 1BTHH 1JXPA 4D7FA 5L6NH 3A7YA 1ZRBA 2A32A 2ZGBH 1SGCA 2AGEX 3M36A 3UQVA 1YCPK 2F9PA 2AS9A 1AVGH 1LKBA 1GJDB 3B23B 5A0AE 5DP6A 4YESB 1H9HE 1O32A 1HAOH 4JYUH 3GICB 1V2QT 1WQVH 4A1VA 1TQ0B 2R3YA 3BG8A 2C90B 1F5KU 1GI9B 1MD8A 3PWCA 2HGTH 3P8FA 3UREA 1KY9A 1QL9A 5F6MA 1XUJA 1BRUP 1L1NA 1TBZH 2ZHQH 1YPGH 4E06H 1P2QA 2HNTC 1AY6H 4U2WA 5CHAC 5A0CA 1LTOA 1F0SA 4B1TA 2FI3E 2GZ7A 4O3UA 3RXTA 4CHAB 4CRBA 2M5TA 1LQEA 1RJXB 1NN6A 1GBTA 2GMTB 3BTHE 1UK2A 1P2IA 1GHBF 1EP5A 1MZAA 2F9BH 1HAVB 1Q3XA 5FBIA 5TCAA 1SGNE 1GI0A 3RXJA 4THNH 2JH0D 2W5EA 3AASA 1SFQB 4AG1A 2FPZA 4Y0YE 4M7GA 3TJVA 1XKBC 3SUDA 1SQTA 2H6MA 1B5GH 1O3AA 3MH7A 3UY9A 2ZU4A 1TLDA 5T6FA 3SW2B 2ZKSA 4UDWH 4ZKNU 4A1TA 4ZHAA 1Z8IB 1ESBA 1L0ZA 1NRRH 1QCPA 1G32B 3AW0A 1TPAE 1BMMH 4JZDH 1UMAH 2FS8A 4UEHH 3SQEE 1C5XB 4IN2A 3SNEA 1PYTC 1V2WT 1O3MA 1KDQB 4IN1A 1OXGA 1O2RA 4GLYA 4X8UH 1MCTA 2C8ZB 2HPPH 3MOCA 2BY9X 4B75A 1HXEH 4I8LA 4DCDA 4MTBA 1DWBH 1DSUA 5LPFA 1PJPA 3PWBA 1V2ST 3RLWH 3NK8A 1EATA 1GHAG 3LOXA 1KYNA 1XKAC 2NU4E 1BRCE 1RRKA 2PGQB 3RXIA 3ZZ7A 5EPYA 2BDBA 4BTUB 4CRDA 1O3IA 1TE0A 3V0XA 1IQNA 1QJ7B 1O36A 1B0FA 1IHTH 3KIDU 1TNHA 2QXIA 1QB1A 3FVFB 1GI2A 1ZGVA 3W94A 1MTVA 3RXOA 2BDIA 1FDPA 1SR5C 3RDZA 1O3KA 1GJBB 1C1PA 1GMHG 1WYKA 1SMFE 1J14A 2CMYA 4ISNA 3RXGA 3KF2A 1S0QA 2ZQ1A 2UUKB 2PWXA 1TPOA 3TLOA 5K0HA 4QT8C 3HGPA 2OBOA 2ODYB 4X2XA 5F8TA 7ESTE 4XE4A 2I6SA 4NIWA 3P95A 1C5RA 1INCA 2KAIB 2G4UA 1P10A 1NTPA 5ESTE 1S81A 1C2MA 1Y5BT 1ELAA 1DITH 1GI1A 5DJ7A 3MO3A 1TBRH 1YPJH 2XWBI 1SGDE 1W8BH 1GHXH 1QB9A 1E0FD 1GVZA 4BAQB 4E7RG 4DIIH 1O2GH 1QHRB 2Y5FA 7GCHF 3S9CA 3A88A 1LDTT 4FUDA 1GBCA 2OC0A 5ESBA 1VITF 2IPHA 2ULLA 4FUJA 1CA0B 1EP6A 1C5LH 1IOEA 1BBRE 1FONA 3V7TA 1BQYA 1JRTA 4ZAEA 1TMBH 1AMHA 4NGAH 1EASA 3QZRA 3E6PH 1IHSH 2CJIA 1QTFA 4GAWA 3LH1A 3L3TA 4MG3A 4I32A 2ZQ2A 1MUEB 2GV6A 1QBOA 2PTNA 2O8LA 1C2GA 3RC4A 5E2OA 2TBSA 3A7VA 2Z94A 1YPHE 1UHBA 3GCTG 4CH8B 1WSSH 4J1YA 1QJ1B 1AB9B 1GJ9B 1CT2E 3T27A 3EDXB 1P02A 2V0BA 2A5AA 2CHAC 1G36A 4I8HA 1AFQC 2I6QA 2ILNA 4RKJB 3KQCA 3PMJA 1LPZB 1L4ZA 1UTNA 1JIMA 3STJA 1G3CA 1NFWA 3GY4A 2DUCA 1AFEH 2ODQA 2FZZA 2WV5A 1AZZA 1YPKH 2VVUA 2ZCLP 1P8VC 2YNAA 2NWNA 3I29A 2D26C 1BHXB 1GJ7B 1UVSH 3MFJA 1O2IA 1GGDB 3U9AH 3AVZA 2QCYA 6GCHF 1EPTB 3GY8A 2WPJS 4A6LA 5DP3A 2G51A 3ZYEA 3EGKH 2ZP0H 1HRTH 2BX4A 1ZGIA 3E3TA 1LO6A 1YCPM 4R0IA 5FCKA 1DY9A 1O3NA 4XFQA 1OWIA 2AERH 3LGTA 1TA2A 3T28A 3MTYA 3TJUA 2FIRH 1MZDA 1TYNA 1TOMH 5AFZH 2SNWA 3B8JA 1TRNA 1PPFE 5C1YA 1DOJA 1EAIA 2NU0E 4A5TS 1YCPH 1HCGA 1ANDA 3LKWA 1XUFA 5AF9H 1VITH 1QNJA 3LGIA 3VGCC 1MTUA 1C2EA 3TJOA 3ELAH 4IS5A 3UNQA 2R0LA 3E8LA 2Q6GA 3HKJB 1FV9A 1C1TA 4WMEA 4ABJA 2RA3A 1C1RA 2BD9A 2GMTC 2GGVB 9LPRA 2ALVA 1O3HA 1YC0A 4B74A 3F9FA 1GBFA 3EAJA 2FOBA 4TPIZ 4F49A 4H6SB 4AFSA 1XX9A 1DFPA 4BTTB 1W2KH 5C5NA 3PLKA 2HPQH 1BIOA 3RXHA 1N8OB 5IDKA 4MLFB 3BIVH 1UO6A 2BDAA 1O5AB 2PW8H 2VWOA 3H5CB 1CSOE 3E90B 1CA8B 3M7UA 3KN2A 4KP0A 4KTCA 3SJKA 1UTPA 3VPKA 1CGIE 2NU3E 1C5UA 1T8LA 3P8OA 1ARBA 3EE0B 4AFZA 4AGJA 2AIQA 7KMEH 4K2YA 1J15A 1ZMLA 1GI3A 3ZVGA 1NC6A 1ID5H 2WPHS 1P2NA 1O3DA 2Q6DA 5B6OA 1G37A 1TNJA 3L6PA 5C1UA 4X6MA 1SVPA 5J4QA 4JMYA 4JZ1A 3TNSA 1O2TA 2GX4A 5C67A 2J38A 2V3HH 1C2FA 1TGNA 2OQ5A 1A7SA 4UD9H 1P12E 2HWLB 2FLRH 8LPRA 3UWJH 3OSYA 1AE5A 1IQGA 1GMHF 3UIRA 1C2KA 3F68H 3MU0A 3E0PB 1QL7A 1UTOA 4MNXA 2VWMA 4WH8A 1D3QB 1ZOMA 1UHBB 1NO9H 2H2ZA 2A5KA 2Z9IA 4B2BA 2AGIX 4WJG2 1GBLA 1HLTH 4CRGA 1ESTA 1C9PA 1THSH 2OC1A 2OC8A 3TU7H 1L2EA 3U69H 1W11U 1C1UH 1GDUA 1TAWA 4LZ4B 4K69A 1GHZA 4PROA 1HB0B 2VNTA 2CV3A 1IQEA 3TPIZ 3QGNB 5E2PA 2AMPA 1K9OE 2PKAA 4LZ1H 3RM2H 2ZCHP 1O3EA 4WVPE 2FOCA 3M61U 2XBVA 4NA8A 1K21H 1LPGB 2W7SA 1LQDB 3LPRA 3DFJA 1AKSB 2A4GA 3LGVA 3SU0A 1GHBG 4GSOA 1RIWB 1A5GH 3SORA 3UFAA 4ZXXH 2GCTB 4KKDA 1LPKB 1C1OA 3LIWA 4I8GA 4Y71A 5C5OA 2HOBA 2H9HA 3FANA 4Y7AA 2ALPA 5GCHG 1TIOA 2SGDE 1Y3YA 1DDJA 4Y8YA 1T32A 3A8CA 1O5DH 2ZIQH 4TY7A 3KEEA 3GCHC 2LNCA 1DWCH 5EG4A 3UOPA 4X1NU 1GBHA 2XBXA 3LONA 1IQKA 1XVOA 1NZQH 2ZDKA 2F9OA 4JYTA 4O9VA 3MU4A 5I46H 5T6GA 1KXDA 2OD3B 1FAKH 4KGAA 1K1OA 2DE9A 3KHVA 1NS3A 1YPHC 2OBQA 1QGFA 1GJCB 1FPHH 1EX3A 4BXWA 5JYIA 1ELEE 2ESTE 3NUMA 3ZVFA 2BQWB 1H8IH 1MQ6A 1SGTA 1Y3XA 1RFNA 5E0JA 4RN6A 4K1SA 4AN7A 4MPUA 2XC5A 4TYDA 1P01A 4DY7B 3CS7A 4AYYB 3STIA 3CENA 1G3EA