1BITA

The crystal structure of anionic salmon trypsin in a second crystal form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
222
structure length
222
Chain Sequence
IVGGYECKAYSQAHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of anionic salmon trypsin in a second crystal form.
pubmed doi rcsb
source organism Salmo salar
molecule tags Serine proteinase
total genus 55
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bitA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bitA02
1NT1A 4INHA 1GMCF 1RTKA 4U32A 2H5CA 1JBUH 1FZZA 2I6QA 2JH5D 1W0ZU 2SNVA 5AVDA 4MG3A 1P12E 4IS5A 3SU1A 1XUJA 3ODDA 4B2BA 2XNIA 2Y7XA 1PQ7A 1UVUH 1NRPH 3U1JB 1FAKH 1O3DA 1TGSZ 1O3FA 2VH6A 1XM1A 1A5HA 1SC8U 4H6SB 3VB4A 1L4DA 2G5NA 2GZ9A 3MH6A 5EW1H 3RP2A 1NRNH 2RA0A 1K9OE 1ETRH 4I8LA 1HJAC 2ANYA 1MBQA 2AEIH 2AMPA 2A7HA 4TYDA 3TVJB 5CHAB 5DP9A 3MFJA 1QRZA 3EYDA 1TA6A 3Q3XA 1ELVA 2STBE 1OPHB 3ZVCA 1AN1E 5SGAE 1F0UA 3VGCC 4JYUH 3WY8A 3SHAH 4CR5A 1FV9A 5T6GA 2BDBA 1DOJA 2UUKB 1O2WA 1HAVA 3BN9A 1A3BH 1TMBH 1C1RA 2NU0E 1V2TT 1NZQH 4Q7YA 1W2KH 4NWLA 1QRWA 2AMQA 3W95A 2FO9A 4X2YA 4K69A 2C8WB 1PPBH 2BX3A 3UNQA 3M5MA 1KXAA 4YOJA 1KYNA 1S82A 4OS2A 1BHXF 4BAKB 4XOJA 1O3GA 3GOVB 5G4BA 1O3EA 1O5EH 1ETSH 1UVPA 1HBTH 2HOBA 1FLEE 2NU3E 4KP0A 3U8OH 1NRQH 4WMDA 4DIIH 4AGJA 1TB6H 1IQMA 3LH1A 1TX8A 3RXEA 3SORA 7LPRA 1GBTA 2FOEA 1ZMNA 2ZHWH 1UK2A 3T29A 1ZPBA 2BTCE 3ZVAA 1EJMA 1ZRKA 1V2PT 1G36A 2FYQA 1C5ZB 3GY8A 2PKAB 1Q2WA 3LIWA 1OXGA 3VB7A 3RXVA 5DPAA 4HTCH 4GVUA 1O3PB 2GGVB 1CA0B 4MNWA 1SGRE 1K1IA 3KEEA 2XXLA 1TBZH 4CRGA 1KSNA 4K8BA 1O35A 4MDSA 1BDAA 1CU1A 1GJAB 1WSSH 5T6DA 3S69A 2C93B 1HIAB 4MPVA 5LPEA 5A0CA 1O2TA 1ZHRA 1FONA 4CRFA 2PR3A 2P95A 3TJNA 1FQ3A 4WH6A 3ZV9A 1A4WH 5TJXA 4FU8A 5GDSH 5B6OA 1BUIA 1UCYH 1ZOMA 2G81E 2ZU5A 3ITIA 3RXLA 1O2HA 1ETTH 1QHRB 1LVBA 3MH5A 4HGCA 5C2ZA 1ZTJA 3SGAE 1L1JA 1O3JA 1EZSC 1L4ZA 3KIDU 2FP7B 5EPYA 3MOCA 3BTHE 1GG6B 1J9CH 1TYNA 3GCHB 2TIOA 3KL6A 1BZXE 1QURH 1WYKA 1KDQA 3BTEE 2ZGCA 1C1WH 3GYLB 3SV7A 1HAXB 1ESBA 1F2SE 1HFDA 4X6PA 3RXUA 1XVMA 2TRMA 5A09A 1AZ8A 1CSOE 2O8WA 3HK6B 4Y11E 5EXNA 4WY3A 1KXDA 1NROH 2AFQB 2A4GA 4FUGA 5L2ZH 5DP6A 2QXGA 2G51A 4RN6A 5C1XA 1C5TA 3N7OA 2R9PA 4K8YA 5EXMA 1FI8A 3QTOH 4AB8A 3ODFA 4ZKOU 1HV7A 5F6MA 1WU1A 4ZXXH 3TK9A 2XBWA 2PGQB 2P3UB 3PMJA 3UPEA 2EEKA 4FU7A 5I46H 4ZAEA 1THSH 2BB4A 1TNJA 1XUKA 2VIPA 4Y10E 2ZPRA 2G5VA 2FX6A 1LVYA 1EZUC 1C2IA 3ZZBA 1ABJH 1L2EA 1BMMH 3RXQA 1O39A 3SOSA 1ANBA 1O2ZA 1OS8A 3PLKA 2Z9GA 2ZCHP 4JK5A 2BLQA 4NG9H 3QGJA 2ZHFH 1K22H 5E0JA 1P2IA 1QJ1B 1C2MA 1PPZA 1GHWH 4X6MA 1V2VT 4WWYA 5GWZA 4THNH 2WPMS 1ZGVA 2SFAA 5J4SA 4I8GA 1Z1JA 3PO1B 1ESTA 3ENSB 2R2WU 2VGCB 3VXFH 1TOCB 1GMCG 3A8AA 1EPTB 1HUTH 1JWTA 3FANA 2ANMH 2VVVA 1BB0B 1CBWC 1O3LA 3LGVA 1TE0A 2V6NA 1AO5A 2Z7FE 4XFQA 1B7XB 2WYJA 2ZU2A 4Z0KA 1P2JA 1YLCA 1UTOA 1W13U 4X1PU 3QK1A 3V7TA 1DT2A 2XWAA 3A84A 3LDXH 1TWXB 1SGQE 2VNTA 3ATLA 2GDDA 2BZAA 4OGYA 2HALA 2F9NA 2XCFA 1CHGA 1O5BB 2Z3EA 4K1EA 4KTSA 3B8JA 2WPHS 4O9VA 1MD8A 3BG8A 1DICA 3LU9B 3SNDA 3RXDA 4K2YA 2TGPZ 2BD5A 3TGIE 3SV8A 1YYY1 2GTBA 1T4VH 2NU4E 5FX6A 1QL8A 2J2UA 1MZAA 3OYPA 2CGAA 1UCYE 1V2QT 5HM9A 1Z6EA 4O3TA 1MD7A 1DWBH 3C1KA 3MH7A 2ZWLH 6CHAB 1P8VC 2OCVB 4B75A 1GGDB 3FP8E 1P0SH 3SZNA 3NPSA 2VWLA 2F9UA 1E34B 4Y0ZE 1SGDE 2YNAA 3RXFA 4IN1A 1VITG 2FPZA 4FUIA 5FPYA 4CH8B 1HJ9A 1AWFH 3O8RA 2FOBA 6ESTA 3SNCA 1W10U 3RC4A 5HGGA 3GY5A 3T26A 4JZDH 2BYAX 1GBCA 4YOGA 4SGBE 3M5NA 3BTQE 2ZECA 2G52A 4GPGA 3SU3A 1QQ4A 3LJOA 1K1OA 1BCUH 2ZPSA 1SB1H 4IN2A 1GI6A 4AFSA 1T4UH 1SLWB 1ELDE 1FY3A 1NFWA 2FOCA 1ELCA 2XRCA 5FHTA 5EQRA 1OKXA 1FPHH 4K3JA 1O2QA 2KAIB 1O30A 1KTSB 1ZSLA 2ODYB 3EQ0H 2BD3A 3AAUA 2CN0H 2A45B 1ZZZA 4NFFA 4X1RU 1GJCB 1K21H 3TH4H 2DE9A 1DM4B 4OS4A 5EODA 1QTFA 3JZ2B 2QCYA 2VWOA 2VWNA 2ZHDA 3SGQE 2PLXA 4OS5A 1YCPK 4TWYA 1NU7B 1S85A 3E91A 4ABJA 4BTIB 2SGFE 3TITA 2QXHA 2XWBI 4A1XA 3SNEA 1LPZB 1P2MA 2G4TA 2TGDA 1GBJA 5DKMA 2O8UA 2Y5HA 3S0NA 3Q76A 4ABGA 1O5DH 1GPZA 3LOXA 3RDZA 1DWEH 2M5TA 1QA7A 4NFEA 1UTLM 1UTJA 2P59A 3UWJH 4AB9A 5JYIA 2Q6DA 1B5GH 2FS9A 3ATKA 2PTNA 2A4OA 2FDAA 1Y3UA 4CREA 1Z8JB 4UE7H 2BDHA 5ESBA 2PUQH 1AFEH 3ATMA 1O3HA 3G01A 3TJOA 1C2LA 1ZTKA 2CV3A 3U69H 4CRDA 3SHCH 1A61H 1AZZA 1XMNB 2PFEA 3STJA 3RMLH 1ARCA 3RXKA 4BTUB 1OYTH 4YOIA 3LGYA 3M7UA 4HZHA 4PROA 1VCQA 3RU4D 3D49H 4GLYA 5DO4H 2BVSH 1TMTH 1QCPA 2WPLS 4TY7A 3F9HA 2PKSC 2H5DA 5GPIB 2W3IA 1O33A 2ZTZA 2WPJS 1LHFH 2BVXH 1C1NA 2Z9IA 1HRTH 1ANDA 1O2JA 3GDVA 4X6NA 4E7RG 4K5ZA 3U9AH 2XBVA 3SUFA 4CBNA 1RRKA 1KLIH 1WAYB 2F9PA 4JZFH 4BXSA 1C5XB 1GHBF 1YPLH 1RIWB 5F8ZA 5J4QA 1FJSA 2HVXA 2ZZUH 2GV7A 1GI9B 3P17H 2A32A 3SV9A 1AWHB 1A0JA 2F9OA 5FCKA 1HLTH 1TPAE 4WMFA 1BTYA 2JETC 4ESTE 3FZDA 4ABHA 1WTGH 1G9IE 1SQAA 1AHTH 5EQSA 1HAOH 1VGCC 3QGNB 2FI5E 2FLBH 1C2HA 2ODPA 4R0IA 4ZKRU 4FUEA 1V2OT 4UEHH 1AB9C 3DT0H 4Y8YA 3MO9A 1GJ5H 1ZPZA 1DXPA 1BBRE 1DANH 1BT7A 2UWPA 1BRBE 1FY4A 4AORA 1O2PA 1ZHPA 1P3EA 1OWHA 1A5GH 3RMOH 1AFQC 1VJAU 2BM2A 3MU4A 3O8CA 2QN5T 1QNJA 3ATWA 2P94A 3M35A 1UVOA 3OSYA 1O3KA 4OS1A 3RXJA 2CHAB 1OWDA 1MKWH 1U6QA 2D1JA 3A89A 2WPKS 3SBKA 1FIZA 1KXBA 2HPQH 1HGTH 2HGTH 1SG8B 1XKBC 1MKXH 1WUNH 3UR9A 2Z3DA 2O8LA 1ZGIA 1GHAG 3A7ZA 4NSVA 3A85A 3M36A 1ANCA 1C5QA 2RA3A 4MVNA 1E38B 1TBQH 1MTUA 1H8IH 1DDJA 3VB6A 1H8DH 3GDUA 2RG3A 1EJAA 4SGAE 4GCHF 4X8SH 1H1BA 1P05A 2BQ7B 1UTNA 4B74A 3IG6B 3BSQA 1N1LA 1XXDA 1E36B 4GAWA 1EXFA 1Y3XA 2VIWA 3HGPA 2BD9A 1MQ6A 1KLJH 3KHVA 4MQAA 3MI4A 1XKAC 4JZEH 3PWBA 3K6YA 5DP7A 5JDUB 1O2GH 1H9IE 1GBBA 2SGEE 2XW9A 5ETXA 1GBLA 1N8OB 3UIRA 5T3HA 1W11U 2GMTC 1ELGA 3QX5H 2QXIA 1MH0A 1V2NT 4AX9H 3TPIZ 1SGTA 3W94A 1SGEE 1O2OA 2BD2A 4K1SA 5AFYH 1THPB 5JBCS 1L0ZA 1CGIE 1P10A 1NTPA 2CF9H 2ZTXA 1KXFA 4ZKNU 4Q2KA 4TWWA 3LJJA 1W7XH 3MTYA 3BIVH 5EW2H 3ZZDA 3DFJA 1Q31A 2GDEH 4HI3A 2QIQA 3HK3B 1ZPCA 4NIYA 1OP2A 1FN6A 1MKWK 5HXFA 1B0FA 1LCYA 1ZRBA 3ZZ7A 6LPRA 1C5UA 3AVZA 3UUZA 3RXMA 2FOAA 4FUCA 4YM9A 1GHXH 1XXFA 2HRVA 1FUJA 2BDGA 1D6RA 2AGGX 3F6UH 4TPIZ 3BG4B 1UHBA 2BD7A 4DGJA 1OWIA 2OC1A 4LXBH 3UFAA 5HMAA 2FIRH 1FY5A 1SHYA 3RU4T 1BRUP 4ISNA 3RXSA 1FNIA 2ZQ1A 2ANWA 4Y76A 4DY7B 1BTHH 5FX5A 2C4FH 2GCTC 1D9IA 3CP7A 1ELBA 3ZVEA 4XE4A 3SJOA 1SL3A 5C5OA 2EI7A 3RC5A 1FAXA 3SV6A 3JZ1B 1EX3A 1QBOA 1DXWA 1RD3B 1AVXA 1O2MA 1XUFA 2O8MA 2TBSA 4NIXA 4A7IB 2FLRH 2PW8H 2ZHQH 3F1SB 4CH2B 3ZZ4A 1D3PB 2AIQA 4O3UA 1O2LA 4TPYA 3VEQB 1KXEA 3SW2B 5A2MH 1JXPA 4INKA 2BQ6B 3A83A 3SV2H 1B0EA 5BRRE 1AUJA 1EAWA 1NRRH 1SOZA 1GVLA 1GCTB 4CBOA 2SNWA 5CMXH 1A0LA 1O37A 3RM0H 3CENA 1F92A 3PWCA 1RJXB 2PSXA 4YTAA 2BY5X 2BLWA 2BLVA 4AZ2B 4J2YB 1LHGH 3I77A 1C2EA 1P2QA 4O97A 1ZLRA 2WUCA 1OSSA 2UWLA 4DCDA 4MPUA 9LPRA 4GHQA 4IMZA 1NY22 3LPRA 3M61U 1KXCA 1DPOA 4BAQB 2FESH 4FU9A 1SMFE 3EA7A 4AGKA 1BMLA 1HIAA 2ANKH 3RXRA 1SGPE 3BTGE 5E2PA 1O3NA 1JIRA 4GHTA 3R3GB 2ZGHA 1FPCH 2PTCE 4RSPA 4A1VA 1ABIH 1N6XA 2J9NA 3QO6A 1MCVA 1BIOA 4BAOB 2VIOA 3H7TA 1PYTD 1EAUA 1KDQB 2ZDAH 3SJKA 4B76A 7GCHG 1W7GH 3SNAA 1YPKH 4HFPB 4NZQA 1S0QA 2BDIA 2ZFFH 3TU7H 5F8XA 1K1NA 1V2WT 4AG1A 2ZDVH 3F68H 1VITH 1NO9H 1A1RA 1O31A 1EZXC 2VINA 4XBCA 1MTNB 1PQAA 1HAYB 1MU6B 1CT0E 1C1VH 2ZCLP 3ZVGA 3M3VA 1UTQA 3AASA 3U8TH 1E35B 1QB6A 1RFNA 3MU5A 1O34A 3PMAB 3RXAA 2UUFB 1FY8E 4ZHLU 1NFXA 1GVKB 2GV6A 1DUEA 1PPGE 3NKKA 4OS7A 3UTUH 1GI5A 4GCHG 4ZHAA 3NWUA 4F4OC 1TNKA 5I25A 2ZEBA 1C5VA 3SUEA 4VGCC 1O5FH 1VCWA 2EA3A 1BHXB 1ELAA 1GI1A 3P8NA 2ALVA 4AG2A 2BD4A 1ELEE 3MNCA 1GJDB 3RXHA 1GHVH 1O2YA 3BF6H 4DOQA 1GHYH 4ABIA 1D3DB 4AOQA 3E16B 1AUTC 3ESTA 4FUHA 3MNSA 3UNRA 1O3IA 5TCCA 4Y7BA 3ZYEA 2GX4A 1HAZB 3URCA 3TGKE 2V0BA 1YKTA 4D9RA 3SJ8A 1GI4A 1QB9A 3Q3KA 1E0FD 3IWMA 1SI5H 4MNVA 1WV7H 4K60A 1T31A 2OLGA 2ZU4A 2VIDA 2ZGJA 2I6SA 1ARBA 1AQ7A 1EP5A 2FOGA 3A88A 1F0TA 1FN8A 1UCYK 2F3CE 2H9EH 1Y3WA 3RLWH 1SOTA 1RS0A 4JYVH 2QXJA 4X2XA 4JK6A 2VJ1A 5F8TA 2BOKA 1C5WB 3VB3A 1GBFA 4Y6DA 1HJ8A 3SO3A 3LGWA 1BJVA 1CGHA 1O2NA 1P02A 2HNTE 5LPRA 3MHWU 5DP4A 4WF8A 3E8LA 1J8AA 1ELTA 2Q1JA 2R2MB 5L30H 1EASA 1TLDA 2OP9A 1W0YH 2QAAA 2O9QA 1CGJE 4YO9A 2ASUB 4DG4A 8LPRA 2P8OC 4OGXA 5E0HA 5E8EH 3M37A 1YC0A 1LQDB 1ACBE 1D3TB 5K0HA 1F5LA 3AAVA 1A0HB 1ZYOA 1GMHF 2BQWB 1XVOA 2SGQE 2Z9KA 1LPGB 2A0QB 4JZ1A 3MNBA 1GBEA 5GIBA 2C3SA 1HJAB 2VWMA 1T8NA 2ZDLA 1ORFA 3T62A 1JMOH 2ZGBH 2FZZA 1Z8GA 3KCGH 6GCHF 3UQVA 3MU0A 2QC2A 3BTTE 1P09A 4K1TA 2H2ZA 2FX4A 1UK4A 3D23A 3SQEE 1OWEA 3OU0A 2B9LA 1GJ9B 2ZU1A 3VGCB 3GCTF 2G00A 3LH3A 4JZIA 1HCGA 1PQ5A 1LO6A 5FXLA 2YOLA 1IQLA 1EKBB 1IOEA 4ISLA 4XSKU 2F9VA 2VIVA 3PM3A 3GDSA 3Q77A 2SGDE 2FWWA 2QA9E 3LGTA 4NCYA 1O32A 3UR6A 1XUHA 4NIWA 1TAWA 1EATA 1SR5C 1BBRH 3A7WA 1N8OC 5C1UA 1AVGH 4JMYA 3ELAH 2AMDA 1TONA 1Z8RA 3PROA 5BPEA 1BTXA 1CE5A 1YPEH 3DD2H 1HAPH 1HAGE 1QL9A 4I31A 8KME2 4X1QU 1C4U2 3QLPH 3UOUA 3PLBA 3RMMH 4UD9H 2BD8A 2G8TA 2W26A 4ABDA 1IQEA 3SJ9A 1GJ4H 3RXCA 4Y7AA 4ZHMU 4BAHB 3GICB 2KAIA 5AFZH 2H9TH 1TPPA 1YLDA 1ZHMA 3PMBB 2FEQH 4KTCA 1CA8B 5A8YA 1SFIA 2A1DB 5DP3A 3DFLA 4A1TA 1C2FA 8GCHF 8ESTE 1PPEE 2FI3E 2ZDMA 1ZTLA 2CF8H 4BANB 4JCNA 4NSYA 1T8LA 2UWOA 2XBYA 3PMHB 5FPTA 2VB0A 3SQHE 5CHAC 1MAXA 4D76A 1O2IA 4D9QA 1GJ8B 3DUXH 3HGNA 3E1XB 3NXPA 5JB8S 4ZXYH 1NM6A 2R0KA 4ZKSU 1GMDF 2FTLE 4AYVB 4ZMAH 1C1TA 1UTPA 1MUEB 1SBWA 2OC8A 3ZZCA 1AKSA 2THFB 2ZFPH 4ABBA 1IQNA 5PTPA 1P2OA 3A7VA 1RGQA 3LKWA 3BIUH 1L1GA 4FVDA 3H7OA 4X2VA 5FAHA 1LQEA 2ZI2H 2B7DH 3S7HB 1V2JT 3ZZ3A 1CT4E 1LVOA 5ESTE 4LZ1H 1C5RA 3I78A 2OC7A 2OQUA 3MMGA 3D62A 1AY6H 1BOQA 3PTNA 2BY7X 1NESE 2A2QH 3GCOA 1MQ5A 1TABE 5T6FA 3A86A 5EQQA 3P70B 4MNYA 1S5SA 4I32A 3E6PH 1TNLA 4NWKA 1BBRK 1PJPA 4DVAU 1ZR0A 4I33A 1DLKB 2A7CA 2BXUH 2EI8A 2WV4A 2ZIQH 2ZNKH 1T8OA 3R0FA 1C1UH 1TNIA 4KGAA 2PGBB 3A8DA 4U30A 3S9BA 1CA0C 4I8JA 4B2AA 1Y5UT 3F9EA 2AGEX 2OXSA 1Z6JH 4FUBA 2R0LA 1ZMLA 1GDQA 4Q80A 1W12U 1Z8IB 3M7TA 4LZ4B 2OBQA 1O2VA 4WJG2 1JOUB 1SQTA 2OC0A 3KQCA 1O3CA 2GT8A 5DK1A 1TFXA 1Y8TA 4WVPE 1KLTA 3RMNH 5EGMA 2HNTC 3HKIB 1OP0A 2A4RA 3QDZB 1ZMJA 2IN2A 4XBDA 3GYMA 3EGKH 2A5KA 3QZQA 2OINA 3AW0A 1NU9A 5L6NH 2C8ZB 1UO6A 2ZFRH 3ZZAA 4BOHA 2J34A 2BY8X 5DJ7A 1IQIA 5AF9H 3M5OA 1HAHH 4DJZB 1IQKA 1NFYA 1YM0A 1G37A 2STAE 2AS9A 1XUIA 1GG6C 1H9LB 1C2JA 3GCHC 2JH6D 1F5KU 3P95A 5AHGH 2ZFSA 4R8TB 4NIVA 1DSTA 3AW1A 4E06H 1CHOF 3SN8A 2A31A 2W5EA 1WTHD 2P3FH 2VH0A 5A8ZA 4X8TH 3K6ZA 1BMAA 1TRMA 4CHAB 2TPIZ 2AGIX 3UY9A 1EB2A 4F49A 1WOFA 1T32A 3LGUA 3P8OA 1C5LH 1XUGA 2A5IA 2Q6FA 1IQJA 2XCNA 3QZRA 2F9BH 4ASHA 3C27B 4Y79A 3LT3A 2AERH 3BTKE 3MO3A 2NU1E 1C1QA 1EB1H 1QB1A 1T8MA 3QTVH 3URDA 1IHSH 2Y5GA 2J4IA 4ZROA 1C9PA 2W7UA 3E0PB 1G2MA 1S81A 1FMGA 1Y3VA 3MWIU 4UFGH 3UQOA 2FMJA 3A7YA 3V3MA 5C67A 1AE5A 3BEIB 5F03A 1NC6A 1O3OA 1OWKA 1SVPA 2OUAA 2WPIS 4YLUA 3ZYDA 5GXPA 3HATH 2BXTH 3V0XA 3SUDA 3KNXA 5HM2A 1OOKB 4B71A 1AD8H 1SGFA 1C1OA 1AIXH 1Z7KA 1HNEE 3ZVBA 1V2ST 1OWJA 1AE8H 5ABWA 3PO1C 2BZ6H 2GZ7A 2FXRA 1V6DA 2Z9LA 2FTMA 3S7KB 1GI7B 2VGCC 2ZDKA 1V2KT 2RCEA 4A92A 1EPTC 1TRYA 1Z71A 3E90B 3CS7A 1BTWA 3RLYH 3BTFE 3VPKA 3L6PA 1YF4A 4D7FA 1O2KA 3T2NA 1GDUA 1DY8A 3GY6A 2RDLA 1GJ6A 1UVTH 3BTWE 3KF2A 2FOHA 3OX7U 4B73A 1MMJN 1P57B 2ALPA 1L1NA 2ZC9H 4YLQH 1A46H 3RU4E 2BVRH 3V12A 1Y5AT 3BEUA 8GCHG 2HNTF 2V35A 3U1IB 1SSXA 1TOMH 1JRTA 4JYTA 1SGIB 1NFUA 5TCAA 3TNSA 2ZHEH 1GI3A 1MTSA 2Q6GA 1FIWA 3EAJA 2ZU3A 3MH4A 3RM2H 1DVAH 3ATIA 1HXEH 4AFUA 1BQYA 2HPPH 2WV5A 1DE7H 1WCZA 2BLOA 2FYRA 3VXEH 1O36A 4KELA 3SJIA 6CHAC 1JIMA 1MKXK 1GGDC 1W14U 1GMDG 3ZVFA 3SU6A 2ZG0H 3B23B 2ZCKP 1NS3A 4CRCA 1P2NA 1QY6A 3GY2A 1UHBB 1HAVB 3GISB 1TIOA 1EJNA 1GJBB 1K2I1 2BDCA 2OTVA 4Z6AH 1YPHE 4BXWA 1YPJH 1EP6A 1M9UA 1W3CA 3A81A 1O5AB 1ANEA 2D26C 1P01A 2AIPA 3STIA 2FODA 3CS0A 2Z94A 3TJVA 5DP5A 7KMEH 3UNSA 2VVUA 3P92A 4LK4A 3O8DA 2BY6X 1EQ9A 1HB0B 3OY6U 4ZH8A 1PPHE 1VITF 5JBBS 4BAMB 1NN6A 2G55A 1G32B 1K1MA 3SUGA 3P6ZB 1PPCE 1G3CA 3SI3H 1J15A 2H6MA 5C20A 2R3UA 1BTZA 1CT2E 1SGFG 4AFZA 1GHBG 1SGYE 3RXTA 2HWLB 3QWCH 1UMAH 5FBIA 1V2LT 1O3MA 2J92A 1C1MA 2R3YA 3HPTB 2QV1A 1EOJA 1EUFA 2PKSB 2GP9B 1G30B 3SU4A 1S0RA 3HKJB 4UDWH 4Y8ZA 2AYWA 5E0GA 3NCLA 1Y59T 1LKAA 5EPNA 1C1PA 1VR1H 2CJIA 1OP8A 5FBEA 5GCHF 2PKAA 3Q00A 3UWIA 4IGDA 1ZJKA 1SGCA 2PV9B 4NZLA 1O2RA 4X1NU 3RUOA 4IC6A 4U2WA 1UTMA 4RKJB 1RTLA 5E2OA 2JETB 2YNBA 4XDEA 4B1TA 1MBMA 3FP7E 4BTTB 3K2UA 2OBOA 2GZ8A 1VGCB 5CE1A 1UJ1A 2C8XB 2OQ5A 1F0SA 1SLXB 4YZUA 4ISHH 1AB9B 4YT6H 2C90B 1CHOG 2PHBA 5IDKA 2XBXA 1G3DA 1GBIA 3KN2A 2FOFA 2ZP0H 4NA9H 1C5OH 2F91A 4CR9A 2IJOB 1IQHA 1DFPA 1O5CB 3GCNA 4WXVA 3DA9B 2VVCA 1EAIA 3A87A 1CO7E 4WMEA 2A2XH 1G3BA 4X8UH 4NGAH 1HDTH 1SGNE 1AFQB 1P06A 2ZF0H 1F7ZA 2W3KA 3UREA 1GBDA 1O2SA 2AH4X 4TY6A 4Y71A 2VIQA 4MNXA 3ZZ9A 2FI4E 1GBAA 3O8BA 1X7AC 1TMUH 2Z3CA 1C9TA 4H42U 2PWXA 4X0WU 1AVWA 1O2UA 1SFQB 4AYYB 1DX5M 1C4Y2 1PPFE 1ZJDA 1MAYA 4ABAA 1RIWC 2Y81A 9ESTA 1YPMH 1J14A 4MPXA 1WQVH 5JBTA 1SPJA 3TLOA 1A3EH 1LDTT 1C4V2 1SLUB 4ISIH 4X2WA 3A7TA 2ZPQA 1GBKA 2W7SA 1C2KA 2GD4B 2XC5A 1DS2E 3FAOA 1P2KA 1LPKB 1FDPA 3A8BA 2Z6BD 3E0NB 1VZQH 4LOYH 1EZQA 1H4WA 1QR3E 2ZDNA 1TBRH 3GY4A 2ZA5A 5JPMH 2WINI 5EG4A 4J1YA 1IQFA 1P04A 1LHDH 5FCRA 1S84A 3T25A 1E37B 5LGOA 2EC9H 4FUDA 3SNBA 1MTVA 4ZUHA 2B0FA 3MYWA 1EPTA 3FVFB 1TX6A 2GMTB 3A8CA 5DGJA 1TGBA 2ILNA 1ID5H 3KGPA 5EOKA 1SQOA 2Z9JA 4CHAC 3SI4H 1YCPH 2CHAC 1GI2A 3TK5A 2FM2A 4MPWA 2K1QA 1P3CA 1YPHC 3V13A 1O3AA 4CRAA 1YBWA 4AFQA 3KQBA 4X1SU 3TH2H 2P93A 4NA7A 5IYTA 4CRBA 1D6WA 4A6LA 1AGJA 2ZGXH 1TX7A 3T5FH 1OX1A 1YPGH 5DG6A 5C3NA 3E3TA 2QYIA 1P11E 1V2MT 1TGCA 4Q7ZA 1YCPM 2IPHA 4UONA 2P16A 1IAUA 4QT8C 4FUFA 4UFFH 2ESTE 4FVBA 2Y7ZA 3F9FA 1BRAA 3S9AA 4I7YH 3OTJE 2G4UA 3U98H 1O38A 1FY1A 4OS6A 2OD3B 1IHTH 3BV9B 1TRNA 2O8TA 2CMYA 4H6TA 1GHAF 3K9XB 1QQUA 1LTOA 2NU2E 4DIHH 3PB1E 2DE8A 2CXVA 1BMNH 1YGCH 3FFGA 1PQ8A 3F9GA 3MNXA 1O3BA 1C5YB 2H9HA 3M3TA 4M7GA 1CVWH 1GDNA 2BY9X 1GCDA 2BMGB 1EOLA 2GCTB 1DITH 1KTTB 1QRXA 4ISOA 4FXGH 1GWAA 5DP8A 2WYGA 1QFKH 1NRSH 4IC5A 3RXOA 3RXGA 3D65E 2DUCA 3GY3A 3T27A 2ODQA 2GVFA 4IBLH 2ULLA 3QUMP 2D8WA 4I8HA 1DWCH 1J16A 1RXPA 1AU8A 2NWNA 1YP9A 3DHKH 3KQEA 2UUYA 1GBMA 1ESAA 1C5SA 2TGAA 4KTUA 5GCHG 5EXLA 2GCHF 1GI0A 1Z1IA 2UUJB 2QGRA 4UFEH 1UVSH 1TPSA 4Q7XA 2ZQ2A 4BNRA 1P03A 4WH8A 1WBGB 1GBHA 2Y82A 2ZO3H 1C2DA 2V3HH 1UTKA 5K7RA 1HPGA 1Y3YA 2TGTA 4Y0YE 1BA8B 2XC4A 1ZSJA 1VJ9U 3RC6A 1RTFB 3EA8A 4AN7A 1QIXB 1QBVH 1GL0E 4IW4E 5C1YA 4X6OA 2GKVE 4DURA 3EE0B 4Y8XA 5C5NA 3BG4C 1BTUA 1AKSB 3PV4A 1J17T 1HYLA 1BRCE 3SGBE 3BTME 1QBNA 1TPOA 3S9CA 1Q3XA 2C8YB 2V3OH 3L3TA 3TIUA 3M7QA 4YESB 3SU5A 2BOHB 1LHEH 2B5TB 5GJ4B 1C5MD 1P9UA 3ZZ5A 2XYAA 1LVMA 4A5TS 2VU8E 4U01A 4XBBA 1AI8H 5A0AE 2LNCA 2SGPE 2B8OH 1A2CH 3EA9A 4INLA 1OYQA 2D2DA 3TH3H 2ZFQH 1MCTA 1Y5BT 2ZKSA 2J94A 4IMQA 2P3TB 1QL7A 1V2RT 1C1SA 3L33A 4WXIA 2IOTA 2PSYA 1MTWA 1S6HA 2FOMB 3NZIA 4X8VH 5JBAS 2A4QA 4B2CA 1GCTC 3FZZA 1TNGA 1C5PA 3PTBA 1K1PA 1V2UT 5LH8A 2A7JA 1K1JA 2QF0A 3A80A 3EDXB 2BDAA 2QF3A 1O5GH 4KKDA 4ABEA 4GUXA 5EU8A 1TQ0B 1S6FA 5L2YH 4VGCB 1SLVB 1G3EA 4GSOA 1K28D 3A7XA 1MZDA 4O03A 3A82A 1XX9A 3P8FA 3PLPA 1HXFH 2J95A 3SU0A 1VCPA 1ELFA 1G2LA 1V3XA 1LMWB 2JH0D 3TNTA 1DWDH 3GY7A 3BTDE 4ABFA 7ESTE 1JRSA 5A0BA 4I8KA 5H4IB 1KIGH 1KY9A 3RXPA 3NK8A 1FXYA 3RXIA 1QA0A 3P8GA 3NUMA 1MU8B 1HAIH 5FPSA 1DUAA 1T7CA 3ZVDA 2BHGA 3UOPA 1CBWB 5JB9S 3LGIA 2HLCA 1WQSA 5LPFA 1DSUA 1PFXC 1DLEA 1BITA 2XTTB 3OY5U 3I29A 1INCA 3TK6A 3U8RH 5HYOA 3VFEA 1CQQA 2Y5FA 1GMHG 2ZFTA 5A8XA 3MU1A 3TGJE 1EAXA 4YT7H 1MTNC 3MU8A 1TGNA 4H4FA 2PUXB 1GI8B 4DW2U 2BX4A 4D7GA 7GCHF 3KQDA 3QN7A 1P9SA 1H9HE 2XC0A 2P8OB 6GCHG 1A5IA 3ZZ6A 2A5AA 3MO6A 4D8NA 4MTBA 2FS8A 1IQGA 1SHHB 1DY9A 3GCTG 1QGFA 1PYTC 1LHCH 2GT7A 1O0DH 4RKOB 1TALA 1W8BH 1C5NH 1GJ7B 1GVZA 3H5CB 2QY0B 3ZV8A 3T28A 1LKBA 1QJ6B 1TA2A 2ZTYA 1BJUA 4E05H 1AMHA 1BTPA 1GHZA 2JKHA 2EI6A 3B9FH 4NA8A 3SU2A 3LC3A 1QJ7B 3M3SA 3LONA 4FUJA 3PYHA 1F5RA 3M5LA 1C2GA 4E7NA 2Y80A 1D4PB 3TJUA 2Y6TA 1TQ7B 3VB5A 1NPMA 3Q3YA 2SGAA 1F0RA 1GL1A 1A7SA 3FP6E 4MLFB 1THRH 3RXBA 1UK3A 2F83A 2H1UA 2WUBA 3LC5A 1ZSKA 2J38A 1N6YA 4UFDH 3BEFB 1TNHA 1S83A 1D3QB 3K65B 3ZZ8A 2BDYA 1O2XA 4DT7B 2GCHG 2LPRA 3IITA 1TGTA 1K1LA
chains in the Genus database with same CATH superfamily
1NT1A 4INHA 1GMCF 3F2FA 1RTKA 4U32A 2H5CA 1JBUH 1FZZA 2I6QA 2JH5D 1W0ZU 2F4LA 2SNVA 5AVDA 4MG3A 1P12E 4IS5A 3SU1A 1XUJA 1W0JD 3ODDA 4B2BA 2XNIA 5HKKD 2Y7XA 1PQ7A 1UVUH 1NRPH 1UW7A 3U1JB 1FAKH 1O3DA 1TGSZ 1O3FA 2VH6A 1XM1A 1A5HA 1SC8U 4H6SB 3VB4A 1L4DA 2G5NA 3PRDA 2GZ9A 3MH6A 5EW1H 3RP2A 1NRNH 2RA0A 1K9OE 1ETRH 4I8LA 1HJAC 2ANYA 1MBQA 2AEIH 4HG6A 2AMPA 2A7HA 4TYDA 3TVJB 5CHAB 5DP9A 3MFJA 1QRZA 3EYDA 1TA6A 3Q3XA 1ELVA 2STBE 1OPHB 3ZVCA 1AN1E 5SGAE 1F0UA 3VGCC 4JYUH 3WY8A 3SHAH 4CR5A 1FV9A 5T6GA 2BDBA 2KCOA 1DOJA 2UUKB 1O2WA 1HAVA 3BN9A 1A3BH 1TMBH 1C1RA 2NU0E 1V2TT 2RFKC 1NZQH 2K0QA 4Q7YA 1W2KH 4NWLA 1QRWA 2AMQA 3W95A 2FO9A 4X2YA 4K69A 2C8WB 1PPBH 2BX3A 4TT3D 3UNQA 3M5MA 1KXAA 4YOJA 1KYNA 1S82A 4OS2A 1BHXF 4BAKB 4XOJA 1O3GA 3GOVB 5G4BA 1O3EA 1O5EH 1ETSH 1UVPA 1HBTH 2HOBA 1FLEE 2NU3E 4KP0A 3U8OH 1NRQH 4WMDA 4DIIH 4AGJA 1TB6H 1IQMA 3LH1A 1TX8A 3RXEA 3SORA 7LPRA 1GBTA 2FOEA 1ZMNA 2ZHWH 1UK2A 3T29A 1ZPBA 2BTCE 3ZVAA 1EJMA 1ZRKA 1V2PT 1G36A 2FYQA 1C5ZB 3GY8A 2PKAB 1Q2WA 3LIWA 1OXGA 3VB7A 3RXVA 4ZCNA 5DPAA 4HTCH 4GVUA 1O3PB 2GGVB 1CA0B 4MNWA 1SGRE 1K1IA 3KEEA 2XXLA 1TBZH 4CRGA 1KSNA 4K8BA 1O35A 4MDSA 1BDAA 1CU1A 1GJAB 1WSSH 5T6DA 3S69A 2C93B 4F55A 1HIAB 1H8ED 4MPVA 5LPEA 5A0CA 1O2TA 5C0UA 1ZHRA 2JDID 1FONA 4CRFA 2PR3A 2P95A 3TJNA 1FQ3A 4WH6A 3ZV9A 1A4WH 5TJXA 4FU8A 5GDSH 5FL7D 5B6OA 2KCPA 1BUIA 1UCYH 1ZOMA 2G81E 2ZU5A 3ITIA 3N99A 3RXLA 1O2HA 1ETTH 1QHRB 1LVBA 3MH5A 2XOKD 4HGCA 5C2ZA 1ZTJA 3SGAE 1L1JA 1O3JA 1EZSC 1L4ZA 3KIDU 3FOAA 2FP7B 5EPYA 3MOCA 3BTHE 1WXRA 1GG6B 1J9CH 1TYNA 3GCHB 2TIOA 3KL6A 1BZXE 1QURH 1WYKA 1KDQA 3BTEE 2ZGCA 3DSPA 1C1WH 3GYLB 2EQNA 3SV7A 1HAXB 1ESBA 1F2SE 1HFDA 4X6PA 3RXUA 1XVMA 2TRMA 5A09A 2HLDD 1S6LA 1AZ8A 3OE7D 1CSOE 2O8WA 3HK6B 4Y11E 5EXNA 4WY3A 1KXDA 1NROH 2AFQB 2A4GA 4FUGA 5L2ZH 5DP6A 2QXGA 3WWBA 2G51A 4RN6A 5C1XA 1C5TA 3N7OA 2R9PA 4K8YA 5EXMA 1FI8A 3QTOH 4AB8A 3ODFA 4ZKOU 1HV7A 5KEDA 5F6MA 1WU1A 4ZXXH 3TK9A 2XBWA 2PGQB 2P3UB 3PMJA 3UPEA 2EEKA 4FU7A 5I46H 4ZAEA 2EY4C 1THSH 2BB4A 1TNJA 1XUKA 2VIPA 4Y10E 2ZPRA 1YWUA 2G5VA 2FX6A 1LVYA 1EZUC 1C2IA 3ZZBA 1ABJH 1L2EA 1BMMH 3RXQA 1O39A 3SOSA 1ANBA 1O2ZA 1OS8A 3PLKA 2Z9GA 2ZCHP 4JK5A 2BLQA 4NG9H 3QGJA 2ZHFH 1K22H 5E0JA 1P2IA 1QJ1B 1C2MA 1PPZA 1GHWH 4X6MA 1V2VT 4WWYA 5GWZA 4THNH 2WSSD 2WPMS 1ZGVA 2SFAA 5J4SA 4I8GA 1Z1JA 3PO1B 1ESTA 3ENSB 2R2WU 2VGCB 3VXFH 1TOCB 1GMCG 3A8AA 1EPTB 1HUTH 1JWTA 2VBCA 3FANA 1H8HD 2ANMH 2VVVA 1BB0B 1CBWC 1O3LA 3LGVA 1TE0A 2V6NA 1AO5A 2Z7FE 4XFQA 1B7XB 2WYJA 2ZU2A 4Z0KA 1P2JA 1YLCA 1UTOA 1W13U 4X1PU 3QK1A 3V7TA 1DT2A 2XWAA 3A84A 3LDXH 1TWXB 1SGQE 2VNTA 3ATLA 2GDDA 2BZAA 4OGYA 2HALA 2F9NA 2XCFA 1CHGA 1O5BB 2Z3EA 4K1EA 4KTSA 3B8JA 4P00A 2WPHS 4O9VA 1MD8A 3BG8A 1DICA 3LU9B 3SNDA 3RXDA 4K2YA 2TGPZ 2BD5A 3TGIE 3SV8A 1YYY1 2GTBA 1T4VH 2NU4E 5FX6A 1QL8A 2J2UA 1MZAA 3OYPA 2CGAA 1UCYE 1V2QT 5HM9A 1Z6EA 4O3TA 1MD7A 1DWBH 3C1KA 3MH7A 2ZWLH 6CHAB 1P8VC 2OCVB 4B75A 1GGDB 3FP8E 1P0SH 3SZNA 3NPSA 2VWLA 2J97A 4DT4A 2F9UA 1E34B 4Y0ZE 1SGDE 2YNAA 3RXFA 4IN1A 1VITG 2FPZA 4FUIA 5FPYA 4CH8B 1HJ9A 1AWFH 3O8RA 2FOBA 6ESTA 3SNCA 1W10U 3RC4A 5HGGA 3GY5A 3T26A 4JZDH 2BYAX 1GBCA 4YOGA 4SGBE 3M5NA 3BTQE 2ZECA 2G52A 4GPGA 3SU3A 3MQKC 1QQ4A 3LJOA 4B6EA 1K0HA 1K1OA 1BCUH 2ZPSA 1KMHB 1SB1H 4IN2A 1GI6A 4AFSA 1T4UH 1SLWB 1ELDE 1FY3A 1NFWA 2FOCA 1ELCA 1BMFD 2XRCA 5FHTA 5EQRA 1OKXA 1FPHH 4K3JA 1O2QA 3OAAD 2KAIB 1O30A 1KTSB 1ZSLA 2ODYB 3EQ0H 2BD3A 3AAUA 2CN0H 5IK2D 2A45B 1ZZZA 4NFFA 4X1RU 1GJCB 1K21H 3TH4H 2DE9A 1DM4B 4OS4A 5EODA 1QTFA 3F3BA 3JZ2B 2QCYA 2VWOA 2VWNA 2ZHDA 3SGQE 2PLXA 4OS5A 1YCPK 4TWYA 1NU7B 1S85A 3E91A 4ABJA 4BTIB 2SGFE 3TITA 2QXHA 2XWBI 4A1XA 3SNEA 1LPZB 1P2MA 2G4TA 2TGDA 5EJLA 1GBJA 5DKMA 2O8UA 2Y5HA 3S0NA 3Q76A 4ABGA 1O5DH 1GPZA 3LOXA 3RDZA 1DWEH 2M5TA 1QA7A 4NFEA 1UTLM 1UTJA 2P59A 3DSOA 3UWJH 4AB9A 5JYIA 2Q6DA 1B5GH 2FS9A 4I86A 3ATKA 3EE7A 2PTNA 2A4OA 2FDAA 1Y3UA 4CREA 1Z8JB 2J98B 4UE7H 2BDHA 5ESBA 2PUQH 1AFEH 3ATMA 1O3HA 3G01A 3TJOA 1C2LA 1ZTKA 2CV3A 3U69H 4CRDA 3SHCH 1A61H 1AZZA 1XMNB 4RI0A 2PFEA 3STJA 3RMLH 1ARCA 3RXKA 4BTUB 1OYTH 4YOIA 3LGYA 3M7UA 4HZHA 4PROA 1VCQA 3RU4D 3D49H 4GLYA 5DO4H 2BVSH 1TMTH 1QCPA 2WPLS 4TY7A 3F9HA 2PKSC 2H5DA 5GPIB 2W3IA 1O33A 2ZTZA 2WPJS 1LHFH 2BVXH 1C1NA 3F0PA 2Z9IA 1HRTH 1ANDA 1O2JA 3GDVA 4X6NA 4E7RG 4K5ZA 3U9AH 2XBVA 3SUFA 4CBNA 1RRKA 1KLIH 1WAYB 2F9PA 4JZFH 4BXSA 1C5XB 1GHBF 5T1VA 1YPLH 2HVYB 1RIWB 5F8ZA 5J4QA 1FJSA 2HVXA 2ZZUH 2GV7A 1GI9B 3P17H 2A32A 3SV9A 1AWHB 1A0JA 2F9OA 5FCKA 1HLTH 1TPAE 3OEED 4WMFA 1BTYA 2JETC 4ESTE 3FZDA 4ABHA 1WTGH 1G9IE 4F48B 1SQAA 1AHTH 5EQSA 1HAOH 1VGCC 3QGNB 2FI5E 2FLBH 1C2HA 2ODPA 4R0IA 4ZKRU 4FUEA 1V2OT 4UEHH 1AB9C 3DT0H 4Y8YA 3F2GA 3MO9A 1GJ5H 1ZPZA 1DXPA 1BBRE 1DANH 1BT7A 2UWPA 1BRBE 1FY4A 4AORA 1O2PA 1ZHPA 1P3EA 1OWHA 1A5GH 3RMOH 1AFQC 1VJAU 2BM2A 3MU4A 3O8CA 2QN5T 1QNJA 3ATWA 2P94A 3M35A 1UVOA 3OSYA 3DCLA 1O3KA 4OS1A 3RXJA 2CHAB 2KFWA 1OWDA 1MKWH 1U6QA 2D1JA 3A89A 2WPKS 3SBKA 1FIZA 1KXBA 2HPQH 1HGTH 2HGTH 1SG8B 1XKBC 1MKXH 1WUNH 3UR9A 2Z3DA 3FO8D 2O8LA 1ZGIA 1GHAG 3A7ZA 4NSVA 3A85A 3M36A 1ANCA 1C5QA 3PRBA 2RA3A 4MVNA 1E38B 1TBQH 1MTUA 1H8IH 1DDJA 3VB6A 1H8DH 3GDUA 2RG3A 1EJAA 4SGAE 5DSFA 4GCHF 4X8SH 1H1BA 1P05A 2BQ7B 1UTNA 4B74A 3IG6B 5KECA 3BSQA 1N1LA 1XXDA 1E36B 4GAWA 1EXFA 1Y3XA 3SYJA 1COWD 2VIWA 3HGPA 2BD9A 1MQ6A 1KLJH 3KHVA 4MQAA 3MI4A 1XKAC 4JZEH 3PWBA 3K6YA 5DP7A 5JDUB 1O2GH 1H9IE 1GBBA 2SGEE 2XW9A 5ETXA 1GBLA 1N8OB 3UIRA 5T3HA 1W11U 2GMTC 1ELGA 3QX5H 2QXIA 1MH0A 1V2NT 4AX9H 3TPIZ 1SGTA 3W94A 1SGEE 1O2OA 2BD2A 4K1SA 5AFYH 1THPB 5JBCS 1L0ZA 1CGIE 1P10A 1NTPA 2CF9H 2ZTXA 1KXFA 4ZKNU 4Q2KA 4TWWA 3LJJA 1W7XH 2KR7A 3MTYA 3BIVH 5EW2H 3ZZDA 3DFJA 1Q31A 2GDEH 4HI3A 2QIQA 3HK3B 1ZPCA 4NIYA 1OP2A 1FN6A 1MKWK 5HXFA 1B0FA 1LCYA 1ZRBA 3ZZ7A 6LPRA 1C5UA 3AVZA 3UUZA 3RXMA 2FOAA 4FUCA 4YM9A 1GHXH 1XXFA 2HRVA 1FUJA 2BDGA 2LELA 1D6RA 2AGGX 3F6UH 4TPIZ 3BG4B 1UHBA 2BD7A 4DGJA 1OWIA 2OC1A 4LXBH 3UFAA 5HMAA 2FIRH 1FY5A 1SHYA 3RU4T 1BRUP 4ISNA 3RXSA 1FNIA 2ZQ1A 2ANWA 4Y76A 4DY7B 1BTHH 5FX5A 2C4FH 2GCTC 1D9IA 3CP7A 1ELBA 3ZVEA 4XE4A 4XRNA 3SJOA 1SL3A 5C5OA 2EI7A 3RC5A 1FAXA 3SV6A 3JZ1B 5C0TA 1EX3A 1QBOA 1DXWA 1RD3B 1AVXA 1O2MA 1XUFA 2O8MA 2TBSA 4NIXA 4A7IB 2FLRH 2PW8H 2ZHQH 3F1SB 4CH2B 3ZZ4A 1D3PB 2AIQA 4O3UA 1O2LA 4TPYA 3VEQB 1KXEA 3SW2B 5A2MH 1JXPA 4INKA 2BQ6B 3FKSD 3A83A 3SV2H 1B0EA 5BRRE 1AUJA 1EAWA 1NRRH 1SOZA 1GVLA 1GCTB 4CBOA 2SNWA 5CMXH 1A0LA 1O37A 3RM0H 3CENA 1F92A 3PWCA 1RJXB 2PSXA 4YTAA 2BY5X 2BLWA 2BLVA 4AZ2B 4J2YB 1LHGH 2OK5A 3I77A 4AC9A 1C2EA 1P2QA 4O97A 1ZLRA 2WUCA 1OSSA 2UWLA 4DCDA 4MPUA 9LPRA 4GHQA 4IMZA 1NY22 3LPRA 3M61U 1KXCA 1DPOA 4BAQB 2FESH 4FU9A 1SMFE 3EA7A 4AGKA 1BMLA 1HIAA 2ANKH 3RXRA 1SGPE 3BTGE 5E2PA 1O3NA 1JIRA 4GHTA 3R3GB 2ZGHA 1FPCH 2PTCE 4RSPA 4A1VA 1ABIH 1N6XA 2J9NA 3QO6A 3NRLA 1MCVA 1BIOA 4BAOB 2VIOA 3H7TA 1PYTD 1EAUA 1KDQB 2ZDAH 3SJKA 2KZ4A 4B76A 7GCHG 1W7GH 3SNAA 1YPKH 2KX4A 4HFPB 4NZQA 1S0QA 2BDIA 2QF4A 2ZFFH 3TU7H 5F8XA 1K1NA 1NBME 1V2WT 4AG1A 2ZDVH 3F68H 1VITH 1NO9H 1A1RA 1O31A 1EZXC 2K8IA 2VINA 4XBCA 1PQAA 1MTNB 1HAYB 1MU6B 1CT0E 1C1VH 2ZCLP 3ZVGA 3M3VA 1UTQA 3AASA 3U8TH 1E35B 1QB6A 1RFNA 3MU5A 1O34A 3PMAB 3RXAA 2UUFB 1FY8E 4ZHLU 1NFXA 1GVKB 2GV6A 1DUEA 1PPGE 3NKKA 4OS7A 3UTUH 1GI5A 4GCHG 4ZHAA 3NWUA 4F4OC 1TNKA 5I25A 2ZEBA 1C5VA 3SUEA 4VGCC 1O5FH 1VCWA 2EA3A 1BHXB 1ELAA 1GI1A 3P8NA 2ALVA 4FOUC 4AG2A 2BD4A 4RT0A 1ELEE 3MNCA 4ACBA 1GJDB 3RXHA 1GHVH 1O2YA 3BF6H 3ZIAD 4DOQA 1GHYH 4ABIA 1D3DB 4AOQA 3E16B 1AUTC 3ESTA 2YMSC 4FUHA 3MNSA 1E1RD 1O3IA 3UNRA 1YLNA 5TCCA 4Y7BA 3ZYEA 3WW7A 2GX4A 1HAZB 3URCA 3TGKE 2V0BA 1YKTA 4D9RA 3SJ8A 1GI4A 3AK5A 1QB9A 3Q3KA 1E0FD 3IWMA 1SI5H 4MNVA 1WV7H 4K60A 1T31A 2OLGA 2ZU4A 5HIYA 2VIDA 2ZGJA 2I6SA 1ARBA 1AQ7A 1EP5A 1SQRA 2FOGA 3A88A 1F0TA 1FN8A 1UCYK 2F3CE 2H9EH 1Y3WA 3RLWH 1SOTA 1RS0A 4JYVH 2QXJA 4X2XA 4JK6A 2VJ1A 5F8TA 2BOKA 1C5WB 3VB3A 1GBFA 4Y6DA 1HJ8A 3SO3A 3LGWA 1BJVA 1CGHA 1O2NA 1P02A 2HNTE 5LPRA 3MHWU 5DP4A 4WF8A 3E8LA 1J8AA 1ELTA 2Q1JA 2R2MB 5L30H 1EASA 1TLDA 2OP9A 1W0YH 2QAAA 2O9QA 1CGJE 4YO9A 2ASUB 4DG4A 8LPRA 2P8OC 4OGXA 5E0HA 5E8EH 3M37A 1YC0A 1LQDB 1ACBE 1D3TB 5K0HA 1F5LA 3AAVA 1A0HB 1ZYOA 1GMHF 2BQWB 1XVOA 2SGQE 2Z9KA 1LPGB 2A0QB 2QF5A 4JZ1A 3MNBA 1GBEA 3GS9A 5GIBA 2C3SA 1HJAB 2VWMA 1T8NA 2ZDLA 1ORFA 3T62A 1JMOH 2ZGBH 2FZZA 1Z8GA 3KCGH 6GCHF 3UQVA 3MU0A 2QC2A 3BTTE 1P09A 4K1TA 2H2ZA 2FX4A 1UK4A 3D23A 3SQEE 1OWEA 3OU0A 2B9LA 4OM9A 1GJ9B 2ZU1A 3VGCB 1VKYA 3GCTF 2G00A 3LH3A 5DN6D 4JZIA 1HCGA 1PQ5A 1LO6A 5FXLA 2YOLA 1IQLA 3KYGA 1EKBB 1IOEA 4ISLA 4XSKU 2F9VA 2VIVA 3PM3A 3GDSA 3Q77A 2SGDE 2FWWA 2QA9E 3LGTA 4NCYA 1O32A 3UR6A 5C17A 1XUHA 1WDIA 4NIWA 1TAWA 1EATA 1SR5C 1BBRH 3A7WA 1N8OC 5C1UA 1AVGH 4JMYA 3ELAH 2AMDA 1TONA 1Z8RA 3PROA 5BPEA 1BTXA 1CE5A 1YPEH 3DD2H 1HAPH 1HAGE 1QL9A 4I31A 8KME2 4X1QU 1C4U2 3QLPH 3UOUA 3PLBA 3RMMH 4UD9H 2BD8A 2G8TA 2W26A 4ABDA 1IQEA 3VG8A 3SJ9A 1GJ4H 3RXCA 4Y7AA 4ZHMU 4BAHB 3GICB 2KAIA 5AFZH 2H9TH 1TPPA 2AHME 1YLDA 1ZHMA 2JIZD 2WZQA 3PMBB 2FEQH 4KTCA 1CA8B 5A8YA 1SFIA 2A1DB 5DP3A 3DFLA 4A1TA 1C2FA 8GCHF 8ESTE 1PPEE 2FI3E 2ZDMA 1ZTLA 2CF8H 4BANB 4JCNA 4NSYA 1T8LA 2UWOA 2XBYA 1SKYE 3PMHB 5FPTA 2VB0A 3SQHE 5CHAC 1MAXA 4D76A 1O2IA 4D9QA 1GJ8B 3DUXH 5GNDA 3HGNA 3E1XB 3NXPA 5JB8S 4ZXYH 1NM6A 2R0KA 4ZKSU 1GMDF 2FTLE 4AYVB 4ZMAH 1C1TA 1UTPA 1MUEB 1SBWA 2OC8A 3ZZCA 1AKSA 2THFB 2ZFPH 4ABBA 2RDEA 1IQNA 5PTPA 1P2OA 3A7VA 1RGQA 3LKWA 3BIUH 1L1GA 4FVDA 3H7OA 4X2VA 5FAHA 1LQEA 2ZI2H 2B7DH 4TSFD 3S7HB 1V2JT 3ZZ3A 1CT4E 1LVOA 5ESTE 4LZ1H 1C5RA 3I78A 2OC7A 2OQUA 3MMGA 3D62A 1AY6H 1BOQA 3PTNA 2BY7X 1NESE 2A2QH 3GCOA 1MQ5A 1TABE 5T6FA 3A86A 5EQQA 5C94A 3P70B 4MNYA 1S5SA 4I32A 3E6PH 1TNLA 4NWKA 1BBRK 1PJPA 4DVAU 1ZR0A 4I33A 1DLKB 2A7CA 2BXUH 2EI8A 2WV4A 2ZIQH 2ZNKH 1T8OA 3R0FA 1C1UH 1TNIA 4KGAA 2PGBB 3A8DA 4FETA 4U30A 3S9BA 1CA0C 4I8JA 4B2AA 1Y5UT 3F9EA 2AGEX 2OXSA 1Z6JH 4FUBA 2R0LA 1ZMLA 1GDQA 4Q80A 1W12U 1Z8IB 3M7TA 4LZ4B 2OBQA 1O2VA 3N7EA 4WJG2 1JOUB 1SQTA 2OC0A 3KQCA 1O3CA 2GT8A 5DK1A 1TFXA 1Y8TA 4WVPE 1KLTA 3RMNH 5EGMA 2HNTC 3HKIB 1OP0A 3F2HA 2A4RA 3QDZB 1ZMJA 2IN2A 4XBDA 3GYMA 3EGKH 2A5KA 3QZQA 2OINA 3AW0A 1NU9A 5L6NH 2C8ZB 1UO6A 2ZFRH 3ZZAA 4BOHA 2J34A 2BY8X 5DJ7A 1IQIA 5AF9H 3M5OA 1HAHH 4DJZB 1IQKA 1NFYA 1YM0A 1G37A 2STAE 2AS9A 1XUIA 1GG6C 1H9LB 1C2JA 3GCHC 2JH6D 1F5KU 3P95A 2LP6A 5AHGH 2ZFSA 4R8TB 4NIVA 1DSTA 3AW1A 4E06H 1CHOF 3SN8A 2L6OA 2A31A 2W5EA 1WTHD 2P3FH 2VH0A 5A8ZA 4X8TH 3K6ZA 1BMAA 1TRMA 4CHAB 2TPIZ 2AGIX 3UY9A 1EB2A 4F49A 1WOFA 1T32A 3LGUA 3P8OA 1C5LH 1XUGA 4Q63A 2A5IA 2Q6FA 1IQJA 2XCNA 3QZRA 2F9BH 4ASHA 3C27B 1FX0B 4Y79A 3LT3A 2AERH 3BTKE 3MO3A 2NU1E 3W1EA 1C1QA 1EB1H 1QB1A 1T8MA 3QTVH 3URDA 1IHSH 5KGOA 2Y5GA 2JJ2D 2J4IA 4ZROA 1C9PA 1OHHD 2W7UA 3E0PB 1G2MA 1S81A 1FMGA 1Y3VA 3MWIU 4UFGH 3UQOA 4ACAA 2FMJA 3A7YA 3V3MA 5C67A 1AE5A 3BEIB 5F03A 1NC6A 1O3OA 1OWKA 1SVPA 2OUAA 2WPIS 4YLUA 3ZYDA 5GXPA 3HATH 2BXTH 3V0XA 3SUDA 3KNXA 5HM2A 1OOKB 4B71A 1AD8H 1SGFA 1C1OA 1AIXH 1Z7KA 1HNEE 3ZVBA 1V2ST 1OWJA 1AE8H 5ABWA 3PO1C 2BZ6H 2GZ7A 2FXRA 1V6DA 2Z9LA 2FTMA 3S7KB 1GI7B 2VGCC 2ZDKA 1V2KT 2RCEA 4A92A 1EPTC 1TRYA 1Z71A 3E90B 3CS7A 1BTWA 3PV2A 3RLYH 3BTFE 3VPKA 3L6PA 1YF4A 4D7FA 1O2KA 3T2NA 5F53A 1GDUA 1DY8A 3GY6A 2RDLA 1GJ6A 1UVTH 3BTWE 2WHXA 2FOHA 3KF2A 3OX7U 1MMJN 1P57B 2ALPA 4B73A 1L1NA 2ZC9H 4YLQH 1A46H 3RU4E 5EIYA 2BVRH 3V12A 1Y5AT 3BEUA 8GCHG 2HNTF 2V35A 3U1IB 1SSXA 1TOMH 1JRTA 4JYTA 1SGIB 1NFUA 5TCAA 3TNSA 2ZHEH 1GI3A 1MTSA 2Q6GA 1FIWA 3EAJA 2ZU3A 3MH4A 3RM2H 1DVAH 3ATIA 1HXEH 4AFUA 1BQYA 2HPPH 2V3MA 2WV5A 1DE7H 1WCZA 2BLOA 2FYRA 3VXEH 1O36A 4KELA 3SJIA 6CHAC 1JIMA 1MKXK 1GGDC 1W14U 1GMDG 3ZVFA 3SU6A 2ZG0H 3B23B 2ZCKP 1NS3A 4CRCA 1P2NA 1QY6A 3GY2A 1UHBB 1HAVB 3GISB 1TIOA 1EJNA 1GJBB 1K2I1 2BDCA 2OTVA 4Z6AH 1YPHE 4BXWA 1YPJH 1EP6A 1M9UA 1W3CA 3A81A 1O5AB 1ANEA 2D26C 1P01A 2AIPA 3STIA 2FODA 3U28C 3CS0A 2Z94A 3TJVA 5DP5A 7KMEH 3UNSA 2VVUA 3P92A 4LK4A 3O8DA 2BY6X 1EQ9A 1HB0B 3KQ5A 3OY6U 4ZH8A 1PPHE 1VITF 5JBBS 4BAMB 1NN6A 2G55A 1G32B 1K1MA 3SUGA 3P6ZB 1PPCE 1G3CA 4RT1A 3SI3H 1J15A 2H6MA 5C20A 2R3UA 1BTZA 1CT2E 1SGFG 4AFZA 1GHBG 1SGYE 3RXTA 2HWLB 3QWCH 1UMAH 5FBIA 1V2LT 1O3MA 2J92A 1C1MA 2R3YA 3HPTB 2QV1A 1EOJA 1EUFA 2PKSB 2GP9B 1G30B 3SU4A 1S0RA 3HKJB 5B6LA 4UDWH 4Y8ZA 4Z1MD 2AYWA 5E0GA 3NCLA 1Y59T 1LKAA 5EPNA 1C1PA 5CDFE 1VR1H 2CJIA 1OP8A 5FBEA 5GCHF 2PKAA 3Q00A 3UWIA 4IGDA 3PV5A 1ZJKA 1SGCA 2PV9B 4NZLA 1O2RA 4X1NU 3RUOA 4IC6A 4U2WA 1UTMA 4RKJB 1RTLA 3WWFA 5E2OA 2JETB 2YNBA 4XDEA 4YXWD 4B1TA 1MBMA 3FP7E 4BTTB 3K2UA 2OBOA 2GJGA 2GZ8A 3SZEA 1VGCB 5CE1A 1UJ1A 2C8XB 2OQ5A 1F0SA 1SLXB 4YZUA 4ISHH 1AB9B 4YT6H 2C90B 1CHOG 2PHBA 5IDKA 2XBXA 1G3DA 1GBIA 3KN2A 4ASUD 2FOFA 2ZP0H 2WPDD 1C5OH 2F91A 4NA9H 4CR9A 2IJOB 1IQHA 1DFPA 1O5CB 3GCNA 4WXVA 3DA9B 3CNRA 2VVCA 1EAIA 3A87A 1CO7E 2W6ID 4WMEA 2A2XH 1G3BA 4X8UH 4NGAH 1HDTH 1SGNE 1AFQB 1P06A 2ZF0H 1F7ZA 2W3KA 3UREA 1GBDA 1O2SA 2AH4X 4TY6A 4Y71A 2VIQA 3OEHD 4MNXA 3ZZ9A 2FI4E 1GBAA 3O8BA 1X7AC 1TMUH 2Z3CA 1C9TA 4H42U 2PWXA 4X0WU 1AVWA 1O2UA 1SFQB 4AYYB 2V7QD 1DX5M 1C4Y2 1PPFE 5CHBA 2J5UA 1ZJDA 1MAYA 4ABAA 1RIWC 2Y81A 9ESTA 1YPMH 1J14A 4MPXA 1WQVH 2WV9A 5JBTA 1SPJA 3TLOA 1A3EH 1LDTT 1C4V2 1SLUB 4ISIH 4X2WA 3A7TA 3F0OA 2ZPQA 1GBKA 2W7SA 1C2KA 2GD4B 2XC5A 1DS2E 3FAOA 1P2KA 1LPKB 1FDPA 3A8BA 2Z6BD 3E0NB 1VZQH 4LOYH 1EZQA 1H4WA 1QR3E 2ZDNA 1TBRH 3GY4A 2ZA5A 5JPMH 2WINI 5EG4A 4J1YA 1IQFA 1P04A 1LHDH 5FCRA 1S84A 3DSGA 3T25A 1E37B 5LGOA 2EC9H 4FUDA 3SNBA 1MTVA 4ZUHA 2B0FA 3MYWA 1EPTA 3FVFB 1TX6A 2GMTB 3A8CA 5DGJA 1TGBA 2ILNA 1E1QD 2F43B 1ID5H 3KGPA 5EOKA 1SQOA 2Z9JA 4CHAC 3SI4H 1YCPH 2CHAC 1GI2A 3TK5A 2FM2A 4MPWA 2K1QA 1P3CA 1YPHC 3V13A 1O3AA 4CRAA 1YBWA 4AFQA 2QE7D 3KQBA 4X1SU 3TH2H 2P93A 4NA7A 5IYTA 4CRBA 1D6WA 4A6LA 1AGJA 2ZGXH 1TX7A 3T5FH 1OX1A 1YPGH 5DG6A 5C3NA 3E3TA 2QYIA 2JJ1D 1P11E 1V2MT 1TGCA 4Q7ZA 1E79D 1YCPM 3H09A 2IPHA 4UONA 2XNDD 2P16A 1IAUA 4QT8C 4FUFA 4UFFH 2ESTE 4FVBA 4XD7D 2Y7ZA 3F9FA 1BRAA 1YY3A 3S9AA 4I7YH 3OTJE 2G4UA 3U98H 1O38A 1FY1A 4OS6A 2OD3B 1IHTH 3BV9B 1TRNA 2O8TA 2CMYA 4H6TA 1GHAF 3K9XB 1QQUA 1LTOA 2NU2E 4DIHH 3PB1E 2DE8A 2CXVA 1BMNH 1YGCH 3FFGA 1PQ8A 3F9GA 3MNXA 1O3BA 2M2AA 1C5YB 2H9HA 3M3TA 4M7GA 1CVWH 1GDNA 1QZ8A 2BY9X 1GCDA 2BMGB 1EOLA 2GCTB 1DITH 1KTTB 1QRXA 4ISOA 4FXGH 1GWAA 5DP8A 2WYGA 1QFKH 1NRSH 4IC5A 3RXOA 3RXGA 3D65E 2DUCA 3GY3A 3T27A 2ODQA 2GVFA 4Q4LA 4IBLH 2ULLA 3QUMP 2D8WA 4P02A 4I8HA 3UAIC 1DWCH 1J16A 1RXPA 1AU8A 2NWNA 1YP9A 3DHKH 3KQEA 2UUYA 1GBMA 1ESAA 1C5SA 2TGAA 4KTUA 5GCHG 5EXLA 2GCHF 1GI0A 1Z1IA 2UUJB 2QGRA 4UFEH 2IJD1 1UVSH 1TPSA 4Q7XA 2ZQ2A 4BNRA 1P03A 4M9FA 4WH8A 1WBGB 1GBHA 2Y82A 2ZO3H 1C2DA 2V3HH 1UTKA 5K7RA 1HPGA 1Y3YA 2TGTA 2KCAA 4Y0YE 1BA8B 2XC4A 3OFND 1ZSJA 1VJ9U 3RC6A 1RTFB 3EA8A 4AN7A 1QIXB 1QBVH 1GL0E 4IW4E 5EJZA 5C1YA 4X6OA 2GKVE 4DURA 3EE0B 4Y8XA 5C5NA 3BG4C 1BTUA 1AKSB 3PV4A 1J17T 1HYLA 4B6FA 1BRCE 3SGBE 3BTME 1QBNA 1TPOA 3S9CA 1Q3XA 2C8YB 2V3OH 3L3TA 3TIUA 3M7QA 4YESB 3SU5A 2BOHB 1LHEH 2B5TB 5GJ4B 1C5MD 1EFRD 1P9UA 3ZZ5A 2XYAA 1LVMA 2J98A 4A5TS 2VU8E 4U01A 4XBBA 1AI8H 5A0AE 2LNCA 2SGPE 2B8OH 1A2CH 3EA9A 4INLA 1OYQA 2D2DA 3TH3H 2ZFQH 1MCTA 2YMSD 1Y5BT 2ZKSA 2J94A 4IMQA 2P3TB 1QL7A 1V2RT 1C1SA 3L33A 4WXIA 2IOTA 2PSYA 1MTWA 5EJ1A 1S6HA 2FOMB 3NZIA 4X8VH 5JBAS 2A4QA 4B2CA 1GCTC 3FZZA 1TNGA 2IPQX 1C5PA 3PTBA 1K1PA 1V2UT 5LH8A 2A7JA 5HIZA 1K1JA 2QF0A 3A80A 3EDXB 2BDAA 2QF3A 3OTPA 1O5GH 4KKDA 4ABEA 4GUXA 5EU8A 1TQ0B 1S6FA 5L2YH 4VGCB 1SLVB 1G3EA 4GSOA 1K28D 2KCYA 1MZDA 3A7XA 4O03A 3A82A 1XX9A 3P8FA 3PLPA 1HXFH 2J95A 3SU0A 1VCPA 1ELFA 1G2LA 1V3XA 1LMWB 2JH0D 3TNTA 1DWDH 3GY7A 2YMSB 3BTDE 4ABFA 7ESTE 1JRSA 5A0BA 4I8KA 5H4IB 1KIGH 1KY9A 3RXPA 3NK8A 1FXYA 3RXIA 1QA0A 3P8GA 3NUMA 1MU8B 1HAIH 5FPSA 1DUAA 1T7CA 3ZVDA 2BHGA 3UOPA 1CBWB 5JB9S 3LGIA 2HLCA 1WQSA 5LPFA 1DSUA 1PFXC 1DLEA 1BITA 2XTTB 3OY5U 3I29A 1INCA 3TK6A 3U8RH 5HYOA 3VFEA 1CQQA 2Y5FA 1GMHG 2ZFTA 5A8XA 3MU1A 3TGJE 1EAXA 4YT7H 1MTNC 3MU8A 1TGNA 4H4FA 2PUXB 2W6JD 1GI8B 4DW2U 2BX4A 4D7GA 7GCHF 3KQDA 3QN7A 1P9SA 1H9HE 2XC0A 2P8OB 6GCHG 1A5IA 3ZZ6A 2L74A 2A5AA 3MO6A 4D8NA 4MTBA 2FS8A 1IQGA 1SHHB 1DY9A 3GCTG 1QGFA 1PYTC 1LHCH 2GT7A 1O0DH 4RKOB 1TALA 1W8BH 1C5NH 1GJ7B 1GVZA 3H5CB 2QY0B 3ZV8A 3T28A 1LKBA 1QJ6B 1TA2A 2ZTYA 1BJUA 4E05H 1AMHA 1BTPA 1W0KD 1GHZA 3N7DA 2JKHA 2EI6A 3B9FH 4NA8A 3SU2A 3LC3A 1QJ7B 3M3SA 3LONA 4FUJA 3PYHA 1F5RA 3M5LA 1C2GA 1MABB 4E7NA 2Y80A 1D4PB 3UB0A 3TJUA 2Y6TA 1TQ7B 3VB5A 1NPMA 3Q3YA 2SGAA 1F0RA 1GL1A 1A7SA 3FP6E 4MLFB 1THRH 3RXBA 1UK3A 2CK3D 3FN8A 2KM0A 2F83A 2H1UA 2WUBA 3LC5A 1ZSKA 2J38A 1N6YA 2PP6A 4UFDH 3BEFB 1TNHA 1S83A 1D3QB 3K65B 3ZZ8A 2BDYA 1O2XA 4DT7B 2GCHG 2LPRA 1NBMD 3IITA 1TGTA 3KYFA 1K1LA
chains in the Genus database with same CATH topology
1NT1A 4INHA 1GMCF 1RTKA 4U32A 2H5CA 1JBUH 1FZZA 2I6QA 2JH5D 1W0ZU 2SNVA 5AVDA 4MG3A 1P12E 4IS5A 3SU1A 1XUJA 3ODDA 4B2BA 2XNIA 2Y7XA 1PQ7A 1UVUH 1NRPH 3U1JB 1FAKH 1O3DA 1TGSZ 1O3FA 2VH6A 1XM1A 1A5HA 1SC8U 4H6SB 3VB4A 1L4DA 2G5NA 2GZ9A 3MH6A 5EW1H 3RP2A 1NRNH 2RA0A 1K9OE 1ETRH 4I8LA 1HJAC 2ANYA 1MBQA 2AEIH 2AMPA 2A7HA 4TYDA 3TVJB 5CHAB 5DP9A 3MFJA 1QRZA 3EYDA 1TA6A 3Q3XA 1ELVA 2STBE 1OPHB 3ZVCA 1AN1E 5SGAE 1F0UA 3VGCC 4JYUH 3WY8A 3SHAH 4CR5A 1FV9A 5T6GA 2BDBA 1DOJA 2UUKB 1O2WA 1HAVA 3BN9A 1A3BH 1TMBH 1C1RA 2NU0E 1V2TT 1NZQH 4Q7YA 1W2KH 4NWLA 1QRWA 2AMQA 3W95A 2FO9A 4X2YA 4K69A 2C8WB 1PPBH 2BX3A 3UNQA 3M5MA 1KXAA 4YOJA 1KYNA 1S82A 4OS2A 1BHXF 4BAKB 4XOJA 1O3GA 3GOVB 5G4BA 1O3EA 1O5EH 1ETSH 1UVPA 1HBTH 2HOBA 1FLEE 2NU3E 4KP0A 3U8OH 1NRQH 4WMDA 4DIIH 4AGJA 1TB6H 1IQMA 3LH1A 1TX8A 3RXEA 3SORA 7LPRA 1GBTA 2FOEA 1ZMNA 2ZHWH 1UK2A 3T29A 1ZPBA 2BTCE 3ZVAA 1EJMA 1ZRKA 1V2PT 1G36A 2FYQA 1C5ZB 3GY8A 2PKAB 1Q2WA 3LIWA 1OXGA 3VB7A 3RXVA 5DPAA 4HTCH 4GVUA 1O3PB 2GGVB 1CA0B 4MNWA 1SGRE 1K1IA 3KEEA 2XXLA 1TBZH 4CRGA 1KSNA 4K8BA 1O35A 4MDSA 1BDAA 1CU1A 1GJAB 1WSSH 5T6DA 3S69A 2C93B 1HIAB 4MPVA 5LPEA 5A0CA 1O2TA 1ZHRA 1FONA 4CRFA 2PR3A 2P95A 3TJNA 1FQ3A 4WH6A 3ZV9A 1A4WH 5TJXA 4FU8A 5GDSH 5B6OA 1BUIA 1UCYH 1ZOMA 2G81E 2ZU5A 3ITIA 3RXLA 1O2HA 1ETTH 1QHRB 1LVBA 3MH5A 4HGCA 5C2ZA 1ZTJA 3SGAE 1L1JA 1O3JA 1EZSC 1L4ZA 3KIDU 2FP7B 5EPYA 3MOCA 3BTHE 1GG6B 1J9CH 1TYNA 3GCHB 2TIOA 3KL6A 1BZXE 1QURH 1WYKA 1KDQA 3BTEE 2ZGCA 1C1WH 3GYLB 3SV7A 1HAXB 1ESBA 1F2SE 1HFDA 4X6PA 3RXUA 1XVMA 2TRMA 5A09A 1AZ8A 1CSOE 2O8WA 3HK6B 4Y11E 5EXNA 4WY3A 1KXDA 1NROH 2AFQB 2A4GA 4FUGA 5L2ZH 5DP6A 2QXGA 2G51A 4RN6A 5C1XA 1C5TA 3N7OA 2R9PA 4K8YA 5EXMA 1FI8A 3QTOH 4AB8A 3ODFA 4ZKOU 1HV7A 5F6MA 1WU1A 4ZXXH 3TK9A 2XBWA 2PGQB 2P3UB 3PMJA 3UPEA 2EEKA 4FU7A 5I46H 4ZAEA 1THSH 2BB4A 1TNJA 1XUKA 2VIPA 4Y10E 2ZPRA 2G5VA 2FX6A 1LVYA 1EZUC 1C2IA 3ZZBA 1ABJH 1L2EA 1BMMH 3RXQA 1O39A 3SOSA 1ANBA 1O2ZA 1OS8A 3PLKA 2Z9GA 2ZCHP 4JK5A 2BLQA 4NG9H 3QGJA 2ZHFH 1K22H 5E0JA 1P2IA 1QJ1B 1C2MA 1PPZA 1GHWH 4X6MA 1V2VT 4WWYA 5GWZA 4THNH 2WPMS 1ZGVA 2SFAA 5J4SA 4I8GA 1Z1JA 3PO1B 1ESTA 3ENSB 2R2WU 2VGCB 3VXFH 1TOCB 1GMCG 3A8AA 1EPTB 1HUTH 1JWTA 3FANA 2ANMH 2VVVA 1BB0B 1CBWC 1O3LA 3LGVA 1TE0A 2V6NA 1AO5A 2Z7FE 4XFQA 1B7XB 2WYJA 2ZU2A 4Z0KA 1P2JA 1YLCA 1UTOA 1W13U 4X1PU 3QK1A 3V7TA 1DT2A 2XWAA 3A84A 3LDXH 1TWXB 1SGQE 2VNTA 3ATLA 2GDDA 2BZAA 4OGYA 2HALA 2F9NA 2XCFA 1CHGA 1O5BB 2Z3EA 4K1EA 4KTSA 3B8JA 2WPHS 4O9VA 1MD8A 3BG8A 1DICA 3LU9B 3SNDA 3RXDA 4K2YA 2TGPZ 2BD5A 3TGIE 3SV8A 1YYY1 2GTBA 1T4VH 2NU4E 5FX6A 1QL8A 2J2UA 1MZAA 3OYPA 2CGAA 1UCYE 1V2QT 5HM9A 1Z6EA 4O3TA 1MD7A 1DWBH 3C1KA 3MH7A 2ZWLH 6CHAB 1P8VC 2OCVB 4B75A 1GGDB 3FP8E 1P0SH 3SZNA 3NPSA 2VWLA 2F9UA 1E34B 4Y0ZE 1SGDE 2YNAA 3RXFA 4IN1A 1VITG 2FPZA 4FUIA 5FPYA 4CH8B 1HJ9A 1AWFH 3O8RA 2FOBA 6ESTA 3SNCA 1W10U 3RC4A 5HGGA 3GY5A 3T26A 4JZDH 2BYAX 1GBCA 4YOGA 4SGBE 3M5NA 3BTQE 2ZECA 2G52A 4GPGA 3SU3A 1QQ4A 3LJOA 1K1OA 1BCUH 2ZPSA 1SB1H 4IN2A 1GI6A 4AFSA 1T4UH 1SLWB 1ELDE 1FY3A 1NFWA 2FOCA 1ELCA 2XRCA 5FHTA 5EQRA 1OKXA 1FPHH 4K3JA 1O2QA 2KAIB 1O30A 1KTSB 1ZSLA 2ODYB 3EQ0H 2BD3A 3AAUA 2CN0H 2A45B 1ZZZA 4NFFA 4X1RU 1GJCB 1K21H 3TH4H 2DE9A 1DM4B 4OS4A 5EODA 1QTFA 3JZ2B 2QCYA 2VWOA 2VWNA 2ZHDA 3SGQE 2PLXA 4OS5A 1YCPK 4TWYA 1NU7B 1S85A 3E91A 4ABJA 4BTIB 2SGFE 3TITA 2QXHA 2XWBI 4A1XA 3SNEA 1LPZB 1P2MA 2G4TA 2TGDA 1GBJA 5DKMA 2O8UA 2Y5HA 3S0NA 3Q76A 4ABGA 1O5DH 1GPZA 3LOXA 3RDZA 1DWEH 2M5TA 1QA7A 4NFEA 1UTLM 1UTJA 2P59A 3UWJH 4AB9A 5JYIA 2Q6DA 1B5GH 2FS9A 3ATKA 2PTNA 2A4OA 2FDAA 1Y3UA 4CREA 1Z8JB 4UE7H 2BDHA 5ESBA 2PUQH 1AFEH 3ATMA 1O3HA 3G01A 3TJOA 1C2LA 1ZTKA 2CV3A 3U69H 4CRDA 3SHCH 1A61H 1AZZA 1XMNB 2PFEA 3STJA 3RMLH 1ARCA 3RXKA 4BTUB 1OYTH 4YOIA 3LGYA 3M7UA 4HZHA 4PROA 1VCQA 3RU4D 3D49H 4GLYA 5DO4H 2BVSH 1TMTH 1QCPA 2WPLS 4TY7A 3F9HA 2PKSC 2H5DA 5GPIB 2W3IA 1O33A 2ZTZA 2WPJS 1LHFH 2BVXH 1C1NA 2Z9IA 1HRTH 1ANDA 1O2JA 3GDVA 4X6NA 4E7RG 4K5ZA 3U9AH 2XBVA 3SUFA 4CBNA 1RRKA 1KLIH 1WAYB 2F9PA 4JZFH 4BXSA 1C5XB 1GHBF 1YPLH 1RIWB 5F8ZA 5J4QA 1FJSA 2HVXA 2ZZUH 2GV7A 1GI9B 3P17H 2A32A 3SV9A 1AWHB 1A0JA 2F9OA 5FCKA 1HLTH 1TPAE 4WMFA 1BTYA 2JETC 4ESTE 3FZDA 4ABHA 1WTGH 1G9IE 1SQAA 1AHTH 5EQSA 1HAOH 1VGCC 3QGNB 2FI5E 2FLBH 1C2HA 2ODPA 4R0IA 4ZKRU 4FUEA 1V2OT 4UEHH 1AB9C 3DT0H 4Y8YA 3MO9A 1GJ5H 1ZPZA 1DXPA 1BBRE 1DANH 1BT7A 2UWPA 1BRBE 1FY4A 4AORA 1O2PA 1ZHPA 1P3EA 1OWHA 1A5GH 3RMOH 1AFQC 1VJAU 2BM2A 3MU4A 3O8CA 2QN5T 1QNJA 3ATWA 2P94A 3M35A 1UVOA 3OSYA 1O3KA 4OS1A 3RXJA 2CHAB 1OWDA 1MKWH 1U6QA 2D1JA 3A89A 2WPKS 3SBKA 1FIZA 1KXBA 2HPQH 1HGTH 2HGTH 1SG8B 1XKBC 1MKXH 1WUNH 3UR9A 2Z3DA 2O8LA 1ZGIA 1GHAG 3A7ZA 4NSVA 3A85A 3M36A 1ANCA 1C5QA 2RA3A 4MVNA 1E38B 1TBQH 1MTUA 1H8IH 1DDJA 3VB6A 1H8DH 3GDUA 2RG3A 1EJAA 4SGAE 4GCHF 4X8SH 1H1BA 1P05A 2BQ7B 1UTNA 4B74A 3IG6B 3BSQA 1N1LA 1XXDA 1E36B 4GAWA 1EXFA 1Y3XA 2VIWA 3HGPA 2BD9A 1MQ6A 1KLJH 3KHVA 4MQAA 3MI4A 1XKAC 4JZEH 3PWBA 3K6YA 5DP7A 5JDUB 1O2GH 1H9IE 1GBBA 2SGEE 2XW9A 5ETXA 1GBLA 1N8OB 3UIRA 5T3HA 1W11U 2GMTC 1ELGA 3QX5H 2QXIA 1MH0A 1V2NT 4AX9H 3TPIZ 1SGTA 3W94A 1SGEE 1O2OA 2BD2A 4K1SA 5AFYH 1THPB 5JBCS 1L0ZA 1CGIE 1P10A 1NTPA 2CF9H 2ZTXA 1KXFA 4ZKNU 4Q2KA 4TWWA 3LJJA 1W7XH 3MTYA 3BIVH 5EW2H 3ZZDA 3DFJA 1Q31A 2GDEH 4HI3A 2QIQA 3HK3B 1ZPCA 4NIYA 1OP2A 1FN6A 1MKWK 5HXFA 1B0FA 1LCYA 1ZRBA 3ZZ7A 6LPRA 1C5UA 3AVZA 3UUZA 3RXMA 2FOAA 4FUCA 4YM9A 1GHXH 1XXFA 2HRVA 1FUJA 2BDGA 1D6RA 2AGGX 3F6UH 4TPIZ 3BG4B 1UHBA 2BD7A 4DGJA 1OWIA 2OC1A 4LXBH 3UFAA 5HMAA 2FIRH 1FY5A 1SHYA 3RU4T 1BRUP 4ISNA 3RXSA 1FNIA 2ZQ1A 2ANWA 4Y76A 4DY7B 1BTHH 5FX5A 2C4FH 2GCTC 1D9IA 3CP7A 1ELBA 3ZVEA 4XE4A 3SJOA 1SL3A 5C5OA 2EI7A 3RC5A 1FAXA 3SV6A 3JZ1B 1EX3A 1QBOA 1DXWA 1RD3B 1AVXA 1O2MA 1XUFA 2O8MA 2TBSA 4NIXA 4A7IB 2FLRH 2PW8H 2ZHQH 3F1SB 4CH2B 3ZZ4A 1D3PB 2AIQA 4O3UA 1O2LA 4TPYA 3VEQB 1KXEA 3SW2B 5A2MH 1JXPA 4INKA 2BQ6B 3A83A 3SV2H 1B0EA 5BRRE 1AUJA 1EAWA 1NRRH 1SOZA 1GVLA 1GCTB 4CBOA 2SNWA 5CMXH 1A0LA 1O37A 3RM0H 3CENA 1F92A 3PWCA 1RJXB 2PSXA 4YTAA 2BY5X 2BLWA 2BLVA 4AZ2B 4J2YB 1LHGH 3I77A 1C2EA 1P2QA 4O97A 1ZLRA 2WUCA 1OSSA 2UWLA 4DCDA 4MPUA 9LPRA 4GHQA 4IMZA 1NY22 3LPRA 3M61U 1KXCA 1DPOA 4BAQB 2FESH 4FU9A 1SMFE 3EA7A 4AGKA 1BMLA 1HIAA 2ANKH 3RXRA 1SGPE 3BTGE 5E2PA 1O3NA 1JIRA 4GHTA 3R3GB 2ZGHA 1FPCH 2PTCE 4RSPA 4A1VA 1ABIH 1N6XA 2J9NA 3QO6A 1MCVA 1BIOA 4BAOB 2VIOA 3H7TA 1PYTD 1EAUA 1KDQB 2ZDAH 3SJKA 4B76A 7GCHG 1W7GH 3SNAA 1YPKH 4HFPB 4NZQA 1S0QA 2BDIA 2ZFFH 3TU7H 5F8XA 1K1NA 1V2WT 4AG1A 2ZDVH 3F68H 1VITH 1NO9H 1A1RA 1O31A 1EZXC 2VINA 4XBCA 1MTNB 1PQAA 1HAYB 1MU6B 1CT0E 1C1VH 2ZCLP 3ZVGA 3M3VA 1UTQA 3AASA 3U8TH 1E35B 1QB6A 1RFNA 3MU5A 1O34A 3PMAB 3RXAA 2UUFB 1FY8E 4ZHLU 1NFXA 1GVKB 2GV6A 1DUEA 1PPGE 3NKKA 4OS7A 3UTUH 1GI5A 4GCHG 4ZHAA 3NWUA 4F4OC 1TNKA 5I25A 2ZEBA 1C5VA 3SUEA 4VGCC 1O5FH 1VCWA 2EA3A 1BHXB 1ELAA 1GI1A 3P8NA 2ALVA 4AG2A 2BD4A 1ELEE 3MNCA 1GJDB 3RXHA 1GHVH 1O2YA 3BF6H 4DOQA 1GHYH 4ABIA 1D3DB 4AOQA 3E16B 1AUTC 3ESTA 4FUHA 3MNSA 3UNRA 1O3IA 5TCCA 4Y7BA 3ZYEA 2GX4A 1HAZB 3URCA 3TGKE 2V0BA 1YKTA 4D9RA 3SJ8A 1GI4A 1QB9A 3Q3KA 1E0FD 3IWMA 1SI5H 4MNVA 1WV7H 4K60A 1T31A 2OLGA 2ZU4A 2VIDA 2ZGJA 2I6SA 1ARBA 1AQ7A 1EP5A 2FOGA 3A88A 1F0TA 1FN8A 1UCYK 2F3CE 2H9EH 1Y3WA 3RLWH 1SOTA 1RS0A 4JYVH 2QXJA 4X2XA 4JK6A 2VJ1A 5F8TA 2BOKA 1C5WB 3VB3A 1GBFA 4Y6DA 1HJ8A 3SO3A 3LGWA 1BJVA 1CGHA 1O2NA 1P02A 2HNTE 5LPRA 3MHWU 5DP4A 4WF8A 3E8LA 1J8AA 1ELTA 2Q1JA 2R2MB 5L30H 1EASA 1TLDA 2OP9A 1W0YH 2QAAA 2O9QA 1CGJE 4YO9A 2ASUB 4DG4A 8LPRA 2P8OC 4OGXA 5E0HA 5E8EH 3M37A 1YC0A 1LQDB 1ACBE 1D3TB 5K0HA 1F5LA 3AAVA 1A0HB 1ZYOA 1GMHF 2BQWB 1XVOA 2SGQE 2Z9KA 1LPGB 2A0QB 4JZ1A 3MNBA 1GBEA 5GIBA 2C3SA 1HJAB 2VWMA 1T8NA 2ZDLA 1ORFA 3T62A 1JMOH 2ZGBH 2FZZA 1Z8GA 3KCGH 6GCHF 3UQVA 3MU0A 2QC2A 3BTTE 1P09A 4K1TA 2H2ZA 2FX4A 1UK4A 3D23A 3SQEE 1OWEA 3OU0A 2B9LA 1GJ9B 2ZU1A 3VGCB 3GCTF 2G00A 3LH3A 4JZIA 1HCGA 1PQ5A 1LO6A