1BITA

The crystal structure of anionic salmon trypsin in a second crystal form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
222
structure length
222
Chain Sequence
b'IVGGYECKAYSQAHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of anionic salmon trypsin in a second crystal form.
pubmed doi rcsb
source organism Salmo salar
molecule tags Serine proteinase
total genus 55
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bitA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bitA02
3M5NA 3P8FA 4ZMAH 1EPTA 3L33A 3JZ2B 4UDWH 1XVOA 2WPHS 1YLCA 2JETC 1YPGH 1V2MT 4I33A 2Z3CA 1MU6B 3M7QA 3S69A 1ETSH 2Q1JA 1HJ8A 1CQQA 4CBNA 1ANCA 1O5EH 3TJVA 2FOBA 1ETRH 4ABFA 2TGDA 4AORA 1HDTH 2TGTA 4FVBA 1O2YA 1OYQA 3NXPA 4BAMB 2XW9A 3E90B 2QA9E 1MCVA 1KXDA 3HKIB 3Q3KA 2BXUH 4DJZB 4OS1A 4I8GA 1O2WA 4OGYA 1C5XB 2BM2A 3TK9A 3PWCA 1OP8A 4BANB 2CGAA 1KDQA 1RGQA 1QCPA 2C90B 2OC7A 1P02A 4XDEA 3TIUA 3UWIA 1A5IA 2ZECA 1C9TA 1GDNA 4AFSA 5JYIA 2ZPQA 1WSSH 1GBIA 4K69A 3SV9A 1C9PA 1VCPA 1QHRB 1CSOE 1ZHPA 3HK3B 3ZYEA 4NA9H 2Q6FA 2W3IA 1C2MA 3H7OA 3SZNA 1D3PB 2BLWA 1O3FA 1WYKA 4ABEA 1OPHB 3T29A 5ESBA 3UUZA 1QIXB 2VIDA 5C1XA 1TMBH 5A2MH 1ZRKA 5DGJA 1C2KA 4ABGA 1BTYA 3LU9B 1CT2E 1GG6C 5E2OA 4X1PU 2FIRH 4DG4A 2F9UA 1O2XA 1YLDA 3SJ8A 4BXSA 3P8OA 2BQ7B 1NRSH 1KXCA 2AEIH 2XCFA 1BIOA 1TQ7B 5T6FA 5JB9S 1KXAA 4TYDA 1FZZA 5ESTE 3TGIE 4AN7A 1AFEH 5C1UA 1OS8A 1T32A 4NZLA 2QXIA 2ZHQH 4D7FA 1IQJA 1E0FD 4YESB 3SUGA 2CF8H 7GCHF 1YPHE 1FY5A 1WUNH 1GI5A 1Y3UA 2H9TH 3TGJE 2ZFTA 5C67A 1GI7B 3QLPH 1SLVB 1UTKA 5A8XA 2BD2A 1K21H 5HGGA 1SSXA 2A4OA 2ODYB 2F9PA 1ZHRA 2ZEBA 3MO6A 4MG3A 1GHVH 1LPGB 3GCNA 2ODPA 3UNQA 1O2VA 2A5AA 3M5OA 1V2UT 2FESH 3VXFH 3TJUA 3LONA 1C4V2 2XNIA 4E7RG 1IOEA 1NROH 3U1IB 2BQ6B 2YNAA 3ZVBA 1SGFA 4ABAA 1LDTT 4AYYB 1O5DH 1QJ7B 2ULLA 1M9UA 3S0NA 2FXRA 1C1TA 4Y79A 3KEEA 1NFWA 5IYTA 3URCA 3GY8A 3HKJB 1X7AC 4NIVA 2BMGB 2I6QA 2FX6A 3MH5A 3RXCA 4AX9H 2ZFQH 2R3YA 7KMEH 1IQFA 1O36A 1GHZA 3TGKE 1TOCB 3EE0B 4LK4A 9LPRA 1DWEH 2P93A 3PO1C 3GY6A 1SMFE 1PPCE 1UVSH 1AFQC 1P12E 2C8WB 1FONA 1F92A 2BXTH 1QY6A 8GCHF 1S6HA 1O5FH 1S5SA 1UK3A 1D6RA 1V2RT 3ATKA 2W26A 3EDXB 3H7TA 3LGYA 1T8LA 2C93B 3MO3A 1C1NA 1WU1A 1UTLM 2ZDLA 5HM9A 4OS5A 4X6PA 1TPAE 1IHSH 2Z7FE 3ZZ5A 1ANBA 2J4IA 3LOXA 3NK8A 3RM2H 3ZZCA 2ZP0H 1V2PT 2BLOA 1FN8A 1KXFA 1XVMA 2STBE 3E16B 3PMHB 3U8OH 1GMCG 4ABDA 3RMMH 2J34A 5GJ4B 1MQ5A 1A1RA 1C2JA 1FY3A 4NIWA 1H9LB 1U6QA 1ANDA 5FBEA 3QDZB 2RCEA 3NUMA 3L6PA 1C2FA 2BZAA 5AF9H 2HNTF 2BDYA 2FPZA 4FUHA 2RA3A 2VJ1A 4B74A 2ALPA 2PHBA 3UR6A 4HI3A 3PMAB 1DY8A 3CENA 2VH0A 1EAXA 2G4TA 2ZG0H 3BTTE 1AMHA 3DHKH 1UCYH 1C2HA 2J95A 1TNGA 3SUEA 3A8AA 3KGPA 3SOSA 3KHVA 3MO9A 1A7SA 3ENSB 4SGBE 3BTDE 3B23B 1BHXB 4CRGA 2QC2A 4OS4A 1SHYA 2XC4A 4TY7A 2BDCA 4QT8C 1K1LA 4DY7B 1BHXF 1K1IA 2SGEE 1HAIH 2P8OC 1O31A 2HGTH 1SGPE 1GJBB 1TRNA 2R2MB 1FAXA 3K6ZA 3BEIB 1C1WH 1HAVB 1A4WH 1NFYA 1K1OA 2NU2E 1MTNC 5A0BA 1T8OA 1XX9A 1DICA 1UJ1A 5HMAA 1O2OA 1RTFB 4U01A 2FM2A 1VITF 3F68H 3ZZ4A 2ZGCA 1C5TA 3BEUA 3PV4A 1B0FA 5EG4A 1F0UA 1Y3VA 2G52A 4Y10E 2OC0A 3SV6A 2A32A 1GBCA 1BZXE 1ARBA 3A84A 4H6TA 3SU4A 2CHAB 1V2JT 1QFKH 4H42U 1EZUC 2BX4A 4MNWA 3M3VA 2C3SA 3BIUH 3ZZ8A 2CN0H 1OWJA 1C1PA 3A80A 5EXNA 1EP6A 1GBFA 1IQLA 2ILNA 1CA8B 3GDSA 1IQIA 2AFQB 4K1EA 5FCKA 1KXEA 1UHBB 4IMQA 1BJVA 3D65E 3PWBA 2Z3EA 3RMOH 3A7VA 1ETTH 2G00A 3RXIA 1RTLA 3M37A 1PQAA 1UK2A 3TNTA 1OP2A 2VINA 1LHCH 3QX5H 1IQGA 3D49H 5DP7A 4ASHA 2PFEA 2JETB 1HBTH 3VB5A 3W94A 3LPRA 4AB9A 1ID5H 1TALA 4MPWA 3AAVA 1FV9A 4X2WA 1GBAA 1TMUH 1LVMA 1HNEE 4UFDH 1N1LA 5JBBS 1GI1A 1P05A 1C2LA 1WV7H 1P3CA 3T25A 2V3OH 1O3NA 1AHTH 1Q2WA 4KKDA 4JYUH 3SU0A 7LPRA 1GPZA 2PSYA 3M3TA 1SLUB 3SGAE 1C5LH 3AW0A 4XOJA 3SJOA 4DW2U 3MFJA 2ZWLH 4KGAA 1GI9B 4BTIB 1HAVA 1Z1IA 4WXIA 1NN6A 3QK1A 4X6MA 1D3QB 1F2SE 5DPAA 4NA7A 1GHYH 1QB9A 1ARCA 1SGDE 1VJAU 1YGCH 8KME2 1G3EA 2DE9A 3TLOA 1TBZH 4KTSA 5CE1A 2ANKH 3PMBB 1E37B 1G2MA 4UFFH 1EZQA 1TGTA 2P94A 3STJA 1T8MA 2BD8A 3VPKA 1DSUA 3Q3YA 1AVWA 1BDAA 1TFXA 2J38A 3SNEA 4AGKA 1ZGIA 2FYRA 2HPQH 3ATLA 1XKBC 3RXLA 6GCHF 2IN2A 1FXYA 5DP9A 1IQNA 1K1NA 1B7XB 4ISOA 4A6LA 1O3CA 5FCRA 1YM0A 2TIOA 3T2NA 3FP6E 5LGOA 2JKHA 1UHBA 3QN7A 1C5ZB 5E0JA 4DCDA 4WY3A 1XUHA 4X2XA 2WUCA 2BY7X 1O2GH 1EOLA 2V6NA 1O0DH 2Z9JA 1YPEH 1GG6B 2H6MA 4MDSA 4A92A 1NZQH 2OC8A 3MH6A 1WTHD 3CS7A 2A0QB 2ALVA 3SBKA 5FX5A 2KAIB 4JZDH 1IQEA 1N8OC 1TBRH 1JRTA 1ZHMA 4OS7A 4B2CA 1EJMA 1SPJA 1S85A 1RTKA 1Z8IB 1L1GA 1ESAA 2EEKA 1W12U 1AI8H 1W14U 3LDXH 1MMJN 4TWYA 2O9QA 3UTUH 1PPHE 1O35A 2FYQA 4X1QU 3A8DA 1EQ9A 2OBOA 4SGAE 2J94A 4X2VA 1FPHH 4X1NU 2AMQA 2GCHF 3VFEA 1F0RA 1SG8B 1DVAH 1SGTA 3P70B 2A7JA 1VR1H 4YOIA 1GCTB 2QXHA 1AB9B 5EPNA 2P59A 5A09A 3S9BA 3ESTA 1KXBA 1NRRH 1QL9A 2FEQH 1TGCA 1P2QA 1Q3XA 1DPOA 5PTPA 3E0PB 1NU9A 2ZTYA 4H4FA 5FPYA 2ZU3A 5GIBA 2VIWA 1TMTH 3MOCA 2WPIS 1GBHA 3GY5A 2W5EA 5I25A 1S6FA 2QGRA 4IC6A 4DOQA 2QF0A 5EW1H 1BA8B 3B9FH 1TX7A 1O3PB 1MTSA 3QGJA 4YZUA 1CHOG 1ABIH 4BNRA 2EI7A 5DP5A 2ZA5A 1CGIE 1O3IA 3ZVAA 1FN6A 3LIWA 5AFZH 2ZDMA 2ZQ2A 3PO1B 4CHAC 4BOHA 1E36B 1O2SA 2ZGJA 1GBDA 1C1OA 3SW2B 4TWWA 1FJSA 1QQUA 2FOFA 2A4QA 2QIQA 1MQ6A 2ZCHP 4H6SB 4FVDA 5LPEA 3T26A 1MH0A 2OC1A 1P3EA 2BTCE 1UTMA 3PTBA 1T8NA 4ZROA 1C5MD 1YPHC 5CMXH 1LPKB 1BTZA 1TBQH 2KAIA 1G32B 2OQUA 3TH3H 1TQ0B 1FDPA 3MH7A 4D76A 3F9HA 3QTVH 1HV7A 3SJIA 6CHAC 1CT4E 2QF3A 1C5VA 3AASA 2FP7B 3BTHE 1C5OH 3TITA 2F9NA 2AMDA 4X2YA 5DJ7A 1GJDB 1VITH 1YPMH 2PR3A 3EA7A 3QTOH 1HJAB 2AERH 2PW8H 4AOQA 4AFQA 2XBXA 1DM4B 5EW2H 1QL8A 1BTHH 1ZSKA 2F9BH 5AHGH 1BBRH 1GL1A 4TY6A 1MBQA 1GI3A 1C1MA 2FDAA 1MTUA 5FAHA 4D9RA 1V3XA 2FOMB 1AZZA 2UUYA 3SGQE 4FU9A 1O2LA 3QZQA 4ZHAA 3SUFA 4JYVH 2BD7A 3PMJA 4GCHF 4Q7ZA 3VB6A 3A83A 4IN1A 1MUEB 1YPLH 2P8OB 2ZHFH 1BB0B 4YT7H 3F9FA 2Y80A 3UWJH 1W13U 2NU4E 4D7GA 4FU7A 1J16A 1MTNB 1Y3XA 1Y3YA 1GHBF 2EC9H 2A31A 1SGNE 3FP8E 2A7CA 3U9AH 2GGVB 2ZZUH 1H4WA 1TX8A 4NFEA 2W7UA 1IQMA 2P3UB 1NRNH 1SBWA 3A8BA 3EA9A 4O9VA 2VVVA 2D2DA 1Z1JA 1HAYB 1ZJDA 1W2KH 1PPZA 4AZ2B 1QA0A 1ZTKA 1K28D 4I8KA 3TPIZ 5FPTA 3SV7A 1AZ8A 1JWTA 3LGUA 3ODFA 1SQAA 4E05H 1YKTA 3SQHE 1Y59T 1EB2A 1SGFG 2NWNA 4ISHH 1EP5A 1O2MA 2UWPA 5DP4A 3MNXA 4D9QA 1FY8E 1UCYK 4J1YA 1TB6H 1UTOA 1KTTB 2HNTE 3BF6H 4X1RU 3RXJA 1YP9A 3ZV9A 1A3BH 2ZPRA 2H5DA 1SOZA 3EAJA 3TK5A 2BVSH 3BTKE 2WUBA 1VCWA 3S7KB 1HLTH 2DUCA 5LH8A 1C1UH 1SHHB 1MTWA 1XXDA 4X8UH 4BTTB 4NCYA 2PGBB 1GBJA 1GMHF 2ZI2H 1OOKB 2FOHA 1AE8H 1ZSLA 2Z3DA 1DOJA 1KTSB 1YYY1 1LMWB 2FS9A 1P10A 1NO9H 5F6MA 1C1VH 1TA2A 1SGEE 3PB1E 4Y7AA 2QXJA 2ZFPH 4D8NA 2AGGX 4YOJA 2Y6TA 2A5KA 2ANYA 1TLDA 3GY2A 3A8CA 4BXWA 3ODDA 3GYMA 3D23A 1TIOA 4WWYA 4MPVA 3ZV8A 1QJ1B 2V35A 3AW1A 4JK5A 2ZF0H 4MPUA 4JZEH 3GCHC 1LPZB 1KY9A 1EXFA 1B0EA 1EX3A 2A2XH 3RXGA 1ELTA 4IS5A 1VGCC 1MCTA 4XE4A 7GCHG 1DXPA 1A5GH 3MI4A 3A89A 1TNHA 4Y76A 2XCNA 1LO6A 1P2MA 1W0ZU 2R0KA 1F5KU 4THNH 3T62A 5EPYA 2M5TA 5HYOA 1O38A 3MH4A 3NCLA 1MAYA 1TPSA 1HYLA 2GX4A 3FP7E 1RJXB 3SV8A 2GMTC 1OSSA 1DSTA 1GHAF 2R2WU 3K6YA 2ZGBH 1EZSC 1QB1A 1MU8B 1SQTA 1GGDB 5G4BA 1OWKA 3SV2H 2IPHA 4WF8A 1P2OA 1BRCE 2GTBA 2BOHB 2Y5GA 2VWLA 4YT6H 3P95A 2Z9GA 5B6OA 1O2JA 2GT7A 2GZ7A 2FOGA 1EPTC 4UD9H 1P8VC 3MTYA 3NPSA 1OP0A 4FUGA 1ABJH 2WPLS 4YM9A 2PWXA 2WYGA 2DE8A 1BTPA 1O30A 3SU1A 1L0ZA 2ASUB 2C8XB 3U1JB 4FUCA 1IAUA 1NESE 5ETXA 4FU8A 1L1NA 1TGSZ 3LH3A 3NKKA 1O2HA 2B5TB 2TPIZ 5LPRA 2XRCA 1SL3A 1LQDB 8GCHG 1NT1A 1EKBB 2Z9KA 2D8WA 3MNCA 5IDKA 2GCTB 1C2GA 3FANA 1O2UA 5J4QA 3P6ZB 5FHTA 1N8OB 3RXOA 1HCGA 3BTWE 3C1KA 3T27A 4AG1A 2A2QH 3M5LA 5J4SA 4F49A 1HXEH 4OGXA 4KELA 2HALA 3SI3H 1L2EA 7ESTE 5JBCS 5C3NA 3ZZ3A 1OKXA 6LPRA 1L1JA 4HFPB 3PROA 4ZUHA 1JOUB 4IBLH 3UNRA 1FLEE 1AVXA 1PFXC 3V7TA 4B76A 1Z8RA 1LHGH 2BD9A 1SGQE 3MU0A 3V13A 2FI4E 2TGPZ 1IQHA 3ATWA 4CRDA 3EGKH 4ISIH 1E38B 3A86A 1DUEA 1ZOMA 4JMYA 5T6GA 1C5SA 1P57B 1O33A 3BN9A 4GSOA 2Z9IA 1YPJH 2TGAA 3KN2A 1AUTC 1LHDH 3RC6A 1T4UH 1O2RA 5GPIB 2STAE 1K1PA 2B0FA 1S84A 2FLRH 2ZDKA 4MNYA 4NZQA 1JIRA 1MZAA 4X8SH 1CBWB 1GJ8B 1GWAA 4R8TB 2OXSA 1DY9A 1ZSJA 1D4PB 2P3TB 2ZFRH 1P9UA 1DT2A 3F9EA 2GV7A 4LZ1H 5BPEA 3SNBA 3DFJA 1GJ4H 2AS9A 1G3DA 1SC8U 1OYTH 2I6SA 4JCNA 1C2DA 2PUQH 4NG9H 4WMEA 1GJ7B 1GBEA 3T5FH 5JB8S 1DDJA 4CHAB 3GY7A 1HAZB 4O3UA 4ISNA 1BRAA 3K2UA 1S82A 2O8TA 3TH2H 2HLCA 3E6PH 2UWOA 1TPPA 1VITG 2AMPA 1BTUA 3SORA 3OTJE 1MKWK 4YTAA 5AFYH 1DLKB 1ANEA 1G3CA 1GVZA 1W7XH 1XMNB 2BVRH 4ABIA 3GICB 1EUFA 2FTMA 1FMGA 4ESTE 1YF4A 2AIQA 5EQQA 4NWKA 4GVUA 2PKSC 1S0QA 3HGNA 1Z6EA 3NZIA 1GBBA 1PPBH 3BTFE 1MZDA 3RU4E 3TVJB 3PLBA 3AAUA 1P09A 3DUXH 2YNBA 3MU8A 1IHTH 1ELBA 1YCPM 2BY9X 3M36A 3IG6B 1HIAB 3GY3A 4ZXXH 1UTJA 1J15A 1Y5AT 2K1QA 4BTUB 1Y5UT 1TABE 1WQVH 2LPRA 4AG2A 4Y11E 1O2PA 3GDVA 5F03A 1C5RA 4B2BA 4DURA 3K65B 4JZ1A 4INKA 1BTXA 3HGPA 1C5PA 1CO7E 4E06H 1G37A 3U8RH 1UTQA 4BAKB 3ELAH 3CP7A 4LXBH 2Y5HA 3ZZAA 1TOMH 3LC3A 3RXHA 5EU8A 2EI8A 1BRBE 1A3EH 1BCUH 2FOCA 2GDEH 3DFLA 1A2CH 4LZ4B 1C5QA 1O2QA 2PLXA 3Q77A 1ORFA 1PJPA 5DP3A 2NU0E 1NFUA 2FX4A 4B71A 2BY5X 1P06A 3BEFB 2C8YB 4WH6A 2CMYA 1O3BA 1ZJKA 4NIXA 1SVPA 2QV1A 4K3JA 2ZFFH 1WOFA 3RXSA 2PTCE 1QQ4A 2GT8A 1BMNH 1ZPZA 1KYNA 3EA8A 1Q31A 2Q6DA 2WV5A 2FLBH 2OINA 5GCHF 5C20A 2A4GA 2VWNA 1QRXA 4BAQB 1AD8H 5ABWA 2OTVA 4ZKOU 4CH8B 2GP9B 2FO9A 2BVXH 3ZZ7A 4K2YA 3KCGH 3RXKA 2BDGA 3HK6B 3U8TH 5DK1A 1TGBA 1UCYE 2VU8E 8LPRA 2BX3A 1D9IA 5EQSA 1Z8JB 3KQCA 1EATA 2ZHWH 3F9GA 4DVAU 4K8BA 2IJOB 3AVZA 3O8CA 1BBRK 4F4OC 1YCPH 1LVYA 2Y81A 1TE0A 2Z94A 3V12A 1DX5M 3KL6A 1TYNA 1O32A 2XBWA 3DA9B 4A5TS 1UVTH 4Q7YA 1SLXB 1AUJA 4YLUA 3RXTA 6GCHG 4A1XA 1UTNA 2HWLB 4DIIH 4Q2KA 1TWXB 2CV3A 2BB4A 1V2WT 2BDIA 4CBOA 1HIAA 1DXWA 4IMZA 3IWMA 1O3JA 4ZAEA 2BLVA 2R9PA 5L6NH 3RMNH 1TX6A 4ABHA 3QUMP 1LCYA 1MKXH 1VJ9U 1Z8GA 4HZHA 2SNWA 4X6OA 1H9IE 3G01A 4X8VH 1RIWC 2WPMS 2FODA 3SGBE 2UUKB 3OY6U 4Y8YA 4YLQH 1PYTC 2ZKSA 3VXEH 5HM2A 1SR5C 2VH6A 1THSH 3S7HB 1HUTH 2P16A 1ZPCA 1OWEA 2GD4B 1RRKA 3U69H 3MU5A 1TRYA 4A1VA 2ZO3H 4ZKRU 1O3OA 3GCTF 5GDSH 2SGDE 5DG6A 5LPFA 4OS6A 1KIGH 1Z71A 3LT3A 1G2LA 2GCHG 3M5MA 1MKWH 3ITIA 3BTQE 3RXPA 3TNSA 1HAHH 2CJIA 1GVKB 2GMTB 1GI8B 1W8BH 1O2NA 1C2IA 5A8YA 1P2KA 1EOJA 1QL7A 4O03A 3FFGA 4MTBA 4NSYA 1O3EA 2FOAA 1F7ZA 3OYPA 1XUJA 1BJUA 1P03A 2ZTZA 1P9SA 4ZKNU 2HNTC 5JBAS 2HPPH 3O8DA 3LC5A 3SU2A 1NS3A 1C1QA 1QBNA 3BG4C 1F5RA 1N6YA 1C2EA 1OXGA 2ODQA 1FY4A 5DP8A 5F8XA 1H1BA 1T4VH 4TPIZ 1RXPA 4DT7B 2FTLE 1MD8A 3BIVH 4FUFA 1HGTH 4U32A 3VGCC 3STIA 1QTFA 3V0XA 1W11U 4GAWA 1WTGH 3JZ1B 3D62A 2ZDNA 4K5ZA 1WQSA 1O2KA 1GMDF 1S81A 2G5NA 2QY0B 2O8UA 1AFQB 3HPTB 4WMFA 5EXMA 1A0HB 1Y8TA 1AU8A 1ZRBA 4FUJA 1CT0E 3MU4A 4UEHH 4GHTA 1K1MA 1EZXC 2QAAA 1SGRE 1D3DB 3H5CB 1T31A 3FVFB 3EYDA 1BMLA 1GCDA 1DWDH 4I8LA 4X6NA 1GI4A 4JZFH 1NFXA 3M7TA 2B7DH 5HXFA 2O8MA 3UPEA 2SGFE 1TAWA 2FI5E 3SJ9A 3UNSA 4I8JA 5FXLA 1VZQH 2EA3A 4ZKSU 3C27B 4MNXA 1JBUH 5C1YA 1P04A 3KF2A 2QCYA 4MLFB 2SGQE 2WYJA 1XUGA 2ZHEH 2YOLA 3SQEE 1C5NH 3PYHA 1J8AA 3F1SB 2PTNA 2XWBI 4B2AA 1A46H 5FX6A 2O8LA 5EXLA 4Y8XA 2V0BA 3TU7H 3RLYH 3MMGA 1PQ8A 1O5AB 4GPGA 1O3DA 3GOVB 5CHAC 1WCZA 4INLA 4NFFA 4ABJA 1BOQA 2XBVA 2ANMH 3KNXA 3RUOA 3UIRA 1GI2A 3GISB 3ZZBA 3S9AA 2ZFSA 3BV9B 2V3HH 4X8TH 3SU3A 1TNIA 2C4FH 2Q6GA 2GVFA 4K8YA 3GDUA 2ZU2A 4RN6A 2A7HA 4GCHG 5FBIA 1GJ6A 1LHEH 4VGCC 1F0TA 1L4ZA 2BD3A 4LOYH 3SHAH 1P2NA 4IGDA 1W10U 4NWLA 1UK4A 3LH1A 1ZTJA 1BTWA 1QJ6B 1XKAC 1K22H 1GHBG 1ACBE 2BY8X 3RXEA 3A7YA 1ELGA 5L2YH 2AYWA 4WXVA 4HTCH 1AKSB 4MNVA 1AE5A 1HAXB 1GI0A 3PTNA 1AQ7A 1MAXA 4NIYA 1GDQA 2BDBA 4DGJA 1V2LT 1O2TA 2ESTE 3PM3A 3M3SA 4HGCA 2UUJB 4UONA 1KSNA 2ZCKP 4CRAA 4UE7H 3GY4A 2P95A 3ZZ9A 3URDA 4I32A 2PKSB 1NM6A 1V2KT 3E1XB 1GHWH 1RFNA 3KQEA 2WV4A 1QBVH 4FUDA 5A8ZA 3Q76A 2HVXA 3ZYDA 2Z9LA 1G30B 2ZDAH 9ESTA 2FWWA 5T3HA 2EI6A 3ZVEA 4Y6DA 2G5VA 4CH2B 3K9XB 1A0LA 4O97A 5DKMA 2BLQA 2R3UA 1BT7A 1GMHG 2BYAX 1SGIB 1H9HE 2ZU1A 1XXFA 3A7TA 2NU1E 1HAOH 3RXBA 1YBWA 1ZGVA 2C8ZB 3F6UH 3ZVDA 1HXFH 8ESTE 1XUKA 2CF9H 2GV6A 1CA0C 1EJNA 1E35B 1P2IA 2H5CA 4CRBA 1C4Y2 3E91A 1W0YH 4FUBA 4YOGA 1CHGA 1PQ7A 4KP0A 1C1SA 2A1DB 1H8DH 3MNBA 4M7GA 1MBMA 3B8JA 5TJXA 1INCA 4K1SA 3RXAA 2PKAB 2SNVA 4WMDA 2BD4A 3A7ZA 3BTGE 3R3GB 3Q00A 3RM0H 1OX1A 1JIMA 2GZ9A 4NGAH 1O3AA 3A87A 1UVUH 1RS0A 1BBRE 1DE7H 3SI4H 1V2ST 2ZGHA 1LTOA 3FZDA 4Y0YE 3UY9A 5F8TA 3SO3A 1AKSA 2LNCA 5L2ZH 1GHAG 1W7GH 3ATIA 3SNDA 4Z6AH 3TJOA 4CR5A 1GCTC 1ZTLA 3OX7U 3P92A 4WJG2 1PPFE 1AB9C 2W3KA 1UO6A 2GKVE 4A1TA 3SHCH 4I8HA 2RA0A 1LKBA 2J9NA 1KLJH 4WVPE 2VIPA 2ZU5A 2R0LA 1EASA 1HB0B 4Y0ZE 4CREA 2FZZA 1TGNA 1CU1A 1TONA 1UVPA 3M35A 4XBCA 1LVBA 1OWHA 2PUXB 2GDDA 2VWOA 3U98H 3VB3A 2OLGA 2Y7XA 1QA7A 4GHQA 5EQRA 3LKWA 1DWCH 1L4DA 1PYTD 2J2UA 1NPMA 4KTCA 1DFPA 1ZR0A 1ZLRA 1EJAA 1RIWB 5K7RA 2J92A 3I29A 3LGTA 3VB7A 1CGHA 2XC5A 2ZDVH 5I46H 4CR9A 1DS2E 1G3BA 1OWIA 3OSYA 1ELAA 1N6XA 2OQ5A 2SGAA 1TRMA 4GLYA 1FQ3A 2H9HA 4ABBA 1XM1A 3RC5A 1NU7B 3GYLB 2F9VA 1GDUA 5JBTA 1AIXH 1YCPK 2BHGA 2D1JA 3A81A 3SU6A 3ZVGA 3VB4A 3UOPA 4U30A 5C5NA 3TH4H 3P17H 1Z7KA 4PROA 3RXDA 4Y8ZA 1O39A 3LJJA 3RMLH 4IN2A 2W7SA 3DT0H 3TJNA 2PKAA 1GI6A 2RG3A 4U2WA 4Y7BA 3FZZA 3BSQA 1GL0E 3ZVFA 2VGCC 2Y7ZA 1F0SA 5EOKA 1QR3E 1UTPA 4MVNA 3KIDU 1GMCF 6ESTA 4A7IB 4R0IA 4UFEH 1EAIA 1HJAC 3N7OA 1FI8A 3QGNB 1D3TB 2UUFB 4ZHLU 3S9CA 1MKXK 3BG4B 3KQBA 4YO9A 4DIHH 1ZMLA 1UMAH 1D6WA 2F83A 1DANH 1BUIA 1V2NT 1O3MA 2UWLA 1TA6A 2VIVA 1GBLA 3LGWA 3HATH 3SNCA 1BITA 1PPGE 1ELCA 3VGCB 1KLIH 1G9IE 3R0FA 2AH4X 4IW4E 1WAYB 4AB8A 1B5GH 2F3CE 1ELEE 1NRPH 3PLKA 1DWBH 1TNKA 2WINI 3IITA 3P8GA 1PPEE 5DP6A 1J9CH 1GBKA 2ZC9H 1XUIA 1ZZZA 5A0CA 2G81E 4Q80A 1BMAA 3LGIA 2Z6BD 1ESBA 3EQ0H 2PV9B 1TNJA 1RD3B 2HRVA 3A7XA 4RKJB 2VIOA 5JPMH 3VEQB 1CGJE 1S83A 1SLWB 1AVGH 2ZCLP 3ZZDA 1GJCB 4I7YH 6CHAB 2FOEA 1FIZA 2GZ8A 5EODA 3SU5A 1O5CB 3ATMA 4UFGH 1V2QT 1TPOA 1Y5BT 1S0RA 2B8OH 2VIQA 2BDAA 3SN8A 1V2TT 1AN1E 2QYIA 4WH8A 2XXLA 1MD7A 5CHAB 4FUIA 3KQDA 1ELFA 3LJOA 1K1JA 4ZHMU 2SFAA 1DITH 4K1TA 4XFQA 5FPSA 1AGJA 1GBMA 1PQ5A 2BOKA 3TK6A 1VCQA 3WY8A 4O3TA 2H2ZA 2WPKS 1BRUP 3MU1A 1C5WB 1QURH 2A5IA 1QNJA 1JXPA 5E8EH 4FUEA 2OP9A 1ZYOA 4VGCB 3OU0A 3GCOA 2H9EH 2VVCA 2BDHA 5DO4H 5SGAE 1YC0A 4Y71A 5A0AE 2Y5FA 3I77A 2XTTB 3V3MA 5GCHG 1ZPBA 4JYTA 1AWFH 1DUAA 2JH5D 3O8RA 2FMJA 2BY6X 4IC5A 1QRZA 2IOTA 2PSXA 1SGCA 4ZXYH 2OD3B 4GUXA 1ELDE 1AWHB 2F9OA 5T6DA 3T28A 1HJ9A 3UQVA 2VWMA 4Q7XA 5JDUB 2H1UA 1XUFA 1GVLA 2AGIX 3A88A 1LQEA 3SNAA 2O8WA 1C4U2 3L3TA 3M61U 4XBBA 1V2VT 1KLTA 1GGDC 1G36A 1QRWA 2XBYA 3SJKA 2ZHDA 1LHFH 5C2ZA 2VNTA 3RLWH 1BMMH 3RDZA 4B1TA 4NSVA 4CRFA 4CRCA 1EAWA 3RXRA 3RXUA 3O8BA 1W3CA 1CE5A 5GWZA 5L30H 1NRQH 1Z6JH 2AIPA 3UREA 2QN5T 3ZVCA 1YPKH 2D26C 2WPJS 2RDLA 3UFAA 1A5HA 2ZNKH 1O3LA 3OY5U 2OBQA 1CA0B 3A82A 2A45B 5EGMA 1BQYA 2B9LA 3GCHB 1EAUA 1Y3WA 3FAOA 3QO6A 1QBOA 1T7CA 1HPGA 1O3KA 1K9OE 2G51A 2NU3E 2SGPE 1VGCB 1AO5A 1FUJA 1V6DA 2FS8A 5TCAA 1AY6H 1J17T 3Q3XA 4AYVB 2G55A 2GCTC 2HOBA 4JZIA 3RC4A 3GCTG 3MNSA 4X0WU 1NC6A 3E3TA 2VB0A 4MPXA 5K0HA 3MYWA 2P3FH 3CS0A 4RSPA 3M7UA 4I31A 3UR9A 2OUAA 1WBGB 3RU4D 2XC0A 3W95A 1O34A 1HAGE 1NTPA 3BTEE 3RXVA 1O2IA 2TBSA 2BQWB 5AVDA 4BAOB 5E0GA 1EB1H 1P11E 1O3HA 1FNIA 2OCVB 1CVWH 4OS2A 2G8TA 2TRMA 2ZGXH 1P0SH 4J2YB 5E0HA 4B75A 2F91A 1V2OT 1NY22 1C5UA 1TNLA 1HRTH 1EPTB 2ANWA 1UVOA 3MWIU 3UOUA 4FXGH 1QB6A 2FI3E 3MHWU 1JMOH 2G4UA 1O5BB 3SUDA 4AGJA 3RXMA 1FAKH 1H8IH 2ZTXA 4JK6A 2ZIQH 3A7WA 2JH0D 2QXGA 1DLEA 2PGQB 1F5LA 3ZZ6A 1J14A 1FPCH 1GMDG 4AFUA 1C5YB 1GBTA 1GJ9B 3RP2A 4RKOB 1CHOF 1CBWC 2THFB 3PLPA 1IQKA 4Z0KA 1GJAB 4B73A 1ELVA 1LVOA 1SFQB 1QGFA 4NA8A 3I78A 4MQAA 3QWCH 2JH6D 3RU4T 2XWAA 2Y82A 2CXVA 5C5OA 4AFZA 1KDQB 4BAHB 1SI5H 3UQOA 5E2PA 2BD5A 1O2ZA 4KTUA 1FY1A 5TCCA 2A4RA 3BG8A 2AGEX 1GHXH 1LKAA 1THPB 2CHAC 3P8NA 2XYAA 4E7NA 1ESTA 1OWDA 1P2JA 2BZ6H 5F8ZA 4INHA 3DD2H 3LGVA 1A0JA 4K60A 2VGCB 5GXPA 1SOTA 5BRRE 1GJ5H 4ISLA 4XSKU 1THRH 2VVUA 3RXQA 1SQOA 1HAPH 1MTVA 1ZMJA 3NWUA 3RXFA 3QZRA 1C1RA 1O3GA 4XBDA 2ZU4A 1E34B 1A61H 5H4IB 4ZH8A 1O37A 1O5GH 1K2I1 3A85A 1SFIA 1ZMNA 1SGYE 3E0NB 2ZQ1A 1HFDA 1FIWA 1P01A 3E8LA 4TPYA 1JRSA 1SB1H 4X1SU 2ZPSA 3BTME
chains in the Genus database with same CATH superfamily
3M5NA 3P8FA 4ZMAH 1EPTA 3L33A 3JZ2B 4UDWH 1XVOA 2WPHS 2WV9A 1YLCA 2JETC 1YPGH 1V2MT 4I33A 1H8HD 2Z3CA 1MU6B 3M7QA 3S69A 1ETSH 2Q1JA 1HJ8A 1CQQA 4CBNA 1ANCA 1O5EH 3TJVA 2FOBA 1ETRH 4ABFA 2TGDA 4AORA 1HDTH 2TGTA 4FVBA 1O2YA 1OYQA 3NXPA 4BAMB 2XW9A 3E90B 2QA9E 1MCVA 1KXDA 3HKIB 3Q3KA 2BXUH 4DJZB 4OS1A 4I8GA 1O2WA 4OGYA 1C5XB 2BM2A 3TK9A 3PWCA 1OP8A 4BANB 2CGAA 1KDQA 1RGQA 1QCPA 2C90B 2OC7A 1P02A 4XDEA 3TIUA 3UWIA 1A5IA 2ZECA 1C9TA 1GDNA 4AFSA 5JYIA 2ZPQA 1WSSH 1GBIA 4K69A 3SV9A 1C9PA 1VCPA 1QHRB 1CSOE 1ZHPA 3HK3B 5B6LA 3ZYEA 4NA9H 2Q6FA 2W3IA 1C2MA 3H7OA 3SZNA 1D3PB 2BLWA 1O3FA 1WYKA 4ABEA 1OPHB 4RT1A 3T29A 5ESBA 3UUZA 1QIXB 2VIDA 5C1XA 1TMBH 5A2MH 1ZRKA 5DGJA 1C2KA 4ABGA 1BTYA 3LU9B 1CT2E 1GG6C 5E2OA 4X1PU 2FIRH 4DG4A 2F9UA 1NBME 1O2XA 1YLDA 3EE7A 3SJ8A 4BXSA 3P8OA 2BQ7B 1NRSH 1KXCA 2AEIH 2XCFA 1BIOA 1TQ7B 5T6FA 5JB9S 1KXAA 4TSFD 4TYDA 1FZZA 5ESTE 3TGIE 4AN7A 1AFEH 3GS9A 5C1UA 3N99A 1OS8A 1T32A 4NZLA 2QXIA 2ZHQH 4D7FA 1IQJA 1E0FD 4YESB 3SUGA 2JIZD 2CF8H 7GCHF 1YPHE 1FY5A 1WUNH 1GI5A 1Y3UA 2H9TH 3TGJE 2ZFTA 3H09A 1QZ8A 5C67A 1GI7B 3QLPH 1SLVB 1UTKA 5A8XA 2BD2A 1K21H 5HGGA 1SSXA 2A4OA 2ODYB 2F9PA 1ZHRA 2ZEBA 3MO6A 4MG3A 1GHVH 1LPGB 3GCNA 2ODPA 3UNQA 1O2VA 2A5AA 3DSOA 3M5OA 2HLDD 1V2UT 2FESH 3VXFH 3TJUA 5HKKD 3LONA 1C4V2 2XNIA 4E7RG 1IOEA 1NROH 3U1IB 2BQ6B 2YNAA 2KX4A 3ZVBA 1SGFA 4ABAA 1LDTT 4AYYB 1O5DH 1QJ7B 2ULLA 3SZEA 1M9UA 3S0NA 2FXRA 1C1TA 4Y79A 3KEEA 1NFWA 5IYTA 3URCA 3GY8A 3HKJB 1X7AC 4NIVA 2BMGB 2K0QA 2I6QA 2FX6A 3MH5A 3RXCA 4AX9H 2ZFQH 2R3YA 7KMEH 1IQFA 1O36A 1GHZA 3TGKE 1TOCB 3EE0B 4LK4A 9LPRA 1DWEH 2P93A 3PO1C 3GY6A 1SMFE 1PPCE 1UVSH 1AFQC 1P12E 2C8WB 1FONA 1F92A 2BXTH 1QY6A 8GCHF 1S6HA 1O5FH 1S5SA 1H8ED 1D6RA 1UK3A 1V2RT 3ATKA 2W26A 3EDXB 3H7TA 3CNRA 3LGYA 1T8LA 2C93B 2IJD1 3MO3A 1C1NA 1WU1A 1UTLM 2ZDLA 5HM9A 4OS5A 4X6PA 1TPAE 1IHSH 2Z7FE 3ZZ5A 1ANBA 2J4IA 3LOXA 3NK8A 3RM2H 1BMFD 3ZZCA 2ZP0H 1V2PT 2BLOA 1FN8A 1KXFA 1XVMA 2STBE 3E16B 3PMHB 3U8OH 1GMCG 4ABDA 2JJ1D 3RMMH 2J34A 5GJ4B 1MQ5A 1A1RA 1C2JA 1FY3A 4NIWA 1H9LB 1U6QA 1ANDA 5FBEA 3QDZB 2RCEA 3NUMA 3L6PA 1C2FA 2BZAA 5AF9H 2HNTF 2BDYA 2FPZA 4FUHA 2M2AA 2RA3A 2VJ1A 4B74A 2ALPA 2PHBA 3UR6A 4HI3A 3PMAB 1DY8A 2QF5A 3CENA 2VH0A 1EAXA 2G4TA 2ZG0H 3BTTE 1AMHA 3DHKH 1UCYH 1C2HA 2J95A 1TNGA 3SUEA 3A8AA 3KGPA 3SOSA 3KHVA 3MO9A 5EJ1A 1A7SA 1UW7A 3ENSB 4SGBE 3BTDE 3B23B 1BHXB 4CRGA 2QC2A 4OS4A 1SHYA 2XC4A 4TY7A 2BDCA 4QT8C 1K1LA 4DY7B 1BHXF 1K1IA 2SGEE 1HAIH 2P8OC 1O31A 2HGTH 1SGPE 2KR7A 1GJBB 1TRNA 2KFWA 2R2MB 1FAXA 3K6ZA 4B6FA 3BEIB 1C1WH 1HAVB 1A4WH 1NFYA 1K1OA 2NU2E 1MTNC 5A0BA 1T8OA 1XX9A 1DICA 2YMSD 1UJ1A 5HMAA 1O2OA 1RTFB 4U01A 2FM2A 1VITF 3F68H 3ZZ4A 2ZGCA 1C5TA 3BEUA 3PV4A 1B0FA 5EG4A 2YMSB 1F0UA 1Y3VA 2G52A 4Y10E 2OC0A 3SV6A 2A32A 1GBCA 1BZXE 1ARBA 3A84A 4H6TA 3SU4A 2CHAB 4Z1MD 1V2JT 1QFKH 4H42U 1EZUC 2BX4A 4MNWA 3M3VA 2C3SA 3BIUH 3ZZ8A 2CN0H 1OWJA 1C1PA 3A80A 1KMHB 5EXNA 1EP6A 1GBFA 1IQLA 2ILNA 1CA8B 3GDSA 1IQIA 2AFQB 4K1EA 5FCKA 1KXEA 1UHBB 4IMQA 1BJVA 3D65E 3PWBA 2Z3EA 3RMOH 3A7VA 1ETTH 2G00A 3RXIA 1RTLA 3M37A 1PQAA 1UK2A 3TNTA 1OP2A 2VINA 1LHCH 3QX5H 1IQGA 3D49H 5DP7A 4ASHA 2PFEA 2JETB 1HBTH 3VB5A 3W94A 3LPRA 4AB9A 1ID5H 1TALA 3FKSD 3AAVA 4MPWA 1FV9A 4X2WA 4ACAA 1GBAA 1TMUH 1LVMA 1HNEE 4UFDH 1N1LA 5JBBS 1GI1A 1P05A 1C2LA 1WV7H 1P3CA 3T25A 2V3OH 1O3NA 1AHTH 1Q2WA 4KKDA 4JYUH 5HIYA 3SU0A 5EJZA 7LPRA 4B6EA 1GPZA 2PSYA 3M3TA 1SLUB 3SGAE 1C5LH 3AW0A 4XOJA 3SJOA 2F4LA 4DW2U 3MFJA 2ZWLH 4KGAA 1GI9B 4BTIB 1HAVA 1Z1IA 4WXIA 1NN6A 3QK1A 4X6MA 1D3QB 1F2SE 5DPAA 4NA7A 1GHYH 1QB9A 1OHHD 1ARCA 1SGDE 1VJAU 1YGCH 8KME2 1G3EA 1YWUA 2DE9A 3TLOA 1TBZH 4KTSA 5CE1A 2ANKH 3PMBB 1E37B 1G2MA 4UFFH 1EZQA 1TGTA 2P94A 3STJA 1T8MA 2BD8A 3VPKA 1DSUA 3Q3YA 1AVWA 1BDAA 1TFXA 2J38A 3SNEA 1W0JD 4AGKA 1ZGIA 2FYRA 2HPQH 3ATLA 1W0KD 1XKBC 3RXLA 6GCHF 2IN2A 1FXYA 5DP9A 1IQNA 1K1NA 1B7XB 4ISOA 4A6LA 1O3CA 5FCRA 1YM0A 1WXRA 2TIOA 3T2NA 3FP6E 5LGOA 2JKHA 1UHBA 3QN7A 1C5ZB 5E0JA 4DCDA 4WY3A 1XUHA 4X2XA 2WUCA 2BY7X 1O2GH 1EOLA 2V6NA 1O0DH 2Z9JA 1YPEH 1GG6B 2H6MA 4MDSA 4A92A 1NZQH 2OC8A 3MH6A 1WTHD 3CS7A 2A0QB 2ALVA 3SBKA 5FX5A 2KAIB 4JZDH 1IQEA 1N8OC 1TBRH 1JRTA 1ZHMA 4OS7A 4B2CA 1EJMA 1SPJA 1S85A 1RTKA 1Z8IB 1L1GA 1ESAA 2EEKA 1W12U 1AI8H 3UB0A 1W14U 3LDXH 1MMJN 4TWYA 2O9QA 3UTUH 1PPHE 1O35A 2FYQA 4X1QU 3A8DA 1EQ9A 2OBOA 4SGAE 2J94A 4X2VA 1FPHH 4X1NU 2AMQA 2GCHF 3VFEA 1F0RA 1SG8B 1DVAH 4XRNA 1SGTA 3P70B 2A7JA 1VR1H 4YOIA 1GCTB 2QXHA 1AB9B 5EPNA 4RI0A 2P59A 5A09A 3S9BA 3ESTA 1KXBA 1NRRH 1QL9A 2FEQH 3PRDA 1TGCA 1P2QA 1Q3XA 1DPOA 5PTPA 3E0PB 1NU9A 2ZTYA 4H4FA 5FPYA 2ZU3A 5GIBA 2VIWA 1TMTH 3MOCA 2WPIS 1GBHA 3GY5A 2L74A 2W5EA 5I25A 1S6FA 2QGRA 4IC6A 4DOQA 2QF0A 5EW1H 1BA8B 3B9FH 1TX7A 1O3PB 1MTSA 3QGJA 4YZUA 1CHOG 1ABIH 4BNRA 2EI7A 5DP5A 2RFKC 2ZA5A 1CGIE 1O3IA 3ZVAA 1FN6A 3LIWA 5AFZH 2ZDMA 2ZQ2A 3PO1B 4CHAC 5T1VA 4BOHA 1E36B 1O2SA 2ZGJA 1GBDA 5KECA 1C1OA 3SW2B 4TWWA 3PV2A 1FJSA 1QQUA 2FOFA 2A4QA 2QIQA 1MQ6A 2ZCHP 4H6SB 4FVDA 5LPEA 3T26A 1MH0A 2OC1A 1P3EA 3N7DA 2BTCE 1UTMA 3PTBA 1T8NA 4ZROA 1C5MD 1MABB 1YPHC 5CMXH 1LPKB 1BTZA 1TBQH 2KAIA 1G32B 2OQUA 3TH3H 1TQ0B 1FDPA 3MH7A 4D76A 3F9HA 3QTVH 1HV7A 3SJIA 6CHAC 1CT4E 2QF3A 1C5VA 3AASA 2FP7B 3BTHE 1C5OH 4M9FA 3TITA 2F9NA 5KEDA 2AMDA 4X2YA 5DJ7A 1GJDB 1VITH 1YPMH 2PR3A 3EA7A 3QTOH 1HJAB 2AERH 2PW8H 4AOQA 4AFQA 2XBXA 1DM4B 5EW2H 1QL8A 1BTHH 1SKYE 1ZSKA 2F9BH 5AHGH 1BBRH 1GL1A 3AK5A 4TY6A 1MBQA 1GI3A 1C1MA 2FDAA 1MTUA 5FAHA 4D9RA 1V3XA 2FOMB 1AZZA 5GNDA 2UUYA 3SGQE 4FU9A 1O2LA 3QZQA 4ZHAA 3SUFA 4JYVH 2BD7A 3PMJA 4GCHF 4Q7ZA 3VB6A 3A83A 4IN1A 1MUEB 1YPLH 2P8OB 2ZHFH 1BB0B 4YT7H 3F9FA 2Y80A 3UWJH 1W13U 2NU4E 4D7GA 4FU7A 5CHBA 1J16A 1MTNB 1Y3XA 1Y3YA 1GHBF 2EC9H 2A31A 1SGNE 3FP8E 2A7CA 3U9AH 2GGVB 2ZZUH 1H4WA 1TX8A 4NFEA 2W7UA 1IQMA 2P3UB 1NRNH 1SBWA 2EY4C 3A8BA 3EA9A 4O9VA 2VVVA 2D2DA 1Z1JA 1HAYB 1ZJDA 1W2KH 1PPZA 4AZ2B 1QA0A 1ZTKA 1K28D 4I8KA 3TPIZ 5FPTA 3SV7A 1AZ8A 1JWTA 3LGUA 3ODFA 1SQAA 4E05H 1YKTA 3SQHE 1Y59T 1EB2A 1SGFG 2NWNA 4ISHH 1EP5A 1O2MA 2UWPA 2KCAA 5DP4A 3MNXA 4D9QA 1FY8E 1UCYK 4J1YA 1TB6H 1UTOA 1KTTB 2HNTE 3BF6H 4X1RU 3RXJA 1YP9A 3ZV9A 1A3BH 2ZPRA 2JDID 2H5DA 1SOZA 3EAJA 3TK5A 2BVSH 3BTKE 2WUBA 4F55A 1VCWA 3S7KB 1HLTH 2DUCA 5LH8A 1C1UH 1SHHB 1MTWA 1XXDA 4X8UH 4OM9A 4BTTB 4NCYA 2PGBB 1GBJA 1GMHF 2ZI2H 1OOKB 2FOHA 1AE8H 1ZSLA 2Z3DA 1DOJA 1KTSB 1YYY1 1LMWB 2FS9A 1P10A 1NO9H 5F6MA 1C1VH 1TA2A 1SGEE 3PB1E 2WPDD 4Y7AA 2QXJA 2ZFPH 4D8NA 2AGGX 4YOJA 2Y6TA 2A5KA 2ANYA 1TLDA 2CK3D 3GY2A 3A8CA 4BXWA 2KCPA 3ODDA 3GYMA 3D23A 1TIOA 4WWYA 4MPVA 3ZV8A 1QJ1B 2V35A 3AW1A 4JK5A 2ZF0H 4MPUA 4JZEH 3GCHC 1LPZB 1KY9A 1EXFA 1B0EA 1EX3A 2A2XH 3RXGA 1ELTA 4IS5A 1VGCC 1MCTA 4XE4A 7GCHG 1DXPA 1A5GH 3MI4A 3A89A 1TNHA 4Y76A 2XCNA 1LO6A 1P2MA 1W0ZU 2R0KA 1F5KU 4THNH 3T62A 5EPYA 2M5TA 5HYOA 1O38A 1S6LA 3MH4A 3NCLA 1MAYA 1TPSA 1HYLA 2GX4A 3FP7E 1RJXB 3SV8A 2GMTC 1OSSA 2J98A 1DSTA 1GHAF 2R2WU 3K6YA 2ZGBH 1EZSC 1QB1A 1MU8B 1SQTA 1GGDB 5G4BA 1OWKA 3SV2H 2IPHA 4WF8A 1P2OA 1BRCE 2GTBA 2BOHB 2Y5GA 2VWLA 4YT6H 3P95A 2Z9GA 5B6OA 1O2JA 2GT7A 2GZ7A 2WZQA 2FOGA 1EPTC 4UD9H 1P8VC 3MTYA 3NPSA 1OP0A 4FUGA 1ABJH 2WPLS 4YM9A 4ACBA 2PWXA 2WYGA 2DE8A 1BTPA 1O30A 2WSSD 3SU1A 1L0ZA 2ASUB 2C8XB 3U1JB 4FUCA 1IAUA 1NESE 5ETXA 4FU8A 1L1NA 1TGSZ 3LH3A 3NKKA 1O2HA 2B5TB 2TPIZ 5LPRA 2XRCA 1SL3A 1LQDB 8GCHG 1NT1A 1EKBB 2Z9KA 2D8WA 3MNCA 5IDKA 2GCTB 1C2GA 3FANA 1O2UA 5J4QA 3P6ZB 5FHTA 1N8OB 3RXOA 1HCGA 3BTWE 3C1KA 3T27A 4AG1A 2A2QH 3M5LA 5J4SA 4F49A 1HXEH 4FOUC 4OGXA 4KELA 2HALA 3SI3H 1L2EA 7ESTE 5JBCS 5C3NA 3ZZ3A 1OKXA 6LPRA 1L1JA 4HFPB 3PROA 4ZUHA 1JOUB 4IBLH 3UNRA 1FLEE 1AVXA 3WW7A 1PFXC 3V7TA 4B76A 1Z8RA 1LHGH 2BD9A 1SGQE 3MU0A 3V13A 2FI4E 2TGPZ 1IQHA 3ATWA 2QE7D 4CRDA 3EGKH 4ISIH 1E38B 3A86A 1DUEA 1ZOMA 4JMYA 5T6GA 1C5SA 1P57B 1O33A 3BN9A 4GSOA 2Z9IA 1YPJH 2TGAA 3KN2A 1AUTC 1LHDH 3PV5A 3RC6A 1T4UH 1O2RA 5GPIB 2STAE 1K1PA 2B0FA 1S84A 2FLRH 2ZDKA 4MNYA 4NZQA 1JIRA 1MZAA 4X8SH 1CBWB 1GJ8B 1GWAA 4R8TB 2OXSA 3F2HA 3PRBA 1DY9A 1ZSJA 2KCYA 1D4PB 2P3TB 2ZFRH 1P9UA 1DT2A 3F9EA 1NBMD 2GV7A 4LZ1H 5BPEA 3SNBA 3DFJA 1E1RD 1GJ4H 2AS9A 1G3DA 1SC8U 1OYTH 2I6SA 4JCNA 1C2DA 2PUQH 4NG9H 4WMEA 1GJ7B 1GBEA 3T5FH 5JB8S 1DDJA 4CHAB 3GY7A 1HAZB 4O3UA 4ISNA 1BRAA 3K2UA 1S82A 2O8TA 5F53A 3TH2H 2HLCA 3E6PH 2UWOA 1TPPA 1VITG 2AMPA 1BTUA 3SORA 3OTJE 1MKWK 4YTAA 5AFYH 1DLKB 1ANEA 1G3CA 1GVZA 1W7XH 2K8IA 1XMNB 2BVRH 4ABIA 3GICB 1EUFA 2FTMA 1FMGA 4ESTE 1YF4A 2AIQA 5EQQA 4P02A 5C17A 4NWKA 4GVUA 2PKSC 1S0QA 3HGNA 1Z6EA 3NZIA 1GBBA 1PPBH 1YY3A 3F2GA 3BTFE 1MZDA 3RU4E 3TVJB 3PLBA 3AAUA 1P09A 3DUXH 2YNBA 3MU8A 1IHTH 1ELBA 1YCPM 2BY9X 3M36A 3IG6B 1HIAB 3GY3A 4ZXXH 1UTJA 1J15A 1Y5AT 2K1QA 4BTUB 1Y5UT 1TABE 1WQVH 2LPRA 4AG2A 4Y11E 1O2PA 3GDVA 5F03A 1C5RA 4B2BA 4DURA 3K65B 3F0PA 4JZ1A 2KZ4A 4INKA 1BTXA 3HGPA 1C5PA 1CO7E 1SQRA 4E06H 1G37A 3U8RH 1UTQA 4BAKB 3ELAH 3CP7A 4LXBH 2Y5HA 3ZZAA 4F48B 1TOMH 3LC3A 3RXHA 5EU8A 2EI8A 1BRBE 4FETA 1A3EH 1BCUH 2FOCA 2GDEH 3DFLA 1A2CH 2J5UA 4LZ4B 2OK5A 1WDIA 1C5QA 1O2QA 2PLXA 3Q77A 1ORFA 1PJPA 5DP3A 2NU0E 1NFUA 2FX4A 4B71A 2BY5X 1P06A 3BEFB 2C8YB 4WH6A 2CMYA 1O3BA 1ZJKA 4NIXA 1SVPA 2QV1A 4K3JA 2ZFFH 1WOFA 3RXSA 2PTCE 1QQ4A 2GT8A 1BMNH 1ZPZA 1KYNA 3EA8A 5IK2D 1Q31A 2Q6DA 2WV5A 2FLBH 2OINA 5GCHF 5C20A 2A4GA 2VWNA 1QRXA 4BAQB 1AD8H 5ABWA 2OTVA 4ZKOU 4CH8B 2GP9B 2FO9A 2BVXH 3ZZ7A 4K2YA 3KCGH 3RXKA 2BDGA 3HK6B 3U8TH 5DK1A 1TGBA 1UCYE 2VU8E 8LPRA 2BX3A 1D9IA 5EQSA 1Z8JB 3KQCA 1EATA 2ZHWH 3F9GA 4DVAU 1COWD 4K8BA 2IJOB 3AVZA 5DSFA 3O8CA 1BBRK 4F4OC 1YCPH 1LVYA 2Y81A 1TE0A 2Z94A 3V12A 1DX5M 3KL6A 1TYNA 1O32A 2XBWA 3DA9B 4A5TS 1UVTH 4Q7YA 1SLXB 1AUJA 4YLUA 3RXTA 6GCHG 4A1XA 1UTNA 2HWLB 4DIIH 4Q2KA 1TWXB 2CV3A 2BB4A 1V2WT 2BDIA 4CBOA 1HIAA 1DXWA 4IMZA 3IWMA 1O3JA 4ZAEA 2BLVA 2R9PA 5DN6D 5L6NH 3RMNH 1TX6A 4ABHA 3QUMP 1LCYA 1MKXH 1VJ9U 1Z8GA 4HZHA 2SNWA 4P00A 4X6OA 1H9IE 3G01A 4X8VH 1RIWC 2WPMS 2FODA 3FO8D 3SGBE 2UUKB 3OY6U 4HG6A 4Y8YA 4YLQH 1PYTC 2ZKSA 3VXEH 5HM2A 1SR5C 2VH6A 1THSH 3S7HB 1HUTH 2P16A 1ZPCA 1OWEA 2GD4B 1RRKA 3U69H 3MU5A 1TRYA 4A1VA 2ZO3H 4ZKRU 1O3OA 3GCTF 5GDSH 2SGDE 5DG6A 5LPFA 4OS6A 1KIGH 1Z71A 3LT3A 1G2LA 2GCHG 3M5MA 4I86A 2KM0A 1MKWH 3ITIA 3BTQE 3RXPA 3TNSA 1HAHH 2CJIA 1GVKB 2GMTB 1GI8B 2V3MA 1W8BH 1O2NA 1C2IA 5A8YA 1P2KA 1EOJA 1QL7A 4O03A 3FFGA 4MTBA 4NSYA 1O3EA 4ASUD 2FOAA 2XOKD 1F7ZA 3WWBA 3OYPA 2WHXA 1XUJA 1BJUA 1P03A 2ZTZA 1P9SA 4ZKNU 2HNTC 5JBAS 2HPPH 3O8DA 3LC5A 3SU2A 1NS3A 1C1QA 4ZCNA 1QBNA 3BG4C 1F5RA 1N6YA 1C2EA 1OXGA 2ODQA 1FY4A 5DP8A 5F8XA 1H1BA 1T4VH 4TPIZ 1RXPA 4DT7B 2FTLE 1MD8A 3BIVH 4FUFA 1HGTH 4U32A 3VGCC 3STIA 1QTFA 3V0XA 1W11U 4GAWA 1WTGH 3JZ1B 3D62A 2ZDNA 4K5ZA 1WQSA 1O2KA 3OFND 1GMDF 1S81A 2G5NA 2QY0B 2O8UA 1AFQB 3HPTB 4WMFA 2GJGA 5EXMA 1A0HB 1Y8TA 1AU8A 1ZRBA 3U28C 4FUJA 1CT0E 3MU4A 4UEHH 4GHTA 1K1MA 1EZXC 2QAAA 1SGRE 1D3DB 3H5CB 1T31A 3FVFB 3EYDA 1BMLA 1GCDA 1DWDH 4I8LA 4X6NA 1GI4A 4JZFH 1NFXA 3M7TA 2B7DH 5HXFA 2O8MA 3UPEA 1K0HA 2SGFE 1TAWA 2FI5E 3SJ9A 3UNSA 4I8JA 5FXLA 1VZQH 2EA3A 4ZKSU 3C27B 4MNXA 1JBUH 5C1YA 1P04A 3KF2A 3NRLA 2QCYA 4MLFB 5C94A 2SGQE 2WYJA 1XUGA 2ZHEH 2YOLA 3SQEE 1C5NH 3PYHA 1J8AA 3F1SB 1E79D 2PTNA 2XWBI 4B2AA 1A46H 5FX6A 2O8LA 5EXLA 4Y8XA 2V0BA 3TU7H 3RLYH 3MMGA 1PQ8A 1O5AB 4GPGA 1O3DA 3GOVB 5CHAC 1WCZA 4INLA 4NFFA 4ABJA 1BOQA 2XBVA 3F0OA 2ANMH 3KNXA 2VBCA 3RUOA 3UIRA 1GI2A 3GISB 3ZZBA 3S9AA 2ZFSA 3BV9B 2V3HH 4X8TH 3SU3A 1TNIA 2C4FH 2Q6GA 2GVFA 4K8YA 3GDUA 2ZU2A 4RN6A 2A7HA 4GCHG 5FBIA 1GJ6A 1LHEH 4VGCC 1F0TA 1L4ZA 2BD3A 4LOYH 3SHAH 1P2NA 4IGDA 1W10U 4NWLA 1UK4A 3LH1A 1ZTJA 1BTWA 1QJ6B 1XKAC 1K22H 1GHBG 1ACBE 2BY8X 3RXEA 3A7YA 1ELGA 5L2YH 2J98B 2AYWA 4WXVA 4HTCH 1AKSB 4MNVA 1AE5A 1HAXB 1GI0A 3PTNA 4YXWD 1AQ7A 1MAXA 4NIYA 4AC9A 1GDQA 2BDBA 4DGJA 1V2LT 1O2TA 2ESTE 3PM3A 3M3SA 4HGCA 2UUJB 4UONA 1KSNA 2ZCKP 4CRAA 4UE7H 3GY4A 2P95A 3ZZ9A 3URDA 4I32A 2PKSB 1NM6A 1V2KT 3E1XB 1GHWH 1RFNA 3KQEA 2WV4A 1QBVH 4FUDA 5A8ZA 3Q76A 2HVXA 3ZYDA 2Z9LA 1G30B 2ZDAH 9ESTA 2FWWA 5T3HA 2EI6A 3ZVEA 4Y6DA 2G5VA 4CH2B 3K9XB 1A0LA 4O97A 5DKMA 2BLQA 2R3UA 1BT7A 1GMHG 3FN8A 2BYAX 1SGIB 4Q4LA 1H9HE 2ZU1A 1XXFA 3A7TA 2NU1E 1HAOH 3RXBA 1YBWA 1ZGVA 2C8ZB 3F6UH 1VKYA 3ZVDA 1HXFH 8ESTE 1XUKA 2CF9H 2GV6A 2F43B 1CA0C 1EJNA 1E35B 1P2IA 2H5CA 4CRBA 1C4Y2 3E91A 1W0YH 4FUBA 4YOGA 4Q63A 1CHGA 1PQ7A 4KP0A 1C1SA 2A1DB 1H8DH 3MNBA 4M7GA 1MBMA 3B8JA 5TJXA 1INCA 4K1SA 3RXAA 2PKAB 2SNVA 4WMDA 2BD4A 3A7ZA 3BTGE 3R3GB 3Q00A 3RM0H 1OX1A 1JIMA 2GZ9A 4NGAH 1O3AA 3A87A 1UVUH 1RS0A 5FL7D 1BBRE 1DE7H 3SI4H 1V2ST 2ZGHA 1LTOA 3FZDA 4Y0YE 3UY9A 5F8TA 3SO3A 1AKSA 2LNCA 5L2ZH 1GHAG 1W7GH 3ATIA 3SNDA 4Z6AH 2EQNA 3TJOA 4CR5A 2HVYB 1GCTC 1ZTLA 3OX7U 3P92A 4WJG2 1PPFE 1AB9C 2W3KA 1UO6A 2GKVE 4A1TA 3SHCH 4I8HA 2RA0A 1LKBA 1E1QD 2J9NA 1KLJH 4WVPE 2VIPA 2ZU5A 2R0LA 1EASA 1HB0B 4Y0ZE 4CREA 5C0UA 2FZZA 1TGNA 3F2FA 1CU1A 1TONA 1UVPA 3M35A 4XBCA 1LVBA 1OWHA 2PUXB 2GDDA 2VWOA 3U98H 3VB3A 2OLGA 2Y7XA 1QA7A 4GHQA 5EQRA 3LKWA 1DWCH 1L4DA 1PYTD 2J2UA 1NPMA 4KTCA 1DFPA 1ZR0A 1ZLRA 1EJAA 1RIWB 3OEHD 5K7RA 2J92A 3DSGA 3I29A 3LGTA 3VB7A 1CGHA 2XC5A 2ZDVH 5I46H 4CR9A 1DS2E 1G3BA 1OWIA 3OSYA 1ELAA 1N6XA 2OQ5A 2SGAA 1TRMA 4GLYA 1FQ3A 2H9HA 3N7EA 4ABBA 1XM1A 3RC5A 1NU7B 3GYLB 2F9VA 1GDUA 5JBTA 1AIXH 1YCPK 4DT4A 2BHGA 2D1JA 3OAAD 3A81A 3SU6A 3KYFA 3ZVGA 3VB4A 3UOPA 4U30A 5C5NA 3TH4H 3P17H 1Z7KA 4PROA 3RXDA 4Y8ZA 1O39A 3LJJA 3RMLH 4IN2A 2W7SA 3DT0H 3TJNA 2PKAA 1GI6A 2RG3A 4U2WA 4Y7BA 3FZZA 3BSQA 1GL0E 3ZVFA 2IPQX 2VGCC 2Y7ZA 1F0SA 5EOKA 3KQ5A 1QR3E 1UTPA 4MVNA 3KIDU 1GMCF 6ESTA 4A7IB 4R0IA 4UFEH 2V7QD 1EAIA 1HJAC 3N7OA 1FI8A 2QF4A 3QGNB 1D3TB 2UUFB 4ZHLU 3S9CA 1MKXK 3BG4B 3KQBA 4YO9A 4DIHH 1ZMLA 1UMAH 1D6WA 2F83A 1DANH 1BUIA 1V2NT 1O3MA 2UWLA 1TA6A 2VIVA 1GBLA 3LGWA 3HATH 3SNCA 1BITA 1PPGE 1ELCA 3VGCB 1KLIH 1G9IE 3R0FA 2AH4X 2AHME 4IW4E 1WAYB 4AB8A 1B5GH 2F3CE 1ELEE 1NRPH 3PLKA 1DWBH 1TNKA 2WINI 3IITA 3P8GA 1PPEE 5DP6A 1J9CH 1GBKA 2ZC9H 1XUIA 1ZZZA 5A0CA 2G81E 4Q80A 1BMAA 3LGIA 2Z6BD 1ESBA 3EQ0H 2PV9B 1TNJA 1RD3B 2HRVA 3A7XA 4RKJB 2VIOA 5JPMH 3VEQB 1CGJE 1S83A 1SLWB 2J97A 1AVGH 5EJLA 2ZCLP 3ZZDA 1GJCB 4I7YH 6CHAB 2FOEA 1FIZA 2GZ8A 5EODA 3SU5A 1O5CB 3ATMA 3WWFA 4UFGH 3KYGA 1V2QT 1TPOA 1Y5BT 1S0RA 2B8OH 2VIQA 2BDAA 3SN8A 3MQKC 1V2TT 1AN1E 2QYIA 4WH8A 2XXLA 1MD7A 5CHAB 4FUIA 3KQDA 1ELFA 3LJOA 1K1JA 4ZHMU 2SFAA 1DITH 4K1TA 4XFQA 5KGOA 4RT0A 5FPSA 1AGJA 1GBMA 1PQ5A 2BOKA 3TK6A 1VCQA 3WY8A 4O3TA 2H2ZA 2WPKS 5C0TA 1BRUP 3MU1A 1C5WB 1QURH 2A5IA 3W1EA 1QNJA 1JXPA 5E8EH 4FUEA 5HIZA 2OP9A 1ZYOA 4VGCB 3OU0A 3VG8A 3GCOA 2H9EH 2VVCA 2BDHA 5DO4H 5SGAE 1YC0A 4Y71A 5A0AE 2Y5FA 3I77A 1YLNA 2XTTB 3V3MA 5GCHG 1ZPBA 4JYTA 4XD7D 3UAIC 1AWFH 1DUAA 2JH5D 2KCOA 3O8RA 2FMJA 2BY6X 4IC5A 1QRZA 2IOTA 2PSXA 1SGCA 4ZXYH 2OD3B 4GUXA 1ELDE 1AWHB 2F9OA 5T6DA 3T28A 1HJ9A 3UQVA 2VWMA 4Q7XA 5EIYA 2H1UA 5JDUB 1XUFA 1GVLA 2AGIX 3A88A 1LQEA 3SNAA 2O8WA 1C4U2 2PP6A 3L3TA 3M61U 4XBBA 1V2VT 1KLTA 1GGDC 1G36A 1QRWA 2XBYA 3SJKA 2ZHDA 1LHFH 5C2ZA 2VNTA 3RLWH 1BMMH 3RDZA 4B1TA 4NSVA 4CRFA 4CRCA 1EAWA 3DSPA 3RXRA 3RXUA 3O8BA 1W3CA 1CE5A 5GWZA 5L30H 1NRQH 1Z6JH 2AIPA 3UREA 3FOAA 2QN5T 3ZVCA 1YPKH 2D26C 2WPJS 2RDLA 3UFAA 1A5HA 2ZNKH 1O3LA 3OY5U 2OBQA 1CA0B 3A82A 2A45B 5EGMA 1BQYA 3SYJA 2B9LA 3GCHB 1EAUA 1Y3WA 3FAOA 3QO6A 1QBOA 1T7CA 2JJ2D 1HPGA 1O3KA 1K9OE 2G51A 2NU3E 2SGPE 1VGCB 2W6ID 1AO5A 1FX0B 1FUJA 1V6DA 2FS8A 5TCAA 1AY6H 1J17T 3Q3XA 4AYVB 2G55A 2GCTC 2HOBA 4JZIA 3RC4A 3GCTG 3MNSA 4X0WU 1NC6A 3E3TA 2VB0A 4MPXA 5K0HA 5CDFE 3MYWA 2P3FH 3CS0A 4RSPA 3M7UA 4I31A 3UR9A 2OUAA 1WBGB 3RU4D 2XC0A 3W95A 1O34A 1HAGE 1NTPA 3BTEE 3RXVA 1O2IA 2TBSA 2BQWB 5AVDA 4BAOB 5E0GA 1EB1H 1P11E 1O3HA 1FNIA 2OCVB 1CVWH 4OS2A 2G8TA 2TRMA 2ZGXH 1P0SH 4J2YB 5E0HA 2LELA 4B75A 2F91A 2RDEA 1V2OT 1NY22 1C5UA 1TNLA 1HRTH 1EPTB 2ANWA 1UVOA 3MWIU 2XNDD 3UOUA 4FXGH 1QB6A 2FI3E 2L6OA 3MHWU 1JMOH 2G4UA 1O5BB 3SUDA 4AGJA 3RXMA 1FAKH 1H8IH 2ZTXA 4JK6A 2ZIQH 3A7WA 2JH0D 2QXGA 1EFRD 1DLEA 2PGQB 1F5LA 3ZZ6A 1J14A 1FPCH 1GMDG 4AFUA 1C5YB 3OEED 1GBTA 1GJ9B 3RP2A 4RKOB 1CHOF 1CBWC 3DCLA 3ZIAD 2THFB 3PLPA 1IQKA 4Z0KA 1GJAB 4B73A 1ELVA 1LVOA 1SFQB 1QGFA 4NA8A 3I78A 4MQAA 3QWCH 2JH6D 3OE7D 3RU4T 2XWAA 2Y82A 2CXVA 5C5OA 2LP6A 1KDQB 4AFZA 4BAHB 1SI5H 3UQOA 5E2PA 2BD5A 2YMSC 3OTPA 1O2ZA 4KTUA 1FY1A 5TCCA 2A4RA 3BG8A 2AGEX 1GHXH 1LKAA 1THPB 2CHAC 3P8NA 2XYAA 4E7NA 1ESTA 1OWDA 1P2JA 2BZ6H 5F8ZA 4INHA 3DD2H 3LGVA 1A0JA 4K60A 2VGCB 5GXPA 1SOTA 5BRRE 1GJ5H 4ISLA 3F3BA 1THRH 2VVUA 4XSKU 3RXQA 1SQOA 2W6JD 1HAPH 1MTVA 1ZMJA 3NWUA 3RXFA 3QZRA 1C1RA 1O3GA 4XBDA 2ZU4A 1E34B 1A61H 5H4IB 4ZH8A 1O37A 1O5GH 1K2I1 3A85A 1SFIA 1ZMNA 4TT3D 1SGYE 3E0NB 2ZQ1A 1HFDA 1FIWA 1P01A 3E8LA 4TPYA 1JRSA 1SB1H 4X1SU 2ZPSA 3BTME
chains in the Genus database with same CATH topology
3M5NA 3P8FA 4ZMAH 1EPTA 3L33A 3JZ2B 4UDWH 1XVOA 2WPHS 1YLCA 2JETC 1YPGH 1V2MT 4I33A 2Z3CA 1MU6B 3M7QA 3S69A 1ETSH 2Q1JA 1HJ8A 1CQQA 4CBNA 1ANCA 1O5EH 3TJVA 2FOBA 1ETRH 4ABFA 2TGDA 4AORA 1HDTH 2TGTA 4FVBA 1O2YA 1OYQA 3NXPA 4BAMB 2XW9A 3E90B 2QA9E 1MCVA 1KXDA 3HKIB 3Q3KA 2BXUH 4DJZB 4OS1A 4I8GA 1O2WA 4OGYA 1C5XB 2BM2A 3TK9A 3PWCA 1OP8A 4BANB 2CGAA 1KDQA 1RGQA 1QCPA 2C90B 2OC7A 1P02A 4XDEA 3TIUA 3UWIA 1A5IA 2ZECA 1C9TA 1GDNA 4AFSA 5JYIA 2ZPQA 1WSSH 1GBIA 4K69A 3SV9A 1C9PA 1VCPA 1QHRB 1CSOE 1ZHPA 3HK3B 3ZYEA 4NA9H 2Q6FA 2W3IA 1C2MA 3H7OA 3SZNA 1D3PB 2BLWA 1O3FA 1WYKA 4ABEA 1OPHB 3T29A 5ESBA 3UUZA 1QIXB 2VIDA 5C1XA 1TMBH 5A2MH 1ZRKA 5DGJA 1C2KA 4ABGA 1BTYA 3LU9B 1CT2E 1GG6C 5E2OA 4X1PU 2FIRH 4DG4A 2F9UA 1O2XA 1YLDA 3SJ8A 4BXSA 3P8OA 2BQ7B 1NRSH 1KXCA 2AEIH 2XCFA 1BIOA 1TQ7B 5T6FA 5JB9S 1KXAA 4TYDA 1FZZA 5ESTE 3TGIE 4AN7A 1AFEH 5C1UA 1OS8A 1T32A 4NZLA 2QXIA 2ZHQH 4D7FA 1IQJA 1E0FD 4YESB 3SUGA 2CF8H 7GCHF 1YPHE 1FY5A 1WUNH 1GI5A 1Y3UA 2H9TH 3TGJE 2ZFTA 5C67A 1GI7B 3QLPH 1SLVB 1UTKA 5A8XA 2BD2A 1K21H 5HGGA 1SSXA 2A4OA 2ODYB 2F9PA 1ZHRA 2ZEBA 3MO6A 4MG3A 1GHVH 1LPGB 3GCNA 2ODPA 3UNQA 1O2VA 2A5AA 3M5OA 1V2UT 2FESH 3VXFH 3TJUA 3LONA 1C4V2 2XNIA 4E7RG 1IOEA 1NROH 3U1IB 2BQ6B 2YNAA 3ZVBA 1SGFA 4ABAA 1LDTT 4AYYB 1O5DH 1QJ7B 2ULLA 1M9UA 3S0NA 2FXRA 1C1TA 4Y79A 3KEEA 1NFWA 5IYTA 3URCA 3GY8A 3HKJB 1X7AC 4NIVA 2BMGB 2I6QA 2FX6A 3MH5A 3RXCA 4AX9H 2ZFQH 2R3YA 7KMEH 1IQFA 1O36A 1GHZA 3TGKE 1TOCB 3EE0B 4LK4A 9LPRA 1DWEH 2P93A 3PO1C 3GY6A 1SMFE 1PPCE 1UVSH 1AFQC 1P12E 2C8WB 1FONA 1F92A 2BXTH 1QY6A 8GCHF 1S6HA 1O5FH 1S5SA 1UK3A 1D6RA 1V2RT 3ATKA 2W26A 3EDXB 3H7TA 3LGYA 1T8LA 2C93B 3MO3A 1C1NA 1WU1A 1UTLM 2ZDLA 5HM9A 4OS5A 4X6PA 1TPAE 1IHSH 2Z7FE 3ZZ5A 1ANBA 2J4IA 3LOXA 3NK8A 3RM2H 3ZZCA 2ZP0H 1V2PT 2BLOA 1FN8A 1KXFA 1XVMA 2STBE 3E16B 3PMHB 3U8OH 1GMCG 4ABDA 3RMMH 2J34A 5GJ4B 1MQ5A 1A1RA 1C2JA 1FY3A 4NIWA 1H9LB 1U6QA 1ANDA 5FBEA 3QDZB 2RCEA 3NUMA 3L6PA 1C2FA 2BZAA 5AF9H 2HNTF 2BDYA 2FPZA 4FUHA 2RA3A 2VJ1A 4B74A 2ALPA 2PHBA 3UR6A 4HI3A 3PMAB 1DY8A 3CENA 2VH0A 1EAXA 2G4TA 2ZG0H 3BTTE 1AMHA 3DHKH 1UCYH 1C2HA 2J95A 1TNGA 3SUEA 3A8AA 3KGPA 3SOSA 3KHVA 3MO9A 1A7SA 3ENSB 4SGBE 3BTDE 3B23B 1BHXB 4CRGA 2QC2A 4OS4A 1SHYA 2XC4A 4TY7A 2BDCA 4QT8C 1K1LA 4DY7B 1BHXF 1K1IA 2SGEE 1HAIH 2P8OC 1O31A 2HGTH 1SGPE 1GJBB 1TRNA 2R2MB 1FAXA 3K6ZA 3BEIB 1C1WH 1HAVB 1A4WH 1NFYA 1K1OA 2NU2E 1MTNC 5A0BA 1T8OA 1XX9A 1DICA 1UJ1A 5HMAA 1O2OA 1RTFB 4U01A 2FM2A 1VITF 3F68H 3ZZ4A 2ZGCA 1C5TA 3BEUA 3PV4A 1B0FA 5EG4A 1F0UA 1Y3VA 2G52A 4Y10E 2OC0A 3SV6A 2A32A 1GBCA 1BZXE 1ARBA 3A84A 4H6TA 3SU4A 2CHAB 1V2JT 1QFKH 4H42U 1EZUC 2BX4A 4MNWA 3M3VA 2C3SA 3BIUH 3ZZ8A 2CN0H 1OWJA 1C1PA 3A80A 5EXNA 1EP6A 1GBFA 1IQLA 2ILNA 1CA8B 3GDSA 1IQIA 2AFQB 4K1EA 5FCKA 1KXEA 1UHBB 4IMQA 1BJVA 3D65E 3PWBA 2Z3EA 3RMOH 3A7VA 1ETTH 2G00A 3RXIA 1RTLA 3M37A 1PQAA 1UK2A 3TNTA 1OP2A 2VINA 1LHCH 3QX5H 1IQGA 3D49H 5DP7A 4ASHA 2PFEA 2JETB 1HBTH 3VB5A 3W94A 3LPRA 4AB9A 1ID5H 1TALA 4MPWA 3AAVA 1FV9A 4X2WA 1GBAA 1TMUH 1LVMA 1HNEE 4UFDH 1N1LA 5JBBS 1GI1A 1P05A 1C2LA 1WV7H 1P3CA 3T25A 2V3OH 1O3NA 1AHTH 1Q2WA 4KKDA 4JYUH 3SU0A 7LPRA 1GPZA 2PSYA 3M3TA 1SLUB 3SGAE 1C5LH 3AW0A 4XOJA 3SJOA 4DW2U 3MFJA 2ZWLH 4KGAA 1GI9B 4BTIB 1HAVA 1Z1IA 4WXIA 1NN6A 3QK1A 4X6MA 1D3QB 1F2SE 5DPAA 4NA7A 1GHYH 1QB9A 1ARCA 1SGDE 1VJAU 1YGCH 8KME2 1G3EA 2DE9A 3TLOA 1TBZH 4KTSA 5CE1A 2ANKH 3PMBB 1E37B 1G2MA 4UFFH 1EZQA 1TGTA 2P94A 3STJA 1T8MA 2BD8A 3VPKA 1DSUA 3Q3YA 1AVWA 1BDAA 1TFXA 2J38A 3SNEA 4AGKA 1ZGIA 2FYRA 2HPQH 3ATLA 1XKBC 3RXLA 6GCHF 2IN2A 1FXYA 5DP9A 1IQNA 1K1NA 1B7XB 4ISOA 4A6LA 1O3CA 5FCRA 1YM0A 2TIOA 3T2NA 3FP6E 5LGOA 2JKHA 1UHBA 3QN7A 1C5ZB 5E0JA 4DCDA 4WY3A 1XUHA 4X2XA 2WUCA 2BY7X 1O2GH 1EOLA 2V6NA 1O0DH 2Z9JA 1YPEH 1GG6B 2H6MA 4MDSA 4A92A 1NZQH 2OC8A 3MH6A 1WTHD 3CS7A 2A0QB 2ALVA 3SBKA 5FX5A 2KAIB 4JZDH 1IQEA 1N8OC 1TBRH 1JRTA 1ZHMA 4OS7A 4B2CA 1EJMA 1SPJA 1S85A 1RTKA 1Z8IB 1L1GA 1ESAA 2EEKA 1W12U 1AI8H 1W14U 3LDXH 1MMJN 4TWYA 2O9QA 3UTUH 1PPHE 1O35A 2FYQA 4X1QU 3A8DA 1EQ9A 2OBOA 4SGAE 2J94A 4X2VA 1FPHH 4X1NU 2AMQA 2GCHF 3VFEA 1F0RA 1SG8B 1DVAH 1SGTA 3P70B 2A7JA 1VR1H 4YOIA 1GCTB 2QXHA 1AB9B 5EPNA 2P59A 5A09A 3S9BA 3ESTA 1KXBA 1NRRH 1QL9A 2FEQH 1TGCA 1P2QA 1Q3XA 1DPOA 5PTPA 3E0PB 1NU9A 2ZTYA 4H4FA 5FPYA 2ZU3A 5GIBA 2VIWA 1TMTH 3MOCA 2WPIS 1GBHA 3GY5A 2W5EA 5I25A 1S6FA 2QGRA 4IC6A 4DOQA 2QF0A 5EW1H 1BA8B 3B9FH 1TX7A 1O3PB 1MTSA 3QGJA 4YZUA 1CHOG 1ABIH 4BNRA 2EI7A 5DP5A 2ZA5A 1CGIE 1O3IA 3ZVAA 1FN6A 3LIWA 5AFZH 2ZDMA 2ZQ2A 3PO1B 4CHAC 4BOHA 1E36B 1O2SA 2ZGJA 1GBDA 1C1OA 3SW2B 4TWWA 1FJSA 1QQUA 2FOFA 2A4QA 2QIQA 1MQ6A 2ZCHP 4H6SB 4FVDA 5LPEA 3T26A 1MH0A 2OC1A 1P3EA 2BTCE 1UTMA 3PTBA 1T8NA 4ZROA 1C5MD 1YPHC 5CMXH 1LPKB 1BTZA 1TBQH 2KAIA 1G32B 2OQUA 3TH3H 1TQ0B 1FDPA 3MH7A 4D76A 3F9HA 3QTVH 1HV7A 3SJIA 6CHAC 1CT4E 2QF3A 1C5VA 3AASA 2FP7B 3BTHE 1C5OH 3TITA 2F9NA 2AMDA 4X2YA 5DJ7A 1GJDB 1VITH 1YPMH 2PR3A 3EA7A 3QTOH 1HJAB 2AERH 2PW8H 4AOQA 4AFQA 2XBXA 1DM4B 5EW2H 1QL8A 1BTHH 1ZSKA 2F9BH 5AHGH 1BBRH 1GL1A 4TY6A 1MBQA 1GI3A 1C1MA 2FDAA 1MTUA 5FAHA 4D9RA 1V3XA 2FOMB 1AZZA 2UUYA 3SGQE 4FU9A 1O2LA 3QZQA 4ZHAA 3SUFA 4JYVH 2BD7A 3PMJA 4GCHF 4Q7ZA 3VB6A 3A83A 4IN1A 1MUEB 1YPLH 2P8OB 2ZHFH 1BB0B 4YT7H 3F9FA 2Y80A 3UWJH 1W13U 2NU4E 4D7GA 4FU7A 1J16A 1MTNB 1Y3XA 1Y3YA 1GHBF 2EC9H 2A31A 1SGNE 3FP8E 2A7CA 3U9AH 2GGVB 2ZZUH 1H4WA 1TX8A 4NFEA 2W7UA 1IQMA 2P3UB 1NRNH 1SBWA 3A8BA 3EA9A 4O9VA 2VVVA 2D2DA 1Z1JA 1HAYB 1ZJDA 1W2KH 1PPZA 4AZ2B 1QA0A 1ZTKA 1K28D 4I8KA 3TPIZ 5FPTA 3SV7A 1AZ8A 1JWTA 3LGUA 3ODFA 1SQAA 4E05H 1YKTA 3SQHE 1Y59T 1EB2A 1SGFG 2NWNA 4ISHH 1EP5A 1O2MA 2UWPA 5DP4A 3MNXA 4D9QA 1FY8E 1UCYK 4J1YA 1TB6H 1UTOA 1KTTB 2HNTE 3BF6H 4X1RU 3RXJA 1YP9A 3ZV9A 1A3BH 2ZPRA 2H5DA 1SOZA 3EAJA 3TK5A 2BVSH 3BTKE 2WUBA 1VCWA 3S7KB 1HLTH 2DUCA 5LH8A 1C1UH 1SHHB 1MTWA 1XXDA 4X8UH 4BTTB 4NCYA 2PGBB 1GBJA 1GMHF 2ZI2H 1OOKB 2FOHA 1AE8H 1ZSLA 2Z3DA 1DOJA 1KTSB 1YYY1 1LMWB 2FS9A 1P10A 1NO9H 5F6MA 1C1VH 1TA2A 1SGEE 3PB1E 4Y7AA 2QXJA 2ZFPH 4D8NA 2AGGX 4YOJA 2Y6TA 2A5KA 2ANYA 1TLDA 3GY2A 3A8CA 4BXWA 3ODDA 3GYMA 3D23A 1TIOA 4WWYA 4MPVA 3ZV8A 1QJ1B 2V35A 3AW1A 4JK5A 2ZF0H 4MPUA 4JZEH 3GCHC 1LPZB 1KY9A 1EXFA 1B0EA 1EX3A 2A2XH 3RXGA 1ELTA 4IS5A 1VGCC 1MCTA 4XE4A 7GCHG 1DXPA 1A5GH 3MI4A 3A89A 1TNHA 4Y76A 2XCNA 1LO6A 1P2MA 1W0ZU 2R0KA 1F5KU 4THNH 3T62A 5EPYA 2M5TA 5HYOA 1O38A 3MH4A 3NCLA 1MAYA 1TPSA 1HYLA 2GX4A 3FP7E 1RJXB 3SV8A 2GMTC 1OSSA 1DSTA 1GHAF 2R2WU 3K6YA 2ZGBH 1EZSC 1QB1A 1MU8B 1SQTA 1GGDB 5G4BA 1OWKA 3SV2H 2IPHA 4WF8A 1P2OA 1BRCE 2GTBA 2BOHB 2Y5GA 2VWLA 4YT6H 3P95A 2Z9GA 5B6OA 1O2JA 2GT7A 2GZ7A 2FOGA 1EPTC 4UD9H 1P8VC 3MTYA 3NPSA 1OP0A 4FUGA 1ABJH 2WPLS 4YM9A 2PWXA 2WYGA 2DE8A 1BTPA 1O30A 3SU1A 1L0ZA 2ASUB 2C8XB 3U1JB 4FUCA 1IAUA 1NESE 5ETXA 4FU8A 1L1NA 1TGSZ 3LH3A 3NKKA 1O2HA 2B5TB 2TPIZ 5LPRA 2XRCA 1SL3A 1LQDB 8GCHG 1NT1A 1EKBB 2Z9KA 2D8WA 3MNCA 5IDKA 2GCTB 1C2GA 3FANA 1O2UA 5J4QA 3P6ZB 5FHTA 1N8OB 3RXOA 1HCGA 3BTWE 3C1KA 3T27A 4AG1A 2A2QH 3M5LA 5J4SA 4F49A 1HXEH 4OGXA 4KELA 2HALA 3SI3H 1L2EA 7ESTE 5JBCS 5C3NA 3ZZ3A 1OKXA 6LPRA 1L1JA 4HFPB 3PROA 4ZUHA 1JOUB 4IBLH 3UNRA 1FLEE 1AVXA 1PFXC 3V7TA 4B76A 1Z8RA 1LHGH 2BD9A 1SGQE 3MU0A 3V13A 2FI4E 2TGPZ 1IQHA 3ATWA 4CRDA 3EGKH 4ISIH 1E38B 3A86A 1DUEA 1ZOMA 4JMYA 5T6GA 1C5SA 1P57B 1O33A 3BN9A 4GSOA 2Z9IA 1YPJH 2TGAA 3KN2A 1AUTC 1LHDH 3RC6A 1T4UH 1O2RA 5GPIB 2STAE 1K1PA 2B0FA 1S84A 2FLRH 2ZDKA 4MNYA 4NZQA 1JIRA 1MZAA 4X8SH 1CBWB 1GJ8B 1GWAA 4R8TB 2OXSA 1DY9A 1ZSJA 1D4PB 2P3TB 2ZFRH 1P9UA 1DT2A 3F9EA 2GV7A 4LZ1H 5BPEA 3SNBA 3DFJA 1GJ4H 2AS9A 1G3DA 1SC8U 1OYTH 2I6SA 4JCNA 1C2DA 2PUQH 4NG9H 4WMEA 1GJ7B 1GBEA 3T5FH 5JB8S 1DDJA 4CHAB 3GY7A 1HAZB 4O3UA 4ISNA 1BRAA 3K2UA 1S82A 2O8TA 3TH2H 2HLCA 3E6PH 2UWOA 1TPPA 1VITG 2AMPA 1BTUA 3SORA 3OTJE 1MKWK 4YTAA 5AFYH 1DLKB 1ANEA 1G3CA 1GVZA 1W7XH 1XMNB 2BVRH 4ABIA 3GICB 1EUFA 2FTMA 1FMGA 4ESTE 1YF4A 2AIQA 5EQQA 4NWKA