1BITA

The crystal structure of anionic salmon trypsin in a second crystal form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
222
structure length
222
Chain Sequence
IVGGYECKAYSQAHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of anionic salmon trypsin in a second crystal form.
pubmed doi rcsb
source organism Salmo salar
molecule tags Serine proteinase
total genus 55
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bitA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bitA02
1MU6B 2B9LA 4KKDA 3OY6U 5DK1A 1KXDA 1SGDE 1SLWB 1NFUA 4Y7AA 2ZDKA 5DP5A 4AB9A 1ELDE 1IQKA 5A09A 5CHAC 1C2EA 1TNKA 1NRPH 1W2KH 1GDQA 2XTTB 1OWIA 3UY9A 3QWCH 2JH5D 3IWMA 1NFWA 1KXBA 1O3AA 4B75A 2FIRH 1O3GA 1EZXC 3RXKA 4K3JA 3VEQB 1GDUA 1AO5A 1GI6A 1KTSB 3K6YA 1GBFA 1NC6A 3H7OA 1EOJA 1AI8H 4X6MA 2J94A 4X8UH 1SGYE 4ISOA 1V2JT 3SQEE 4X1RU 2FESH 1B0FA 3BV9B 1O0DH 2R3UA 3A87A 4FUGA 2A7HA 2J95A 5EU8A 4AZ2B 1SL3A 1GBEA 1GJDB 4OS4A 4ZHLU 4DY7B 1XKAC 1DM4B 1TGSZ 1HAVA 3KCGH 3OU0A 3BIVH 3E3TA 1EB2A 1RFNA 2JH6D 3P8OA 2CHAB 5C3NA 4Q7XA 3UNRA 1GBIA 4U30A 3BTTE 2TGAA 4DURA 1P06A 2ILNA 1LDTT 2QIQA 4NIYA 3DFJA 3TIUA 3BTHE 2Y5HA 2IPHA 3KQCA 3GY6A 3NK8A 1VJ9U 4X1SU 1JMOH 3RXRA 1G36A 1V2OT 3A7YA 4H6SB 3SU3A 4M7GA 3EGKH 1GHWH 4RKJB 2D1JA 2BD9A 2CMYA 1H8DH 1DSUA 2FLRH 1C5ZB 1JIMA 3NWUA 3TJUA 1O2ZA 2VGCC 3DFLA 1G3BA 1AUTC 2BMGB 1BMLA 1C2GA 4I8HA 1DT2A 3BSQA 2OTVA 5EXMA 1HIAB 1A0JA 1SGFG 1GJCB 3IG6B 3PTNA 5L2ZH 3RXUA 5EODA 1TALA 2A45B 3MNSA 2IJOB 3MU4A 1C9TA 1D4PB 3A8BA 3F9HA 4WH6A 4ZKNU 4MPXA 3M7QA 1OX1A 3KF2A 3SI4H 3PLBA 1YYY1 3DA9B 3I77A 1IOEA 2A32A 3D65E 2BD5A 1ZGVA 2HNTC 4Z0KA 3U69H 1SGCA 1GJ7B 3ZZ3A 1QY6A 1GBBA 2VWOA 2B7DH 2H9EH 4GCHG 4IW4E 5JBCS 2XWBI 5EQRA 4DW2U 5T3HA 7KMEH 2ZGBH 3ZVAA 1K1LA 1J16A 1TQ7B 3MU8A 1AD8H 1SFQB 2RDLA 1O3BA 3QUMP 5FBEA 1SGNE 3UIRA 4ABAA 3TNTA 3M35A 2ZP0H 1HUTH 1J8AA 2CHAC 7GCHG 1S0RA 1AZZA 1WQVH 3T62A 1ANBA 2VNTA 1T8NA 2HOBA 3RMOH 1P2MA 1VITF 1P03A 1K9OE 1OWJA 3TH3H 3EAJA 2ZHQH 2F91A 3ZZCA 1GJ5H 2ZDVH 3ZVEA 4X8TH 4YZUA 2ZU3A 4UDWH 2D8WA 3DD2H 1ZSJA 3E91A 1K22H 2PR3A 3SUDA 2G81E 1O2QA 4AORA 3ZVDA 2BY6X 3A82A 1QBNA 4K1EA 4NSYA 4BAOB 1DWEH 5FPSA 3TU7H 4HTCH 4YT6H 3MWIU 1C1RA 5G4BA 1ID5H 1P10A 1DOJA 3RXFA 4KTUA 4ZUHA 1O3PB 1J15A 4X0WU 4CRCA 1BT7A 1O3DA 1NU9A 1OP8A 1J9CH 2I6QA 4IGDA 1QJ7B 4ZXXH 1O33A 2ZA5A 3MH4A 5GXPA 4MQAA 4ZH8A 4JK5A 3GY7A 2FOCA 4JYTA 3ZZ4A 2ODYB 1O2JA 1GMHG 1GPZA 1V2QT 4ABEA 1E38B 1Z8IB 2SGAA 1ZSKA 1YLDA 2FM2A 4NGAH 1ZOMA 4BTTB 2FX4A 1AY6H 1DWBH 1HXEH 2PUXB 3SV6A 2Q6DA 3UOPA 1ARCA 2ALVA 4U2WA 5GWZA 4TY6A 2ZDAH 1V2WT 1CGIE 2VIWA 8GCHG 1O3KA 4FU7A 1MCVA 1OWEA 4X2VA 3QLPH 2ZCKP 2AYWA 1FAKH 2TGDA 3BTFE 3M5MA 1Z6EA 1V3XA 4FUFA 5GDSH 4K1TA 4B2CA 5L6NH 1MKXK 3Q76A 3M5NA 2SGFE 1VCPA 4ISIH 2SGQE 2Y7XA 4DJZB 6GCHG 1LMWB 4AYYB 5LH8A 1C2FA 5E8EH 1GJ8B 2SNVA 1HAHH 1C1TA 2C8XB 2VWNA 5AVDA 5HGGA 1Z7KA 2OP9A 2SGEE 3A84A 1ZPCA 3A7VA 2VVCA 1AWHB 3SV9A 2ZECA 5A0CA 2WPLS 1T31A 5C2ZA 3LKWA 1YPMH 2XYAA 2EA3A 1OYTH 1P02A 5GCHF 3UREA 1C2HA 2OC7A 2QXGA 3MNBA 1K1MA 1GMDG 4FVDA 1O5CB 1DICA 1T7CA 2ZPQA 1HBTH 1TIOA 4ABIA 3PWCA 1TBQH 3SNCA 5DP4A 1UTPA 3AAUA 4IN1A 3CENA 4RN6A 4Y7BA 3RXTA 4O3UA 4YO9A 1ZHMA 4A5TS 4ESTE 3Q77A 3T2NA 1SOTA 2UUYA 3QX5H 2YOLA 1QA7A 1ZTJA 1C5XB 1VGCB 4NWLA 1SGFA 2HWLB 1GHBG 3E0PB 2OBQA 2UWLA 3A7WA 1H9IE 3BTQE 2PW8H 2JH0D 1W8BH 1HYLA 2TGPZ 4YOGA 3ODDA 1TGTA 1BRCE 1GHZA 5EW1H 4WVPE 1P2NA 2Q1JA 1ZMJA 1CGJE 4B71A 2OC0A 1A3EH 4OGXA 1MD8A 4K1SA 2GV6A 3ZVFA 2OQUA 1AMHA 4NZLA 5LPRA 1Y3WA 1IQIA 1MU8B 1H4WA 3T25A 1SC8U 1QNJA 5E2PA 1MTVA 2XW9A 2VWLA 4BXSA 4Y71A 1KTTB 2G52A 3PYHA 2XBXA 4I31A 3T29A 1BMAA 2THFB 1GDNA 5LPFA 1DY8A 1EJNA 1O39A 4UFDH 2XXLA 1CHOF 4GPGA 4Y8XA 3SUGA 3S9BA 1OPHB 1MTUA 2F9NA 3M37A 1N6YA 3LT3A 1NT1A 3OSYA 3M61U 1TE0A 2G4TA 2HNTF 2IN2A 4A7IB 4CR9A 1YPLH 3ATMA 1V2VT 2GDEH 3V0XA 1QRWA 2J92A 1DE7H 4INHA 2D26C 3KL6A 3RXVA 1TONA 2A5KA 3HATH 3S0NA 1A61H 1KXFA 2OD3B 4NIWA 3HK6B 1C1SA 5C1XA 1RTFB 5EPYA 1O2XA 1OXGA 4NCYA 5EW2H 3MO9A 4ZKRU 1W0ZU 1NO9H 1HJAC 2ZFPH 3DUXH 4CRGA 1EJMA 1Z1IA 2W5EA 3RC6A 2TGTA 1KLTA 1GBDA 2AMDA 4X2YA 1TNLA 1OSSA 4FU9A 1C1MA 5IDKA 4OS6A 3HKJB 1XUIA 1C5QA 4AFUA 1EQ9A 1GJ6A 4DOQA 1CGHA 1TMBH 3TH2H 5B6OA 2ZU2A 1J17T 4GUXA 1D3TB 4BAKB 1ABJH 1GHVH 1SOZA 5A8YA 1C2MA 2FWWA 4U01A 3UFAA 2FPZA 1TOCB 4F49A 2GT8A 2F9BH 1SHYA 2J34A 2BB4A 2QF3A 1UHBB 1CO7E 2G8TA 4NG9H 4YOJA 3P8NA 4I33A 1D3QB 3ELAH 3A80A 3UUZA 3SU0A 1LHFH 1SLUB 3M3TA 5EQSA 2ZQ2A 4B76A 1A0LA 1NFXA 1JIRA 3CP7A 2LNCA 2J38A 3DT0H 2XWAA 1DLEA 1K1NA 2Y5FA 2R0KA 2I6SA 1BTZA 1P2OA 2SGPE 2VJ1A 1GG6C 1N8OB 2V0BA 1EZQA 2FZZA 4QT8C 4RSPA 3U1JB 4MVNA 4UE7H 1A2CH 3K6ZA 2ODQA 2OINA 1E35B 5T6FA 4X1PU 4B74A 4LOYH 1YKTA 2Z3CA 2KAIB 1TBRH 3Q3YA 1FY8E 4SGAE 1AQ7A 2FTLE 2BLOA 1O35A 1L2EA 1Y8TA 1ELEE 1CE5A 4MNXA 3SU1A 4Q80A 1A7SA 3C1KA 2ALPA 2EI8A 3LGTA 1ELTA 3SOSA 3V12A 4XOJA 1K28D 4WF8A 3RC5A 5L2YH 1PQ8A 3A88A 3RXBA 5C67A 4WXVA 1O5BB 4O03A 1HV7A 2QA9E 3E8LA 3S69A 2GMTB 1C5NH 1GI0A 1PQAA 2P8OB 4I8KA 2ZWLH 1V2NT 3QO6A 1LPZB 3QK1A 2GV7A 2BOHB 1IQLA 2W26A 1UVOA 3A86A 4BTUB 1YPHC 2GP9B 3M3VA 3Q3XA 1G3DA 2H6MA 5DP7A 4TPYA 1O3OA 1EP6A 2GTBA 1HCGA 4BXWA 1FQ3A 1AKSA 2H9HA 3FAOA 1FY1A 2G5NA 1CT0E 2C3SA 2FYRA 4BNRA 3ZZ7A 1AFEH 2VIQA 2ANWA 3BTWE 2QXHA 3FZDA 4K8BA 3MO6A 2BDYA 1SVPA 8KME2 2G00A 1V2RT 3RXAA 3QTVH 4BAQB 1FUJA 1C5SA 3V3MA 1JXPA 1OWDA 3RM0H 1D9IA 1P2IA 1DANH 1PPGE 4H6TA 1QJ6B 2YNAA 1N8OC 2OC1A 1HAPH 2Z94A 3RXEA 1DVAH 3TK9A 4D7FA 2P3FH 1D6RA 3C27B 4ZHMU 1VZQH 3SGQE 2G5VA 3LJJA 2Z9KA 2NU3E 1ACBE 2BLQA 3UNSA 1UTQA 3OYPA 3D23A 3KIDU 4VGCB 3UTUH 2P59A 1C5LH 1HAIH 3AVZA 1TPPA 1Z8GA 3ZZ9A 1ZHPA 1KLJH 4NFFA 2GZ7A 2FOEA 1LQDB 4AN7A 2PTCE 4UFGH 5J4QA 2FI3E 2ZI2H 1S83A 3ZZ6A 3MNXA 5E0JA 2J2UA 2F9PA 2C8YB 1BBRH 3SU4A 2ZQ1A 5IYTA 4O97A 1U6QA 1EB1H 2GMTC 1SG8B 2P8OC 5EXLA 5GIBA 1OOKB 2Z9JA 2Y5GA 2V3HH 5F6MA 2CXVA 3T28A 1BZXE 4D7GA 4NIVA 4FUIA 3RXPA 1O2NA 1QR3E 4ABBA 2PGQB 1K1OA 3MTYA 3TNSA 2O8LA 3ZZBA 2FTMA 2WPMS 1F5RA 2J4IA 4X8SH 1BMMH 3EA7A 1UK2A 3JZ1B 1BTHH 2CJIA 2R0LA 2UUJB 3GDSA 1DY9A 2AGIX 2QCYA 1JOUB 4FUJA 2D2DA 3UR6A 1CU1A 1ZR0A 4CBNA 4JZIA 4K60A 5DGJA 4GHTA 1DUEA 3NZIA 3UWJH 2H2ZA 4YLUA 1AVXA 1MMJN 1AU8A 4MNVA 3VXFH 1G3EA 1K2I1 1RTLA 1IQEA 4HFPB 3ATWA 3KQEA 2NU2E 1EKBB 1KDQA 5ABWA 2ZTZA 4NZQA 3PMJA 1P9SA 2YNBA 3RUOA 2FX6A 1O3FA 4LZ4B 3AAVA 2ZFSA 1HAVB 7LPRA 1OP2A 1G32B 1O2VA 1QL7A 4R0IA 2RCEA 1TNGA 5J4SA 4O9VA 4YTAA 4VGCC 1YPHE 2V6NA 3VFEA 3O8RA 1ELVA 4K2YA 1UTOA 4CRDA 1BTYA 3ATIA 3P6ZB 3LH3A 1K21H 2FOHA 4TWYA 2BX3A 3NXPA 5FBIA 2RA3A 5L30H 3LONA 3RM2H 3B23B 1XXDA 3VB5A 4MTBA 1Z8RA 6LPRA 3M7UA 4X2WA 3ZVGA 2ZPSA 1DLKB 1AUJA 1LHCH 1ZMLA 4SGBE 2G4UA 3RXGA 3GOVB 1N1LA 4MLFB 1B7XB 4HGCA 3VPKA 1VITG 1YBWA 2NU4E 1T4UH 1QB6A 2XCNA 2ZGHA 1WQSA 4J1YA 1C4V2 1G2MA 2ZU1A 1LVBA 2PUQH 4ZROA 2ZIQH 3SV7A 1A1RA 1O3MA 3N7OA 3U8RH 2VINA 2R2WU 4OS1A 4LZ1H 1Y5UT 4WH8A 3RLYH 3F9EA 1Y5BT 3MFJA 3A89A 2A7JA 4I32A 1OKXA 1V2TT 4DIHH 2WUCA 4BAMB 5SGAE 1H9LB 2A0QB 3GY5A 3T27A 4WMEA 4A1VA 1UCYH 1C1WH 2P94A 3CS7A 1EP5A 3SNBA 1ZPBA 4CR5A 2SNWA 1ZSLA 1CQQA 1SGTA 3BIUH 1ESAA 3SU2A 2EI7A 2O8UA 1NN6A 1W14U 1A5GH 5FX5A 1HFDA 1LKBA 1TRNA 3B8JA 1QBOA 1HRTH 1P2QA 5ESTE 3G01A 3T5FH 1XUKA 1OP0A 4ABHA 1P2KA 5DO4H 1TX8A 1W0YH 3AW1A 1O3NA 4X1NU 1FJSA 2P93A 3UNQA 3VXEH 2BDBA 1PJPA 1XM1A 1MAYA 3SNEA 2JKHA 3TPIZ 1O3IA 1BIOA 1PPZA 2HRVA 1DWCH 1F0UA 1DDJA 1ESTA 3PM3A 4XBDA 2FS9A 2FODA 3FP6E 1C5WB 2WYJA 2F83A 2ZFQH 1MTWA 1QB1A 1BRAA 5TCAA 3K2UA 3V7TA 5AFYH 1ARBA 1AVGH 1Y3YA 1L4DA 1UVSH 2Z9GA 3VB7A 1TB6H 1ETSH 4IMQA 1TOMH 1CT2E 2VH0A 2OQ5A 4F4OC 3EDXB 1NU7B 3LDXH 4MPVA 2BVXH 2ZU5A 1Y3VA 2XCFA 5E2OA 1WUNH 3BG8A 1XUGA 4JCNA 1O5FH 2B5TB 4GSOA 3HPTB 4TWWA 1F5KU 4O3TA 1GHAF 2F3CE 4KGAA 2BY7X 1LTOA 2XRCA 1GVZA 4OGYA 1YPJH 3A83A 3QGNB 3SV2H 1AE8H 1UTKA 1GBCA 2BD4A 2QV1A 5HM9A 1MQ6A 1GBMA 5GCHG 3RXIA 3RXOA 2ODPA 1SSXA 1O2OA 2Q6GA 3RC4A 2Z3DA 3T26A 1S0QA 1TPAE 3PMBB 1GHYH 1D3PB 1ANDA 4MPWA 1HB0B 5AHGH 1AE5A 1FONA 1P04A 4A1TA 1TA6A 2P16A 1P57B 1P9UA 4MG3A 1CT4E 2HNTE 1RS0A 3STJA 2ANMH 1YF4A 8LPRA 1F2SE 1GJBB 3GY2A 1LPGB 4Y8YA 1TA2A 1NFYA 4DIIH 2Y82A 2TRMA 1QBVH 1IHSH 1EPTA 1KIGH 1SGIB 1GBJA 1VJAU 4OS5A 4WJG2 5JB9S 4DVAU 1MD7A 1RGQA 1WCZA 2PKAA 1KSNA 3SHAH 1HJAB 1QRZA 1M9UA 1AGJA 1ZJDA 5T6DA 4B1TA 1LPKB 1KXEA 3NCLA 1C4Y2 3RLWH 3LJOA 2B8OH 1FZZA 3SZNA 2A5AA 5ESBA 1LHEH 4Y11E 4KELA 1ETTH 1INCA 1XMNB 3SGAE 3BEIB 1IQNA 3F9FA 1BA8B 2F9OA 1O2TA 1HAXB 1HJ8A 4E06H 3A8DA 4KP0A 1UTLM 1L1NA 5DP3A 2RA0A 1E34B 3A7XA 3MU5A 4OS7A 2ZFRH 3LU9B 1KYNA 1EATA 1GJ4H 1T32A 2SGDE 3UPEA 1BRUP 1LVOA 1P11E 3KNXA 3ZVBA 2Z6BD 2ZF0H 1BJVA 1SPJA 4OS2A 2GT7A 2HPPH 1HDTH 1Z1JA 3SHCH 3KGPA 1EPTB 1THSH 2C4FH 5DKMA 4ZKOU 1G2LA 1V2PT 5F8XA 1CHOG 3U1IB 4Q7ZA 1ELCA 1GL0E 4U32A 3PMHB 2GD4B 4IC6A 4XBCA 1SGEE 1TGCA 2BHGA 3K9XB 3OTJE 1EOLA 1TYNA 4NWKA 5C1YA 3TITA 3SN8A 1GG6B 1BBRK 1TPOA 2BZ6H 1YP9A 1F7ZA 1BTWA 2OBOA 3TGIE 1LVYA 5JBTA 1BTPA 1A5HA 1HLTH 2AS9A 5HXFA 4I7YH 1QQ4A 1FPHH 3AW0A 1DX5M 1K1IA 2GZ8A 2ASUB 3D49H 3RU4D 1A46H 8ESTE 3RXCA 1P0SH 1NROH 1ZMNA 1TMUH 2A7CA 2BVSH 1HGTH 1O3JA 5FX6A 1XUJA 4XDEA 5A0BA 2P3UB 2ZKSA 1GGDB 4MNWA 2TBSA 2G51A 3A81A 2WYGA 4WMFA 4ABGA 1P01A 1ESBA 1GI4A 1NRSH 1F92A 1XUFA 1MQ5A 2FLBH 3ITIA 3H5CB 2CV3A 1MAXA 1DS2E 1Y5AT 1SQAA 1TX7A 2ZO3H 1FAXA 1BCUH 3S7KB 5A8ZA 3RXSA 2C93B 1S6FA 1O36A 1S82A 2O8MA 2A4OA 1TPSA 1Y3UA 1O2PA 2BQ7B 3RP2A 1DXWA 1CBWB 1DSTA 3TGJE 1C2IA 1PPBH 3ENSB 1C1QA 1V2KT 3SU6A 1UTMA 1QTFA 1HAOH 1FV9A 1EPTC 1AIXH 4Y76A 1D3DB 3BTGE 3D62A 1EX3A 2FI5E 2OC8A 1YGCH 1SGQE 2ZTYA 1ZZZA 2Y80A 1GI2A 2A4RA 1MUEB 3NUMA 1BMNH 4MPUA 1MZAA 2ZGCA 4AGJA 5JPMH 4Y79A 5T6GA 1XVOA 2Z9IA 3PO1B 3EQ0H 3M36A 5C5OA 2BD3A 1K1JA 3FFGA 4NSVA 1AN1E 1V2LT 1FIZA 4UFEH 1PYTD 1IAUA 2ZHFH 1Y59T 1BRBE 1SLXB 4DGJA 1C2JA 1ZRBA 3LC3A 3UQVA 1NM6A 1V2MT 2AMPA 2AMQA 3ZZDA 4UONA 3SNDA 2FOBA 2BOKA 1V2ST 3TJVA 5PTPA 1Z8JB 4ZXYH 1GGDC 5AFZH 1GI7B 2VB0A 4DT7B 2M5TA 1SGPE 3LIWA 4H4FA 1IQFA 4YOIA 1VR1H 1W12U 2XC5A 2FDAA 2GCHF 1UCYK 2BTCE 4IN2A 4CREA 1HAYB 1AFQC 1O5EH 1JBUH 3MU0A 1FN8A 2BD8A 2Z3EA 2A5IA 3LGIA 1GI3A 6CHAB 1BHXF 1TBZH 1P3CA 3SW2B 4AG2A 1PPEE 2GCTC 2FOAA 1C9PA 3PTBA 1B5GH 3ZV9A 2BXUH 1FN6A 1ZGIA 1CBWC 1P8VC 1AVWA 3BTDE 1THPB 3FP7E 2QXIA 3A7ZA 3PB1E 4KTSA 5AF9H 1NS3A 2R3YA 1J14A 1G9IE 4CRFA 2BY9X 1IQHA 2H5DA 2PLXA 3SGBE 1QJ1B 1NESE 3NKKA 1P09A 3LGVA 5BRRE 2FYQA 3P92A 3NPSA 3KQBA 1UVUH 4INLA 1V6DA 3SU5A 2PV9B 2AGEX 4E7NA 4XE4A 1ZTKA 1WBGB 2VVUA 1HPGA 1O5GH 1GI5A 1AZ8A 2ULLA 1ETRH 4Y0ZE 4Z6AH 4JZ1A 3Q00A 1W11U 5DJ7A 1Y3XA 4DCDA 3PO1C 3GCNA 3M5OA 1RTKA 3E90B 1MTNB 1C5OH 2WPIS 4WWYA 2K1QA 1BOQA 1DWDH 1Z6JH 1AHTH 2P3TB 1WSSH 4LXBH 1HJ9A 2FP7B 4X6NA 5C5NA 4CH8B 3GCTF 1ZHRA 2ZHEH 1FY3A 3GY8A 4AGKA 3TK5A 1Z71A 1S81A 1TGBA 1OWKA 3KQDA 3RMLH 3UR9A 4AFSA 4D9RA 2PWXA 2WINI 5C1UA 1AKSB 1F0SA 3PLKA 1A4WH 2W7SA 2QC2A 1QCPA 2WPKS 5H4IB 1WAYB 1QA0A 1JWTA 1ANEA 4IMZA 3TLOA 3B9FH 2BDAA 2BM2A 3MH5A 1RIWB 1RRKA 5A8XA 2A4QA 3HKIB 3MH6A 4NA7A 1FXYA 1ELGA 3Q3KA 1OYQA 1KLIH 1O32A 4MDSA 1DPOA 5JBBS 6CHAC 3TK6A 5EGMA 2A2XH 4FUEA 3S9CA 2GZ9A 1MKWH 1P2JA 2WUBA 1O2YA 1GCTB 1TGNA 6ESTA 1E37B 4IBLH 2H5CA 3QZRA 1IQJA 2XC0A 3GY3A 3LH1A 1X7AC 5K7RA 3URCA 4WXIA 4BAHB 2BY5X 1FY4A 3P95A 2V3OH 3FP8E 4JZEH 1O30A 1DITH 3QN7A 1ELAA 5F03A 2R9PA 1CA8B 2ZDNA 4YLQH 2BYAX 4XFQA 2PFEA 4BTIB 4D8NA 1T8MA 3U9AH 2WV5A 1AB9B 1SQTA 1HIAA 5JDUB 1O5DH 4RKOB 1O2WA 4JK6A 1NRQH 1MH0A 2XBWA 1G37A 4H42U 5DG6A 3GYMA 1O3HA 3ESTA 4Y10E 3PROA 1SBWA 3A8CA 4Q7YA 3EA9A 2VIOA 4GAWA 3SUFA 1A0HB 5DPAA 5FXLA 3LGYA 1SI5H 4KTCA 2AEIH 1P12E 2ZCHP 1MTNC 3GCHB 1O3LA 4MNYA 3M7TA 4AX9H 4Y0YE 5I46H 1LCYA 2HLCA 2FS8A 1GBTA 2UWPA 1A5IA 5JB8S 3FVFB 1T8LA 1O2KA 1O2HA 3SUEA 3F1SB 4XSKU 1BITA 3URDA 2TPIZ 1ELFA 2LPRA 4ZKSU 1O38A 1W7XH 4YT7H 4XBBA 1C5RA 5JBAS 1YCPH 1LKAA 2CGAA 3ZYDA 2FOGA 5JYIA 2CF8H 1QB9A 1VCWA 1LHGH 3HGNA 1C5VA 1RIWC 1TQ0B 5HYOA 1PYTC 2DE9A 2R2MB 1FPCH 4AFZA 2BDIA 2QGRA 3QGJA 1RD3B 2FI4E 2VIPA 4INKA 2ZTXA 1XXFA 4FUCA 3V13A 1KDQB 1KXAA 3LGUA 4NIXA 1EAWA 1GCTC 4ZHAA 4K69A 4TY7A 3STIA 5EPNA 4ABJA 1QURH 2NU1E 4I8JA 2OXSA 3L6PA 1KXCA 2EC9H 3KHVA 2HGTH 1JRSA 1C1VH 1G3CA 3RXLA 1EAXA 3U98H 4NA9H 3GY4A 1ZPZA 1BHXB 1L0ZA 1MZDA 1Q3XA 2W7UA 1WV7H 1NRNH 4I8GA 4BANB 1UTNA 1FDPA 1C1PA 1AB9C 5BPEA 1N6XA 2VWMA 5GJ4B 4GCHF 2BVRH 3TVJB 4E7RG 1QGFA 3QTOH 3I78A 4BOHA 3RXHA 1TRYA 1C2KA 3BF6H 1IHTH 3MHWU 4GLYA 4TPIZ 4ZMAH 2AIPA 2VVVA 4FUDA 1BBRE 1UTJA 4NA8A 4THNH 3VGCB 4A6LA 1W7GH 2QN5T 3TH4H 3RU4E 4J2YB 7GCHF 4FUBA 1PFXC 2BDHA 3GCHC 3MO3A 1PPFE 1EUFA 3ATKA 5FCRA 2ZPRA 2CF9H 3BTME 1C5UA 2GKVE 1L1GA 1W10U 2VU8E 2P95A 2NWNA 2ZCLP 2PHBA 3TGKE 3RDZA 2ZNKH 3HK3B 1O2UA 1FI8A 1O2MA 2PSXA 2GX4A 2AH4X 1YPGH 2QY0B 1PPCE 4JYUH 1S6HA 2BY8X 4FU8A 1DFPA 1LO6A 1QQUA 1TNIA 4X2XA 2O8TA 2XNIA 2F9UA 3R3GB 1XVMA 1TABE 2WV4A 2XBVA 3M3SA 4ISLA 5FPYA 1GHAG 3HGPA 3MNCA 1SLVB 2HVXA 1ELBA 2STAE 1TMTH 4HZHA 1UK3A 4X6OA 4GVUA 1LQEA 2W3IA 1HNEE 1UVPA 3SJIA 1GWAA 1BJUA 4X8VH 1O2IA 4GHQA 5DP8A 4X6PA 1C1UH 2NU0E 2Y6TA 1QL8A 2FOFA 2QAAA 1GVLA 1YPEH 1GMHF 1O31A 1TWXB 1WOFA 2BD7A 5CE1A 3VB6A 1WYKA 1GVKB 4K8YA 4ABDA 3SV8A 1YLCA 5EOKA 5LPEA 2VIVA 1NZQH 3BEFB 1Q2WA 2O9QA 2ZU4A 1ANCA 2ZHDA 1LVMA 1B0EA 1C1NA 1O37A 1XX9A 1OWHA 4CH2B 8GCHF 4B2AA 2TIOA 4PROA 1G30B 2UUKB 4DG4A 1QFKH 3MYWA 2BQ6B 4UEHH 2CN0H 1ZTLA 4B2BA 3PMAB 3VGCC 6GCHF 3SNAA 3CS0A 5LGOA 3L3TA 3LGWA 4CRAA 1O2SA 3E16B 3P8FA 1H8IH 4JZDH 4I8LA 5FPTA 3DHKH 2ZFTA 3P17H 4WY3A 4YESB 1P3EA 1E36B 1H9HE 3ZYEA 2STBE 4CBOA 1BDAA 2PKSB 2ZZUH 2ZDMA 1LHDH 1P05A 3AASA 1D6WA 1TNHA 3W94A 2ZC9H 3MMGA 1ZYOA 4ASHA 4UFFH 1C4U2 1EASA 3FANA 2JETB 4Q2KA 1GMDF 1CHGA 1MTSA 2OCVB 5DP6A 1S85A 3L33A 1UCYE 5EQQA 1QRXA 2V35A 5E0HA 5TJXA 3S9AA 2ESTE 2ANYA 2AIQA 4Y6DA 4CRBA 2C8WB 3I29A 1PPHE 2QYIA 1A3BH 1E0FD 5F8TA 2WPJS 2FOMB 3E6PH 3U8OH 4ABFA 3W95A 2IOTA 3SJ8A 3RMMH 4AFQA 1SR5C 3MI4A 1VCQA 3F9GA 1XUHA 2F9VA 1KY9A 2OLGA 3WY8A 2PKAB 2VH6A 3RXMA 2FMJA 2C8ZB 1BUIA 1FIWA 1GI9B 1QL9A 1GHBF 3QZQA 3SBKA 3SJKA 1GBAA 2HPQH 3RU4T 1GHXH 5A2MH 2EI6A 3SQHE 2DE8A 2Z9LA 3ODFA 2ZGXH 1H1BA 2FO9A 2A1DB 1WTHD 3F6UH 1EXFA 2OUAA 1GI8B 3UWIA 3LC5A 1GL1A 1TX6A 1TLDA 3U8TH 1EAIA 2WPHS 2O8WA 1O2LA 1BQYA 1UO6A 2BLVA 3ZVCA 1NRRH 4IC5A 1MKWK 5FHTA 1S84A 2AGGX 2XC4A 3M5LA 3P70B 3IITA 1UK4A 1JRTA 3TJNA 2GDDA 2GGVB 4JZFH 4ZAEA 3MH7A 4YM9A 1MCTA 3BN9A 1ORFA 1RXPA 1SGRE 1HAGE 1O2GH 3BTEE 3ZZ8A 4AG1A 1XKBC 2Q6FA 3O8BA 1NY22 1BTXA 3SI3H 2ZHWH 1O2RA 1GBHA 3GDVA 2PGBB 1CA0B 3EE0B 3K65B 2ZEBA 2PKSC 3RMNH 3BTKE 2AFQB 1AFQB 1C5PA 3PWBA 5HM2A 4FXGH 4X1QU 1GBKA 1K1PA 1UHBA 1NPMA 1PQ7A 7ESTE 2JETC 1O3EA 1EJAA 1FMGA 2GCTB 2H9TH 2Y7ZA 1THRH 1OS8A 2RG3A 2FEQH 4E05H 1GJAB 5I25A 3RXQA 1L4ZA 2A4GA 2H1UA 1C5TA 1Q31A 1VGCC 1GMCG 4A1XA 4JMYA 1UJ1A 1ZLRA 3SO3A 2HALA 1C1OA 1UMAH 3O8CA 4TYDA 5EXNA 1QIXB 3PLPA 2A2QH 5A0AE 1BB0B 3F68H 1DUAA 1S5SA 4CHAB 1C5MD 1EZUC 2KAIA 1GMCF 3BG4B 1TRMA 1QHRB 2Y81A 3OX7U 2BQWB 1YC0A 1CSOE 3E1XB 1F0TA 2FXRA 1YPKH 2A31A 4D76A 5HMAA 1YCPK 2Z7FE 2BD2A 1ABIH 1W13U 3A7TA 5FCKA 1CVWH 1GCDA 1IQMA 1SFIA 1WU1A 4R8TB 1O34A 4FUHA 2UWOA 1FLEE 2QXJA 4AOQA 1GBLA 1BTUA 5ETXA 3EYDA 4Y8ZA 1C2DA 2AERH 3A85A 1YCPM 2G55A 3LOXA 3R0FA 3FZZA 4B73A 2GCHG 3MU1A 1SB1H 2J9NA 2ZG0H 4LK4A 5DP9A 4HI3A 1EZSC 2W3KA 2BX4A 5F8ZA 1MBMA 1VITH 3A8AA 1AWFH 2ZFFH 1MKXH 1W3CA 1CA0C 5CHAB 1V2UT 5K0HA 2BLWA 1FNIA 2BDCA 4IS5A 2BZAA 4JYVH 2XBYA 3GDUA 4ISNA 1NTPA 1C5YB 3GICB 5GPIB 2PSYA 1C2LA 4D9QA 2SFAA 3SJOA 9ESTA 1O3CA 3EA8A 3KN2A 2UUFB 4UD9H 1WTGH 1UVTH 2ZDLA 1GJ9B 3TJOA 3P8GA 3ZZ5A 1SQOA 2ANKH 3QDZB 2BDGA 3GYLB 1T8OA 4FVBA 3RXDA 5EG4A 3GISB 3SJ9A 9LPRA 3PV4A 1RJXB 3E0NB 3KEEA 2DUCA 4K5ZA 1ZJKA 1ZRKA 1YM0A 3GCOA 3MOCA 4A92A 2VIDA 5FAHA 4CHAC 1GI1A 2EEKA 3BG4C 4NFEA 5TCCA 3VB3A 2QF0A 1SHHB 3VB4A 3RXJA 1FY5A 4AYVB 1PQ5A 2PTNA 3JZ2B 3H7TA 1HXFH 1F0RA 1TAWA 3GCTG 3S7HB 2B0FA 2GVFA 1IQGA 3UQOA 4AB8A 3UOUA 4WMDA 1HAZB 1O5AB 3OY5U 4ISHH 3ZZAA 3O8DA 1L1JA 5E0GA 1MBQA 2ZGJA 3SORA 1TNJA 1T4VH 3ZV8A 1TFXA 5C20A 1DXPA 3ATLA 2BXTH 3LPRA 1F5LA 5CMXH 2VGCB 1EAUA 3BEUA 1SMFE 2C90B
chains in the Genus database with same CATH superfamily
1MU6B 2B9LA 4KKDA 3OY6U 5DK1A 1KXDA 1SGDE 1SLWB 1NFUA 4Y7AA 2ZDKA 5DP5A 4AB9A 1ELDE 1IQKA 5A09A 5CHAC 1C2EA 1TNKA 1NRPH 1W2KH 1GDQA 2XTTB 1OWIA 3UY9A 3QWCH 2JH5D 3IWMA 1NFWA 1KXBA 1O3AA 4B75A 2FIRH 1O3GA 1VKYA 1EZXC 3RXKA 4K3JA 3VEQB 1GDUA 1AO5A 2W6ID 1GI6A 1KTSB 3K6YA 1GBFA 1NC6A 3H7OA 1EOJA 1AI8H 4X6MA 5GNDA 2J94A 4X8UH 1SGYE 4ISOA 1V2JT 3SQEE 4X1RU 2FESH 1B0FA 2KM0A 3BV9B 1O0DH 2R3UA 3A87A 4FUGA 2A7HA 2J95A 5EU8A 4AZ2B 1SL3A 1GBEA 1GJDB 4OS4A 4ZHLU 4DY7B 1XKAC 1DM4B 1TGSZ 1HAVA 3KCGH 1W0KD 3BIVH 3E3TA 3OU0A 1EB2A 1RFNA 2JH6D 3P8OA 2CHAB 5C3NA 4Q7XA 3UNRA 1GBIA 3OAAD 4U30A 3BTTE 2TGAA 4DURA 1P06A 2ILNA 1LDTT 2QIQA 4NIYA 3DFJA 3TIUA 3BTHE 2Y5HA 2IPHA 3KQCA 3GY6A 3NK8A 1VJ9U 4X1SU 1JMOH 3RXRA 1G36A 1V2OT 3A7YA 4H6SB 3SU3A 4M7GA 3EGKH 1GHWH 4RKJB 2D1JA 2BD9A 2CMYA 1H8DH 1DSUA 2FLRH 1C5ZB 1JIMA 3NWUA 3TJUA 1O2ZA 2VGCC 3DFLA 1G3BA 1AUTC 2BMGB 1BMLA 1C2GA 4I8HA 1DT2A 3BSQA 2OTVA 5EXMA 1HIAB 1A0JA 4FOUC 1SGFG 1GJCB 3IG6B 3PTNA 5L2ZH 2IPQX 1YWUA 3RXUA 5EODA 1TALA 2A45B 3MNSA 2IJOB 3MU4A 1C9TA 1D4PB 3A8BA 3F9HA 4WH6A 4ZKNU 4MPXA 3M7QA 1OX1A 3KF2A 3SI4H 3PLBA 2K8IA 2XNDD 1YYY1 3DA9B 3I77A 1IOEA 2A32A 3D65E 2BD5A 1ZGVA 2HNTC 4Z0KA 3U69H 1SGCA 1GJ7B 3ZZ3A 1QY6A 1GBBA 2QF5A 2B7DH 2H9EH 2VWOA 4GCHG 4IW4E 5JBCS 2XWBI 5EQRA 4DW2U 5T3HA 7KMEH 2ZGBH 3ZVAA 1K1LA 1J16A 1TQ7B 3MU8A 1AD8H 3N7DA 1SFQB 2RDLA 1O3BA 3QUMP 5FBEA 1SGNE 3UIRA 4ABAA 3TNTA 3M35A 2ZP0H 1HUTH 1J8AA 2CHAC 7GCHG 1S0RA 1AZZA 1WQVH 3T62A 1ANBA 2VNTA 1WDIA 1T8NA 2HOBA 3RMOH 1P2MA 1VITF 1P03A 1K9OE 1OWJA 3TH3H 3EAJA 2ZHQH 2F91A 3ZZCA 1GJ5H 2ZDVH 3ZVEA 4X8TH 4YZUA 2ZU3A 4UDWH 2D8WA 3DD2H 1ZSJA 3E91A 1K22H 2PR3A 3SUDA 2G81E 1O2QA 4AORA 3ZVDA 2BY6X 3A82A 1QBNA 4K1EA 4NSYA 4BAOB 1DWEH 5FPSA 3TU7H 4HTCH 4YT6H 3MWIU 1C1RA 2K0QA 5G4BA 1ID5H 1E1RD 1P10A 1DOJA 3RXFA 4KTUA 4ZUHA 1O3PB 1J15A 4X0WU 4CRCA 1BT7A 1O3DA 1NU9A 1OP8A 1J9CH 2I6QA 4IGDA 1QJ7B 4ZXXH 1O33A 2ZA5A 3MH4A 5GXPA 4MQAA 4ZH8A 4JK5A 3GY7A 2FOCA 4JYTA 3ZZ4A 2ODYB 1O2JA 1GMHG 1GPZA 1V2QT 4ABEA 1E38B 1Z8IB 2SGAA 2M2AA 1ZSKA 2YMSB 1YLDA 2FM2A 4NGAH 2KR7A 1ZOMA 4BTTB 2FX4A 1AY6H 1DWBH 1HXEH 2PUXB 3SV6A 2Q6DA 3UOPA 1ARCA 2ALVA 4U2WA 5GWZA 4TY6A 2ZDAH 1V2WT 1CGIE 2VIWA 8GCHG 1O3KA 4FU7A 1MCVA 1OWEA 4X2VA 3QLPH 2ZCKP 2AYWA 1FAKH 2TGDA 3BTFE 3M5MA 1Z6EA 1V3XA 4FUFA 5GDSH 4K1TA 4B2CA 5L6NH 1MKXK 3Q76A 3M5NA 2SGFE 1VCPA 2JJ2D 4ISIH 2SGQE 2Y7XA 4DJZB 6GCHG 1LMWB 4AYYB 5LH8A 1C2FA 5E8EH 1GJ8B 2SNVA 1HAHH 1C1TA 2C8XB 2VWNA 5AVDA 5HGGA 1Z7KA 2OP9A 4B6FA 2SGEE 3A84A 1ZPCA 2KZ4A 3A7VA 2VVCA 1AWHB 3SV9A 2ZECA 5A0CA 2WPLS 3PV5A 1T31A 5C2ZA 3LKWA 1YPMH 2XYAA 2EA3A 1OYTH 1P02A 5GCHF 3UREA 1C2HA 2OC7A 2QXGA 3MNBA 1K1MA 1GMDG 4FVDA 1O5CB 1DICA 4F55A 1T7CA 2ZPQA 1HBTH 1TIOA 4ABIA 3PWCA 3ZIAD 1TBQH 3SNCA 4HG6A 5DP4A 1UTPA 3AAUA 4IN1A 3CENA 4RN6A 4Y7BA 3RXTA 4O3UA 4YO9A 1ZHMA 4A5TS 4ESTE 3Q77A 3T2NA 1SOTA 2UUYA 3QX5H 2YOLA 1QZ8A 1QA7A 1ZTJA 1C5XB 1VGCB 4NWLA 1SGFA 2HWLB 1GHBG 3E0PB 2OBQA 2UWLA 5T1VA 3A7WA 2YMSC 1H9IE 3BTQE 2PW8H 2JH0D 1W8BH 1HYLA 2TGPZ 4YOGA 3ODDA 1TGTA 1BRCE 1GHZA 5EW1H 4WVPE 1P2NA 2Q1JA 3OEED 1ZMJA 3F2FA 5F53A 1CGJE 4B71A 2OC0A 1A3EH 4OGXA 1MD8A 4K1SA 2GV6A 3ZVFA 2OQUA 1AMHA 4NZLA 5LPRA 1Y3WA 1IQIA 1MU8B 1H4WA 4AC9A 3T25A 1SC8U 1QNJA 3PRDA 5E2PA 1MTVA 2XW9A 2VWLA 4BXSA 4Y71A 1KTTB 2G52A 3PYHA 2XBXA 4I31A 3T29A 1BMAA 2THFB 1GDNA 5LPFA 1DY8A 1EJNA 1O39A 4UFDH 2XXLA 1CHOF 4GPGA 4Y8XA 3SUGA 3S9BA 1OPHB 1MTUA 2F9NA 3M37A 1N6YA 3LT3A 1NT1A 3OSYA 3M61U 1TE0A 2G4TA 2HNTF 2IN2A 4A7IB 4CR9A 1YPLH 3ATMA 1V2VT 2GDEH 3V0XA 1QRWA 2J92A 2VBCA 1DE7H 4INHA 2D26C 2WHXA 3KL6A 3RXVA 1TONA 2A5KA 3HATH 3S0NA 3MQKC 1A61H 2WZQA 1KXFA 2OD3B 4NIWA 3HK6B 1C1SA 5C1XA 1RTFB 5EPYA 1O2XA 1OXGA 4NCYA 5EW2H 3MO9A 4ZKRU 1W0ZU 1NO9H 1HJAC 2ZFPH 3DUXH 4CRGA 1EJMA 1Z1IA 2W5EA 3RC6A 2TGTA 1KLTA 1GBDA 2AMDA 4X2YA 1TNLA 2V7QD 4TT3D 3W1EA 1OSSA 4FU9A 1C1MA 5IDKA 4OS6A 3HKJB 1XUIA 1C5QA 4AFUA 1EQ9A 1GJ6A 4DOQA 1CGHA 1TMBH 3TH2H 5B6OA 2ZU2A 1J17T 4GUXA 1D3TB 4BAKB 1ABJH 1GHVH 1SOZA 5A8YA 1C2MA 2FWWA 4U01A 3UFAA 2FPZA 1TOCB 4F49A 2GT8A 5KECA 2F9BH 1SHYA 2J34A 2BB4A 2QF3A 1UHBB 1CO7E 5EJ1A 2G8TA 3F0PA 4NG9H 4YOJA 3P8NA 4I33A 1D3QB 3ELAH 3A80A 3AK5A 3UUZA 3SU0A 1LHFH 1SLUB 3M3TA 2J98A 2F43B 5EQSA 2ZQ2A 4B76A 4ZCNA 1A0LA 1NFXA 1JIRA 3CP7A 2LNCA 3UB0A 2J38A 3DT0H 2XWAA 1DLEA 1K1NA 2Y5FA 2R0KA 2EY4C 2AHME 2I6SA 1BTZA 1P2OA 2SGPE 2VJ1A 1GG6C 5EIYA 1N8OB 2V0BA 1EZQA 2FZZA 3DSOA 4QT8C 4RSPA 3U1JB 4MVNA 4UE7H 1A2CH 3K6ZA 2ODQA 2OINA 1E35B 5T6FA 4X1PU 4B74A 4LOYH 5DN6D 1YKTA 2Z3CA 1MABB 2KAIB 1TBRH 3Q3YA 1FY8E 4SGAE 1AQ7A 2FTLE 2BLOA 1O35A 1L2EA 1Y8TA 1ELEE 1CE5A 4MNXA 3SU1A 4Q80A 1A7SA 3C1KA 2ALPA 2EI8A 3LGTA 1ELTA 3SOSA 3V12A 4XOJA 1K28D 4WF8A 3RC5A 1UW7A 1COWD 5L2YH 1PQ8A 3A88A 3RXBA 5C67A 4WXVA 1O5BB 2L6OA 4O03A 1HV7A 2QA9E 3E8LA 3S69A 2GMTB 1C5NH 1GI0A 1PQAA 2P8OB 4I8KA 5DSFA 2ZWLH 1V2NT 3QO6A 2JDID 1LPZB 3QK1A 2GV7A 2BOHB 1IQLA 2W26A 1UVOA 3A86A 4BTUB 1YPHC 2GP9B 3M3VA 3Q3XA 1G3DA 2H6MA 5DP7A 4TPYA 1YLNA 1O3OA 1EP6A 2GTBA 1HCGA 4BXWA 1FQ3A 1AKSA 2H9HA 3FAOA 1FY1A 2G5NA 1CT0E 2C3SA 2FYRA 4BNRA 3ZZ7A 1AFEH 2VIQA 2ANWA 3BTWE 2QXHA 3FZDA 4K8BA 3MO6A 2BDYA 1SVPA 8KME2 2G00A 1V2RT 3RXAA 3QTVH 4BAQB 1FUJA 1C5SA 3V3MA 1JXPA 1OWDA 3RM0H 1D9IA 1P2IA 1DANH 1PPGE 4H6TA 1QJ6B 2J5UA 2YNAA 2IJD1 1N8OC 2OC1A 1HAPH 2Z94A 3RXEA 1DVAH 3TK9A 4D7FA 2P3FH 1D6RA 3C27B 4ZHMU 1VZQH 3SGQE 2G5VA 3LJJA 2Z9KA 2NU3E 1ACBE 2BLQA 3UNSA 1UTQA 4Z1MD 3OYPA 3D23A 3KIDU 4VGCB 3UTUH 2P59A 1C5LH 1HAIH 3AVZA 2KCYA 1TPPA 1Z8GA 3ZZ9A 1ZHPA 1KLJH 4NFFA 2GZ7A 2FOEA 1LQDB 4AN7A 2PTCE 4UFGH 5J4QA 2FI3E 2ZI2H 3F2GA 1S83A 2KCPA 3ZZ6A 3MNXA 5E0JA 2J2UA 2F9PA 2C8YB 1BBRH 3SU4A 2ZQ1A 5IYTA 4O97A 1U6QA 1KMHB 1EB1H 2GMTC 1SG8B 2P8OC 5EXLA 5GIBA 1OOKB 2Z9JA 2Y5GA 2V3HH 5F6MA 2CXVA 3T28A 1BZXE 4D7GA 4NIVA 4FUIA 3RXPA 1O2NA 1QR3E 4ABBA 2PGQB 1K1OA 3MTYA 3TNSA 5C0TA 2O8LA 3ZZBA 2FTMA 2WPMS 1F5RA 2J4IA 4X8SH 1BMMH 3EA7A 1UK2A 3JZ1B 1BTHH 2CJIA 2R0LA 2UUJB 3GDSA 1DY9A 4RT1A 2AGIX 2QCYA 1JOUB 4FUJA 2D2DA 3UR6A 1CU1A 1NBME 1ZR0A 4CBNA 4JZIA 4K60A 5DGJA 4GHTA 1DUEA 3NZIA 3UWJH 2H2ZA 3UAIC 4YLUA 1AVXA 1OHHD 1MMJN 1AU8A 4MNVA 3VXFH 1G3EA 1K2I1 1RTLA 5KGOA 1IQEA 4HFPB 3ATWA 3KQEA 2YMSD 2NU2E 1EKBB 1KDQA 5ABWA 5KEDA 2ZTZA 4NZQA 3PMJA 1P9SA 2YNBA 3RUOA 2FX6A 1O3FA 4LZ4B 3AAVA 2ZFSA 1HAVB 7LPRA 1OP2A 1G32B 1O2VA 1QL7A 4R0IA 2RCEA 1TNGA 5IK2D 5J4SA 4O9VA 4YTAA 4VGCC 1YPHE 2V6NA 3VFEA 3O8RA 1ELVA 4K2YA 1UTOA 4CRDA 1BTYA 3H09A 3ATIA 3P6ZB 3LH3A 1K21H 2FOHA 4TWYA 2BX3A 3NXPA 5FBIA 2RA3A 5L30H 3LONA 3RM2H 3B23B 1XXDA 3VB5A 4MTBA 1Z8RA 6LPRA 3M7UA 4X2WA 3ZVGA 2ZPSA 1DLKB 1AUJA 1LHCH 1ZMLA 4SGBE 2G4UA 3RXGA 3GOVB 1N1LA 4MLFB 1B7XB 4HGCA 3VPKA 1VITG 1YBWA 2NU4E 1T4UH 1QB6A 2XCNA 2ZGHA 5HKKD 1WQSA 4J1YA 1C4V2 2QE7D 1G2MA 2ZU1A 1LVBA 2PUQH 4ZROA 2ZIQH 3SV7A 1A1RA 1O3MA 3N7OA 3U8RH 2VINA 2R2WU 4OS1A 4P00A 4RT0A 4LZ1H 1Y5UT 4WH8A 3RLYH 3F9EA 1Y5BT 3MFJA 3A89A 2A7JA 4I32A 1OKXA 1V2TT 4DIHH 2WUCA 4BAMB 5SGAE 1H9LB 2A0QB 3GY5A 3T27A 4WMEA 4A1VA 5CHBA 1UCYH 1C1WH 2P94A 3CS7A 1EP5A 3SNBA 1ZPBA 4CR5A 2SNWA 1ZSLA 1CQQA 1SGTA 3BIUH 1ESAA 3SU2A 2EI7A 2O8UA 1NN6A 1W14U 1A5GH 5FX5A 1HFDA 1LKBA 1TRNA 3B8JA 1QBOA 1HRTH 1SQRA 1P2QA 3FO8D 5ESTE 3G01A 3T5FH 1XUKA 1OP0A 4ABHA 1P2KA 5DO4H 1TX8A 2WSSD 1W0YH 3AW1A 1O3NA 4X1NU 1FJSA 2P93A 3UNQA 3VXEH 2BDBA 1PJPA 3U28C 1XM1A 1MAYA 3SNEA 2JKHA 3TPIZ 1O3IA 2HLDD 1BIOA 1PPZA 2HRVA 1DWCH 1F0UA 1DDJA 1ESTA 3PM3A 4XBDA 2FS9A 2FODA 3FP6E 1C5WB 2WYJA 2F83A 2ZFQH 1MTWA 1QB1A 1BRAA 5TCAA 3K2UA 3V7TA 5AFYH 1ARBA 1AVGH 1Y3YA 1L4DA 1UVSH 2Z9GA 3VB7A 1TB6H 1ETSH 4IMQA 1TOMH 1CT2E 2VH0A 2OQ5A 4F4OC 3EDXB 4F48B 1NU7B 3LDXH 4MPVA 2BVXH 2ZU5A 1Y3VA 2XCFA 2XOKD 5E2OA 1WUNH 3BG8A 1XUGA 4JCNA 1O5FH 2B5TB 4GSOA 3HPTB 4TWWA 1F5KU 4O3TA 1GHAF 2F3CE 4KGAA 2BY7X 1LTOA 2XRCA 1GVZA 4OGYA 4XRNA 1YPJH 3A83A 3QGNB 3SV2H 1AE8H 1UTKA 1GBCA 2BD4A 2QV1A 5HM9A 1MQ6A 1GBMA 2V3MA 5GCHG 3RXIA 3RXOA 2ODPA 1SSXA 1O2OA 2Q6GA 3RC4A 2Z3DA 1NBMD 3T26A 1S0QA 1TPAE 3PMBB 1GHYH 1D3PB 1ANDA 4MPWA 1HB0B 5AHGH 1AE5A 1FONA 1P04A 4A1TA 1TA6A 2P16A 1P57B 1P9UA 4MG3A 1CT4E 2HNTE 1RS0A 3STJA 2ANMH 1YF4A 2GJGA 8LPRA 1F2SE 1GJBB 3GY2A 1LPGB 4Y8YA 1TA2A 1NFYA 4DIIH 2Y82A 2TRMA 1QBVH 3SYJA 1IHSH 1EPTA 1KIGH 1SGIB 1GBJA 1VJAU 3FOAA 4OS5A 4WJG2 5JB9S 4DVAU 1MD7A 1RGQA 1WCZA 2PKAA 3CNRA 1KSNA 3SHAH 1HJAB 1QRZA 1M9UA 1AGJA 1ZJDA 5T6DA 4I86A 4B1TA 1LPKB 1KXEA 3NCLA 1C4Y2 3RLWH 3LJOA 2B8OH 1FZZA 3SZNA 3SZEA 2A5AA 5ESBA 1LHEH 4Y11E 4KELA 1ETTH 1INCA 1XMNB 3F0OA 3SGAE 3BEIB 1IQNA 3F9FA 1BA8B 2F9OA 1O2TA 1HAXB 1HJ8A 4E06H 3A8DA 4KP0A 1UTLM 1L1NA 5DP3A 2PP6A 2RA0A 1E34B 3A7XA 3MU5A 4OS7A 2ZFRH 3OE7D 3LU9B 1KYNA 1EATA 2RFKC 1GJ4H 1T32A 2SGDE 3UPEA 1BRUP 1LVOA 1P11E 3KNXA 3EE7A 2Z6BD 3ZVBA 2ZF0H 1BJVA 1SPJA 4OS2A 2GT7A 2HPPH 1HDTH 1Z1JA 3SHCH 3KGPA 1EPTB 1THSH 2C4FH 5DKMA 4ZKOU 1G2LA 1V2PT 5F8XA 1CHOG 3U1IB 4Q7ZA 5C0UA 1ELCA 1GL0E 4U32A 3PMHB 2GD4B 4IC6A 4XBCA 1SGEE 1TGCA 2BHGA 3K9XB 3OTJE 1EOLA 1TYNA 4NWKA 5C1YA 3TITA 3SN8A 1GG6B 4YXWD 1BBRK 1TPOA 2BZ6H 1YP9A 1F7ZA 1BTWA 2OBOA 3TGIE 1LVYA 5JBTA 1BTPA 1A5HA 1HLTH 2AS9A 5HXFA 4I7YH 1QQ4A 1FPHH 3AW0A 1DX5M 1K1IA 2GZ8A 2ASUB 3D49H 3RU4D 1A46H 8ESTE 3RXCA 1P0SH 1NROH 1ZMNA 1TMUH 2A7CA 2BVSH 1HGTH 1O3JA 5FX6A 1XUJA 4XDEA 5A0BA 2P3UB 2ZKSA 1GGDB 4MNWA 2TBSA 2G51A 3A81A 2WYGA 4WMFA 4FETA 4ABGA 1P01A 1ESBA 4TSFD 1GI4A 1NRSH 1F92A 1XUFA 1MQ5A 2FLBH 3ITIA 3F3BA 3H5CB 2CV3A 1MAXA 1DS2E 1Y5AT 1SQAA 2KX4A 1TX7A 2ZO3H 1FAXA 1BCUH 3S7KB 5A8ZA 3RXSA 2C93B 1S6FA 1O36A 1S82A 2O8MA 2A4OA 1TPSA 1Y3UA 1O2PA 2BQ7B 3RP2A 1DXWA 1CBWB 1DSTA 3TGJE 1C2IA 1PPBH 3ENSB 1C1QA 1V2KT 3SU6A 1UTMA 1QTFA 1HAOH 1FV9A 1H8ED 1EPTC 1AIXH 4Y76A 1D3DB 2KCAA 3BTGE 3D62A 1EX3A 2FI5E 2OC8A 1YGCH 1SGQE 2ZTYA 1ZZZA 2Y80A 1GI2A 2A4RA 1MUEB 3NUMA 2LELA 1BMNH 4MPUA 1MZAA 2ZGCA 4AGJA 5JPMH 4Y79A 5T6GA 1XVOA 2Z9IA 3PO1B 3EQ0H 3M36A 5C5OA 2BD3A 1K1JA 3FFGA 4NSVA 1AN1E 1V2LT 1FIZA 4UFEH 1PYTD 1IAUA 2ZHFH 1Y59T 1BRBE 1SLXB 4DGJA 1C2JA 1ZRBA 3LC3A 3F2HA 3UQVA 1NM6A 1V2MT 2AMPA 2AMQA 3ZZDA 1E79D 4UONA 3SNDA 2FOBA 3FN8A 2BOKA 1V2ST 1H8HD 3TJVA 5PTPA 1Z8JB 4ZXYH 1GGDC 5AFZH 1GI7B 2VB0A 4DT7B 2M5TA 1SGPE 3LIWA 4H4FA 1IQFA 2OK5A 4YOIA 1VR1H 1W12U 2XC5A 2FDAA 2GCHF 2J98B 1UCYK 2BTCE 4IN2A 4CREA 1HAYB 1AFQC 1O5EH 1JBUH 3MU0A 1FN8A 2BD8A 2Z3EA 2A5IA 2J97A 3LGIA 1GI3A 6CHAB 1BHXF 4ASUD 1TBZH 1P3CA 3SW2B 4AG2A 1PPEE 2GCTC 2FOAA 1C9PA 3PTBA 1B5GH 3ZV9A 2BXUH 1FN6A 1ZGIA 1CBWC 1P8VC 1AVWA 3BTDE 1THPB 3FP7E 2QXIA 3A7ZA 3PB1E 4KTSA 5AF9H 1NS3A 2R3YA 1J14A 1G9IE 4CRFA 2BY9X 1IQHA 2H5DA 2PLXA 3SGBE 1QJ1B 1NESE 3NKKA 1P09A 3LGVA 5BRRE 2FYQA 3P92A 3NPSA 3DSGA 3KQBA 1UVUH 4INLA 1V6DA 3SU5A 2PV9B 2AGEX 4E7NA 4XE4A 2F4LA 1ZTKA 1WBGB 2VVUA 1HPGA 1O5GH 1GI5A 2RDEA 1AZ8A 2ULLA 1ETRH 4Y0ZE 4Z6AH 4JZ1A 3Q00A 1W11U 5DJ7A 1Y3XA 1E1QD 4DCDA 3PO1C 3GCNA 3M5OA 1RTKA 3E90B 1MTNB 1C5OH 2WPIS 4WWYA 2K1QA 1BOQA 1DWDH 2LP6A 1Z6JH 1AHTH 2P3TB 1WSSH 4LXBH 1HJ9A 3N7EA 2FP7B 4X6NA 5C5NA 4CH8B 3GCTF 1ZHRA 2ZHEH 1FY3A 3GY8A 4AGKA 3TK5A 1Z71A 5C17A 1K0HA 1S81A 1TGBA 1OWKA 3KQDA 3RMLH 3UR9A 4AFSA 4D9RA 2PWXA 2WINI 5C1UA 1AKSB 1F0SA 3PLKA 1A4WH 2W7SA 2QC2A 1QCPA 2WPKS 5H4IB 1WAYB 1QA0A 1JWTA 1ANEA 4IMZA 3TLOA 3B9FH 2BDAA 2BM2A 3MH5A 1RIWB 1RRKA 5A8XA 2A4QA 3HKIB 3MH6A 4NA7A 1FXYA 1ELGA 3Q3KA 1OYQA 1KLIH 1O32A 4MDSA 1DPOA 5JBBS 6CHAC 3TK6A 3PV2A 2A2XH 5EGMA 4FUEA 3S9CA 2GZ9A 1MKWH 1FX0B 1P2JA 2WUBA 1O2YA 1GCTB 1TGNA 6ESTA 1E37B 4IBLH 2H5CA 3QZRA 1IQJA 2XC0A 3GY3A 2WV9A 1X7AC 3LH1A 5K7RA 3URCA 4WXIA 4BAHB 2BY5X 1FY4A 3P95A 2V3OH 3FP8E 4JZEH 1O30A 1DITH 3QN7A 1ELAA 5F03A 4P02A 2R9PA 1CA8B 2ZDNA 4YLQH 2BYAX 4XFQA 2PFEA 4BTIB 4D8NA 1T8MA 3U9AH 2WV5A 1AB9B 1SQTA 1HIAA 3N99A 5JDUB 1O5DH 4RKOB 1O2WA 4JK6A 2EQNA 4Q63A 1NRQH 1MH0A 2XBWA 1G37A 4H42U 5DG6A 3GYMA 1O3HA 3ESTA 4Y10E 3PROA 1SBWA 3A8CA 4Q7YA 3EA9A 2VIOA 4GAWA 3SUFA 1A0HB 5DPAA 5FXLA 3LGYA 1SI5H 4KTCA 2AEIH 1P12E 2ZCHP 1MTNC 3GCHB 1O3LA 3OTPA 4MNYA 3M7TA 4AX9H 4Y0YE 5I46H 1LCYA 2HLCA 2FS8A 1GBTA 2UWPA 1A5IA 4OM9A 5JB8S 3FVFB 1T8LA 1O2KA 1O2HA 2QF4A 3SUEA 3F1SB 4XSKU 1BITA 3URDA 2TPIZ 1ELFA 2LPRA 4ZKSU 1O38A 1W7XH 4YT7H 4XBBA 4RI0A 1C5RA 5JBAS 1YCPH 1LKAA 2CGAA 3ZYDA 4ACAA 2FOGA 5JYIA 2CF8H 3DCLA 1QB9A 1VCWA 1LHGH 3HGNA 1C5VA 1RIWC 1TQ0B 5HYOA 1PYTC 2DE9A 2R2MB 1FPCH 4AFZA 2BDIA 2QGRA 3QGJA 1RD3B 2FI4E 2VIPA 4INKA 2ZTXA 1XXFA 4FUCA 3V13A 1KDQB 1KXAA 3LGUA 4NIXA 1EAWA 1GCTC 3WWBA 4ZHAA 4K69A 4TY7A 3STIA 5EPNA 4ABJA 5CDFE 1BMFD 1QURH 3VG8A 2NU1E 4I8JA 2OXSA 3L6PA 1KXCA 2EC9H 3OEHD 3KHVA 2HGTH 1JRSA 1C1VH 1G3CA 3RXLA 1EAXA 3U98H 4NA9H 3GY4A 1ZPZA 1BHXB 1L0ZA 1MZDA 1Q3XA 2W7UA 1WV7H 1NRNH 4I8GA 4BANB 1UTNA 1FDPA 1C1PA 1AB9C 5BPEA 1N6XA 2VWMA 3GS9A 5GJ4B 4GCHF 2BVRH 3TVJB 4E7RG 5FL7D 1QGFA 3QTOH 3I78A 4BOHA 3RXHA 1TRYA 2WPDD 1C2KA 3BF6H 1IHTH 3MHWU 4GLYA 4TPIZ 4ZMAH 2AIPA 2VVVA 4FUDA 1BBRE 1UTJA 4NA8A 4THNH 3VGCB 4A6LA 1W7GH 2QN5T 3TH4H 3RU4E 4J2YB 7GCHF 4FUBA 1PFXC 2BDHA 3GCHC 3MO3A 3KYGA 1PPFE 1EUFA 3ATKA 5FCRA 4DT4A 2ZPRA 2CF9H 3BTME 1C5UA 2GKVE 1L1GA 1W10U 2VU8E 2P95A 2NWNA 2ZCLP 2PHBA 3TGKE 3RDZA 2ZNKH 3HK3B 1O2UA 1FI8A 1O2MA 2PSXA 2GX4A 2AH4X 1YPGH 2QY0B 1PPCE 4JYUH 1S6HA 2BY8X 4FU8A 1DFPA 1LO6A 1QQUA 1TNIA 4X2XA 2O8TA 2XNIA 2F9UA 3R3GB 1XVMA 1TABE 2WV4A 2XBVA 3M3SA 4ISLA 5FPYA 1GHAG 3HGPA 3MNCA 1SLVB 2HVXA 1ELBA 2STAE 1TMTH 4HZHA 1UK3A 4X6OA 4GVUA 1LQEA 4B6EA 2W3IA 1HNEE 2JJ1D 1UVPA 3SJIA 1GWAA 1BJUA 4X8VH 1O2IA 4GHQA 5DP8A 4X6PA 2L74A 1C1UH 2NU0E 2Y6TA 1QL8A 2FOFA 2QAAA 1GVLA 1YPEH 1GMHF 1O31A 1TWXB 1WOFA 2JIZD 2BD7A 5CE1A 3VB6A 1WYKA 1GVKB 4K8YA 4ABDA 3SV8A 1YLCA 5EOKA 5LPEA 2VIVA 1NZQH 3BEFB 1Q2WA 2O9QA 2ZU4A 1ANCA 2ZHDA 1LVMA 1B0EA 1C1NA 1O37A 1XX9A 1OWHA 4CH2B 8GCHF 4B2AA 2TIOA 4PROA 1G30B 2UUKB 4DG4A 1QFKH 3MYWA 2BQ6B 4UEHH 2CN0H 1ZTLA 4B2BA 3PMAB 3VGCC 6GCHF 3SNAA 3CS0A 5LGOA 3L3TA 3LGWA 4CRAA 1O2SA 3E16B 3P8FA 1H8IH 4JZDH 4I8LA 5FPTA 3DHKH 2ZFTA 3P17H 4WY3A 4YESB 1P3EA 1E36B 1H9HE 2CK3D 3ZYEA 2STBE 4CBOA 3DSPA 1BDAA 2PKSB 2ZZUH 2ZDMA 1LHDH 1P05A 3AASA 1D6WA 1TNHA 3W94A 2ZC9H 3MMGA 1ZYOA 4ASHA 4UFFH 1C4U2 1EASA 3FANA 2JETB 4Q2KA 1WXRA 1GMDF 1CHGA 1MTSA 2OCVB 5DP6A 1S85A 3L33A 1UCYE 5EQQA 1QRXA 2V35A 5E0HA 5TJXA 3S9AA 2ESTE 2ANYA 2AIQA 4Y6DA 4CRBA 2C8WB 3I29A 1PPHE 2QYIA 1A3BH 1E0FD 5F8TA 2WPJS 2FOMB 3E6PH 3U8OH 4ABFA 3W95A 2IOTA 3SJ8A 3RMMH 4AFQA 1SR5C 3MI4A 1VCQA 3F9GA 1XUHA 2F9VA 1KY9A 2OLGA 3WY8A 2PKAB 2VH6A 3RXMA 2FMJA 2C8ZB 1BUIA 1FIWA 1GI9B 1QL9A 1GHBF 3QZQA 3SBKA 3SJKA 1GBAA 2HPQH 3RU4T 1GHXH 5A2MH 2EI6A 3SQHE 2DE8A 2Z9LA 4M9FA 3ODFA 2ZGXH 1H1BA 2KFWA 2FO9A 2A1DB 1WTHD 3F6UH 1EXFA 2OUAA 1GI8B 3UWIA 3LC5A 1GL1A 1TX6A 1TLDA 3U8TH 1EAIA 2WPHS 2O8WA 3FKSD 1O2LA 1BQYA 1UO6A 2BLVA 3ZVCA 1NRRH 4IC5A 5EJZA 1MKWK 5FHTA 3WWFA 1S84A 2AGGX 2XC4A 3M5LA 3P70B 3IITA 3NRLA 1UK4A 1JRTA 3TJNA 2GDDA 2GGVB 4JZFH 4ZAEA 3WW7A 4Q4LA 3MH7A 4YM9A 1MCTA 3BN9A 1ORFA 1RXPA 1SGRE 1HAGE 1O2GH 3BTEE 3ZZ8A 5HIYA 4AG1A 1XKBC 2Q6FA 3O8BA 1NY22 1BTXA 3SI3H 2ZHWH 1O2RA 2KCOA 1GBHA 3GDVA 2PGBB 1CA0B 3EE0B 3K65B 2ZEBA 2PKSC 3RMNH 3BTKE 2AFQB 1AFQB 1C5PA 3PWBA 5HM2A 4FXGH 4X1QU 1GBKA 1K1PA 1UHBA 1NPMA 1PQ7A 7ESTE 2JETC 1O3EA 1EJAA 1FMGA 2GCTB 3KQ5A 2H9TH 2Y7ZA 1THRH 1OS8A 2RG3A 2FEQH 4E05H 1GJAB 5I25A 3RXQA 1L4ZA 2A4GA 2H1UA 1C5TA 1Q31A 1VGCC 1GMCG 4A1XA 4JMYA 1UJ1A 1ZLRA 3SO3A 2HALA 1C1OA 1UMAH 5C94A 4XD7D 3O8CA 4TYDA 5EXNA 1QIXB 3PLPA 2A2QH 5A0AE 1BB0B 3F68H 1DUAA 1S5SA 4CHAB 1C5MD 1EZUC 2KAIA 2HVYB 1YY3A 1GMCF 3BG4B 1TRMA 1QHRB 2Y81A 3OX7U 2BQWB 1YC0A 5EJLA 5HIZA 1CSOE 3E1XB 1F0TA 2FXRA 1YPKH 2A31A 4D76A 5HMAA 3PRBA 1YCPK 2Z7FE 2BD2A 1ABIH 1W13U 3A7TA 5FCKA 1CVWH 1SKYE 1GCDA 1IQMA 1SFIA 1WU1A 4R8TB 1O34A 4FUHA 2UWOA 1FLEE 2QXJA 4AOQA 1GBLA 1BTUA 5ETXA 3EYDA 4Y8ZA 1C2DA 2AERH 3A85A 1YCPM 2G55A 3LOXA 3R0FA 3FZZA 4B73A 2GCHG 3MU1A 1SB1H 2J9NA 2ZG0H 4LK4A 5DP9A 4HI3A 1EZSC 2W3KA 2BX4A 5F8ZA 1MBMA 1VITH 3A8AA 1AWFH 2ZFFH 1MKXH 1W3CA 1CA0C 5CHAB 1V2UT 5K0HA 2BLWA 2W6JD 1FNIA 2BDCA 4IS5A 2BZAA 4JYVH 2XBYA 3GDUA 4ISNA 1NTPA 3KYFA 5B6LA 1C5YB 3GICB 5GPIB 2PSYA 1C2LA 4D9QA 2SFAA 3SJOA 9ESTA 1O3CA 3EA8A 3KN2A 2UUFB 4UD9H 1WTGH 1W0JD 1UVTH 2ZDLA 1GJ9B 3TJOA 3P8GA 3ZZ5A 1SQOA 2ANKH 3QDZB 2BDGA 3GYLB 1T8OA 4FVBA 3RXDA 5EG4A 3GISB 3SJ9A 9LPRA 3PV4A 1RJXB 3E0NB 3KEEA 2DUCA 4K5ZA 1ZJKA 1ZRKA 1YM0A 3GCOA 3MOCA 4A92A 2VIDA 5FAHA 4CHAC 1GI1A 2EEKA 3BG4C 4ACBA 4NFEA 5TCCA 3VB3A 2QF0A 1SHHB 3VB4A 3RXJA 1FY5A 4AYVB 1PQ5A 1EFRD 2PTNA 3JZ2B 3H7TA 1HXFH 1F0RA 1TAWA 3GCTG 3S7HB 2B0FA 2GVFA 1IQGA 3UQOA 4AB8A 3UOUA 4WMDA 1HAZB 1O5AB 3OY5U 4ISHH 3ZZAA 3O8DA 1L1JA 5E0GA 1MBQA 2ZGJA 3SORA 1TNJA 1T4VH 3ZV8A 1TFXA 1S6LA 5C20A 1DXPA 3ATLA 2BXTH 3LPRA 1F5LA 5CMXH 2VGCB 1EAUA 3BEUA 1SMFE 2C90B 3OFND
chains in the Genus database with same CATH topology
1MU6B 2B9LA 4KKDA 3OY6U 5DK1A 1KXDA 1SGDE 1SLWB 1NFUA 4Y7AA 2ZDKA 5DP5A 4AB9A 1ELDE 1IQKA 5A09A 5CHAC 1C2EA 1TNKA 1NRPH 1W2KH 1GDQA 2XTTB 1OWIA 3UY9A 3QWCH 2JH5D 3IWMA 1NFWA 1KXBA 1O3AA 4B75A 2FIRH 1O3GA 1EZXC 3RXKA 4K3JA 3VEQB 1GDUA 1AO5A 1GI6A 1KTSB 3K6YA 1GBFA 1NC6A 3H7OA 1EOJA 1AI8H 4X6MA 2J94A 4X8UH 1SGYE 4ISOA 1V2JT 3SQEE 4X1RU 2FESH 1B0FA 3BV9B 1O0DH 2R3UA 3A87A 4FUGA 2A7HA 2J95A 5EU8A 4AZ2B 1SL3A 1GBEA 1GJDB 4OS4A 4ZHLU 4DY7B 1XKAC 1DM4B 1TGSZ 1HAVA 3KCGH 3OU0A 3BIVH 3E3TA 1EB2A 1RFNA 2JH6D 3P8OA 2CHAB 5C3NA 4Q7XA 3UNRA 1GBIA 4U30A 3BTTE 2TGAA 4DURA 1P06A 2ILNA 1LDTT 2QIQA 4NIYA 3DFJA 3TIUA 3BTHE 2Y5HA 2IPHA 3KQCA 3GY6A 3NK8A 1VJ9U 4X1SU 1JMOH 3RXRA 1G36A 1V2OT 3A7YA 4H6SB 3SU3A 4M7GA 3EGKH 1GHWH 4RKJB 2D1JA 2BD9A 2CMYA 1H8DH 1DSUA 2FLRH 1C5ZB 1JIMA 3NWUA 3TJUA 1O2ZA 2VGCC 3DFLA 1G3BA 1AUTC 2BMGB 1BMLA 1C2GA 4I8HA 1DT2A 3BSQA 2OTVA 5EXMA 1HIAB 1A0JA 1SGFG 1GJCB 3IG6B 3PTNA 5L2ZH 3RXUA 5EODA 1TALA 2A45B 3MNSA 2IJOB 3MU4A 1C9TA 1D4PB 3A8BA 3F9HA 4WH6A 4ZKNU 4MPXA 3M7QA 1OX1A 3KF2A 3SI4H 3PLBA 1YYY1 3DA9B 3I77A 1IOEA 2A32A 3D65E 2BD5A 1ZGVA 2HNTC 4Z0KA 3U69H 1SGCA 1GJ7B 3ZZ3A 1QY6A 1GBBA 2VWOA 2B7DH 2H9EH 4GCHG 4IW4E 5JBCS 2XWBI 5EQRA 4DW2U 5T3HA 7KMEH 2ZGBH 3ZVAA 1K1LA 1J16A 1TQ7B 3MU8A 1AD8H 1SFQB 2RDLA 1O3BA 3QUMP 5FBEA 1SGNE 3UIRA 4ABAA 3TNTA 3M35A 2ZP0H 1HUTH 1J8AA 2CHAC 7GCHG 1S0RA 1AZZA 1WQVH 3T62A 1ANBA 2VNTA 1T8NA 2HOBA 3RMOH 1P2MA 1VITF 1P03A 1K9OE 1OWJA 3TH3H 3EAJA 2ZHQH 2F91A 3ZZCA 1GJ5H 2ZDVH 3ZVEA 4X8TH 4YZUA 2ZU3A 4UDWH 2D8WA 3DD2H 1ZSJA 3E91A 1K22H 2PR3A 3SUDA 2G81E 1O2QA 4AORA 3ZVDA 2BY6X 3A82A 1QBNA 4K1EA 4NSYA 4BAOB 1DWEH 5FPSA 3TU7H 4HTCH 4YT6H 3MWIU 1C1RA 5G4BA 1ID5H 1P10A 1DOJA 3RXFA 4KTUA 4ZUHA 1O3PB 1J15A 4X0WU 4CRCA 1BT7A 1O3DA 1NU9A 1OP8A 1J9CH 2I6QA 4IGDA 1QJ7B 4ZXXH 1O33A 2ZA5A 3MH4A 5GXPA 4MQAA 4ZH8A 4JK5A 3GY7A 2FOCA 4JYTA 3ZZ4A 2ODYB 1O2JA 1GMHG 1GPZA 1V2QT 4ABEA 1E38B 1Z8IB 2SGAA 1ZSKA 1YLDA 2FM2A 4NGAH 1ZOMA 4BTTB 2FX4A 1AY6H 1DWBH 1HXEH 2PUXB 3SV6A 2Q6DA 3UOPA 1ARCA 2ALVA 4U2WA 5GWZA 4TY6A 2ZDAH 1V2WT 1CGIE 2VIWA 8GCHG 1O3KA 4FU7A 1MCVA 1OWEA 4X2VA 3QLPH 2ZCKP 2AYWA 1FAKH 2TGDA 3BTFE 3M5MA 1Z6EA 1V3XA 4FUFA 5GDSH 4K1TA 4B2CA 5L6NH 1MKXK 3Q76A 3M5NA 2SGFE 1VCPA 4ISIH 2SGQE 2Y7XA 4DJZB 6GCHG 1LMWB 4AYYB 5LH8A 1C2FA 5E8EH 1GJ8B 2SNVA 1HAHH 1C1TA 2C8XB 2VWNA 5AVDA 5HGGA 1Z7KA 2OP9A 2SGEE 3A84A 1ZPCA 3A7VA 2VVCA 1AWHB 3SV9A 2ZECA 5A0CA 2WPLS 1T31A 5C2ZA 3LKWA 1YPMH 2XYAA 2EA3A 1OYTH 1P02A 5GCHF 3UREA 1C2HA 2OC7A 2QXGA 3MNBA 1K1MA 1GMDG 4FVDA 1O5CB 1DICA 1T7CA 2ZPQA 1HBTH 1TIOA 4ABIA 3PWCA 1TBQH 3SNCA 5DP4A 1UTPA 3AAUA 4IN1A 3CENA 4RN6A 4Y7BA 3RXTA 4O3UA 4YO9A 1ZHMA 4A5TS 4ESTE 3Q77A 3T2NA 1SOTA 2UUYA 3QX5H 2YOLA 1QA7A 1ZTJA 1C5XB 1VGCB 4NWLA 1SGFA 2HWLB 1GHBG 3E0PB 2OBQA 2UWLA 3A7WA 1H9IE 3BTQE 2PW8H 2JH0D 1W8BH 1HYLA 2TGPZ 4YOGA 3ODDA 1TGTA 1BRCE 1GHZA 5EW1H 4WVPE 1P2NA 2Q1JA 1ZMJA 1CGJE 4B71A 2OC0A 1A3EH 4OGXA 1MD8A 4K1SA 2GV6A 3ZVFA 2OQUA 1AMHA 4NZLA 5LPRA 1Y3WA 1IQIA 1MU8B 1H4WA 3T25A 1SC8U 1QNJA 5E2PA 1MTVA 2XW9A 2VWLA 4BXSA 4Y71A 1KTTB 2G52A 3PYHA 2XBXA 4I31A 3T29A 1BMAA 2THFB 1GDNA 5LPFA 1DY8A 1EJNA 1O39A 4UFDH 2XXLA 1CHOF 4GPGA 4Y8XA 3SUGA 3S9BA 1OPHB 1MTUA 2F9NA 3M37A 1N6YA 3LT3A 1NT1A 3OSYA 3M61U 1TE0A 2G4TA 2HNTF 2IN2A 4A7IB 4CR9A 1YPLH 3ATMA 1V2VT 2GDEH 3V0XA 1QRWA 2J92A 1DE7H 4INHA 2D26C 3KL6A 3RXVA 1TONA 2A5KA 3HATH 3S0NA 1A61H 1KXFA 2OD3B 4NIWA 3HK6B 1C1SA 5C1XA 1RTFB 5EPYA 1O2XA 1OXGA 4NCYA 5EW2H 3MO9A 4ZKRU 1W0ZU 1NO9H 1HJAC 2ZFPH 3DUXH 4CRGA 1EJMA 1Z1IA 2W5EA 3RC6A 2TGTA 1KLTA 1GBDA 2AMDA 4X2YA 1TNLA 1OSSA 4FU9A 1C1MA 5IDKA 4OS6A 3HKJB 1XUIA 1C5QA 4AFUA 1EQ9A 1GJ6A 4DOQA 1CGHA 1TMBH 3TH2H 5B6OA 2ZU2A 1J17T 4GUXA 1D3TB 4BAKB 1ABJH 1GHVH 1SOZA 5A8YA 1C2MA 2FWWA 4U01A 3UFAA 2FPZA 1TOCB 4F49A 2GT8A 2F9BH 1SHYA 2J34A 2BB4A 2QF3A 1UHBB 1CO7E 2G8TA 4NG9H 4YOJA 3P8NA 4I33A 1D3QB 3ELAH 3A80A 3UUZA 3SU0A 1LHFH 1SLUB 3M3TA 5EQSA 2ZQ2A 4B76A 1A0LA 1NFXA 1JIRA 3CP7A 2LNCA 2J38A 3DT0H 2XWAA 1DLEA 1K1NA 2Y5FA 2R0KA 2I6SA 1BTZA 1P2OA 2SGPE 2VJ1A 1GG6C 1N8OB 2V0BA 1EZQA 2FZZA 4QT8C 4RSPA 3U1JB 4MVNA 4UE7H 1A2CH 3K6ZA 2ODQA 2OINA 1E35B 5T6FA 4X1PU 4B74A 4LOYH 1YKTA 2Z3CA 2KAIB 1TBRH 3Q3YA 1FY8E 4SGAE 1AQ7A 2FTLE 2BLOA 1O35A 1L2EA 1Y8TA 1ELEE 1CE5A 4MNXA 3SU1A 4Q80A 1A7SA 3C1KA 2ALPA 2EI8A 3LGTA 1ELTA 3SOSA 3V12A 4XOJA 1K28D 4WF8A 3RC5A 5L2YH 1PQ8A 3A88A 3RXBA 5C67A 4WXVA 1O5BB 4O03A 1HV7A 2QA9E 3E8LA 3S69A 2GMTB 1C5NH 1GI0A 1PQAA 2P8OB 4I8KA 2ZWLH 1V2NT 3QO6A 1LPZB 3QK1A 2GV7A 2BOHB 1IQLA 2W26A 1UVOA 3A86A 4BTUB 1YPHC 2GP9B 3M3VA 3Q3XA 1G3DA 2H6MA 5DP7A 4TPYA 1O3OA 1EP6A 2GTBA 1HCGA 4BXWA 1FQ3A 1AKSA 2H9HA 3FAOA 1FY1A 2G5NA 1CT0E 2C3SA 2FYRA 4BNRA 3ZZ7A 1AFEH 2VIQA 2ANWA 3BTWE 2QXHA 3FZDA 4K8BA 3MO6A 2BDYA 1SVPA 8KME2 2G00A 1V2RT 3RXAA 3QTVH 4BAQB 1FUJA 1C5SA 3V3MA 1JXPA 1OWDA 3RM0H 1D9IA 1P2IA 1DANH 1PPGE 4H6TA 1QJ6B 2YNAA 1N8OC 2OC1A 1HAPH 2Z94A 3RXEA 1DVAH 3TK9A 4D7FA 2P3FH 1D6RA 3C27B 4ZHMU 1VZQH 3SGQE 2G5VA 3LJJA 2Z9KA 2NU3E 1ACBE 2BLQA 3UNSA 1UTQA 3OYPA 3D23A 3KIDU 4VGCB 3UTUH 2P59A 1C5LH 1HAIH 3AVZA 1TPPA 1Z8GA 3ZZ9A 1ZHPA 1KLJH 4NFFA 2GZ7A 2FOEA 1LQDB 4AN7A 2PTCE 4UFGH 5J4QA 2FI3E 2ZI2H 1S83A 3ZZ6A 3MNXA 5E0JA 2J2UA 2F9PA 2C8YB 1BBRH 3SU4A 2ZQ1A 5IYTA 4O97A 1U6QA 1EB1H 2GMTC 1SG8B 2P8OC 5EXLA 5GIBA 1OOKB 2Z9JA 2Y5GA 2V3HH 5F6MA 2CXVA 3T28A 1BZXE 4D7GA 4NIVA 4FUIA 3RXPA 1O2NA 1QR3E 4ABBA 2PGQB 1K1OA 3MTYA 3TNSA 2O8LA 3ZZBA 2FTMA 2WPMS 1F5RA 2J4IA 4X8SH 1BMMH 3EA7A 1UK2A 3JZ1B 1BTHH 2CJIA 2R0LA 2UUJB 3GDSA 1DY9A 2AGIX 2QCYA 1JOUB 4FUJA 2D2DA 3UR6A 1CU1A 1ZR0A 4CBNA 4JZIA 4K60A 5DGJA 4GHTA 1DUEA 3NZIA 3UWJH 2H2ZA 4YLUA 1AVXA 1MMJN 1AU8A 4MNVA 3VXFH 1G3EA 1K2I1 1RTLA 1IQEA 4HFPB 3ATWA 3KQEA 2NU2E 1EKBB 1KDQA 5ABWA 2ZTZA 4NZQA 3PMJA 1P9SA 2YNBA 3RUOA 2FX6A 1O3FA 4LZ4B 3AAVA 2ZFSA 1HAVB 7LPRA 1OP2A 1G32B 1O2VA 1QL7A 4R0IA 2RCEA 1TNGA 5J4SA 4O9VA 4YTAA 4VGCC 1YPHE 2V6NA 3VFEA 3O8RA 1ELVA 4K2YA 1UTOA 4CRDA 1BTYA 3ATIA 3P6ZB 3LH3A 1K21H 2FOHA 4TWYA 2BX3A 3NXPA 5FBIA 2RA3A 5L30H 3LONA 3RM2H 3B23B 1XXDA 3VB5A 4MTBA 1Z8RA 6LPRA 3M7UA 4X2WA 3ZVGA 2ZPSA 1DLKB 1AUJA 1LHCH 1ZMLA 4SGBE 2G4UA 3RXGA 3GOVB 1N1LA 4MLFB 1B7XB 4HGCA 3VPKA 1VITG 1YBWA 2NU4E 1T4UH 1QB6A 2XCNA 2ZGHA 1WQSA 4J1YA 1C4V2 1G2MA 2ZU1A 1LVBA 2PUQH 4ZROA 2ZIQH 3SV7A 1A1RA 1O3MA 3N7OA 3U8RH 2VINA 2R2WU 4OS1A 4LZ1H 1Y5UT 4WH8A 3RLYH 3F9EA 1Y5BT 3MFJA 3A89A 2A7JA 4I32A 1OKXA 1V2TT 4DIHH 2WUCA 4BAMB 5SGAE 1H9LB 2A0QB 3GY5A 3T27A 4WMEA 4A1VA 1UCYH 1C1WH 2P94A 3CS7A 1EP5A 3SNBA 1ZPBA 4CR5A 2SNWA 1ZSLA 1CQQA 1SGTA 3BIUH 1ESAA 3SU2A 2EI7A 2O8UA 1NN6A 1W14U 1A5GH 5FX5A 1HFDA 1LKBA 1TRNA 3B8JA 1QBOA 1HRTH 1P2QA 5ESTE 3G01A 3T5FH 1XUKA 1OP0A 4ABHA 1P2KA 5DO4H 1TX8A 1W0YH 3AW1A 1O3NA 4X1NU 1FJSA 2P93A 3UNQA 3VXEH 2BDBA 1PJPA 1XM1A 1MAYA 3SNEA 2JKHA 3TPIZ 1O3IA 1BIOA 1PPZA 2HRVA 1DWCH 1F0UA 1DDJA 1ESTA 3PM3A 4XBDA 2FS9A 2FODA 3FP6E 1C5WB 2WYJA 2F83A 2ZFQH 1MTWA 1QB1A 1BRAA 5TCAA 3K2UA 3V7TA 5AFYH 1ARBA 1AVGH 1Y3YA 1L4DA 1UVSH 2Z9GA 3VB7A 1TB6H 1ETSH 4IMQA 1TOMH 1CT2E 2VH0A 2OQ5A 4F4OC 3EDXB 1NU7B 3LDXH 4MPVA 2BVXH 2ZU5A 1Y3VA 2XCFA 5E2OA 1WUNH 3BG8A 1XUGA 4JCNA 1O5FH 2B5TB 4GSOA 3HPTB 4TWWA 1F5KU 4O3TA 1GHAF 2F3CE 4KGAA 2BY7X 1LTOA 2XRCA 1GVZA 4OGYA 1YPJH 3A83A 3QGNB 3SV2H 1AE8H 1UTKA 1GBCA 2BD4A 2QV1A 5HM9A 1MQ6A 1GBMA 5GCHG 3RXIA 3RXOA 2ODPA 1SSXA 1O2OA 2Q6GA 3RC4A 2Z3DA 3T26A 1S0QA 1TPAE 3PMBB 1GHYH 1D3PB 1ANDA 4MPWA 1HB0B 5AHGH 1AE5A 1FONA 1P04A 4A1TA 1TA6A 2P16A 1P57B 1P9UA 4MG3A 1CT4E 2HNTE 1RS0A 3STJA 2ANMH 1YF4A 8LPRA 1F2SE 1GJBB 3GY2A 1LPGB 4Y8YA 1TA2A 1NFYA 4DIIH 2Y82A 2TRMA 1QBVH 1IHSH 1EPTA 1KIGH 1SGIB 1GBJA 1VJAU 4OS5A 4WJG2 5JB9S 4DVAU 1MD7A 1RGQA 1WCZA 2PKAA 1KSNA 3SHAH 1HJAB 1QRZA 1M9UA 1AGJA 1ZJDA 5T6DA 4B1TA 1LPKB 1KXEA 3NCLA 1C4Y2 3RLWH 3LJOA 2B8OH 1FZZA 3SZNA 2A5AA 5ESBA 1LHEH 4Y11E 4KELA 1ETTH 1INCA 1XMNB 3SGAE 3BEIB 1IQNA 3F9FA 1BA8B 2F9OA 1O2TA 1HAXB