1BJAA

Activation domain of the phage t4 transcription factor mota
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
SKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION REGULATORY PROTEIN MOTA
publication title The activation domain of the MotA transcription factor from bacteriophage T4.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Activation domain
total genus 33
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09114 MotA_activ Transcription factor MotA, activation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bjaA00
4O6JA 3TOAA 2IJLA 2W25A 1GXPA 2HQRA 2Z9OA 4R79A 5HDGA 4P9FA 1CGPA 2VT2A 3FHZA 5HLHA 2VC0A 2PMHA 1EH6A 1IN5A 2RV8A 4LLLA 4KFCA 4HF1A 1OR7A 3KLOA 2CO5A 4RGRA 1A04A 2R7DA 4P9UA 2DFIA 3QPHA 3JSOA 3IHUA 2GWRA 5F64A 5HVQC 1I6XA 1QO0D 3BY6A 4UV9A 2PEXA 1MKMA 1FT9A 1P6RA 5DEQA 2HEOA 2EFWA 3ABUA 2MA3A 3LQRA 1ZYRF 2DQLA 1G6NA 3HRTA 1IUYA 5CVRA 2O03A 2FRHA 2JZYA 1BN5A 3V7SA 3R4KA 1H9GA 2A3SA 4MQ9F 4M72A 3ABTA 1P4WA 2FA5A 2EA2A 2FOKA 1Z6RA 2BBYA 2D1HA 3EETA 4HLXA 3CLOA 4YG2F 4WF2A 3NRVA 3JTGA 2O3FA 2YX7A 1PUEE 2LF8A 5LRSA 1XB4A 4ON0A 4PGHA 3RTRA 4KDPA 1SFUA 1OYYA 4RGXA 1ONVA 1L0OC 2FMYA 1REPC 2FQ3A 2GXBA 3HTSB 3D0SA 1F1ZA 3RKWA 1G3WA 3GWZA 2VBZA 2K02A 4HA8A 1I27A 4M9ZA 4JQFA 3GFMA 3V8KA 5DUKA 4YIFA 1TTYA 2KKOA 2R7FA 2PMUA 5HLIA 2MLKA 4B8XA 3MFKA 2C6YA 2EV0A 4Y13A 2AXLA 3ZMZA 2HGCA 4GYIA 1OYWA 3PQJA 1DPUA 5L3GA 5CYVA 5LGTA 1SFXA 3Q9SA 3F8NA 2QLZA 2G7HA 2ADUA 5L3EA 4M71A 2DT5A 1TQPA 2ZJ2A 2FXAA 5ILSA 4CHUA 2VN2A 3F8BA 1UHWA 1W5TA 3R61A 4HX7A 1KU7A 3IC7A 1E2XA 2STTA 2F5FA 1T98A 3E97A 4CICA 2LF7A 4LJZF 1GHCA 4S04A 3FZVA 1STZA 1XGSA 3RI4A 2OU2A 4P55A 2IA2A 3EDPA 4HW0A 4EJTA 2PG4A 3B02A 3GEZA 2PBIA 1KYZA 1P4AA 1HBXG 1IRGA 2F5EA 2NNYA 4M9XA 1PP8F 4WX9A 4HBLA 4PGGA 1YW9A 1MJAA 4Q47A 4N9HA 4ZYHA 4RB0A 2PLYA 4EVIA 2EWNA 4I98B 1WI9A 1RNLA 3BWGA 2DPUA 3WG9A 1KU2A 1UB9A 4M74A 1Q1HA 1TQIA 3BROA 3CTAA 5FD5A 4RB3C 3I54A 1DUXC 4A2UA 1I1GA 2H09A 2FF4A 4G94A 2LSOA 1QPMA 3Q9VA 3M8FA 2O0YA 4GXOA 1R1VA 5HDKA 3E6MA 3HUGA 2A6EF 2QQBA 2HS5A 3L9FA 2LDUA 3C18A 2FBHA 3ISPA 3BP8A 3KEQA 1W5SA 4EM0B 1BIBA 1FYLA 4LD5A 5CVJA 2M45A 1FYKA 3KP2A 1TBXA 1K6OA 1XDSA 3I5UA 1RI7A 5ICFA 4BH9A 1G4DA 3K9TA 5IT9Z 1L3LA 3RYPA 3E6BA 2ZNZA 4RB1A 5ERIA 5LGUA 2RN7A 2PFBA 4Y17A 3E5UA 2CSOA 2HYFA 1Z6TA 3EYYA 2P6TA 2W24A 3ZMDA 2BEOA 1F5TA 3I53A 2DPDA 1BI2A 4XBFA 2FMLA 2CGPA 1BOAA 1KQ0A 2ZFWA 5BPIA 3V8LA 1FBQA 3FX3A 2CW0F 1YS6A 2XAQA 4BQAA 3ZN0A 1MJ9A 3GFIA 1BBYA 1YIOA 3WE2A 1DDNA 2K86A 3KZZA 4WK8F 3J81Z 5ILUA 1B6AA 2HWVA 4BHCA 2K4JA 4IF4A 1MD0A 4HV5A 4RGUA 3F8FA 2HDCA 4GYGA 1WQ2A 1YO5C 1B1BA 2IA0A 4L9NA 4KIFA 4G6QA 1U5TB 3P9IA 3DFGA 2V79A 1XCVA 3M7GA 3NEUA 2UZKA 4H0EA 2VOOA 2YX4A 3ZPLA 3TGNA 2HR3A 4PDKA 4UVBA 5K5OA 1W4MA 2WC2A 1R7JA 4M73A 2QVOA 2V9VA 3GX4X 3JTHA 3WGIA 1ULYA 3F22A 4WXCA 3KP5A 2A07F 3HRMA 4M6XA 3ZMVA 1SAXA 4CO8A 5FD6A 2EJRA 1WSUA 2L3DA 3LWFA 2DW4A 4HX4A 2QYOA 2V1XA 1H0MA 4LGWA 2FBIA 1F4KA 3CUOA 1QGPA 3SXYA 4KT5C 4EM2A 2DO7A 2XASA 1YYVA 2RC4A 4DNCA 2RVCA 2DK5A 2IP2A 1HKSA 3R60A 1MDMA 1ZAOA 3G73A 5TRDA 5ICGA 3WTSC 3TOBA 3ZMUA 1LB2A 1CF7B 2XGXA 3WU1B 3M9AA 4K2EA 2QM3A 5FB2A 2NS0A 1IN7A 1V4RA 1BIAA 3KP4A 3RKYA 2A69F 2P5LC 3DV8A 5L3CA 2P8TA 3QU6A 3CO7C 2L54A 3GFLA 3IWZA 3BOQA 3FXQA 3F72A 4A5NA 3J7AO 3VEPA 3J81K 5J8FA 3K1MA 2CYYA 1QBJA 3JAMZ 3CO6C 1BC8C 2Y75A 1B9MA 2Z33A 2ZO4A 4ESBA 1S8NA 4RAYA 1D8KA 2O61A 1R1TA 1PDNC 2PI0A 5ED4A 4L18B 3K1NA 5KVRA 4KNYA 2BGCA 2GXGA 3DPLC 2HZTA 5LHIA 2ZBKA 2HOEA 4IRHA 2VOPA 1FY7A 5H6QA 1U78A 3QPTA 4UV8A 4HOBA 3QAHA 1MZBA 4A6DA 2NNNA 4WXHA 3KLNA 4BHBA 1I1SA 3GW2A 4CGZA 3U1DA 1FP1D 2M5WA 3KFWX 3VFZA 3I59A 5DCMA 4O5VA 2E1CA 1O7FA 2Y0MA 3DXJF 3FMSA 5L3FA 3DP7A 3I71A 1B4AA 1P2FA 3GFJA 1T39A 5E8GA 1BI3A 1TW3A 4AD9A 5HLGA 2JT1A 2F5DA 5D8LB 4WCGA 2KJBA 2PJPA 2GA2A 3T5XA 1PP7U 1YLFA 2OBPA 3U9GA 4OU0A 2BYVE 1W7PA 2VBWA 1XGNA 2STWA 4D0PA 4U0YA 1HW5A 4XLNF 1Y0UA 3F6OA 3R0AA 1XDUA 2OZUA 1SD7A 4GCVA 5DDGA 5D5VB 1R22A 4E70A 5D4RA 2J5PA 2GIVA 1VTNC 1JE8A 5FGMA 3KZYA 5JHUA 4AWXB 3E6DA 4ASNA 4RB2C 1HXDA 3S2WA 3FWEA 4GO1A 1YTYA 2HKOA 2ZKZA 2D1VA 1T38A 3GLXA 2ISZA 2FE3A 3F6VA 1USSA 3CDHA 3CUQB 1FOKA 1FC3A 1J9IA 4KA4A 4XSXF 5E18F 2G9WA 3GZ6A 4UUVA 2V1UA 2EB7A 2P5VA 1K78A 4AIKA 3O3KA 3U2RA 3RYRA 2RNJA 3EUHA 1B9NA 3IRRA 3FF5A 3F8CA 1HSTA 3E6CC 1XSVA 1ZRDA 3M8EA 5CVIA 4N9IA 1IN4A 1ZN2A 3KP6A 3VODA 3B73A 3P9KA 4HV6A 1JGSA 3L7WA 5ILVA 4LB5A 3KP7A 1MJBA 2NAZA 2P6SA 2QBYA 5FLXZ 2RDPA 1DP7P 5LRRA 2ZMEA 2QWWA 2XV4S 4L5JA 3V7RA 3K0LA 4EJUA 5DCMB 3R0JA 4XLPF 3MEXA 3O6BB 1YQAA 2OD5A 1U6GA 1HKTA 2EV5A 1BJAA 4MEXF 4DQ2A 3MZHA 2O8XA 1J75A 2Z99A 1FP2A 2ISYA 3H92A 3RPQA 2GQQA 5AIPA 5J6XA 1AWCA 4EV0A 4YFKF 1TW2A 1XSDA 3IKVA 1KU9A 3BJAA 4M6YA 2Z3YA 2XKOA 1BM9A 2V6CA 1QZYA 5HOOA 3LA7A 2Q2EA 4UVCA 2QUFA 2CQKA 2D2WA 4RAZA 4R8HA 4KUMA 3BDDA 1XGOA 5LBQA 2EV6A 4EGYA 5D6FA 4EJOA 3CJNA 3MZYA 4ENJA 3HIFA 1MGTA 3E5XA 1B59A 1RIOH 1FZPB 2KRFA 2Y48A 1Z7UA 4AIJA 4LK1F 4ESFA 3HTUA 5DYMA 2TDXA 4FT8A 2COMA 3SQNA 1S3JA 2FBKA 4Q48A 3BPXA 4IPAA 3R6SA 3HHGA 4LLGF 3E5QA 2YSRA 3OV8A 1FBSA 4OMZA 2XHKA 4KMUX 5FLXK 4IXAA 3GYHX 2BE5F 1LNWA 3K2ZA 1FX7A 5AONA 4ZZLA 2P4WA 3QU3A 3QOPA 4JK1X 4OOIA 1ZG3A 2HFHA 2XRNA 3RJPA 4LB6B 1YG2A 1ZRFA 1TQMA 2NYXA 1USTA 3TO9A 2RGVA 3BJOA 4UHTA 3GZ5A 4LG0A 4KIGA 2ZMEB 1GXQA 1YS7A 4Q5SF 3ZN1A 4A6EA 3MAJA 2P7VB 1SD6A 2JPBA 4L0ZB 4HQMA 5LLQA 1O3RA 3GO5A 1G3TA 2AS5F 1J0RA 4MEYF 3W6KB 3C1DA 3TKYA 1LDKB 4A5MA 1ZREA 4RGSA 3BPVA 3EYIA 4R1HA 1OMIA 1QQIA 1ZG1A 2WV0A 2E1NA 2MBFA 3ECOA 2VE8A 5F6FA 4EJVA 3JW4A 3MWMA 4EGZA 2QQAA 3FMQA 2A5YB 4EMSA 3J80Z 2OA4A 3HOTA 4ZZDA 1LDJA 3BZ6A 5JR3A 4KICA 3I0TA 1EH7A 3WTYC 1ZGJA 2DQRA 2JRTA 3WTTC 3ZMTA 2A61A 5A2QZ 1O57A 3N4MA 5LEKA 1WKMA 1R23A 4G7HF 4N0BA 3GXOA 1FPQA 4MHGA 4F7ZA 5BMZA 2EFQA 4MGRA 1FNNA 4YFXF 3E3VA 1XMKA 1J59A 1FSEA 1LDDA 4U0WA 2EFPA 3DF8A 3L2CA 1XD7A 2L4MA 3PFIA 1U3EM 3PQKA 4OIOF 4UNOA 2XROA 2HKXA 2K4BA 1IN6A 5D5UB 3K1PA 2GA1A 3COAC 3MCZA 5AIQA 4U88A 2RKHA 2DLLA 2ESNA 3TQNA 5JVTA 4TV7A 5IT9K 3DQVC 1S7OA 3WU0A 1LJ9A 4CZZA 2X4HA 3G3ZA 1S29A 2JPCA 2IA1A 5E8IA 1JHHA 4LFUA 3LFKA 2G7UA 1H9TA 3HRSA 4YFNF 1IRFA 3KE2A 3DPTA 3LA3A 5E17F 3H3ZA 3LQQA 5DCFA 2L01A 4Z2YA 4HZFA 3V4GA 4HLYA 2IPQX 3BJ6A 5CLSA 1G3YA 1S7AA 3I4PA 2WWYA 5D5WB 2VONA 1TLHB 3LA2A 2QZ8A 5D4SA 1O3TA 3MQ0A 4BNCA 3FM5A 4CXFA 2XIGA 1HKQA 6PAXA 2H94A 1RUNA 3HOSA 1SD4A 3REOA 2Z5UA 4IVNA 2GZWA 3NQOA 2L4AA 5CVVA 4LK0F 3I64A 2E7XA 3SHFA 2XVCA 4ZYEA 4FHTA 1ZGAA 4BYYA 5BS6A 2ZCWA 1LEBA 4YIIA 1FLIA 4I2OA 2DAOA 1TNTA 1Z1DA 4P5OA 3LAJA 2YU3A 1SMYF 1G3SA 4HQEA 1I5ZA 3T8RA 4OIQF 2ESHA 3WGHA 2E7WA 1ZHFA 4I7HA 4ENMA 1KU3A 4S05A 3P7NA 2H6CA 4WWCA 1FWZA 2A68F 4FX4A 2B0LA 1YW7A 4G7OF 2VBXA 3KCCA 1R5HA 3LAPA 1SFEA 3O2PE 4OMYA 1O3QA 2K7LA 3ELKA 4LLNA 3QP6A 4G8XA 3SZTA 2K27A 2VT3A 2EFOA 1R00A 3IWFA 4M9SA 3TO7A 4L0YB 2XKPA 1ZH5A 2KIMA 5K5QA 1T2KA 3HSEA 2UWMA 3WE3A 5LHHA 4P96A 5EEHA 2O6GE 1R58A 1XGMA 3AAFA 5KK1A 3WODF 4G7ZF 1Z9CA 2ACJA 5F1RA 3WTUC 2XAFA 4IRIA 4L9TA 2QENA 5FFXA 4HF2A 3FXRA 4ZH4F 3VOEA 1X3UA 4HDVA 2Q8KA 4A0XA 1IF1A 1EV7A 1J2XA 1AOYA 5H6RA 2OZ6A 2H27A 1KYWA 1MDMB 2HTJA 5JI6A 2MD5A 1FSHA 2PQ8A 2EFNA 1XCBA 1UFMA 3JAMK 1FBUA 3C3WA 3ECHA 1K7AA 2DK8A 4EM1A 1E17A 5CJ9A 1V3FA 3KETA 4HAMA 5EEGA 2M1BA 5DD4A 2DU9A 2W57A 2OAZA 4OIRF 4A0YA 3ULQB 1O7LA 1LEAA 3EQLF 1S6LA 2X0LA 4KN4X 2DBBA 4CYDA 4OIPF 2MH2A 1XN7A 4GGGA 3QP5A 2XAHA 1DPRA 3GUDA 3F8MA 4L5IA 2Q0OA 3HRUA 1Z91A 5E1ZB 2RQPA 4ENNA 2YPRA 1WRJA 4U0VA 3I59B 4KMFA 1HSJA 2FNAA 5HS8A 4PCQA 2MLGA 1U5TC 1ZLJA 2VBYA 4A0ZA 1UCRA 1OKRA 2MH9A 3QRFF 1IXSB 1D3YA 1RUOA 4NQWA 5LGNA 1T0FA 4ESJA 4I0BA 4LMYA 2EA4A 3TDUC 1W7PB 3ROUA 4QLCU 4I01A 4KIBA 4MTEA 1IZ1A 3P9CA 4NB5A 4EJWA 2VODA 3LSTA 2NRAC 2GAUA 3ZQ7A 5D6EA 2H6BA 1IAWA 5L3DA 1ON2A 4XRFA 1C0WA 4Y15A 5BPDA 4HX8A 3T1BA 1OYIA 3WTVC 1GVJA 1XSXA 5E1WA 4EQQA 1IXRC 1ODDA 4MQVA 3F23A 2VC1A 2IT0A 4HYEA 2JSCA 2R3SA 1KQ8A 1HW1A 5ICCA 2ZNYA 4A12A 1K79A 1KA8A 2DTRA 1KGSA 5FO5A 3TO6A 1U5TA 2JTVA 2CWEA 2BV6A 2D45A 1K78B 1IXCA 2P7CB 4MNUA 1EH8A 3FMRA 4JBAA 1HW2A 2UXNA 1RZ4A 3DKWA 2KIFA 2W84A 4WXDA 1F9NA 1O3SA 5K1YA 4U7DA 3T0YA 1P4XA 5DD8A 5LHGA 2IRFG 3W6JB 1R36A 4HDUA 4I09A 3SFZA 2QBYB 1T6SA 1R1UA 3Q5FA 2KIUA 3ZP5A 1J7KA 1KQ9A 2ELHA 3ERED 3TDZC 5CVUA 4KN7X 2F2EA 5BOXA 4RS8A 3C7JA 3HSRA 2KJCA 4ENKA 3F3XA 4BHPA 5DV5A 4NHJA 2UXXA 4UVAA 2OQRA 1W7PD 1CF7A 2HYGD 1D8JA 1ZRCA 1YW8A 5E20A 3IRQA 4IHTA 4G6DA 4U7BA 3SZPA 5H20A 4Q4ZF 2IVMA 2VXZA 2DI3A 3K69A 3ML6A 4HF0A 4UXNA 4IRGA 4I02A 3RKXA 3FXUA 1QZZA 2F5CA 3IL2A 3D5LA 2M87A 2FNPA 4I0AA 1YFHA 4KYWA 3JSPA 2HQNA 3VB2A 3V7CA 1SMTA 1IW7F 3V8JA 1JHFA 2M30A 2MC3A 1ZLKA 1BC7C 1R5GA 2A6HF 5DUIA 1WWXA 2XAJA 3F21A 2M8EA 2V1DA 1BI1A 3DEUA 2XAGA 1LVAA 2OQGA 5FFZA 4CDGA 4BAYA 2CFXA 1ZARA 4IHSA 5BQTA 3CUQC 1QNTA 1ON1A 1FYMA 3H3UA 4BXUA 3ZMSA 4ZYDA 3L00A 5TJJA 3WGGA 3KP3A 4B09A 1NHAA 5D8KB 2VE9A 1UHMA 3RIRA 1U2WA 2HTSA 3OOPA 1J5YA 4FX0A 3I58A 5HDNA 2FU4A 3WTXC 4PZJA 2IW5A 3M1EA 2EK5A 1XMAA 4L9JA 1LQ1A 4LG0B 3T8TA 2YR2A 3RPUA 1D5VA 3N97A 3HYIA 3KEOA 2FEZA 2LKPA 2P5KA 2L02A 1ZG5A 4AVPA 5D5XB 5L3BA 3HSFA 5J8CA 2FSWA 4AIHA 4QWQA 3GF2A 4O3MA 2LNBA 4ZYGA 3J80K 5HS7A 4XSZF 5IT3A 1TNSA 3L09A 5A2QK 2CG4A 2XUBA 1HQCA 4ETSA 4IJAA 5HS9A 4G9YA 1IN8A 3RDIA 1SD5A 5K5RA 4OINF 2QQ9A 3CUQA 5LEJA 2W85A 2ETHA 2J5OA 3FM3A 5JFRA 5ICEA 1BI0A 3WTWC 1U8RA 3GVAA 3HHHA 3IKTA 1P92A 3WTZA 2PN6A 4MTDA 5E1XA 2ZXJA 1Z05A 1JXSA 4L9VA 2WTEA 1OPCA
chains in the Genus database with same CATH superfamily
4O6JA 2LKXA 4DYCA 5M5WJ 2DOEA 2WAEA 5IY5H 4E7HA 2W00A 2QSFX 3TOAA 2IJLA 2W25A 1GXPA 1QA6A 3CP8A 2HQRA 2B63J 2Z9OA 4R79A 4BBSJ 2DYSH 4A3FJ 5HDGA 3FXJA 1R5ID 4P9FA 1CGPA 3L2VA 2VT2A 2CW7A 3DEWA 3FHZA 3FKIJ 1MH3A 5HLHA 2VC0A 3KZIC 3CCQI 1WJEA 3H1CA 3Q3SA 3QPSA 4HPQA 2PMHA 3BTLA 1EH6A 1IN5A 2R7SA 2RV8A 5B1AH 4LLLA 2ID3A 4KFCA 4HF1A 1OR7A 2BZTA 3KLOA 2FQ4A 1J09A 2CO5A 4RGRA 1A04A 2R7DA 4P9UA 2DFIA 4XLAA 2OC6A 2L0KA 2ELKA 4IZZA 3QPHA 3JSOA 3IHUA 1Y1VJ 1EA3A 2GWRA 5F64A 5HVQC 1I6XA 1QO0D 2NOGA 4AYBN 2VQLA 3BY6A 4UV9A 2LLKA 3BTJA 1APLC 1RR7A 2CW8A 4BUPA 2PEXA 1MKMA 1FT9A 1P6RA 5DEQA 2HEOA 4RM2A 2EFWA 3WG7H 3ABUA 2MA3A 3LQRA 1ZYRF 2HXIA 2DQLA 3BTCA 2ZSHB 1G6NA 3HRTA 2QGUA 1IUYA 5CVRA 3BTIA 1W0UA 2O03A 4BS9A 3JRIA 2FRHA 2BY3A 2JZYA 5GAGJ 5C4XJ 2P0WA 1JUMA 4IHYA 4Y33A 1V54H 1BN5A 3V7SA 4UY8I 3R4KA 1H9GA 2A3SA 4MQ9F 4M72A 3ABTA 3MN2A 1P4WA 2FA5A 2EA2A 2FOKA 1Z6RA 1FIPA 2BBYA 4XQFA 2D1HA 3A01A 2ZMEC 3EETA 4HLXA 4G12A 2IS4A 3CLOA 4YG2F 2QA4I 2OF7A 3KPHA 3LSMA 2KRCA 2XGEA 4WF2A 3NRVA 3JTGA 1SVMA 2QKMB 5F1JA 4YEJA 2O3FA 5KAIC 1IO2A 2YX7A 1PUEE 2LF8A 3I4NJ 5LRSA 1XB4A 4C2UA 4ON0A 3HB9A 4PGHA 3RTRA 3K70D 4KDPA 3HEFA 1SFUA 2LFBA 3HKZA 2L7ZA 1OYYA 4RGXA 4A3CJ 4RDUA 5EEAA 3EPZA 5GPCA 1O4XA 1FTTA 1ONVA 4QPQA 1L0OC 2FMYA 1REPC 2CRGA 2FQ3A 2GXBA 3HTSB 3D0SA 2BHYA 1F1ZA 3RKWA 3HL2A 1MBKA 1DGWY 5JLWA 1YHQI 1G3WA 3GWZA 3SYTA 5KHDA 2VBZA 2K02A 1TWCJ 4HA8A 1I27A 1I3AA 4M9ZA 3NARA 4GFBA 4JQFA 3K4BA 3OL3A 2N8GA 3GFMA 3V8KA 5DUKA 4YIFA 1TTYA 2X9DA 2KKOA 2R7FA 1ZGWA 2PMUA 5HLIA 2MLKA 4B8XA 3MFKA 3JRHA 4XKCA 5IOZA 2EZKA 4BE1A 2C6YA 2EV0A 4Y13A 2IS2A 3OYMA 1GUUA 2AXLA 3ZMZA 2HGCA 4GYIA 1OYWA 4FISA 3PQJA 1DPUA 5L3GA 2OUMA 5IP7J 5CYVA 5LGTA 1NK3P 1SFXA 3Q9SA 3F8NA 2QLZA 2G7HA 2KQRA 4E7LA 2ADUA 5L3EA 2B9SA 4M71A 2DT5A 4HSTA 1TQPA 2ZJ2A 3FXMA 1T8IA 3CCVI 2FXAA 5ILSA 5EG0A 1PVEA 4CHUA 3OOUA 5F27A 4NUBA 2VN2A 3F8BA 1UHWA 3S17J 1W5TA 3R61A 4HX7A 5CKTA 1KU7A 2E2HJ 3ZQCA 3IC7A 3U21A 1E2XA 2STTA 3FK7A 4D7NA 4J00A 2F5FA 1FIAA 1T98A 3E97A 4CICA 2LF7A 5JVGF 1JJ8C 4LJZF 1GHCA 2VJ5A 3FZVA 4S04A 1STZA 5GP9A 1XGSA 1RR8C 3RI4A 2OU2A 4UUSA 4P55A 4A3IJ 3OL4A 2IA2A 3EDPA 4HW0A 4EJTA 4C3JJ 2PG4A 2VKEA 3B02A 3GEZA 1VQ6I 3CCLI 2PBIA 1KYZA 2OTJI 1P4AA 2O7OA 3CC2I 4PFOA 1UAAA 1HBXG 1IRGA 3G2BA 2F5EA 2NNYA 2M4GA 4M9XA 1PP8F 1A31A 4IOCF 3CC7I 4N4OB 1GT0C 4BQNA 3RPUD 1KZHA 2R92J 4WX9A 2MGQA 4Y52J 1X2NA 3VPRA 3HBLA 4HBLA 2I8DA 1BW6A 1AKHA 3BG3A 3FBIB 4PGGA 1YW9A 3A03A 3S14J 1MJAA 2JWTA 3OYHA 1VQOI 4Q47A 1MBJA 4N9HA 4ZYHA 4RB0A 2PLYA 2L9VA 1MSEC 1EJ9A 4EVIA 2DMTA 2EWNA 4I98B 1WI9A 2CU7A 1ITYA 1RNLA 3BWGA 5FLVA 4PJ0C 1VQ8I 3AL0B 1B72B 3FBNB 1JGGA 2ZXWH 2CFOA 2DPUA 1SFKA 1KONA 4RA2A 3WG9A 2VJ4A 3BCBA 1KU2A 3HPGA 1UB9A 1SAUA 4M74A 1Q1HA 3PIOF 4FTHA 2PJRA 1TQIA 2DOAA 1LFPA 3BROA 3CTAA 3VSLA 5FD5A 4RB3C 3I54A 1DUXC 4A2UA 1I1GA 2LR8A 4XORA 4C2TA 4BEHB 2H09A 4D9JA 2FF4A 3MD2A 4G94A 2LSOA 1QPMA 3Q9VA 3M8FA 2O0YA 3D5SC 3CCRI 1HOMA 4GXOA 3A02A 1ZQ3P 1R1VA 4E7SA 4CCKA 5HDKA 1AA7A 3E6MA 3HUGA 4PJMA 4DZPA 2A6EF 1FMVA 2QQBA 4DW6A 3HGYA 4AYBA 2E1MC 2HS5A 1YRNB 3JRBA 3L9FA 2L7KA 3RQIA 2K9SA 3D1NI 2LDUA 3C18A 4DIQA 3LSJA 1U9OA 2FBHA 3ISPA 5FROA 4J01A 3BP8A 3KEQA 1W5SA 4EM0B 2DCEA 1BR4A 5LD2C 2WAQN 1BIBA 1FYLA 4LD5A 5CVJA 3OYFA 4U87A 4HNVA 4A3JJ 3FDYA 3N05A 2M45A 1FYKA 4IL6C 3PO2J 3CQZJ 2O8KA 3KP2A 1X19A 1TBXA 1K6OA 1XC5A 1HC8A 4YIRX 1YIJI 1XDSA 2NXNB 2BW3A 4E7JA 3MZ8A 2H8WA 2L7MP 2YS9A 3I5UA 2CV0A 4LOCA 1RI7A 5ICFA 3G1MA 4BH9A 3GTQJ 2QQ8A 1G4DA 3K9TA 3I55I 5IT9Z 1FJLA 4DBQA 2LVSA 3DKYA 2BHZA 1L3LA 3RYPA 3E6BA 5EGOA 1ETVA 2ZNZA 3S1QJ 2DFHA 2VLAA 1AHDP 4IQJA 3S16J 4RB1A 1BL0A 2HDWA 2L9RA 2XSDC 5ERIA 1GV2A 5EZHA 5LGUA 1VQ4I 2RN7A 2PFBA 4M3BA 3WU2C 4Y17A 3E5UA 4NQWB 2X6XA 4B3XA 1U0JA 2CSOA 3M8JA 2HYFA 1Z6TA 3EYYA 3ZQFA 4V19K 2I10A 2OCCH 2P6TA 2W24A 3ZMDA 2KZVA 2BEOA 2WV1A 2BOLA 2QSGX 3WHCA 2HU9A 2K9MA 3G1OA 2CMPA 1F5TA 2WB1A 4II2A 4M3FA 3I53A 3LSRA 2DPDA 4S0HB 2W48A 2FJ1A 1IDYA 1BI2A 2GOXB 4XBFA 4C9YA 2FMLA 2CGPA 1BOAA 3PNYA 1KQ0A 4XN0A 2Y9YA 3K4LA 4F55A 1NK2P 5DTDA 2ZFWA 5BPIA 3V8LA 1FBQA 1R4NB 3FX3A 5EZGA 2CW0F 1HDDC 1YS6A 2XAQA 3BC8A 3B6CA 4BQAA 1TT0A 4KJZA 3ZN0A 1MNMC 1MJ9A 3CJTB 2EBIA 1YE9A 3DPUA 1JT0A 3GFIA 1D0XA 1BBYA 2W7NA 3VWBA 2RNGA 2CH0A 2FUG2 1YIOA 3WE2A 1DDNA 2K86A 3KZZA 1SFOJ 2JA5J 3OYGA 4B47A 2QF7A 3W2WA 4WK8F 2XDVA 2K9LA 1D1AA 3J81Z 5ILUA 3G6EI 2BVMA 1B6AA 1DGRM 2IXSA 3JR9A 2HWVA 4BHCA 4J19A 5CQEA 2K4JA 2DA5A 4IF4A 4HEA2 1MD0A 4HV5A 2GM4A 2M0CA 4RGUA 4XLFA 1P7IA 3F8FA 2HDCA 3S32A 4C30A 3PIPF 4GYGA 2VQCA 2ZC2A 1WQ2A 1YO5C 1W36D 3I4MJ 1B1BA 2IA0A 3PJRA 2HPIA 2CQXA 4L9NA 3MKLA 4KIFA 3A2KA 4G6QA 2VASA 1N25A 3K4JA 1U5TB 4DZJA 3P9IA 3QWLA 3DFGA 5K7FA 2V79A 3KX2A 4CCOA 1JT6A 1ZELA 4FE4A 4XK4A 1XCVA 2KFDA 3M7GA 3NEUA 2UZKA 4H0EA 2VOOA 2YX4A 3ZPLA 3TGNA 2HR3A 1R71A 2KDOA 4PDKA 2KISA 4I6ZA 2R5YA 4UVBA 5K5OA 1W4MA 2WC2A 2H8RA 1R7JA 1LFBA 4M73A 3ZCOA 2QVOA 2V9VA 2DMNA 3HOUJ 3GX4X 2LG4A 3JTHA 1UHSA 2DFEA 2TRTA 3KYLA 2HOSA 3WGIA 1IRXA 1ULYA 3F22A 4WXCA 5FRNA 1ETYA 3ESWB 3KP5A 2A07F 3HRMA 4M6XA 3ZMVA 1SAXA 3JRAA 3ZQHA 4CO8A 3ZXSA 5FD6A 3DU6A 5JHFA 4XNFA 1Z77A 3I9V2 2EJRA 1VQ7I 4B4CA 1D1CA 2LTPA 1WSUA 2L3DA 2VKVA 2Y0SA 3LWFA 2DW4A 2DT6A 2R7ZJ 1LFUP 1XTAA 4HX4A 3BR2A 2QYOA 2V1XA 4IOAF 1H0MA 4X1EA 4LGWA 2FBIA 1F4KA 3CUOA 1QGPA 3DBLB 3CMAI 2A05A 3SXYA 4KT5C 4EM2A 2A6TA 2GBYA 2Z16A 3S2HJ 2DO7A 2XASA 2Y2ZA 1YYVA 2RC4A 2IEKA 4NC8A 4DNCA 3Q0UA 2RVCA 2DK5A 2IP2A 1HKSA 2JA7J 3CCEI 3CD6I 3R60A 4MFEA 1MDMA 1ZAOA 2JK3A 3G73A 5TRDA 5ICGA 1LE8B 3WTSC 4IO9F 2VI6A 3RSNA 1E3PA 3TOBA 3ZMUA 2XPUA 1LB2A 3CZ6A 1U9NA 2R7QA 1YJNI 1AU7A 1CF7B 2VQHA 4A3GJ 4HRIA 1NG7A 2NVXJ 2XGXA 2Y30A 3WU1B 3BR0A 3BQZA 3M9AA 4K2EA 2QM3A 5FB2A 4CYCA 3OY9A 1ERDA 1FOWA 2EIKH 2EZHA 3A0BC 5F0HA 3OYCA 2NS0A 1IN7A 5BNGA 1V4RA 4YELA 3IV5A 1BIAA 3KP4A 3RKYA 2A69F 2GOMA 3DV8A 3G4SI 2P5LC 5L3CA 2P8TA 3QU6A 3CO7C 2L54A 3GFLA 3IWZA 3BOQA 3FXQA 3F72A 4A5NA 3J7AO 3VEPA 3J81K 5J8FA 2CS3A 1MMSA 3K1MA 3H36A 2CYYA 1G8XA 3J7ZI 1OCZH 3S1RJ 1QBJA 3JAMZ 3CO6C 2FOWA 2COBA 1BC8C 2Y75A 3O8GA 1B9MA 1YOVB 2I5UA 2Z33A 2ZO4A 1Z3XA 3M3YJ 4ESBA 1IRZA 2O5RA 1S8NA 4RBOA 2EIJH 4F93B 4PK4A 4RAYA 1D8KA 2O61A 1R1TA 1R6RA 2E71A 1PDNC 5ED4A 2PI0A 4L18B 3FK6A 3K1NA 5KVRA 4KNYA 5F08A 2BGCA 2GXGA 4M6VA 4B44A 2XGCA 2KRHA 2OTLI 3DPLC 2GXAA 3QYEA 2DFFA 2HZTA 3E0JB 5LHIA 2ZBKA 2HOEA 4IRHA 3JRGA 2VOPA 1FY7A 5H6QA 4AUXA 1U78A 2AO9A 3PL8A 3QPTA 4UV8A 4D5FA 3FHNA 4HOBA 2DODA 3QAHA 1MZBA 1IC8A 3JRCA 1ORKA 3W6VA 4A6DA 2NNNA 4WXHA 3LSGA 3KLNA 3SDBA 3VYTB 4BHBA 1I1SA 3K4CA 3GW2A 4MLOA 3D5RC 4CGZA 3U1DA 1WJAA 1FP1D 2M5WA 2ZJRF 3KFWX 2ZB9A 3VFZA 3I59A 1MBHA 5DCMA 4O5VA 2E1CA 1O7FA 2MYSA 2Y0MA 3CCUI 4D1QA 1JJ6C 3DXJF 1ZTRA 3FMSA 5L3FA 3HGGA 2DMPA 3RZOJ 1QHGA 2V26A 3DP7A 3I71A 3S2DJ 3QPLA 5IP6A 1B4AA 1P2FA 3GFJA 1T39A 1I6HJ 1RPWA 5E8GA 1JTXA 1PUFB 2Y69H 2HNHA 3CCMI 1BI3A 1TW3A 4AD9A 5HLGA 2E35A 2JT1A 2CV2A 1NTCA 2F5DA 5D8LB 3EUHC 2IGNA 4WCGA 1RESA 2KJBA 2PJPA 2EIMH 2GA2A 3T5XA 3M1CA 3CCSI 1PP7U 2NVYJ 3GBGA 1RRJA 1YLFA 2OBPA 3U9GA 3C2HA 4OU0A 2BYVE 2R0QC 1W7PA 2VBWA 2JVGA 1XGNA 5K7HA 2STWA 4D0PA 2LRDA 2O9LA 1X58A 1MMDA 4U0YA 1HW5A 4XLNF 1Y0UA 3CJQB 3IUOA 3MKZA 3CCJI 1Y8RB 3F6OA 3R0AA 1XDUA 1QHHD 2OZUA 1SD7A 4MO7A 1OLTA 1TWAJ 2DA7A 4GCVA 5DDGA 5D5VB 3S3NA 1ACIA 2R5ZA 1R22A 2F4OB 1VFCA 2DJIA 4NBQA 4E70A 1G59A 5D4RA 2J5PA 2GIVA 1D1BA 1UZCA 1VTNC 1JE8A 5FGMA 2DA3A 4NDLA 3KZYA 1HDPA 5JHUA 3X2QH 2P81A 4AWXB 3E6DA 1VQNI 3TMOA 4ASNA 4RB2C 1HXDA 3S2WA 3FWEA 3TP3A 3OR1C 3ZQQA 2JN6A 2LMDA 4GO1A 1YTYA 2HKOA 2ZKZA 2D1VA 3PUFA 1SANA 4BXFA 1T38A 3GLXA 2ISZA 4BU2A 2FE3A 1WVRA 2PMZA 2HDDA 4A3BJ 4BE0A 2EZIA 2ECCA 4IHWA 3F6VA 1USSA 3TL4X 3CDHA 4E4HA 1K4SA 3VSKA 1GDTA 3ZGKA 4XOTA 2JA8J 3CUQB 1S9HA 4MFDA 1ETKA 1FOKA 1TC3C 4BY1J 2VXDA 3S1NJ 1FC3A 1J9IA 2MABA 4KA4A 2VQGA 4XSXF 5E18F 4XICA 4AVZA 2G9WA 3GZ6A 4UUVA 4A3LJ 4QIWN 2V1UA 1RETA 1A36A 2EB7A 4IHVA 4DOZA 3OS1A 1XG1A 3DU5A 2R7WA 3J7AY 2P5VA 1Y39A 1K78A 2QCOA 4AIKA 2MC4A 3O3KA 1R4MB 3U2RA 3ZR8X 3RYRA 2RNJA 3EUHA 2QSHX 1B9NA 1YJWI 4IQ4A 4DJAA 2JVHA 3IRRA 2VKHA 3FF5A 3F8CA 1G2HA 1HSTA 3E6CC 1XSVA 1ZRDA 2DT7B 2GIZA 3M8EA 5CVIA 1S5LC 1T95A 4N9IA 3RQ4A 4B1RA 1IN4A 1HA8A 1E3HA 1ZN2A 5GPAA 4B3AA 3KP6A 1VQ9I 1F36A 3B73A 3P9KA 4HV6A 3VODA 1JGSA 2F48A 2DJNA 2FX0A 3L7WA 3KP7A 1MJBA 5ILVA 4LB5A 3L1PA 4Y7NJ 4G6TB 2NAZA 3BZKA 4IHXA 2ICWG 3ZQIA 2F4IA 2P6SA 2QBYA 1QVUA 4W1UA 5FLXZ 4PJJA 2RDPA 3Q0WA 1DP7P 2VPLA 2JRMA 3K4KA 5LRRA 2ZMEA 3MVPA 4DBRA 2QWWA 3MMYB 2XV4S 2EILH 3PNVA 3G1LA 4L5JA 3HXLA 3W3CA 3V7RA 3K0LA 4EJUA 5DCMB 2LREA 3R0JA 4XLPF 3MEXA 4UB6C 3O6BB 1YQAA 3LL7A 2OD5A 1U6GA 1HKTA 2DOFA 2EV5A 1BJAA 4MEXF 4OAZA 3U1KA 4DQ2A 3EUAA 3W2VA 3MZHA 5J1RA 2ZJQF 2EQRA 2O8XA 2DA1A 1JKRC 2M7BA 2M2EA 4Y4RA 2LBFA 1J75A 2VJJA 2BVLA 2Z99A 1FP2A 2ISYA 4XRSG 4C3HJ 3H92A 3RPQA 2GQQA 5EYRA 5AIPA 5J6XA 2KPMA 3K7AJ 1SVLA 1B8IA 2R7OA 3OWTA 3QYFA 1AWCA 1BR1A 3CMYA 4EV0A 3DKXA 4YFKF 3TW7A 1TW2A 3S93A 5DM6F 1MBGA 1Y6IA 2AQFA 1XSDA 5KNLA 3IKVA 2RAEA 1KU9A 5DS9A 2V4JC 3BJAA 4M6YA 2Z3YA 3TBIA 1W0TA 2XKOA 4RAFA 3VYUB 1WH7A 2V6CA 1BM9A 1Z67A 3FXLA 4YRVA 1WJFA 1X2MA 2ECBA 1QZYA 5HOOA 3LA7A 5CQGA 3A01B 3DBRB 2Q2EA 2WY7Q 3MKWB 4CCMA 4UVCA 3GCMA 3GMEA 2QUFA 2CQKA 4MIMA 3LSIA 2D2WA 4RAZA 4R8HA 4KUMA 3BDDA 1XGOA 3ZRGA 3HZJA 2HPMA 5LBQA 1BOBA 2EV6A 4EGYA 5D6FA 4EJOA 3CJNA 1SC7A 1NG6A 4HSRA 3MZYA 4ENJA 3HIFA 1MGTA 3E5XA 5E79C 5HLTA 3H5RA 1B59A 4XRMA 1RIOH 3RKQA 1SVOA 5IYCJ 3OIPA 2ZFUA 4A3DJ 1FZPB 2KRFA 2Y48A 4HG2A 3OYDA 1Z7UA 4A3EJ 4AIJA 4A3MJ 4LK1F 4F91B 4ESFA 1IV8A 3SJMA 3HTUA 5DYMA 2TDXA 4FT8A 2COMA 2E1OA 2E5ZA 4ZTJA 5IPAA 3SQNA 1K4TA 1S3JA 4KITB 1MH4A 1D0ZA 1I39A 2FBKA 2NVUB 5J1YA 1EKEA 4Q48A 3BPXA 1H8AC 4IPAA 3R6SA 3HHGA 4LLGF 3E5QA 2YSRA 2CQ7A 1YI2I 3OV8A 2CUZA 4CH7A 1FBSA 4OMZA 2XF6A 2OV7A 2XHKA 1ENHA 4KMUX 5FLXK 1Y8QB 4IXAA 5J4VA 3GYHX 2BE5F 1LNWA 1K83J 3K2ZA 2E2IJ 1FX7A 1OCRH 5AONA 2DN0A 4ZZLA 2M9HA 2A5WA 3DLAA 2P4WA 3QU3A 1A6QA 3QOPA 4JK1X 2XB0X 4OOIA 1ZG3A 2HFHA 2K85A 2XRNA 3O8HA 5FKOA 3RJPA 3AKZA 4LB6B 3H3VK 3SEZA 2HVQA 3F0CA 1YG2A 5B3SH 4EATA 3OYAA 1ZRFA 1TQMA 2NYXA 3GZNB 5HNHA 1A5JA 2IS6A 3E7LA 2JUGA 3LSKA 5EG0B 1YJ9I 3SFIA 1USTA 4XKBA 3TO9A 4FCYA 2RGVA 3S15J 3QQAA 1XS9A 2E34A 2L7FP 3BJOA 4BDYA 1POGA 2CUJA 4UHTA 3GZ5A 4LG0A 4ZTFA 4KIGA 2ZMEB 3OR2C 1GXQA 1YS7A 1P9QC 2K5CA 1HF0A 1D0YA 4CZCA 4Q5SF 1BW5A 3ZN1A 4E6KG 2JA6J 4JX5A 2EPFA 4UUSB 2DA2A 3K4NA 4A6EA 3I56I 3DTKA 1Z3YA 3MAJA 2P7VB 1SD6A 4AIDA 2XB5A 2JPBA 3OSGA 1Y1WJ 3GTGJ 4L0ZB 3HPHA 5FJ8J 2L5QA 4HQMA 1JUPA 5LLQA 1O3RA 2LKSA 3GO5A 1R49A 1G3TA 2AS5F 1J0RA 2NVQJ 4MEYF 4A93J 3W6KB 4M3GA 3C1DA 3GTLJ 3TKYA 1LDKB 4RAGA 4A5MA 4ANJA 3JRDA 1ZREA 4RGSA 3BPVA 1VQMI 3EYIA 4R1HA 1OMIA 1QQIA 1JTYA 4JX6A 3UKGA 1IGNA 2QKLB 2NVTJ 1ZG1A 2WV0A 2JA2A 2E1NA 2MBFA 2VUMJ 3ECOA 5IOYA 2VE8A 5F6FA 1XX5A 4CUGA 3OSFA 2X1CA 1NH3A 4LIVA 4EJVA 4GRIA 1WJ5A 3JW4A 1ZKGA 3MWMA 5B66C 4EGZA 2QQAA 1SEUA 1WGXA 1AKHB 4I99C 1RKWA 3FMQA 3W2AA 1QRYA 2A5YB 4EMSA 3J80Z 2WY8Q 2OA4A 4EEFG 3HOTA 4ZZDA 1LDJA 3BZ6A 4CCLA 3GTKJ 1W1WE 5JR3A 4KICA 3I0TA 1EH7A 3WTYC 1ZGJA 1WPKA 1TWHJ 5E3NA 2DQRA 2JRTA 3H0GJ 1JKOC 2GLOA 3PSIA 3WTTC 3ZMTA 3IH4A 2A61A 3NAUA 5A2QZ 1O57A 3N4MA 2MFZA 1FOXA 1EF4A 2X6YA 5LEKA 1WKMA 3BG6A 3L2RA 2PJRB 4HNUA 5H2FC 5B1BH 1R23A 4G7HF 4N0BA 1A35A 3GXOA 1FPQA 4MHGA 3CMEI 4F7ZA 5BMZA 2EFQA 3LSHA 4MGRA 3CJRB 1FNNA 4YFXF 1X1BA 3E3VA 1XMKA 1J59A 1FSEA 2HI3A 1LDDA 4U0WA 4A69C 2EFPA 2BY1A 3DF8A 4E7IA 3L2CA 1LVKA 2NOJB 1XD7A 2L4MA 3PFIA 1U3EM 4DYRA 3JCUC 3ONQA 3PQKA 1MMAA 1DU0A 4OIOF 4UNOA 2XROA 2HKXA 3OYJA 2K4BA 2JQ7A 3HUGB 4FETA 1IN6A 2XSJC 5D5UB 3K1PA 1TWGJ 1X1DA 3CP2A 3CDLA 2GA1A 3COAC 3MCZA 1E3OC 3KYCB 5AIQA 4BACA 2M3AA 5GTIC 4U88A 2KZGA 2LD5A 3CLQA 2RKHA 2DLLA 2VB6A 5C4JJ 2ESNA 3DEEA 5JLXA 3TQNA 5JVTA 4TV7A 5IT9K 3DQVC 1S7OA 3B6AA 3WU0A 3HOXJ 1LJ9A 4CZZA 2XGDA 5DM7F 4XLEA 1P7JA 2X4HA 3G3ZA 1S29A 5IYBJ 2JPCA 3QODA 1OCCH 2WA0A 2IA1A 4NNJA 1U8BA 1TT5B 5E8IA 1JHHA 1PYVA 4LFUA 5M3FJ 3LFKA 2G7UA 2LP0A 1H9TA 3HRSA 4B48A 4YFNF 1X4PA 1V55H 1IRFA 3KE2A 4ABZA 4BJ6C 2BW3B 3DPTA 3LA3A 5E17F 3H3ZA 3LQQA 5DCFA 3OS2A 2L01A 4Z2YA 4HZFA 2L9SA 1S7EA 3HM5A 3V4GA 4M3EA 4HLYA 2IPQX 1X1PA 3BJ6A 5CLSA 1G3YA 2RREA 4H4KC 4PSWA 4IEJA 1S7AA 3I4PA 2WWYA 2K9NA 4XL9A 5D5WB 2VONA 1TLHB 3LA2A 2QZ8A 5D4SA 5EGOB 3MQ0A 1O3TA 4BNCA 3FM5A 4FQGA 4CXFA 4BDZA 2XIGA 3MKYB 2QEXI 1HKQA 6PAXA 1WHUA 2X51A 2H94A 1RUNA 2DXIA 1UG0A 4V2GA 3IH2A 3HOSA 1SD4A 3REOA 2Z5UA 1TWFJ 5M5YJ 4IVNA 2NS8A 2GZWA 3NQOA 2X48A 2L4AA 1Z0XA 3ABKH 3PSFA 4UB8C 5CVVA 2W82A 4LK0F 3I64A 2E7XA 2X6WA 3SHFA 5KAFC 2IAIA 1N77A 2M4KA 4JP0A 2M0MA 2XVCA 4Y3OA 1ZR2A 2JUCA 4PUSA 4ZYEA 1A6IA 4FHTA 3BG7A 1ZGAA 3SZGA 2X1DA 3ZOBA 2WADA 4BYYA 2DYRH 2XPVA 2ZCWA 5BS6A 4YIIA 1LEBA 4XN3A 4BL0B 2JMWA 1FLIA 4I2OA 2DAOA 1VZ0A 1R9TJ 1TNTA 1Z1DA 1T08B 1BA5A 1GLNA 4P5OA 3LAJA 3IH3A 4XOPA 2E1MB 2YU3A 4UUTA 1SMYF 1G3SA 1V5FA 3BLYA 1I5ZA 3T8RA 4HQEA 1H88C 1OISA 4OIQF 5IP9J 3M07A 2ESHA 1W5CC 1PJRA 4II3A 3WGHA 2OCEA 4PFPA 2E7WA 1Z21A 2WAQA 1N78A 1ZHFA 4E7KA 2UV1A 4I7HA 3BQYA 2X6OA 4ENMA 1KU3A 3GTJJ 4S05A 1BR2A 1VI0A 2HQAA 2H6CA 3FIWA 3KYDB 3P7NA 4WWCA 4DGWB 1FWZA 3AL0C 2A68F 4E7ZA 4FX4A 1MMNA 2B0LA 1YW7A 4G7OF 2VBXA 3KCCA 3PUBA 4QSHA 1R5HA 5EJCA 5FKNA 1SFEA 3LAPA 3O2PE 2EZLA 4OMYA 2KLOA 1O3QA 2K7LA 3OYEA 3ELKA 2KL4A 5TISC 4LLNA 3H5AA 3QP6A 4G8XA 3ASOH 3SZTA 2K9QA 5E3OA 2K27A 5HODA 2VT3A 1MNDA 3IAM2 2EFOA 1R00A 2HOTA 3IWFA 4M9SA 3TO7A 3DLLF 2VL8A 1VQKI 4JOMA 3OIQA 4L0YB 2R5YB 2XKPA 1ZH5A 2KIMA 5K5QA 3HOZJ 1T2KA 1WJBA 4D5CA 1W36C 3HSEA 1FMWA 1UJ8A 1GVDA 4AC0A 2UWMA 5K7ZA 2LYCA 3WE3A 5LHHA 2EH3A 3BCAA 4P96A 3H0DA 5EEHA 3HOWJ 2HVRA 2O6GE 1WI3A 4C2MJ 1R58A 1XGMA 3AAFA 5KK1A 3WODF 3HOVJ 3C2BA 4G7ZF 2E19A 1Z9CA 2ACJA 5F1RA 3WTUC 5TGTA 2XAFA 4FE7A 1V5EA 5M5XJ 1JKQC 4IRIA 4L9TA 2QENA 3CC4I 1X3ZB 5J1UA 5FFXA 3IP4B 3RCOA 4XRSA 2LH9A 1HCRA 4HF2A 3K2AA 3FXRA 3BG9A 1RKTA 4ZH4F 1ETOA 1LUJB 2CQNA 3VOEA 2M7AA 4BJTA 4ZDOA 4BJ5C 1X3UA 4HDVA 2Q8KA 5C3EJ 3UR3C 4A0XA 1IF1A 2HYJA 5IYDJ 1EV7A 1J2XA 4RMNA 3J7YJ 1AOYA 2L9NA 2Y9ZA 4NC6A 5H6RA 4IX7A 2OZ6A 2H27A 1KYWA 2XF5A 1MDMB 2B7EA 2HTJA 5JI6A 2AHQA 4BKXA 2Z1DA 2MD5A 1FSHA 2PQ8A 4CA0A 3LOCA 2EFNA 4XKVA 5FKKA 1XCBA 3PFYA 2KHMA 1UFMA 3QOEA 2OPTA 2TCTA 3JAMK 1FBUA 5EF6A 1HLVA 3C3WA 3ECHA 2IGOA 3VYSB 1B72A 1QZEA 2BY2A 4CYCB 1K7AA 2X85A 5F0FA 2R7TA 3NWTA 2DK8A 4EM1A 1E17A 5CJ9A 3ABLH 2BXZA 1V3FA 1T0FC 4Z6YA 3KETA 3KEYA 3CCYA 3VDXA 5J47A 4HAMA 1X1AA 5EEGA 2M1BA 5DD4A 4BEHA 2DU9A 2W57A 3JREA 2WB1N 2OAZA 1ZK8A 1RC9A 2PX9A 4OIRF 1MNEA 3LMMA 1OJLA 2CQQA 4FASD 2ME6A 4A0YA 2W1OA 3DCFA 4ZYAA 3HDDA 4ZJZA 3EUKL 3GLLA 3ULQB 2E2JJ 2CV1A 2CJJA 1O7LA 1LEAA 3EQLF 4D7MA 5HNFA 1ZR4A 1WFXA 5C44J 1S6LA 2X0LA 4KN4X 4A3KJ 1OFCX 3F9KA 2DBBA 4CYDA 3SDGA 4OIPF 4LG3A 2MH2A 4PJNA 1YRNA 2HOAA 5J3LA 1XN7A 3OIOA 3BR1A 4GGGA 3QP5A 2XAHA 3FXOA 1WH5A 3S3MA 2WBMA 1DPRA 3GUDA 3F8MA 2R7XA 2KMUA 4L5IA 3OYNA 2Q0OA 3HRUA 3CDIA 1Z91A 5E1ZB 2UUZA 1Z7LA 2RQPA 1OCPA 3FXKA 4ENNA 2YPRA 1UG2A 2Y31A 1N75A 1WRJA 3A0HC 3S3OA 1X1CA 4U0VA 4X6AJ 1IV6A 3I59B 4KMFA 1HSJA 3BG5A 4I76A 3BR5A 4CCNA 2FNAA 5HS8A 3PO3J 4PCQA 2MLGA 3AFHA 1U5TC 1ZLJA 5LFAA 2VBYA 4A0ZA 4BY7J 1UCRA 1IUFA 3H9GA 1OKRA 2VPRA 2LY2A 2RQQA 9ANTA 1LKXA 2MH9A 3QRFF 1IXSB 1WZ2A 2ZXHA 4W97A 1D3YA 1RUOA 4NQWA 1MBEA 5LGNA 1T0FA 4ESJA 1T56A 3ERMA 2AQEA 2YUSA 4X0GA 1MBFA 4I0BA 4LMYA 2EA4A 3TDUC 1W7PB 2CUEA 3ROUA 1QVTA 4QLCU 2KIQA 3A1YA 4I01A 4KIBA 4OWRB 4MTEA 1IZ1A 3C2GA 3P9CA 4NB5A 4EJWA 2VODA 3LSTA 2K3FA 2X1EA 2NRAC 2GAUA 3ZQ7A 5D6EA 5FKLA 1FTZA 4XKWA 2ELJA 2H6BA 3L2QA 1IAWA 5L3DA 2Y0SN 3K4MA 4KISA 1ON2A 4XRFA 1C0WA 5GADJ 1WJDA 4Y15A 5BPDA 2R5ZB 4RLQA 2ID6A 3BR3A 2V9PA 5E3LA 4HX8A 3T1BA 4JYKA 2ZXIA 4GDFA 1OYIA 3WTVC 3PNTA 1S72I 2FD5A 1GVJA 1XSXA 5E1WA 4EQQA 1IXRC 1ODDA 2F4MB 4MQVA 4BE2A 3F23A 2VC1A 2IT0A 2R93J 4HYEA 3OYLA 2JSCA 2BY0A 2R3SA 3OS0A 4V2FA 4N4NB 3Q0VA 1KQ8A 1HW1A 5ICCA 2KP6A 2ZNYA 4XM3A 4ZDPA 4DYQA 3CF5F 5FRMA 4A12A 1JI8A 1K79A 2Z2SB 3DWLE 5B5EC 1ETXA 3AG1H 1KA8A 1LPQA 4RLFA 2DTRA 3RZDJ 3JRFA 3UNGC 1TP4A 1KGSA 5FO5A 3K70C 3BT9A 2HQ5A 3TO6A 1U5TA 1Y56A 2JTVA 3BZCA 2CWEA 2LOOA 2BV6A 2AXTC 2LY9A 2D45A 2E60A 1K78B 1IXCA 4XLHA 5J40A 2P7CB 4MNUA 1UMQA 2HVSA 2M8GX 1BJZA 2XF7A 3SEQA 1EH8A 2IGKA 2LK2A 3FMRA 4JBAA 1HW2A 3TW6A 2UXNA 4LITA 4QPOA 4ZDLA 1RZ4A 3DKWA 2G0EA 2KIFA 5M3MJ 3QYBA 2W84A 4WXDA 1F9NA 1O3SA 5K1YA 1GV5A 1YITI 1MIJA 3DTIA 3HJEA 3A4CA 1QU3A 4U7DA 3T0YA 1P4XA 1X3WB 5DD8A 5LHGA 2IRFG 3W6JB 1R36A 4HDUA 3GTMJ 4I09A 3SFZA 4F92B 2QBYB 4RM3A 1T6SA 2MD0A 1VNDA 2XRLA 5F0CA 1R1UA 3Q5FA 2KIUA 3ZP5A 3OYBA 1K61A 3KIOA 4BXXJ 1J7KA 1DQUA 1I3QJ 1KQ9A 2ELHA 3ERED 3LSPA 4CCJA 3IAS2 3TDZC 1TZLA 5GAEJ 3BR6A 5CVUA 4KN7X 2F2EA 5BOXA 4RS8A 3C7JA 5FKMA 1I50J 1VQPI 3HSRA 2VIXA 2KJCA 4ENKA 2W4SA 3F3XA 1MMGA 4BHPA 5DV5A 3OYKA 1VQ5I 4NHJA 2VJIA 5FLMJ 5EDNA 1LE8A 1YX3A 3H9QA 2E36A 2UXXA 4UVAA 2F5VA 3DTEA 2DDBA 2OQRA 1MSFC 1W7PD 2LBFB 4QTRA 1CF7A 2HYGD 3HC7A 1DU6A 4F3QA 1D8JA 1ZRCA 1YW8A 5E20A 3IRQA 4IHTA 3ABMH 4G6DA 2JJ7A 1B8IB 4U7BA 3SZPA 1WCMJ 5H20A 4Q4ZF 3LNQA 2R7RA 1M1EB 2IVMA 2ZSIB 2VXZA 2DI3A 1QPIA 3K69A 3E1SA 1MW7A 3ZQLA 3ML6A 4HF0A 2CUFA 3H5NA 4UXNA 2MSYA 3VYRB 3FISA 4IRGA 3WHBA 4I02A 3RKXA 2DMQA 2Q2EB 2V7FA 3FXUA 2LY1A 3LFUA 3DBHB 1QZZA 2F5CA 1JUSA 2H1KA 3IL2A 4HNTA 3I3LA 4KT6A 3D5LA 2M87A 3ASNH 4AU7A 2FNPA 3CF2A 2DTZA 2ME0A 4I0AA 1YFHA 3G71I 3TEDA 4KYWA 3L2WA 3JSPA 2HQNA 3VB2A 3V7CA 1SMTA 3HOYJ 3GTPJ 1IW7F 3V8JA 1JHFA 2M30A 2MC3A 1ZLKA 2V1NA 1BC7C 1UELB 2DA6A 1R5GA 1Y0NA 2A6HF 4L5EA 5DUIA 1WWXA 2XAJA 3F21A 2M8EA 2V1DA 2D5VA 2XAUA 1BI1A 3AG4H 3HKZN 1DP3A 3DEUA 4XMYA 3PM1A 2IGMA 1VF9A 2XAGA 1LVAA 1JKPC 2V6EA 2PMZN 3V42A 2OQGA 2ZJPF 5FFZA 4CDGA 4BAYA 2CFXA 1ZARA 2OJED 4IHSA 5BQTA 4M3DA 3CUQC 1QNTA 1YX5A 1ON1A 3K10A 2H1LA 1FYMA 1ETQA 1V5GA 3H3UA 4C3IJ 1ETWA 2JSPA 4BXUA 2K40A 3ZMSA 3TP0A 4ZYDA 3L00A 4ITVA 1K6YA 5TJJA 3WGGA 1D5YA 2YU9J 2R7VA 3KP3A 4B43A 2R4GA 2V9KA 4CSWA 4B09A 1NHAA 5D8KB 2VE9A 1UHMA 1PUFA 3RIRA 2R7UA 1U2WA 3AG3H 2HTSA 5J4YA 4BQQA 3H35A 3OOPA 5KCMA 1IG7A 4IKFA 1J5YA 4FX0A 3H9JA 3I58A 1IJWC 5HDNA 2DDAA 2Q1ZB 2BXYA 1CQTA 2MW8A 2FU4A 3WTXC 3HG9A 1WJCA 4OAYA 4PZJA 2XC7A 2IW5A 2NS7A 3M1EA 2DMUA 1IDZA 2EK5A 2VKDA 5F04A 3K6GA 1XMAA 1Q1VA 3L2UA 4L9JA 1LQ1A 4BGDA 4LG0B 3T8TA 2YR2A 3S1MJ 5GTHC 3RPUA 1D5VA 3N97A 3HYIA 3KEOA 1TL8A 1XMXA 1OCTC 2FEZA 1XPXA 2LKPA 2P5KA 2L02A 1ZG5A 4AVPA 4AM3A 5D5XB 5L3BA 3HSFA 2F6CA 4XIDA 5J8CA 2FSWA 3OYIA 4AIHA 2HXOA 2XPWA 4QWQA 1OCOH 3GF2A 4O3MA 1T33A 1OR7C 3ZQGA 2LNBA 2K3PA 4ZYGA 2L2OA 3J80K 1VQLI 4PJLA 4JX4A 1X4OA 5HS7A 4BBRJ 1OQYA 1FOYA 3CESA 3OMYA 1E0EA 1F43A 4XSZF 3M4OJ 2EINH 4P1WA 5IT3A 1TNSA 3L09A 5A2QK 2CG4A 2E5NA 2XUBA 3P5JA 4BQOA 1HQCA 3GTOJ 4ETSA 5E3MA 4IJAA 5HS9A 4G9YA 4F52A 2DA4A 1IN8A 4ZC3A 1H89C 3RDIA 1SD5A 4XONA 5K5RA 4OINF 3CMMA 4NC7A 4XLCA 2QQ9A 3CUQA 5LEJA 2W85A 2ETHA 2IS1A 2J5OA 4PSXA 3FM3A 2KT0A 3S8PA 2M34A 5JFRA 5ICEA 5GAHJ 1BI0A 2WAFA 2IBDA 3FKJA 2MG4A 3WTWC 1U8RA 2HZDA 3GVAA 3HHHA 3IKTA 2KDZA 1FEXA 1P92A 3WTZA 2LC2A 2PN6A 4LIUA 4MTDA 5E1XA 3AG2H 2ZXJA 5CPRB 1Z05A 4XR6A 1JXSA 4L9VA 2WTEA 1OPCA 3NWSA
chains in the Genus database with same CATH topology
4O6JA 3TOAA 2IJLA 2W25A 1GXPA 2HQRA 2Z9OA 4R79A 5HDGA 4P9FA 1CGPA 2VT2A 3FHZA 5HLHA 2VC0A 2PMHA 1EH6A 1IN5A 2RV8A 4LLLA 4KFCA 4HF1A 1OR7A 3KLOA 2CO5A 4RGRA 1A04A 2R7DA 4P9UA 2DFIA 3QPHA 3JSOA 3IHUA 2GWRA 5F64A 5HVQC 1I6XA 1QO0D 3BY6A 4UV9A 2PEXA 1MKMA 1FT9A 1P6RA 5DEQA 2HEOA 2EFWA 3ABUA 2MA3A 3LQRA 1ZYRF 2DQLA 1G6NA 3HRTA 1IUYA 5CVRA 2O03A 2FRHA 2JZYA 1BN5A 3V7SA 3R4KA 1H9GA 2A3SA 4MQ9F 4M72A 3ABTA 1P4WA 2FA5A 2EA2A 2FOKA 1Z6RA 2BBYA 2D1HA 3EETA 4HLXA 3CLOA 4YG2F 4WF2A 3NRVA 3JTGA 2O3FA 2YX7A 1PUEE 2LF8A 5LRSA 1XB4A 4ON0A 4PGHA 3RTRA 4KDPA 1SFUA 1OYYA 4RGXA 1ONVA 1L0OC 2FMYA 1REPC 2FQ3A 2GXBA 3HTSB 3D0SA 1F1ZA 3RKWA 1G3WA 3GWZA 2VBZA 2K02A 4HA8A 1I27A 4M9ZA 4JQFA 3GFMA 3V8KA 5DUKA 4YIFA 1TTYA 2KKOA 2R7FA 2PMUA 5HLIA 2MLKA 4B8XA 3MFKA 2C6YA 2EV0A 4Y13A 2AXLA 3ZMZA 2HGCA 4GYIA 1OYWA 3PQJA 1DPUA 5L3GA 5CYVA 5LGTA 1SFXA 3Q9SA 3F8NA 2QLZA 2G7HA 2ADUA 5L3EA 4M71A 2DT5A 1TQPA 2ZJ2A 2FXAA 5ILSA 4CHUA 2VN2A 3F8BA 1UHWA 1W5TA 3R61A 4HX7A 1KU7A 3IC7A 1E2XA 2STTA 2F5FA 1T98A 3E97A 4CICA 2LF7A 4LJZF 1GHCA 4S04A 3FZVA 1STZA 1XGSA 3RI4A 2OU2A 4P55A 2IA2A 3EDPA 4HW0A 4EJTA 2PG4A 3B02A 3GEZA 2PBIA 1KYZA 1P4AA 1HBXG 1IRGA 2F5EA 2NNYA 4M9XA 1PP8F 4WX9A 4HBLA 4PGGA 1YW9A 1MJAA 4Q47A 4N9HA 4ZYHA 4RB0A 2PLYA 4EVIA 2EWNA 4I98B 1WI9A 1RNLA 3BWGA 2DPUA 3WG9A 1KU2A 1UB9A 4M74A 1Q1HA 1TQIA 3BROA 3CTAA 5FD5A 4RB3C 3I54A 1DUXC 4A2UA 1I1GA 2H09A 2FF4A 4G94A 2LSOA 1QPMA 3Q9VA 3M8FA 2O0YA 4GXOA 1R1VA 5HDKA 3E6MA 3HUGA 2A6EF 2QQBA 2HS5A 3L9FA 2LDUA 3C18A 2FBHA 3ISPA 3BP8A 3KEQA 1W5SA 4EM0B 1BIBA 1FYLA 4LD5A 5CVJA 2M45A 1FYKA 3KP2A 1TBXA 1K6OA 1XDSA 3I5UA 1RI7A 5ICFA 4BH9A 1G4DA 3K9TA 5IT9Z 1L3LA 3RYPA 3E6BA 2ZNZA 4RB1A 5ERIA 5LGUA 2RN7A 2PFBA 4Y17A 3E5UA 2CSOA 2HYFA 1Z6TA 3EYYA 2P6TA 2W24A 3ZMDA 2BEOA 1F5TA 3I53A 2DPDA 1BI2A 4XBFA 2FMLA 2CGPA 1BOAA 1KQ0A 2ZFWA 5BPIA 3V8LA 1FBQA 3FX3A 2CW0F 1YS6A 2XAQA 4BQAA 3ZN0A 1MJ9A 3GFIA 1BBYA 1YIOA 3WE2A 1DDNA 2K86A 3KZZA 4WK8F 3J81Z 5ILUA 1B6AA 2HWVA 4BHCA 2K4JA 4IF4A 1MD0A 4HV5A 4RGUA 3F8FA 2HDCA 4GYGA 1WQ2A 1YO5C 1B1BA 2IA0A 4L9NA 4KIFA 4G6QA 1U5TB 3P9IA 3DFGA 2V79A 1XCVA 3M7GA 3NEUA 2UZKA 4H0EA 2VOOA 2YX4A 3ZPLA 3TGNA 2HR3A 4PDKA 4UVBA 5K5OA 1W4MA 2WC2A 1R7JA 4M73A 2QVOA 2V9VA 3GX4X 3JTHA 3WGIA 1ULYA 3F22A 4WXCA 3KP5A 2A07F 3HRMA 4M6XA 3ZMVA 1SAXA 4CO8A 5FD6A 2EJRA 1WSUA 2L3DA 3LWFA 2DW4A 4HX4A 2QYOA 2V1XA 1H0MA 4LGWA 2FBIA 1F4KA 3CUOA 1QGPA 3SXYA 4KT5C 4EM2A 2DO7A 2XASA 1YYVA 2RC4A 4DNCA 2RVCA 2DK5A 2IP2A 1HKSA 3R60A 1MDMA 1ZAOA 3G73A 5TRDA 5ICGA 3WTSC 3TOBA 3ZMUA 1LB2A 1CF7B 2XGXA 3WU1B 3M9AA 4K2EA 2QM3A 5FB2A 2NS0A 1IN7A 1V4RA 1BIAA 3KP4A 3RKYA 2A69F 2P5LC 3DV8A 5L3CA 2P8TA 3QU6A 3CO7C 2L54A 3GFLA 3IWZA 3BOQA 3FXQA 3F72A 4A5NA 3J7AO 3VEPA 3J81K 5J8FA 3K1MA 2CYYA 1QBJA 3JAMZ 3CO6C 1BC8C 2Y75A 1B9MA 2Z33A 2ZO4A 4ESBA 1S8NA 4RAYA 1D8KA 2O61A 1R1TA 1PDNC 2PI0A 5ED4A 4L18B 3K1NA 5KVRA 4KNYA 2BGCA 2GXGA 3DPLC 2HZTA 5LHIA 2ZBKA 2HOEA 4IRHA 2VOPA 1FY7A 5H6QA 1U78A 3QPTA 4UV8A 4HOBA 3QAHA 1MZBA 4A6DA 2NNNA 4WXHA 3KLNA 4BHBA 1I1SA 3GW2A 4CGZA 3U1DA 1FP1D 2M5WA 3KFWX 3VFZA 3I59A 5DCMA 4O5VA 2E1CA 1O7FA 2Y0MA 3DXJF 3FMSA 5L3FA 3DP7A 3I71A 1B4AA 1P2FA 3GFJA 1T39A 5E8GA 1BI3A 1TW3A 4AD9A 5HLGA 2JT1A 2F5DA 5D8LB 4WCGA 2KJBA 2PJPA 2GA2A 3T5XA 1PP7U 1YLFA 2OBPA 3U9GA 4OU0A 2BYVE 1W7PA 2VBWA 1XGNA 2STWA 4D0PA 4U0YA 1HW5A 4XLNF 1Y0UA 3F6OA 3R0AA 1XDUA 2OZUA 1SD7A 4GCVA 5DDGA 5D5VB 1R22A 4E70A 5D4RA 2J5PA 2GIVA 1VTNC 1JE8A 5FGMA 3KZYA 5JHUA 4AWXB 3E6DA 4ASNA 4RB2C 1HXDA 3S2WA 3FWEA 4GO1A 1YTYA 2HKOA 2ZKZA 2D1VA 1T38A 3GLXA 2ISZA 2FE3A 3F6VA 1USSA 3CDHA 3CUQB 1FOKA 1FC3A 1J9IA 4KA4A 4XSXF 5E18F 2G9WA 3GZ6A 4UUVA 2V1UA 2EB7A 2P5VA 1K78A 4AIKA 3O3KA 3U2RA 3RYRA 2RNJA 3EUHA 1B9NA 3IRRA 3FF5A 3F8CA 1HSTA 3E6CC 1XSVA 1ZRDA 3M8EA 5CVIA 4N9IA 1IN4A 1ZN2A 3KP6A 3VODA 3B73A 3P9KA 4HV6A 1JGSA 3L7WA 5ILVA 4LB5A 3KP7A 1MJBA 2NAZA 2P6SA 2QBYA 5FLXZ 2RDPA 1DP7P 5LRRA 2ZMEA 2QWWA 2XV4S 4L5JA 3V7RA 3K0LA 4EJUA 5DCMB 3R0JA 4XLPF 3MEXA 3O6BB 1YQAA 2OD5A 1U6GA 1HKTA 2EV5A 1BJAA 4MEXF 4DQ2A 3MZHA 2O8XA 1J75A 2Z99A 1FP2A 2ISYA 3H92A 3RPQA 2GQQA 5AIPA 5J6XA 1AWCA 4EV0A 4YFKF 1TW2A 1XSDA 3IKVA 1KU9A 3BJAA 4M6YA 2Z3YA 2XKOA 1BM9A 2V6CA 1QZYA 5HOOA 3LA7A 2Q2EA 4UVCA 2QUFA 2CQKA 2D2WA 4RAZA 4R8HA 4KUMA 3BDDA 1XGOA 5LBQA 2EV6A 4EGYA 5D6FA 4EJOA 3CJNA 3MZYA 4ENJA 3HIFA 1MGTA 3E5XA 1B59A 1RIOH 1FZPB 2KRFA 2Y48A 1Z7UA 4AIJA 4LK1F 4ESFA 3HTUA 5DYMA 2TDXA 4FT8A 2COMA 3SQNA 1S3JA 2FBKA 4Q48A 3BPXA 4IPAA 3R6SA 3HHGA 4LLGF 3E5QA 2YSRA 3OV8A 1FBSA 4OMZA 2XHKA 4KMUX 5FLXK 4IXAA 3GYHX 2BE5F 1LNWA 3K2ZA 1FX7A 5AONA 4ZZLA 2P4WA 3QU3A 3QOPA 4JK1X 4OOIA 1ZG3A 2HFHA 2XRNA 3RJPA 4LB6B 1YG2A 1ZRFA 1TQMA 2NYXA 1USTA 3TO9A 2RGVA 3BJOA 4UHTA 3GZ5A 4LG0A 4KIGA 2ZMEB 1GXQA 1YS7A 4Q5SF 3ZN1A 4A6EA 3MAJA 2P7VB 1SD6A 2JPBA 4L0ZB 4HQMA 5LLQA 1O3RA 3GO5A 1G3TA 2AS5F 1J0RA 4MEYF 3W6KB 3C1DA 3TKYA 1LDKB 4A5MA 1ZREA 4RGSA 3BPVA 3EYIA 4R1HA 1OMIA 1QQIA 1ZG1A 2WV0A 2E1NA 2MBFA 3ECOA 2VE8A 5F6FA 4EJVA 3JW4A 3MWMA 4EGZA 2QQAA 3FMQA 2A5YB 4EMSA 3J80Z 2OA4A 3HOTA 4ZZDA 1LDJA 3BZ6A 5JR3A 4KICA 3I0TA 1EH7A 3WTYC 1ZGJA 2DQRA 2JRTA 3WTTC 3ZMTA 2A61A 5A2QZ 1O57A 3N4MA 5LEKA 1WKMA 1R23A 4G7HF 4N0BA 3GXOA 1FPQA 4MHGA 4F7ZA 5BMZA 2EFQA 4MGRA 1FNNA 4YFXF 3E3VA 1XMKA 1J59A 1FSEA 1LDDA 4U0WA 2EFPA 3DF8A 3L2CA 1XD7A 2L4MA 3PFIA 1U3EM 3PQKA 4OIOF 4UNOA 2XROA 2HKXA 2K4BA 1IN6A 5D5UB 3K1PA 2GA1A 3COAC 3MCZA 5AIQA 4U88A 2RKHA 2DLLA 2ESNA 3TQNA 5JVTA 4TV7A 5IT9K 3DQVC 1S7OA 3WU0A 1LJ9A 4CZZA 2X4HA 3G3ZA 1S29A 2JPCA 2IA1A 5E8IA 1JHHA 4LFUA 3LFKA 2G7UA 1H9TA 3HRSA 4YFNF 1IRFA 3KE2A 3DPTA 3LA3A 5E17F 3H3ZA 3LQQA 5DCFA 2L01A 4Z2YA 4HZFA 3V4GA 4HLYA 2IPQX 3BJ6A 5CLSA 1G3YA 1S7AA 3I4PA 2WWYA 5D5WB 2VONA 1TLHB 3LA2A 2QZ8A 5D4SA 1O3TA 3MQ0A 4BNCA 3FM5A 4CXFA 2XIGA 1HKQA 6PAXA 2H94A 1RUNA 3HOSA 1SD4A 3REOA 2Z5UA 4IVNA 2GZWA 3NQOA 2L4AA 5CVVA 4LK0F 3I64A 2E7XA 3SHFA 2XVCA 4ZYEA 4FHTA 1ZGAA 4BYYA 5BS6A 2ZCWA 1LEBA 4YIIA 1FLIA 4I2OA 2DAOA 1TNTA 1Z1DA 4P5OA 3LAJA 2YU3A 1SMYF 1G3SA 4HQEA 1I5ZA 3T8RA 4OIQF 2ESHA 3WGHA 2E7WA 1ZHFA 4I7HA 4ENMA 1KU3A 4S05A 3P7NA 2H6CA 4WWCA 1FWZA 2A68F 4FX4A 2B0LA 1YW7A 4G7OF 2VBXA 3KCCA 1R5HA 3LAPA 1SFEA 3O2PE 4OMYA 1O3QA 2K7LA 3ELKA 4LLNA 3QP6A 4G8XA 3SZTA 2K27A 2VT3A 2EFOA 1R00A 3IWFA 4M9SA 3TO7A 4L0YB 2XKPA 1ZH5A 2KIMA 5K5QA 1T2KA 3HSEA 2UWMA 3WE3A 5LHHA 4P96A 5EEHA 2O6GE 1R58A 1XGMA 3AAFA 5KK1A 3WODF 4G7ZF 1Z9CA 2ACJA 5F1RA 3WTUC 2XAFA 4IRIA 4L9TA 2QENA 5FFXA 4HF2A 3FXRA 4ZH4F 3VOEA 1X3UA 4HDVA 2Q8KA 4A0XA 1IF1A 1EV7A 1J2XA 1AOYA 5H6RA 2OZ6A 2H27A 1KYWA 1MDMB 2HTJA 5JI6A 2MD5A 1FSHA 2PQ8A 2EFNA 1XCBA 1UFMA 3JAMK 1FBUA 3C3WA 3ECHA 1K7AA 2DK8A 4EM1A 1E17A 5CJ9A 1V3FA 3KETA 4HAMA 5EEGA 2M1BA 5DD4A 2DU9A 2W57A 2OAZA 4OIRF 4A0YA 3ULQB 1O7LA 1LEAA 3EQLF 1S6LA 2X0LA 4KN4X 2DBBA 4CYDA 4OIPF 2MH2A 1XN7A 4GGGA 3QP5A 2XAHA 1DPRA 3GUDA 3F8MA 4L5IA 2Q0OA 3HRUA 1Z91A 5E1ZB 2RQPA 4ENNA 2YPRA 1WRJA 4U0VA 3I59B 4KMFA 1HSJA 2FNAA 5HS8A 4PCQA 2MLGA 1U5TC 1ZLJA 2VBYA 4A0ZA 1UCRA 1OKRA 2MH9A 3QRFF 1IXSB 1D3YA 1RUOA 4NQWA 5LGNA 1T0FA 4ESJA 4I0BA 4LMYA 2EA4A 3TDUC 1W7PB 3ROUA 4QLCU 4I01A 4KIBA 4MTEA 1IZ1A 3P9CA 4NB5A 4EJWA 2VODA 3LSTA 2NRAC 2GAUA 3ZQ7A 5D6EA 2H6BA 1IAWA 5L3DA 1ON2A 4XRFA 1C0WA 4Y15A 5BPDA 4HX8A 3T1BA 1OYIA 3WTVC 1GVJA 1XSXA 5E1WA 4EQQA 1IXRC 1ODDA 4MQVA 3F23A 2VC1A 2IT0A 4HYEA 2JSCA 2R3SA 1KQ8A 1HW1A 5ICCA 2ZNYA 4A12A 1K79A 1KA8A 2DTRA 1KGSA 5FO5A 3TO6A 1U5TA 2JTVA 2CWEA 2BV6A 2D45A 1K78B 1IXCA 2P7CB 4MNUA 1EH8A 3FMRA 4JBAA 1HW2A 2UXNA 1RZ4A 3DKWA 2KIFA 2W84A 4WXDA 1F9NA 1O3SA 5K1YA 4U7DA 3T0YA 1P4XA 5DD8A 5LHGA 2IRFG 3W6JB 1R36A 4HDUA 4I09A 3SFZA 2QBYB 1T6SA 1R1UA 3Q5FA 2KIUA 3ZP5A 1J7KA 1KQ9A 2ELHA 3ERED 3TDZC 5CVUA 4KN7X 2F2EA 5BOXA 4RS8A 3C7JA 3HSRA 2KJCA 4ENKA 3F3XA 4BHPA 5DV5A 4NHJA 2UXXA 4UVAA 2OQRA 1W7PD 1CF7A 2HYGD 1D8JA 1ZRCA 1YW8A 5E20A 3IRQA 4IHTA 4G6DA 4U7BA 3SZPA 5H20A 4Q4ZF 2IVMA 2VXZA 2DI3A 3K69A 3ML6A 4HF0A 4UXNA 4IRGA 4I02A 3RKXA 3FXUA 1QZZA 2F5CA 3IL2A 3D5LA 2M87A 2FNPA 4I0AA 1YFHA 4KYWA 3JSPA 2HQNA 3VB2A 3V7CA 1SMTA 1IW7F 3V8JA 1JHFA 2M30A 2MC3A 1ZLKA 1BC7C 1R5GA 2A6HF 5DUIA 1WWXA 2XAJA 3F21A 2M8EA 2V1DA 1BI1A 3DEUA 2XAGA 1LVAA 2OQGA 5FFZA 4CDGA 4BAYA 2CFXA 1ZARA 4IHSA 5BQTA 3CUQC 1QNTA 1ON1A 1FYMA 3H3UA 4BXUA 3ZMSA 4ZYDA 3L00A 5TJJA 3WGGA 3KP3A 4B09A 1NHAA 5D8KB 2VE9A 1UHMA 3RIRA 1U2WA 2HTSA 3OOPA 1J5YA 4FX0A 3I58A 5HDNA 2FU4A 3WTXC 4PZJA 2IW5A 3M1EA 2EK5A 1XMAA 4L9JA 1LQ1A 4LG0B 3T8TA 2YR2A 3RPUA 1D5VA 3N97A 3HYIA 3KEOA 2FEZA 2LKPA 2P5KA 2L02A 1ZG5A 4AVPA 5D5XB 5L3BA 3HSFA 5J8CA 2FSWA 4AIHA 4QWQA 3GF2A 4O3MA 2LNBA 4ZYGA 3J80K 5HS7A 4XSZF 5IT3A 1TNSA 3L09A 5A2QK 2CG4A 2XUBA 1HQCA 4ETSA 4IJAA 5HS9A 4G9YA 1IN8A 3RDIA 1SD5A 5K5RA 4OINF 2QQ9A 3CUQA 5LEJA 2W85A 2ETHA 2J5OA 3FM3A 5JFRA 5ICEA 1BI0A 3WTWC 1U8RA 3GVAA 3HHHA 3IKTA 1P92A 3WTZA 2PN6A 4MTDA 5E1XA 2ZXJA 1Z05A 1JXSA 4L9VA 2WTEA 1OPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6J A;  3TOA A;  2IJL A;  2W25 A;  1GXP A;  2HQR A;  2Z9O A;  4R79 A;  5HDG A;  4P9F A;  1CGP A;  2VT2 A;  3FHZ A;  5HLH A;  2VC0 A;  2PMH A;  1EH6 A;  1IN5 A;  2RV8 A;  4LLL A;  4KFC A;  4HF1 A;  1OR7 A;  3KLO A;  2CO5 A;  4RGR A;  1A04 A;  2R7D A;  4P9U A;  2DFI A;  3QPH A;  3JSO A;  3IHU A;  2GWR A;  5F64 A;  5HVQ C;  1I6X A;  1QO0 D;  3BY6 A;  4UV9 A;  2PEX A;  1MKM A;  1FT9 A;  1P6R A;  5DEQ A;  2HEO A;  2EFW A;  3ABU A;  2MA3 A;  3LQR A;  1ZYR F;  2DQL A;  1G6N A;  3HRT A;  1IUY A;  5CVR A;  2O03 A;  2FRH A;  2JZY A;  1BN5 A;  3V7S A;  3R4K A;  1H9G A;  2A3S A;  4MQ9 F;  4M72 A;  3ABT A;  1P4W A;  2FA5 A;  2EA2 A;  2FOK A;  1Z6R A;  2BBY A;  2D1H A;  3EET A;  4HLX A;  3CLO A;  4YG2 F;  4WF2 A;  3NRV A;  3JTG A;  2O3F A;  2YX7 A;  1PUE E;  2LF8 A;  5LRS A;  1XB4 A;  4ON0 A;  4PGH A;  3RTR A;  4KDP A;  1SFU A;  1OYY A;  4RGX A;  1ONV A;  1L0O C;  2FMY A;  1REP C;  2FQ3 A;  2GXB A;  3HTS B;  3D0S A;  1F1Z A;  3RKW A;  1G3W A;  3GWZ A;  2VBZ A;  2K02 A;  4HA8 A;  1I27 A;  4M9Z A;  4JQF A;  3GFM A;  3V8K A;  5DUK A;  4YIF A;  1TTY A;  2KKO A;  2R7F A;  2PMU A;  5HLI A;  2MLK A;  4B8X A;  3MFK A;  2C6Y A;  2EV0 A;  4Y13 A;  2AXL A;  3ZMZ A;  2HGC A;  4GYI A;  1OYW A;  3PQJ A;  1DPU A;  5L3G A;  5CYV A;  5LGT A;  1SFX A;  3Q9S A;  3F8N A;  2QLZ A;  2G7H A;  2ADU A;  5L3E A;  4M71 A;  2DT5 A;  1TQP A;  2ZJ2 A;  2FXA A;  5ILS A;  4CHU A;  2VN2 A;  3F8B A;  1UHW A;  1W5T A;  3R61 A;  4HX7 A;  1KU7 A;  3IC7 A;  1E2X A;  2STT A;  2F5F A;  1T98 A;  3E97 A;  4CIC A;  2LF7 A;  4LJZ F;  1GHC A;  4S04 A;  3FZV A;  1STZ A;  1XGS A;  3RI4 A;  2OU2 A;  4P55 A;  2IA2 A;  3EDP A;  4HW0 A;  4EJT A;  2PG4 A;  3B02 A;  3GEZ A;  2PBI A;  1KYZ A;  1P4A A;  1HBX G;  1IRG A;  2F5E A;  2NNY A;  4M9X A;  1PP8 F;  4WX9 A;  4HBL A;  4PGG A;  1YW9 A;  1MJA A;  4Q47 A;  4N9H A;  4ZYH A;  4RB0 A;  2PLY A;  4EVI A;  2EWN A;  4I98 B;  1WI9 A;  1RNL A;  3BWG A;  2DPU A;  3WG9 A;  1KU2 A;  1UB9 A;  4M74 A;  1Q1H A;  1TQI A;  3BRO A;  3CTA A;  5FD5 A;  4RB3 C;  3I54 A;  1DUX C;  4A2U A;  1I1G A;  2H09 A;  2FF4 A;  4G94 A;  2LSO A;  1QPM A;  3Q9V A;  3M8F A;  2O0Y A;  4GXO A;  1R1V A;  5HDK A;  3E6M A;  3HUG A;  2A6E F;  2QQB A;  2HS5 A;  3L9F A;  2LDU A;  3C18 A;  2FBH A;  3ISP A;  3BP8 A;  3KEQ A;  1W5S A;  4EM0 B;  1BIB A;  1FYL A;  4LD5 A;  5CVJ A;  2M45 A;  1FYK A;  3KP2 A;  1TBX A;  1K6O A;  1XDS A;  3I5U A;  1RI7 A;  5ICF A;  4BH9 A;  1G4D A;  3K9T A;  5IT9 Z;  1L3L A;  3RYP A;  3E6B A;  2ZNZ A;  4RB1 A;  5ERI A;  5LGU A;  2RN7 A;  2PFB A;  4Y17 A;  3E5U A;  2CSO A;  2HYF A;  1Z6T A;  3EYY A;  2P6T A;  2W24 A;  3ZMD A;  2BEO A;  1F5T A;  3I53 A;  2DPD A;  1BI2 A;  4XBF A;  2FML A;  2CGP A;  1BOA A;  1KQ0 A;  2ZFW A;  5BPI A;  3V8L A;  1FBQ A;  3FX3 A;  2CW0 F;  1YS6 A;  2XAQ A;  4BQA A;  3ZN0 A;  1MJ9 A;  3GFI A;  1BBY A;  1YIO A;  3WE2 A;  1DDN A;  2K86 A;  3KZZ A;  4WK8 F;  3J81 Z;  5ILU A;  1B6A A;  2HWV A;  4BHC A;  2K4J A;  4IF4 A;  1MD0 A;  4HV5 A;  4RGU A;  3F8F A;  2HDC A;  4GYG A;  1WQ2 A;  1YO5 C;  1B1B A;  2IA0 A;  4L9N A;  4KIF A;  4G6Q A;  1U5T B;  3P9I A;  3DFG A;  2V79 A;  1XCV A;  3M7G A;  3NEU A;  2UZK A;  4H0E A;  2VOO A;  2YX4 A;  3ZPL A;  3TGN A;  2HR3 A;  4PDK A;  4UVB A;  5K5O A;  1W4M A;  2WC2 A;  1R7J A;  4M73 A;  2QVO A;  2V9V A;  3GX4 X;  3JTH A;  3WGI A;  1ULY A;  3F22 A;  4WXC A;  3KP5 A;  2A07 F;  3HRM A;  4M6X A;  3ZMV A;  1SAX A;  4CO8 A;  5FD6 A;  2EJR A;  1WSU A;  2L3D A;  3LWF A;  2DW4 A;  4HX4 A;  2QYO A;  2V1X A;  1H0M A;  4LGW A;  2FBI A;  1F4K A;  3CUO A;  1QGP A;  3SXY A;  4KT5 C;  4EM2 A;  2DO7 A;  2XAS A;  1YYV A;  2RC4 A;  4DNC A;  2RVC A;  2DK5 A;  2IP2 A;  1HKS A;  3R60 A;  1MDM A;  1ZAO A;  3G73 A;  5TRD A;  5ICG A;  3WTS C;  3TOB A;  3ZMU A;  1LB2 A;  1CF7 B;  2XGX A;  3WU1 B;  3M9A A;  4K2E A;  2QM3 A;  5FB2 A;  2NS0 A;  1IN7 A;  1V4R A;  1BIA A;  3KP4 A;  3RKY A;  2A69 F;  2P5L C;  3DV8 A;  5L3C A;  2P8T A;  3QU6 A;  3CO7 C;  2L54 A;  3GFL A;  3IWZ A;  3BOQ A;  3FXQ A;  3F72 A;  4A5N A;  3J7A O;  3VEP A;  3J81 K;  5J8F A;  3K1M A;  2CYY A;  1QBJ A;  3JAM Z;  3CO6 C;  1BC8 C;  2Y75 A;  1B9M A;  2Z33 A;  2ZO4 A;  4ESB A;  1S8N A;  4RAY A;  1D8K A;  2O61 A;  1R1T A;  1PDN C;  2PI0 A;  5ED4 A;  4L18 B;  3K1N A;  5KVR A;  4KNY A;  2BGC A;  2GXG A;  3DPL C;  2HZT A;  5LHI A;  2ZBK A;  2HOE A;  4IRH A;  2VOP A;  1FY7 A;  5H6Q A;  1U78 A;  3QPT A;  4UV8 A;  4HOB A;  3QAH A;  1MZB A;  4A6D A;  2NNN A;  4WXH A;  3KLN A;  4BHB A;  1I1S A;  3GW2 A;  4CGZ A;  3U1D A;  1FP1 D;  2M5W A;  3KFW X;  3VFZ A;  3I59 A;  5DCM A;  4O5V A;  2E1C A;  1O7F A;  2Y0M A;  3DXJ F;  3FMS A;  5L3F A;  3DP7 A;  3I71 A;  1B4A A;  1P2F A;  3GFJ A;  1T39 A;  5E8G A;  1BI3 A;  1TW3 A;  4AD9 A;  5HLG A;  2JT1 A;  2F5D A;  5D8L B;  4WCG A;  2KJB A;  2PJP A;  2GA2 A;  3T5X A;  1PP7 U;  1YLF A;  2OBP A;  3U9G A;  4OU0 A;  2BYV E;  1W7P A;  2VBW A;  1XGN A;  2STW A;  4D0P A;  4U0Y A;  1HW5 A;  4XLN F;  1Y0U A;  3F6O A;  3R0A A;  1XDU A;  2OZU A;  1SD7 A;  4GCV A;  5DDG A;  5D5V B;  1R22 A;  4E70 A;  5D4R A;  2J5P A;  2GIV A;  1VTN C;  1JE8 A;  5FGM A;  3KZY A;  5JHU A;  4AWX B;  3E6D A;  4ASN A;  4RB2 C;  1HXD A;  3S2W A;  3FWE A;  4GO1 A;  1YTY A;  2HKO A;  2ZKZ A;  2D1V A;  1T38 A;  3GLX A;  2ISZ A;  2FE3 A;  3F6V A;  1USS A;  3CDH A;  3CUQ B;  1FOK A;  1FC3 A;  1J9I A;  4KA4 A;  4XSX F;  5E18 F;  2G9W A;  3GZ6 A;  4UUV A;  2V1U A;  2EB7 A;  2P5V A;  1K78 A;  4AIK A;  3O3K A;  3U2R A;  3RYR A;  2RNJ A;  3EUH A;  1B9N A;  3IRR A;  3FF5 A;  3F8C A;  1HST A;  3E6C C;  1XSV A;  1ZRD A;  3M8E A;  5CVI A;  4N9I A;  1IN4 A;  1ZN2 A;  3KP6 A;  3VOD A;  3B73 A;  3P9K A;  4HV6 A;  1JGS A;  3L7W A;  5ILV A;  4LB5 A;  3KP7 A;  1MJB A;  2NAZ A;  2P6S A;  2QBY A;  5FLX Z;  2RDP A;  1DP7 P;  5LRR A;  2ZME A;  2QWW A;  2XV4 S;  4L5J A;  3V7R A;  3K0L A;  4EJU A;  5DCM B;  3R0J A;  4XLP F;  3MEX A;  3O6B B;  1YQA A;  2OD5 A;  1U6G A;  1HKT A;  2EV5 A;  1BJA A;  4MEX F;  4DQ2 A;  3MZH A;  2O8X A;  1J75 A;  2Z99 A;  1FP2 A;  2ISY A;  3H92 A;  3RPQ A;  2GQQ A;  5AIP A;  5J6X A;  1AWC A;  4EV0 A;  4YFK F;  1TW2 A;  1XSD A;  3IKV A;  1KU9 A;  3BJA A;  4M6Y A;  2Z3Y A;  2XKO A;  1BM9 A;  2V6C A;  1QZY A;  5HOO A;  3LA7 A;  2Q2E A;  4UVC A;  2QUF A;  2CQK A;  2D2W A;  4RAZ A;  4R8H A;  4KUM A;  3BDD A;  1XGO A;  5LBQ A;  2EV6 A;  4EGY A;  5D6F A;  4EJO A;  3CJN A;  3MZY A;  4ENJ A;  3HIF A;  1MGT A;  3E5X A;  1B59 A;  1RIO H;  1FZP B;  2KRF A;  2Y48 A;  1Z7U A;  4AIJ A;  4LK1 F;  4ESF A;  3HTU A;  5DYM A;  2TDX A;  4FT8 A;  2COM A;  3SQN A;  1S3J A;  2FBK A;  4Q48 A;  3BPX A;  4IPA A;  3R6S A;  3HHG A;  4LLG F;  3E5Q A;  2YSR A;  3OV8 A;  1FBS A;  4OMZ A;  2XHK A;  4KMU X;  5FLX K;  4IXA A;  3GYH X;  2BE5 F;  1LNW A;  3K2Z A;  1FX7 A;  5AON A;  4ZZL A;  2P4W A;  3QU3 A;  3QOP A;  4JK1 X;  4OOI A;  1ZG3 A;  2HFH A;  2XRN A;  3RJP A;  4LB6 B;  1YG2 A;  1ZRF A;  1TQM A;  2NYX A;  1UST A;  3TO9 A;  2RGV A;  3BJO A;  4UHT A;  3GZ5 A;  4LG0 A;  4KIG A;  2ZME B;  1GXQ A;  1YS7 A;  4Q5S F;  3ZN1 A;  4A6E A;  3MAJ A;  2P7V B;  1SD6 A;  2JPB A;  4L0Z B;  4HQM A;  5LLQ A;  1O3R A;  3GO5 A;  1G3T A;  2AS5 F;  1J0R A;  4MEY F;  3W6K B;  3C1D A;  3TKY A;  1LDK B;  4A5M A;  1ZRE A;  4RGS A;  3BPV A;  3EYI A;  4R1H A;  1OMI A;  1QQI A;  1ZG1 A;  2WV0 A;  2E1N A;  2MBF A;  3ECO A;  2VE8 A;  5F6F A;  4EJV A;  3JW4 A;  3MWM A;  4EGZ A;  2QQA A;  3FMQ A;  2A5Y B;  4EMS A;  3J80 Z;  2OA4 A;  3HOT A;  4ZZD A;  1LDJ A;  3BZ6 A;  5JR3 A;  4KIC A;  3I0T A;  1EH7 A;  3WTY C;  1ZGJ A;  2DQR A;  2JRT A;  3WTT C;  3ZMT A;  2A61 A;  5A2Q Z;  1O57 A;  3N4M A;  5LEK A;  1WKM A;  1R23 A;  4G7H F;  4N0B A;  3GXO A;  1FPQ A;  4MHG A;  4F7Z A;  5BMZ A;  2EFQ A;  4MGR A;  1FNN A;  4YFX F;  3E3V A;  1XMK A;  1J59 A;  1FSE A;  1LDD A;  4U0W A;  2EFP A;  3DF8 A;  3L2C A;  1XD7 A;  2L4M A;  3PFI A;  1U3E M;  3PQK A;  4OIO F;  4UNO A;  2XRO A;  2HKX A;  2K4B A;  1IN6 A;  5D5U B;  3K1P A;  2GA1 A;  3COA C;  3MCZ A;  5AIQ A;  4U88 A;  2RKH A;  2DLL A;  2ESN A;  3TQN A;  5JVT A;  4TV7 A;  5IT9 K;  3DQV C;  1S7O A;  3WU0 A;  1LJ9 A;  4CZZ A;  2X4H A;  3G3Z A;  1S29 A;  2JPC A;  2IA1 A;  5E8I A;  1JHH A;  4LFU A;  3LFK A;  2G7U A;  1H9T A;  3HRS A;  4YFN F;  1IRF A;  3KE2 A;  3DPT A;  3LA3 A;  5E17 F;  3H3Z A;  3LQQ A;  5DCF A;  2L01 A;  4Z2Y A;  4HZF A;  3V4G A;  4HLY A;  2IPQ X;  3BJ6 A;  5CLS A;  1G3Y A;  1S7A A;  3I4P A;  2WWY A;  5D5W B;  2VON A;  1TLH B;  3LA2 A;  2QZ8 A;  5D4S A;  1O3T A;  3MQ0 A;  4BNC A;  3FM5 A;  4CXF A;  2XIG A;  1HKQ A;  6PAX A;  2H94 A;  1RUN A;  3HOS A;  1SD4 A;  3REO A;  2Z5U A;  4IVN A;  2GZW A;  3NQO A;  2L4A A;  5CVV A;  4LK0 F;  3I64 A;  2E7X A;  3SHF A;  2XVC A;  4ZYE A;  4FHT A;  1ZGA A;  4BYY A;  5BS6 A;  2ZCW A;  1LEB A;  4YII A;  1FLI A;  4I2O A;  2DAO A;  1TNT A;  1Z1D A;  4P5O A;  3LAJ A;  2YU3 A;  1SMY F;  1G3S A;  4HQE A;  1I5Z A;  3T8R A;  4OIQ F;  2ESH A;  3WGH A;  2E7W A;  1ZHF A;  4I7H A;  4ENM A;  1KU3 A;  4S05 A;  3P7N A;  2H6C A;  4WWC A;  1FWZ A;  2A68 F;  4FX4 A;  2B0L A;  1YW7 A;  4G7O F;  2VBX A;  3KCC A;  1R5H A;  3LAP A;  1SFE A;  3O2P E;  4OMY A;  1O3Q A;  2K7L A;  3ELK A;  4LLN A;  3QP6 A;  4G8X A;  3SZT A;  2K27 A;  2VT3 A;  2EFO A;  1R00 A;  3IWF A;  4M9S A;  3TO7 A;  4L0Y B;  2XKP A;  1ZH5 A;  2KIM A;  5K5Q A;  1T2K A;  3HSE A;  2UWM A;  3WE3 A;  5LHH A;  4P96 A;  5EEH A;  2O6G E;  1R58 A;  1XGM A;  3AAF A;  5KK1 A;  3WOD F;  4G7Z F;  1Z9C A;  2ACJ A;  5F1R A;  3WTU C;  2XAF A;  4IRI A;  4L9T A;  2QEN A;  5FFX A;  4HF2 A;  3FXR A;  4ZH4 F;  3VOE A;  1X3U A;  4HDV A;  2Q8K A;  4A0X A;  1IF1 A;  1EV7 A;  1J2X A;  1AOY A;  5H6R A;  2OZ6 A;  2H27 A;  1KYW A;  1MDM B;  2HTJ A;  5JI6 A;  2MD5 A;  1FSH A;  2PQ8 A;  2EFN A;  1XCB A;  1UFM A;  3JAM K;  1FBU A;  3C3W A;  3ECH A;  1K7A A;  2DK8 A;  4EM1 A;  1E17 A;  5CJ9 A;  1V3F A;  3KET A;  4HAM A;  5EEG A;  2M1B A;  5DD4 A;  2DU9 A;  2W57 A;  2OAZ A;  4OIR F;  4A0Y A;  3ULQ B;  1O7L A;  1LEA A;  3EQL F;  1S6L A;  2X0L A;  4KN4 X;  2DBB A;  4CYD A;  4OIP F;  2MH2 A;  1XN7 A;  4GGG A;  3QP5 A;  2XAH A;  1DPR A;  3GUD A;  3F8M A;  4L5I A;  2Q0O A;  3HRU A;  1Z91 A;  5E1Z B;  2RQP A;  4ENN A;  2YPR A;  1WRJ A;  4U0V A;  3I59 B;  4KMF A;  1HSJ A;  2FNA A;  5HS8 A;  4PCQ A;  2MLG A;  1U5T C;  1ZLJ A;  2VBY A;  4A0Z A;  1UCR A;  1OKR A;  2MH9 A;  3QRF F;  1IXS B;  1D3Y A;  1RUO A;  4NQW A;  5LGN A;  1T0F A;  4ESJ A;  4I0B A;  4LMY A;  2EA4 A;  3TDU C;  1W7P B;  3ROU A;  4QLC U;  4I01 A;  4KIB A;  4MTE A;  1IZ1 A;  3P9C A;  4NB5 A;  4EJW A;  2VOD A;  3LST A;  2NRA C;  2GAU A;  3ZQ7 A;  5D6E A;  2H6B A;  1IAW A;  5L3D A;  1ON2 A;  4XRF A;  1C0W A;  4Y15 A;  5BPD A;  4HX8 A;  3T1B A;  1OYI A;  3WTV C;  1GVJ A;  1XSX A;  5E1W A;  4EQQ A;  1IXR C;  1ODD A;  4MQV A;  3F23 A;  2VC1 A;  2IT0 A;  4HYE A;  2JSC A;  2R3S A;  1KQ8 A;  1HW1 A;  5ICC A;  2ZNY A;  4A12 A;  1K79 A;  1KA8 A;  2DTR A;  1KGS A;  5FO5 A;  3TO6 A;  1U5T A;  2JTV A;  2CWE A;  2BV6 A;  2D45 A;  1K78 B;  1IXC A;  2P7C B;  4MNU A;  1EH8 A;  3FMR A;  4JBA A;  1HW2 A;  2UXN A;  1RZ4 A;  3DKW A;  2KIF A;  2W84 A;  4WXD A;  1F9N A;  1O3S A;  5K1Y A;  4U7D A;  3T0Y A;  1P4X A;  5DD8 A;  5LHG A;  2IRF G;  3W6J B;  1R36 A;  4HDU A;  4I09 A;  3SFZ A;  2QBY B;  1T6S A;  1R1U A;  3Q5F A;  2KIU A;  3ZP5 A;  1J7K A;  1KQ9 A;  2ELH A;  3ERE D;  3TDZ C;  5CVU A;  4KN7 X;  2F2E A;  5BOX A;  4RS8 A;  3C7J A;  3HSR A;  2KJC A;  4ENK A;  3F3X A;  4BHP A;  5DV5 A;  4NHJ A;  2UXX A;  4UVA A;  2OQR A;  1W7P D;  1CF7 A;  2HYG D;  1D8J A;  1ZRC A;  1YW8 A;  5E20 A;  3IRQ A;  4IHT A;  4G6D A;  4U7B A;  3SZP A;  5H20 A;  4Q4Z F;  2IVM A;  2VXZ A;  2DI3 A;  3K69 A;  3ML6 A;  4HF0 A;  4UXN A;  4IRG A;  4I02 A;  3RKX A;  3FXU A;  1QZZ A;  2F5C A;  3IL2 A;  3D5L A;  2M87 A;  2FNP A;  4I0A A;  1YFH A;  4KYW A;  3JSP A;  2HQN A;  3VB2 A;  3V7C A;  1SMT A;  1IW7 F;  3V8J A;  1JHF A;  2M30 A;  2MC3 A;  1ZLK A;  1BC7 C;  1R5G A;  2A6H F;  5DUI A;  1WWX A;  2XAJ A;  3F21 A;  2M8E A;  2V1D A;  1BI1 A;  3DEU A;  2XAG A;  1LVA A;  2OQG A;  5FFZ A;  4CDG A;  4BAY A;  2CFX A;  1ZAR A;  4IHS A;  5BQT A;  3CUQ C;  1QNT A;  1ON1 A;  1FYM A;  3H3U A;  4BXU A;  3ZMS A;  4ZYD A;  3L00 A;  5TJJ A;  3WGG A;  3KP3 A;  4B09 A;  1NHA A;  5D8K B;  2VE9 A;  1UHM A;  3RIR A;  1U2W A;  2HTS A;  3OOP A;  1J5Y A;  4FX0 A;  3I58 A;  5HDN A;  2FU4 A;  3WTX C;  4PZJ A;  2IW5 A;  3M1E A;  2EK5 A;  1XMA A;  4L9J A;  1LQ1 A;  4LG0 B;  3T8T A;  2YR2 A;  3RPU A;  1D5V A;  3N97 A;  3HYI A;  3KEO A;  2FEZ A;  2LKP A;  2P5K A;  2L02 A;  1ZG5 A;  4AVP A;  5D5X B;  5L3B A;  3HSF A;  5J8C A;  2FSW A;  4AIH A;  4QWQ A;  3GF2 A;  4O3M A;  2LNB A;  4ZYG A;  3J80 K;  5HS7 A;  4XSZ F;  5IT3 A;  1TNS A;  3L09 A;  5A2Q K;  2CG4 A;  2XUB A;  1HQC A;  4ETS A;  4IJA A;  5HS9 A;  4G9Y A;  1IN8 A;  3RDI A;  1SD5 A;  5K5R A;  4OIN F;  2QQ9 A;  3CUQ A;  5LEJ A;  2W85 A;  2ETH A;  2J5O A;  3FM3 A;  5JFR A;  5ICE A;  1BI0 A;  3WTW C;  1U8R A;  3GVA A;  3HHH A;  3IKT A;  1P92 A;  3WTZ A;  2PN6 A;  4MTD A;  5E1X A;  2ZXJ A;  1Z05 A;  1JXS A;  4L9V A;  2WTE A;  1OPC A; 
#chains in the Genus database with same CATH topology
 4O6J A;  2LKX A;  4DYC A;  5M5W J;  2DOE A;  2WAE A;  5IY5 H;  4E7H A;  2W00 A;  2QSF X;  3TOA A;  2IJL A;  2W25 A;  1GXP A;  1QA6 A;  3CP8 A;  2HQR A;  2B63 J;  2Z9O A;  4R79 A;  4BBS J;  2DYS H;  4A3F J;  5HDG A;  3FXJ A;  1R5I D;  4P9F A;  1CGP A;  3L2V A;  2VT2 A;  2CW7 A;  3DEW A;  3FHZ A;  3FKI J;  1MH3 A;  5HLH A;  2VC0 A;  3KZI C;  3CCQ I;  1WJE A;  3H1C A;  3Q3S A;  3QPS A;  4HPQ A;  2PMH A;  3BTL A;  1EH6 A;  1IN5 A;  2R7S A;  2RV8 A;  5B1A H;  4LLL A;  2ID3 A;  4KFC A;  4HF1 A;  1OR7 A;  2BZT A;  3KLO A;  2FQ4 A;  1J09 A;  2CO5 A;  4RGR A;  1A04 A;  2R7D A;  4P9U A;  2DFI A;  4XLA A;  2OC6 A;  2L0K A;  2ELK A;  4IZZ A;  3QPH A;  3JSO A;  3IHU A;  1Y1V J;  1EA3 A;  2GWR A;  5F64 A;  5HVQ C;  1I6X A;  1QO0 D;  2NOG A;  4AYB N;  2VQL A;  3BY6 A;  4UV9 A;  2LLK A;  3BTJ A;  1APL C;  1RR7 A;  2CW8 A;  4BUP A;  2PEX A;  1MKM A;  1FT9 A;  1P6R A;  5DEQ A;  2HEO A;  4RM2 A;  2EFW A;  3WG7 H;  3ABU A;  2MA3 A;  3LQR A;  1ZYR F;  2HXI A;  2DQL A;  3BTC A;  2ZSH B;  1G6N A;  3HRT A;  2QGU A;  1IUY A;  5CVR A;  3BTI A;  1W0U A;  2O03 A;  4BS9 A;  3JRI A;  2FRH A;  2BY3 A;  2JZY A;  5GAG J;  5C4X J;  2P0W A;  1JUM A;  4IHY A;  4Y33 A;  1V54 H;  1BN5 A;  3V7S A;  4UY8 I;  3R4K A;  1H9G A;  2A3S A;  4MQ9 F;  4M72 A;  3ABT A;  3MN2 A;  1P4W A;  2FA5 A;  2EA2 A;  2FOK A;  1Z6R A;  1FIP A;  2BBY A;  4XQF A;  2D1H A;  3A01 A;  2ZME C;  3EET A;  4HLX A;  4G12 A;  2IS4 A;  3CLO A;  4YG2 F;  2QA4 I;  2OF7 A;  3KPH A;  3LSM A;  2KRC A;  2XGE A;  4WF2 A;  3NRV A;  3JTG A;  1SVM A;  2QKM B;  5F1J A;  4YEJ A;  2O3F A;  5KAI C;  1IO2 A;  2YX7 A;  1PUE E;  2LF8 A;  3I4N J;  5LRS A;  1XB4 A;  4C2U A;  4ON0 A;  3HB9 A;  4PGH A;  3RTR A;  3K70 D;  4KDP A;  3HEF A;  1SFU A;  2LFB A;  3HKZ A;  2L7Z A;  1OYY A;  4RGX A;  4A3C J;  4RDU A;  5EEA A;  3EPZ A;  5GPC A;  1O4X A;  1FTT A;  1ONV A;  4QPQ A;  1L0O C;  2FMY A;  1REP C;  2CRG A;  2FQ3 A;  2GXB A;  3HTS B;  3D0S A;  2BHY A;  1F1Z A;  3RKW A;  3HL2 A;  1MBK A;  1DGW Y;  5JLW A;  1YHQ I;  1G3W A;  3GWZ A;  3SYT A;  5KHD A;  2VBZ A;  2K02 A;  1TWC J;  4HA8 A;  1I27 A;  1I3A A;  4M9Z A;  3NAR A;  4GFB A;  4JQF A;  3K4B A;  3OL3 A;  2N8G A;  3GFM A;  3V8K A;  5DUK A;  4YIF A;  1TTY A;  2X9D A;  2KKO A;  2R7F A;  1ZGW A;  2PMU A;  5HLI A;  2MLK A;  4B8X A;  3MFK A;  3JRH A;  4XKC A;  5IOZ A;  2EZK A;  4BE1 A;  2C6Y A;  2EV0 A;  4Y13 A;  2IS2 A;  3OYM A;  1GUU A;  2AXL A;  3ZMZ A;  2HGC A;  4GYI A;  1OYW A;  4FIS A;  3PQJ A;  1DPU A;  5L3G A;  2OUM A;  5IP7 J;  5CYV A;  5LGT A;  1NK3 P;  1SFX A;  3Q9S A;  3F8N A;  2QLZ A;  2G7H A;  2KQR A;  4E7L A;  2ADU A;  5L3E A;  2B9S A;  4M71 A;  2DT5 A;  4HST A;  1TQP A;  2ZJ2 A;  3FXM A;  1T8I A;  3CCV I;  2FXA A;  5ILS A;  5EG0 A;  1PVE A;  4CHU A;  3OOU A;  5F27 A;  4NUB A;  2VN2 A;  3F8B A;  1UHW A;  3S17 J;  1W5T A;  3R61 A;  4HX7 A;  5CKT A;  1KU7 A;  2E2H J;  3ZQC A;  3IC7 A;  3U21 A;  1E2X A;  2STT A;  3FK7 A;  4D7N A;  4J00 A;  2F5F A;  1FIA A;  1T98 A;  3E97 A;  4CIC A;  2LF7 A;  5JVG F;  1JJ8 C;  4LJZ F;  1GHC A;  2VJ5 A;  3FZV A;  4S04 A;  1STZ A;  5GP9 A;  1XGS A;  1RR8 C;  3RI4 A;  2OU2 A;  4UUS A;  4P55 A;  4A3I J;  3OL4 A;  2IA2 A;  3EDP A;  4HW0 A;  4EJT A;  4C3J J;  2PG4 A;  2VKE A;  3B02 A;  3GEZ A;  1VQ6 I;  3CCL I;  2PBI A;  1KYZ A;  2OTJ I;  1P4A A;  2O7O A;  3CC2 I;  4PFO A;  1UAA A;  1HBX G;  1IRG A;  3G2B A;  2F5E A;  2NNY A;  2M4G A;  4M9X A;  1PP8 F;  1A31 A;  4IOC F;  3CC7 I;  4N4O B;  1GT0 C;  4BQN A;  3RPU D;  1KZH A;  2R92 J;  4WX9 A;  2MGQ A;  4Y52 J;  1X2N A;  3VPR A;  3HBL A;  4HBL A;  2I8D A;  1BW6 A;  1AKH A;  3BG3 A;  3FBI B;  4PGG A;  1YW9 A;  3A03 A;  3S14 J;  1MJA A;  2JWT A;  3OYH A;  1VQO I;  4Q47 A;  1MBJ A;  4N9H A;  4ZYH A;  4RB0 A;  2PLY A;  2L9V A;  1MSE C;  1EJ9 A;  4EVI A;  2DMT A;  2EWN A;  4I98 B;  1WI9 A;  2CU7 A;  1ITY A;  1RNL A;  3BWG A;  5FLV A;  4PJ0 C;  1VQ8 I;  3AL0 B;  1B72 B;  3FBN B;  1JGG A;  2ZXW H;  2CFO A;  2DPU A;  1SFK A;  1KON A;  4RA2 A;  3WG9 A;  2VJ4 A;  3BCB A;  1KU2 A;  3HPG A;  1UB9 A;  1SAU A;  4M74 A;  1Q1H A;  3PIO F;  4FTH A;  2PJR A;  1TQI A;  2DOA A;  1LFP A;  3BRO A;  3CTA A;  3VSL A;  5FD5 A;  4RB3 C;  3I54 A;  1DUX C;  4A2U A;  1I1G A;  2LR8 A;  4XOR A;  4C2T A;  4BEH B;  2H09 A;  4D9J A;  2FF4 A;  3MD2 A;  4G94 A;  2LSO A;  1QPM A;  3Q9V A;  3M8F A;  2O0Y A;  3D5S C;  3CCR I;  1HOM A;  4GXO A;  3A02 A;  1ZQ3 P;  1R1V A;  4E7S A;  4CCK A;  5HDK A;  1AA7 A;  3E6M A;  3HUG A;  4PJM A;  4DZP A;  2A6E F;  1FMV A;  2QQB A;  4DW6 A;  3HGY A;  4AYB A;  2E1M C;  2HS5 A;  1YRN B;  3JRB A;  3L9F A;  2L7K A;  3RQI A;  2K9S A;  3D1N I;  2LDU A;  3C18 A;  4DIQ A;  3LSJ A;  1U9O A;  2FBH A;  3ISP A;  5FRO A;  4J01 A;  3BP8 A;  3KEQ A;  1W5S A;  4EM0 B;  2DCE A;  1BR4 A;  5LD2 C;  2WAQ N;  1BIB A;  1FYL A;  4LD5 A;  5CVJ A;  3OYF A;  4U87 A;  4HNV A;  4A3J J;  3FDY A;  3N05 A;  2M45 A;  1FYK A;  4IL6 C;  3PO2 J;  3CQZ J;  2O8K A;  3KP2 A;  1X19 A;  1TBX A;  1K6O A;  1XC5 A;  1HC8 A;  4YIR X;  1YIJ I;  1XDS A;  2NXN B;  2BW3 A;  4E7J A;  3MZ8 A;  2H8W A;  2L7M P;  2YS9 A;  3I5U A;  2CV0 A;  4LOC A;  1RI7 A;  5ICF A;  3G1M A;  4BH9 A;  3GTQ J;  2QQ8 A;  1G4D A;  3K9T A;  3I55 I;  5IT9 Z;  1FJL A;  4DBQ A;  2LVS A;  3DKY A;  2BHZ A;  1L3L A;  3RYP A;  3E6B A;  5EGO A;  1ETV A;  2ZNZ A;  3S1Q J;  2DFH A;  2VLA A;  1AHD P;  4IQJ A;  3S16 J;  4RB1 A;  1BL0 A;  2HDW A;  2L9R A;  2XSD C;  5ERI A;  1GV2 A;  5EZH A;  5LGU A;  1VQ4 I;  2RN7 A;  2PFB A;  4M3B A;  3WU2 C;  4Y17 A;  3E5U A;  4NQW B;  2X6X A;  4B3X A;  1U0J A;  2CSO A;  3M8J A;  2HYF A;  1Z6T A;  3EYY A;  3ZQF A;  4V19 K;  2I10 A;  2OCC H;  2P6T A;  2W24 A;  3ZMD A;  2KZV A;  2BEO A;  2WV1 A;  2BOL A;  2QSG X;  3WHC A;  2HU9 A;  2K9M A;  3G1O A;  2CMP A;  1F5T A;  2WB1 A;  4II2 A;  4M3F A;  3I53 A;  3LSR A;  2DPD A;  4S0H B;  2W48 A;  2FJ1 A;  1IDY A;  1BI2 A;  2GOX B;  4XBF A;  4C9Y A;  2FML A;  2CGP A;  1BOA A;  3PNY A;  1KQ0 A;  4XN0 A;  2Y9Y A;  3K4L A;  4F55 A;  1NK2 P;  5DTD A;  2ZFW A;  5BPI A;  3V8L A;  1FBQ A;  1R4N B;  3FX3 A;  5EZG A;  2CW0 F;  1HDD C;  1YS6 A;  2XAQ A;  3BC8 A;  3B6C A;  4BQA A;  1TT0 A;  4KJZ A;  3ZN0 A;  1MNM C;  1MJ9 A;  3CJT B;  2EBI A;  1YE9 A;  3DPU A;  1JT0 A;  3GFI A;  1D0X A;  1BBY A;  2W7N A;  3VWB A;  2RNG A;  2CH0 A;  2FUG 2;  1YIO A;  3WE2 A;  1DDN A;  2K86 A;  3KZZ A;  1SFO J;  2JA5 J;  3OYG A;  4B47 A;  2QF7 A;  3W2W A;  4WK8 F;  2XDV A;  2K9L A;  1D1A A;  3J81 Z;  5ILU A;  3G6E I;  2BVM A;  1B6A A;  1DGR M;  2IXS A;  3JR9 A;  2HWV A;  4BHC A;  4J19 A;  5CQE A;  2K4J A;  2DA5 A;  4IF4 A;  4HEA 2;  1MD0 A;  4HV5 A;  2GM4 A;  2M0C A;  4RGU A;  4XLF A;  1P7I A;  3F8F A;  2HDC A;  3S32 A;  4C30 A;  3PIP F;  4GYG A;  2VQC A;  2ZC2 A;  1WQ2 A;  1YO5 C;  1W36 D;  3I4M J;  1B1B A;  2IA0 A;  3PJR A;  2HPI A;  2CQX A;  4L9N A;  3MKL A;  4KIF A;  3A2K A;  4G6Q A;  2VAS A;  1N25 A;  3K4J A;  1U5T B;  4DZJ A;  3P9I A;  3QWL A;  3DFG A;  5K7F A;  2V79 A;  3KX2 A;  4CCO A;  1JT6 A;  1ZEL A;  4FE4 A;  4XK4 A;  1XCV A;  2KFD A;  3M7G A;  3NEU A;  2UZK A;  4H0E A;  2VOO A;  2YX4 A;  3ZPL A;  3TGN A;  2HR3 A;  1R71 A;  2KDO A;  4PDK A;  2KIS A;  4I6Z A;  2R5Y A;  4UVB A;  5K5O A;  1W4M A;  2WC2 A;  2H8R A;  1R7J A;  1LFB A;  4M73 A;  3ZCO A;  2QVO A;  2V9V A;  2DMN A;  3HOU J;  3GX4 X;  2LG4 A;  3JTH A;  1UHS A;  2DFE A;  2TRT A;  3KYL A;  2HOS A;  3WGI A;  1IRX A;  1ULY A;  3F22 A;  4WXC A;  5FRN A;  1ETY A;  3ESW B;  3KP5 A;  2A07 F;  3HRM A;  4M6X A;  3ZMV A;  1SAX A;  3JRA A;  3ZQH A;  4CO8 A;  3ZXS A;  5FD6 A;  3DU6 A;  5JHF A;  4XNF A;  1Z77 A;  3I9V 2;  2EJR A;  1VQ7 I;  4B4C A;  1D1C A;  2LTP A;  1WSU A;  2L3D A;  2VKV A;  2Y0S A;  3LWF A;  2DW4 A;  2DT6 A;  2R7Z J;  1LFU P;  1XTA A;  4HX4 A;  3BR2 A;  2QYO A;  2V1X A;  4IOA F;  1H0M A;  4X1E A;  4LGW A;  2FBI A;  1F4K A;  3CUO A;  1QGP A;  3DBL B;  3CMA I;  2A05 A;  3SXY A;  4KT5 C;  4EM2 A;  2A6T A;  2GBY A;  2Z16 A;  3S2H J;  2DO7 A;  2XAS A;  2Y2Z A;  1YYV A;  2RC4 A;  2IEK A;  4NC8 A;  4DNC A;  3Q0U A;  2RVC A;  2DK5 A;  2IP2 A;  1HKS A;  2JA7 J;  3CCE I;  3CD6 I;  3R60 A;  4MFE A;  1MDM A;  1ZAO A;  2JK3 A;  3G73 A;  5TRD A;  5ICG A;  1LE8 B;  3WTS C;  4IO9 F;  2VI6 A;  3RSN A;  1E3P A;  3TOB A;  3ZMU A;  2XPU A;  1LB2 A;  3CZ6 A;  1U9N A;  2R7Q A;  1YJN I;  1AU7 A;  1CF7 B;  2VQH A;  4A3G J;  4HRI A;  1NG7 A;  2NVX J;  2XGX A;  2Y30 A;  3WU1 B;  3BR0 A;  3BQZ A;  3M9A A;  4K2E A;  2QM3 A;  5FB2 A;  4CYC A;  3OY9 A;  1ERD A;  1FOW A;  2EIK H;  2EZH A;  3A0B C;  5F0H A;  3OYC A;  2NS0 A;  1IN7 A;  5BNG A;  1V4R A;  4YEL A;  3IV5 A;  1BIA A;  3KP4 A;  3RKY A;  2A69 F;  2GOM A;  3DV8 A;  3G4S I;  2P5L C;  5L3C A;  2P8T A;  3QU6 A;  3CO7 C;  2L54 A;  3GFL A;  3IWZ A;  3BOQ A;  3FXQ A;  3F72 A;  4A5N A;  3J7A O;  3VEP A;  3J81 K;  5J8F A;  2CS3 A;  1MMS A;  3K1M A;  3H36 A;  2CYY A;  1G8X A;  3J7Z I;  1OCZ H;  3S1R J;  1QBJ A;  3JAM Z;  3CO6 C;  2FOW A;  2COB A;  1BC8 C;  2Y75 A;  3O8G A;  1B9M A;  1YOV B;  2I5U A;  2Z33 A;  2ZO4 A;  1Z3X A;  3M3Y J;  4ESB A;  1IRZ A;  2O5R A;  1S8N A;  4RBO A;  2EIJ H;  4F93 B;  4PK4 A;  4RAY A;  1D8K A;  2O61 A;  1R1T A;  1R6R A;  2E71 A;  1PDN C;  5ED4 A;  2PI0 A;  4L18 B;  3FK6 A;  3K1N A;  5KVR A;  4KNY A;  5F08 A;  2BGC A;  2GXG A;  4M6V A;  4B44 A;  2XGC A;  2KRH A;  2OTL I;  3DPL C;  2GXA A;  3QYE A;  2DFF A;  2HZT A;  3E0J B;  5LHI A;  2ZBK A;  2HOE A;  4IRH A;  3JRG A;  2VOP A;  1FY7 A;  5H6Q A;  4AUX A;  1U78 A;  2AO9 A;  3PL8 A;  3QPT A;  4UV8 A;  4D5F A;  3FHN A;  4HOB A;  2DOD A;  3QAH A;  1MZB A;  1IC8 A;  3JRC A;  1ORK A;  3W6V A;  4A6D A;  2NNN A;  4WXH A;  3LSG A;  3KLN A;  3SDB A;  3VYT B;  4BHB A;  1I1S A;  3K4C A;  3GW2 A;  4MLO A;  3D5R C;  4CGZ A;  3U1D A;  1WJA A;  1FP1 D;  2M5W A;  2ZJR F;  3KFW X;  2ZB9 A;  3VFZ A;  3I59 A;  1MBH A;  5DCM A;  4O5V A;  2E1C A;  1O7F A;  2MYS A;  2Y0M A;  3CCU I;  4D1Q A;  1JJ6 C;  3DXJ F;  1ZTR A;  3FMS A;  5L3F A;  3HGG A;  2DMP A;  3RZO J;  1QHG A;  2V26 A;  3DP7 A;  3I71 A;  3S2D J;  3QPL A;  5IP6 A;  1B4A A;  1P2F A;  3GFJ A;  1T39 A;  1I6H J;  1RPW A;  5E8G A;  1JTX A;  1PUF B;  2Y69 H;  2HNH A;  3CCM I;  1BI3 A;  1TW3 A;  4AD9 A;  5HLG A;  2E35 A;  2JT1 A;  2CV2 A;  1NTC A;  2F5D A;  5D8L B;  3EUH C;  2IGN A;  4WCG A;  1RES A;  2KJB A;  2PJP A;  2EIM H;  2GA2 A;  3T5X A;  3M1C A;  3CCS I;  1PP7 U;  2NVY J;  3GBG A;  1RRJ A;  1YLF A;  2OBP A;  3U9G A;  3C2H A;  4OU0 A;  2BYV E;  2R0Q C;  1W7P A;  2VBW A;  2JVG A;  1XGN A;  5K7H A;  2STW A;  4D0P A;  2LRD A;  2O9L A;  1X58 A;  1MMD A;  4U0Y A;  1HW5 A;  4XLN F;  1Y0U A;  3CJQ B;  3IUO A;  3MKZ A;  3CCJ I;  1Y8R B;  3F6O A;  3R0A A;  1XDU A;  1QHH D;  2OZU A;  1SD7 A;  4MO7 A;  1OLT A;  1TWA J;  2DA7 A;  4GCV A;  5DDG A;  5D5V B;  3S3N A;  1ACI A;  2R5Z A;  1R22 A;  2F4O B;  1VFC A;  2DJI A;  4NBQ A;  4E70 A;  1G59 A;  5D4R A;  2J5P A;  2GIV A;  1D1B A;  1UZC A;  1VTN C;  1JE8 A;  5FGM A;  2DA3 A;  4NDL A;  3KZY A;  1HDP A;  5JHU A;  3X2Q H;  2P81 A;  4AWX B;  3E6D A;  1VQN I;  3TMO A;  4ASN A;  4RB2 C;  1HXD A;  3S2W A;  3FWE A;  3TP3 A;  3OR1 C;  3ZQQ A;  2JN6 A;  2LMD A;  4GO1 A;  1YTY A;  2HKO A;  2ZKZ A;  2D1V A;  3PUF A;  1SAN A;  4BXF A;  1T38 A;  3GLX A;  2ISZ A;  4BU2 A;  2FE3 A;  1WVR A;  2PMZ A;  2HDD A;  4A3B J;  4BE0 A;  2EZI A;  2ECC A;  4IHW A;  3F6V A;  1USS A;  3TL4 X;  3CDH A;  4E4H A;  1K4S A;  3VSK A;  1GDT A;  3ZGK A;  4XOT A;  2JA8 J;  3CUQ B;  1S9H A;  4MFD A;  1ETK A;  1FOK A;  1TC3 C;  4BY1 J;  2VXD A;  3S1N J;  1FC3 A;  1J9I A;  2MAB A;  4KA4 A;  2VQG A;  4XSX F;  5E18 F;  4XIC A;  4AVZ A;  2G9W A;  3GZ6 A;  4UUV A;  4A3L J;  4QIW N;  2V1U A;  1RET A;  1A36 A;  2EB7 A;  4IHV A;  4DOZ A;  3OS1 A;  1XG1 A;  3DU5 A;  2R7W A;  3J7A Y;  2P5V A;  1Y39 A;  1K78 A;  2QCO A;  4AIK A;  2MC4 A;  3O3K A;  1R4M B;  3U2R A;  3ZR8 X;  3RYR A;  2RNJ A;  3EUH A;  2QSH X;  1B9N A;  1YJW I;  4IQ4 A;  4DJA A;  2JVH A;  3IRR A;  2VKH A;  3FF5 A;  3F8C A;  1G2H A;  1HST A;  3E6C C;  1XSV A;  1ZRD A;  2DT7 B;  2GIZ A;  3M8E A;  5CVI A;  1S5L C;  1T95 A;  4N9I A;  3RQ4 A;  4B1R A;  1IN4 A;  1HA8 A;  1E3H A;  1ZN2 A;  5GPA A;  4B3A A;  3KP6 A;  1VQ9 I;  1F36 A;  3B73 A;  3P9K A;  4HV6 A;  3VOD A;  1JGS A;  2F48 A;  2DJN A;  2FX0 A;  3L7W A;  3KP7 A;  1MJB A;  5ILV A;  4LB5 A;  3L1P A;  4Y7N J;  4G6T B;  2NAZ A;  3BZK A;  4IHX A;  2ICW G;  3ZQI A;  2F4I A;  2P6S A;  2QBY A;  1QVU A;  4W1U A;  5FLX Z;  4PJJ A;  2RDP A;  3Q0W A;  1DP7 P;  2VPL A;  2JRM A;  3K4K A;  5LRR A;  2ZME A;  3MVP A;  4DBR A;  2QWW A;  3MMY B;  2XV4 S;  2EIL H;  3PNV A;  3G1L A;  4L5J A;  3HXL A;  3W3C A;  3V7R A;  3K0L A;  4EJU A;  5DCM B;  2LRE A;  3R0J A;  4XLP F;  3MEX A;  4UB6 C;  3O6B B;  1YQA A;  3LL7 A;  2OD5 A;  1U6G A;  1HKT A;  2DOF A;  2EV5 A;  1BJA A;  4MEX F;  4OAZ A;  3U1K A;  4DQ2 A;  3EUA A;  3W2V A;  3MZH A;  5J1R A;  2ZJQ F;  2EQR A;  2O8X A;  2DA1 A;  1JKR C;  2M7B A;  2M2E A;  4Y4R A;  2LBF A;  1J75 A;  2VJJ A;  2BVL A;  2Z99 A;  1FP2 A;  2ISY A;  4XRS G;  4C3H J;  3H92 A;  3RPQ A;  2GQQ A;  5EYR A;  5AIP A;  5J6X A;  2KPM A;  3K7A J;  1SVL A;  1B8I A;  2R7O A;  3OWT A;  3QYF A;  1AWC A;  1BR1 A;  3CMY A;  4EV0 A;  3DKX A;  4YFK F;  3TW7 A;  1TW2 A;  3S93 A;  5DM6 F;  1MBG A;  1Y6I A;  2AQF A;  1XSD A;  5KNL A;  3IKV A;  2RAE A;  1KU9 A;  5DS9 A;  2V4J C;  3BJA A;  4M6Y A;  2Z3Y A;  3TBI A;  1W0T A;  2XKO A;  4RAF A;  3VYU B;  1WH7 A;  2V6C A;  1BM9 A;  1Z67 A;  3FXL A;  4YRV A;  1WJF A;  1X2M A;  2ECB A;  1QZY A;  5HOO A;  3LA7 A;  5CQG A;  3A01 B;  3DBR B;  2Q2E A;  2WY7 Q;  3MKW B;  4CCM A;  4UVC A;  3GCM A;  3GME A;  2QUF A;  2CQK A;  4MIM A;  3LSI A;  2D2W A;  4RAZ A;  4R8H A;  4KUM A;  3BDD A;  1XGO A;  3ZRG A;  3HZJ A;  2HPM A;  5LBQ A;  1BOB A;  2EV6 A;  4EGY A;  5D6F A;  4EJO A;  3CJN A;  1SC7 A;  1NG6 A;  4HSR A;  3MZY A;  4ENJ A;  3HIF A;  1MGT A;  3E5X A;  5E79 C;  5HLT A;  3H5R A;  1B59 A;  4XRM A;  1RIO H;  3RKQ A;  1SVO A;  5IYC J;  3OIP A;  2ZFU A;  4A3D J;  1FZP B;  2KRF A;  2Y48 A;  4HG2 A;  3OYD A;  1Z7U A;  4A3E J;  4AIJ A;  4A3M J;  4LK1 F;  4F91 B;  4ESF A;  1IV8 A;  3SJM A;  3HTU A;  5DYM A;  2TDX A;  4FT8 A;  2COM A;  2E1O A;  2E5Z A;  4ZTJ A;  5IPA A;  3SQN A;  1K4T A;  1S3J A;  4KIT B;  1MH4 A;  1D0Z A;  1I39 A;  2FBK A;  2NVU B;  5J1Y A;  1EKE A;  4Q48 A;  3BPX A;  1H8A C;  4IPA A;  3R6S A;  3HHG A;  4LLG F;  3E5Q A;  2YSR A;  2CQ7 A;  1YI2 I;  3OV8 A;  2CUZ A;  4CH7 A;  1FBS A;  4OMZ A;  2XF6 A;  2OV7 A;  2XHK A;  1ENH A;  4KMU X;  5FLX K;  1Y8Q B;  4IXA A;  5J4V A;  3GYH X;  2BE5 F;  1LNW A;  1K83 J;  3K2Z A;  2E2I J;  1FX7 A;  1OCR H;  5AON A;  2DN0 A;  4ZZL A;  2M9H A;  2A5W A;  3DLA A;  2P4W A;  3QU3 A;  1A6Q A;  3QOP A;  4JK1 X;  2XB0 X;  4OOI A;  1ZG3 A;  2HFH A;  2K85 A;  2XRN A;  3O8H A;  5FKO A;  3RJP A;  3AKZ A;  4LB6 B;  3H3V K;  3SEZ A;  2HVQ A;  3F0C A;  1YG2 A;  5B3S H;  4EAT A;  3OYA A;  1ZRF A;  1TQM A;  2NYX A;  3GZN B;  5HNH A;  1A5J A;  2IS6 A;  3E7L A;  2JUG A;  3LSK A;  5EG0 B;  1YJ9 I;  3SFI A;  1UST A;  4XKB A;  3TO9 A;  4FCY A;  2RGV A;  3S15 J;  3QQA A;  1XS9 A;  2E34 A;  2L7F P;  3BJO A;  4BDY A;  1POG A;  2CUJ A;  4UHT A;  3GZ5 A;  4LG0 A;  4ZTF A;  4KIG A;  2ZME B;  3OR2 C;  1GXQ A;  1YS7 A;  1P9Q C;  2K5C A;  1HF0 A;  1D0Y A;  4CZC A;  4Q5S F;  1BW5 A;  3ZN1 A;  4E6K G;  2JA6 J;  4JX5 A;  2EPF A;  4UUS B;  2DA2 A;  3K4N A;  4A6E A;  3I56 I;  3DTK A;  1Z3Y A;  3MAJ A;  2P7V B;  1SD6 A;  4AID A;  2XB5 A;  2JPB A;  3OSG A;  1Y1W J;  3GTG J;  4L0Z B;  3HPH A;  5FJ8 J;  2L5Q A;  4HQM A;  1JUP A;  5LLQ A;  1O3R A;  2LKS A;  3GO5 A;  1R49 A;  1G3T A;  2AS5 F;  1J0R A;  2NVQ J;  4MEY F;  4A93 J;  3W6K B;  4M3G A;  3C1D A;  3GTL J;  3TKY A;  1LDK B;  4RAG A;  4A5M A;  4ANJ A;  3JRD A;  1ZRE A;  4RGS A;  3BPV A;  1VQM I;  3EYI A;  4R1H A;  1OMI A;  1QQI A;  1JTY A;  4JX6 A;  3UKG A;  1IGN A;  2QKL B;  2NVT J;  1ZG1 A;  2WV0 A;  2JA2 A;  2E1N A;  2MBF A;  2VUM J;  3ECO A;  5IOY A;  2VE8 A;  5F6F A;  1XX5 A;  4CUG A;  3OSF A;  2X1C A;  1NH3 A;  4LIV A;  4EJV A;  4GRI A;  1WJ5 A;  3JW4 A;  1ZKG A;  3MWM A;  5B66 C;  4EGZ A;  2QQA A;  1SEU A;  1WGX A;  1AKH B;  4I99 C;  1RKW A;  3FMQ A;  3W2A A;  1QRY A;  2A5Y B;  4EMS A;  3J80 Z;  2WY8 Q;  2OA4 A;  4EEF G;  3HOT A;  4ZZD A;  1LDJ A;  3BZ6 A;  4CCL A;  3GTK J;  1W1W E;  5JR3 A;  4KIC A;  3I0T A;  1EH7 A;  3WTY C;  1ZGJ A;  1WPK A;  1TWH J;  5E3N A;  2DQR A;  2JRT A;  3H0G J;  1JKO C;  2GLO A;  3PSI A;  3WTT C;  3ZMT A;  3IH4 A;  2A61 A;  3NAU A;  5A2Q Z;  1O57 A;  3N4M A;  2MFZ A;  1FOX A;  1EF4 A;  2X6Y A;  5LEK A;  1WKM A;  3BG6 A;  3L2R A;  2PJR B;  4HNU A;  5H2F C;  5B1B H;  1R23 A;  4G7H F;  4N0B A;  1A35 A;  3GXO A;  1FPQ A;  4MHG A;  3CME I;  4F7Z A;  5BMZ A;  2EFQ A;  3LSH A;  4MGR A;  3CJR B;  1FNN A;  4YFX F;  1X1B A;  3E3V A;  1XMK A;  1J59 A;  1FSE A;  2HI3 A;  1LDD A;  4U0W A;  4A69 C;  2EFP A;  2BY1 A;  3DF8 A;  4E7I A;  3L2C A;  1LVK A;  2NOJ B;  1XD7 A;  2L4M A;  3PFI A;  1U3E M;  4DYR A;  3JCU C;  3ONQ A;  3PQK A;  1MMA A;  1DU0 A;  4OIO F;  4UNO A;  2XRO A;  2HKX A;  3OYJ A;  2K4B A;  2JQ7 A;  3HUG B;  4FET A;  1IN6 A;  2XSJ C;  5D5U B;  3K1P A;  1TWG J;  1X1D A;  3CP2 A;  3CDL A;  2GA1 A;  3COA C;  3MCZ A;  1E3O C;  3KYC B;  5AIQ A;  4BAC A;  2M3A A;  5GTI C;  4U88 A;  2KZG A;  2LD5 A;  3CLQ A;  2RKH A;  2DLL A;  2VB6 A;  5C4J J;  2ESN A;  3DEE A;  5JLX A;  3TQN A;  5JVT A;  4TV7 A;  5IT9 K;  3DQV C;  1S7O A;  3B6A A;  3WU0 A;  3HOX J;  1LJ9 A;  4CZZ A;  2XGD A;  5DM7 F;  4XLE A;  1P7J A;  2X4H A;  3G3Z A;  1S29 A;  5IYB J;  2JPC A;  3QOD A;  1OCC H;  2WA0 A;  2IA1 A;  4NNJ A;  1U8B A;  1TT5 B;  5E8I A;  1JHH A;  1PYV A;  4LFU A;  5M3F J;  3LFK A;  2G7U A;  2LP0 A;  1H9T A;  3HRS A;  4B48 A;  4YFN F;  1X4P A;  1V55 H;  1IRF A;  3KE2 A;  4ABZ A;  4BJ6 C;  2BW3 B;  3DPT A;  3LA3 A;  5E17 F;  3H3Z A;  3LQQ A;  5DCF A;  3OS2 A;  2L01 A;  4Z2Y A;  4HZF A;  2L9S A;  1S7E A;  3HM5 A;  3V4G A;  4M3E A;  4HLY A;  2IPQ X;  1X1P A;  3BJ6 A;  5CLS A;  1G3Y A;  2RRE A;  4H4K C;  4PSW A;  4IEJ A;  1S7A A;  3I4P A;  2WWY A;  2K9N A;  4XL9 A;  5D5W B;  2VON A;  1TLH B;  3LA2 A;  2QZ8 A;  5D4S A;  5EGO B;  3MQ0 A;  1O3T A;  4BNC A;  3FM5 A;  4FQG A;  4CXF A;  4BDZ A;  2XIG A;  3MKY B;  2QEX I;  1HKQ A;  6PAX A;  1WHU A;  2X51 A;  2H94 A;  1RUN A;  2DXI A;  1UG0 A;  4V2G A;  3IH2 A;  3HOS A;  1SD4 A;  3REO A;  2Z5U A;  1TWF J;  5M5Y J;  4IVN A;  2NS8 A;  2GZW A;  3NQO A;  2X48 A;  2L4A A;  1Z0X A;  3ABK H;  3PSF A;  4UB8 C;  5CVV A;  2W82 A;  4LK0 F;  3I64 A;  2E7X A;  2X6W A;  3SHF A;  5KAF C;  2IAI A;  1N77 A;  2M4K A;  4JP0 A;  2M0M A;  2XVC A;  4Y3O A;  1ZR2 A;  2JUC A;  4PUS A;  4ZYE A;  1A6I A;  4FHT A;  3BG7 A;  1ZGA A;  3SZG A;  2X1D A;  3ZOB A;  2WAD A;  4BYY A;  2DYR H;  2XPV A;  2ZCW A;  5BS6 A;  4YII A;  1LEB A;  4XN3 A;  4BL0 B;  2JMW A;  1FLI A;  4I2O A;  2DAO A;  1VZ0 A;  1R9T J;  1TNT A;  1Z1D A;  1T08 B;  1BA5 A;  1GLN A;  4P5O A;  3LAJ A;  3IH3 A;  4XOP A;  2E1M B;  2YU3 A;  4UUT A;  1SMY F;  1G3S A;  1V5F A;  3BLY A;  1I5Z A;  3T8R A;  4HQE A;  1H88 C;  1OIS A;  4OIQ F;  5IP9 J;  3M07 A;  2ESH A;  1W5C C;  1PJR A;  4II3 A;  3WGH A;  2OCE A;  4PFP A;  2E7W A;  1Z21 A;  2WAQ A;  1N78 A;  1ZHF A;  4E7K A;  2UV1 A;  4I7H A;  3BQY A;  2X6O A;  4ENM A;  1KU3 A;  3GTJ J;  4S05 A;  1BR2 A;  1VI0 A;  2HQA A;  2H6C A;  3FIW A;  3KYD B;  3P7N A;  4WWC A;  4DGW B;  1FWZ A;  3AL0 C;  2A68 F;  4E7Z A;  4FX4 A;  1MMN A;  2B0L A;  1YW7 A;  4G7O F;  2VBX A;  3KCC A;  3PUB A;  4QSH A;  1R5H A;  5EJC A;  5FKN A;  1SFE A;  3LAP A;  3O2P E;  2EZL A;  4OMY A;  2KLO A;  1O3Q A;  2K7L A;  3OYE A;  3ELK A;  2KL4 A;  5TIS C;  4LLN A;  3H5A A;  3QP6 A;  4G8X A;  3ASO H;  3SZT A;  2K9Q A;  5E3O A;  2K27 A;  5HOD A;  2VT3 A;  1MND A;  3IAM 2;  2EFO A;  1R00 A;  2HOT A;  3IWF A;  4M9S A;  3TO7 A;  3DLL F;  2VL8 A;  1VQK I;  4JOM A;  3OIQ A;  4L0Y B;  2R5Y B;  2XKP A;  1ZH5 A;  2KIM A;  5K5Q A;  3HOZ J;  1T2K A;  1WJB A;  4D5C A;  1W36 C;  3HSE A;  1FMW A;  1UJ8 A;  1GVD A;  4AC0 A;  2UWM A;  5K7Z A;  2LYC A;  3WE3 A;  5LHH A;  2EH3 A;  3BCA A;  4P96 A;  3H0D A;  5EEH A;  3HOW J;  2HVR A;  2O6G E;  1WI3 A;  4C2M J;  1R58 A;  1XGM A;  3AAF A;  5KK1 A;  3WOD F;  3HOV J;  3C2B A;  4G7Z F;  2E19 A;  1Z9C A;  2ACJ A;  5F1R A;  3WTU C;  5TGT A;  2XAF A;  4FE7 A;  1V5E A;  5M5X J;  1JKQ C;  4IRI A;  4L9T A;  2QEN A;  3CC4 I;  1X3Z B;  5J1U A;  5FFX A;  3IP4 B;  3RCO A;  4XRS A;  2LH9 A;  1HCR A;  4HF2 A;  3K2A A;  3FXR A;  3BG9 A;  1RKT A;  4ZH4 F;  1ETO A;  1LUJ B;  2CQN A;  3VOE A;  2M7A A;  4BJT A;  4ZDO A;  4BJ5 C;  1X3U A;  4HDV A;  2Q8K A;  5C3E J;  3UR3 C;  4A0X A;  1IF1 A;  2HYJ A;  5IYD J;  1EV7 A;  1J2X A;  4RMN A;  3J7Y J;  1AOY A;  2L9N A;  2Y9Z A;  4NC6 A;  5H6R A;  4IX7 A;  2OZ6 A;  2H27 A;  1KYW A;  2XF5 A;  1MDM B;  2B7E A;  2HTJ A;  5JI6 A;  2AHQ A;  4BKX A;  2Z1D A;  2MD5 A;  1FSH A;  2PQ8 A;  4CA0 A;  3LOC A;  2EFN A;  4XKV A;  5FKK A;  1XCB A;  3PFY A;  2KHM A;  1UFM A;  3QOE A;  2OPT A;  2TCT A;  3JAM K;  1FBU A;  5EF6 A;  1HLV A;  3C3W A;  3ECH A;  2IGO A;  3VYS B;  1B72 A;  1QZE A;  2BY2 A;  4CYC B;  1K7A A;  2X85 A;  5F0F A;  2R7T A;  3NWT A;  2DK8 A;  4EM1 A;  1E17 A;  5CJ9 A;  3ABL H;  2BXZ A;  1V3F A;  1T0F C;  4Z6Y A;  3KET A;  3KEY A;  3CCY A;  3VDX A;  5J47 A;  4HAM A;  1X1A A;  5EEG A;  2M1B A;  5DD4 A;  4BEH A;  2DU9 A;  2W57 A;  3JRE A;  2WB1 N;  2OAZ A;  1ZK8 A;  1RC9 A;  2PX9 A;  4OIR F;  1MNE A;  3LMM A;  1OJL A;  2CQQ A;  4FAS D;  2ME6 A;  4A0Y A;  2W1O A;  3DCF A;  4ZYA A;  3HDD A;  4ZJZ A;  3EUK L;  3GLL A;  3ULQ B;  2E2J J;  2CV1 A;  2CJJ A;  1O7L A;  1LEA A;  3EQL F;  4D7M A;  5HNF A;  1ZR4 A;  1WFX A;  5C44 J;  1S6L A;  2X0L A;  4KN4 X;  4A3K J;  1OFC X;  3F9K A;  2DBB A;  4CYD A;  3SDG A;  4OIP F;  4LG3 A;  2MH2 A;  4PJN A;  1YRN A;  2HOA A;  5J3L A;  1XN7 A;  3OIO A;  3BR1 A;  4GGG A;  3QP5 A;  2XAH A;  3FXO A;  1WH5 A;  3S3M A;  2WBM A;  1DPR A;  3GUD A;  3F8M A;  2R7X A;  2KMU A;  4L5I A;  3OYN A;  2Q0O A;  3HRU A;  3CDI A;  1Z91 A;  5E1Z B;  2UUZ A;  1Z7L A;  2RQP A;  1OCP A;  3FXK A;  4ENN A;  2YPR A;  1UG2 A;  2Y31 A;  1N75 A;  1WRJ A;  3A0H C;  3S3O A;  1X1C A;  4U0V A;  4X6A J;  1IV6 A;  3I59 B;  4KMF A;  1HSJ A;  3BG5 A;  4I76 A;  3BR5 A;  4CCN A;  2FNA A;  5HS8 A;  3PO3 J;  4PCQ A;  2MLG A;  3AFH A;  1U5T C;  1ZLJ A;  5LFA A;  2VBY A;  4A0Z A;  4BY7 J;  1UCR A;  1IUF A;  3H9G A;  1OKR A;  2VPR A;  2LY2 A;  2RQQ A;  9ANT A;  1LKX A;  2MH9 A;  3QRF F;  1IXS B;  1WZ2 A;  2ZXH A;  4W97 A;  1D3Y A;  1RUO A;  4NQW A;  1MBE A;  5LGN A;  1T0F A;  4ESJ A;  1T56 A;  3ERM A;  2AQE A;  2YUS A;  4X0G A;  1MBF A;  4I0B A;  4LMY A;  2EA4 A;  3TDU C;  1W7P B;  2CUE A;  3ROU A;  1QVT A;  4QLC U;  2KIQ A;  3A1Y A;  4I01 A;  4KIB A;  4OWR B;  4MTE A;  1IZ1 A;  3C2G A;  3P9C A;  4NB5 A;  4EJW A;  2VOD A;  3LST A;  2K3F A;  2X1E A;  2NRA C;  2GAU A;  3ZQ7 A;  5D6E A;  5FKL A;  1FTZ A;  4XKW A;  2ELJ A;  2H6B A;  3L2Q A;  1IAW A;  5L3D A;  2Y0S N;  3K4M A;  4KIS A;  1ON2 A;  4XRF A;  1C0W A;  5GAD J;  1WJD A;  4Y15 A;  5BPD A;  2R5Z B;  4RLQ A;  2ID6 A;  3BR3 A;  2V9P A;  5E3L A;  4HX8 A;  3T1B A;  4JYK A;  2ZXI A;  4GDF A;  1OYI A;  3WTV C;  3PNT A;  1S72 I;  2FD5 A;  1GVJ A;  1XSX A;  5E1W A;  4EQQ A;  1IXR C;  1ODD A;  2F4M B;  4MQV A;  4BE2 A;  3F23 A;  2VC1 A;  2IT0 A;  2R93 J;  4HYE A;  3OYL A;  2JSC A;  2BY0 A;  2R3S A;  3OS0 A;  4V2F A;  4N4N B;  3Q0V A;  1KQ8 A;  1HW1 A;  5ICC A;  2KP6 A;  2ZNY A;  4XM3 A;  4ZDP A;  4DYQ A;  3CF5 F;  5FRM A;  4A12 A;  1JI8 A;  1K79 A;  2Z2S B;  3DWL E;  5B5E C;  1ETX A;  3AG1 H;  1KA8 A;  1LPQ A;  4RLF A;  2DTR A;  3RZD J;  3JRF A;  3UNG C;  1TP4 A;  1KGS A;  5FO5 A;  3K70 C;  3BT9 A;  2HQ5 A;  3TO6 A;  1U5T A;  1Y56 A;  2JTV A;  3BZC A;  2CWE A;  2LOO A;  2BV6 A;  2AXT C;  2LY9 A;  2D45 A;  2E60 A;  1K78 B;  1IXC A;  4XLH A;  5J40 A;  2P7C B;  4MNU A;  1UMQ A;  2HVS A;  2M8G X;  1BJZ A;  2XF7 A;  3SEQ A;  1EH8 A;  2IGK A;  2LK2 A;  3FMR A;  4JBA A;  1HW2 A;  3TW6 A;  2UXN A;  4LIT A;  4QPO A;  4ZDL A;  1RZ4 A;  3DKW A;  2G0E A;  2KIF A;  5M3M J;  3QYB A;  2W84 A;  4WXD A;  1F9N A;  1O3S A;  5K1Y A;  1GV5 A;  1YIT I;  1MIJ A;  3DTI A;  3HJE A;  3A4C A;  1QU3 A;  4U7D A;  3T0Y A;  1P4X A;  1X3W B;  5DD8 A;  5LHG A;  2IRF G;  3W6J B;  1R36 A;  4HDU A;  3GTM J;  4I09 A;  3SFZ A;  4F92 B;  2QBY B;  4RM3 A;  1T6S A;  2MD0 A;  1VND A;  2XRL A;  5F0C A;  1R1U A;  3Q5F A;  2KIU A;  3ZP5 A;  3OYB A;  1K61 A;  3KIO A;  4BXX J;  1J7K A;  1DQU A;  1I3Q J;  1KQ9 A;  2ELH A;  3ERE D;  3LSP A;  4CCJ A;  3IAS 2;  3TDZ C;  1TZL A;  5GAE J;  3BR6 A;  5CVU A;  4KN7 X;  2F2E A;  5BOX A;  4RS8 A;  3C7J A;  5FKM A;  1I50 J;  1VQP I;  3HSR A;  2VIX A;  2KJC A;  4ENK A;  2W4S A;  3F3X A;  1MMG A;  4BHP A;  5DV5 A;  3OYK A;  1VQ5 I;  4NHJ A;  2VJI A;  5FLM J;  5EDN A;  1LE8 A;  1YX3 A;  3H9Q A;  2E36 A;  2UXX A;  4UVA A;  2F5V A;  3DTE A;  2DDB A;  2OQR A;  1MSF C;  1W7P D;  2LBF B;  4QTR A;  1CF7 A;  2HYG D;  3HC7 A;  1DU6 A;  4F3Q A;  1D8J A;  1ZRC A;  1YW8 A;  5E20 A;  3IRQ A;  4IHT A;  3ABM H;  4G6D A;  2JJ7 A;  1B8I B;  4U7B A;  3SZP A;  1WCM J;  5H20 A;  4Q4Z F;  3LNQ A;  2R7R A;  1M1E B;  2IVM A;  2ZSI B;  2VXZ A;  2DI3 A;  1QPI A;  3K69 A;  3E1S A;  1MW7 A;  3ZQL A;  3ML6 A;  4HF0 A;  2CUF A;  3H5N A;  4UXN A;  2MSY A;  3VYR B;  3FIS A;  4IRG A;  3WHB A;  4I02 A;  3RKX A;  2DMQ A;  2Q2E B;  2V7F A;  3FXU A;  2LY1 A;  3LFU A;  3DBH B;  1QZZ A;  2F5C A;  1JUS A;  2H1K A;  3IL2 A;  4HNT A;  3I3L A;  4KT6 A;  3D5L A;  2M87 A;  3ASN H;  4AU7 A;  2FNP A;  3CF2 A;  2DTZ A;  2ME0 A;  4I0A A;  1YFH A;  3G71 I;  3TED A;  4KYW A;  3L2W A;  3JSP A;  2HQN A;  3VB2 A;  3V7C A;  1SMT A;  3HOY J;  3GTP J;  1IW7 F;  3V8J A;  1JHF A;  2M30 A;  2MC3 A;  1ZLK A;  2V1N A;  1BC7 C;  1UEL B;  2DA6 A;  1R5G A;  1Y0N A;  2A6H F;  4L5E A;  5DUI A;  1WWX A;  2XAJ A;  3F21 A;  2M8E A;  2V1D A;  2D5V A;  2XAU A;  1BI1 A;  3AG4 H;  3HKZ N;  1DP3 A;  3DEU A;  4XMY A;  3PM1 A;  2IGM A;  1VF9 A;  2XAG A;  1LVA A;  1JKP C;  2V6E A;  2PMZ N;  3V42 A;  2OQG A;  2ZJP F;  5FFZ A;  4CDG A;  4BAY A;  2CFX A;  1ZAR A;  2OJE D;  4IHS A;  5BQT A;  4M3D A;  3CUQ C;  1QNT A;  1YX5 A;  1ON1 A;  3K10 A;  2H1L A;  1FYM A;  1ETQ A;  1V5G A;  3H3U A;  4C3I J;  1ETW A;  2JSP A;  4BXU A;  2K40 A;  3ZMS A;  3TP0 A;  4ZYD A;  3L00 A;  4ITV A;  1K6Y A;  5TJJ A;  3WGG A;  1D5Y A;  2YU9 J;  2R7V A;  3KP3 A;  4B43 A;  2R4G A;  2V9K A;  4CSW A;  4B09 A;  1NHA A;  5D8K B;  2VE9 A;  1UHM A;  1PUF A;  3RIR A;  2R7U A;  1U2W A;  3AG3 H;  2HTS A;  5J4Y A;  4BQQ A;  3H35 A;  3OOP A;  5KCM A;  1IG7 A;  4IKF A;  1J5Y A;  4FX0 A;  3H9J A;  3I58 A;  1IJW C;  5HDN A;  2DDA A;  2Q1Z B;  2BXY A;  1CQT A;  2MW8 A;  2FU4 A;  3WTX C;  3HG9 A;  1WJC A;  4OAY A;  4PZJ A;  2XC7 A;  2IW5 A;  2NS7 A;  3M1E A;  2DMU A;  1IDZ A;  2EK5 A;  2VKD A;  5F04 A;  3K6G A;  1XMA A;  1Q1V A;  3L2U A;  4L9J A;  1LQ1 A;  4BGD A;  4LG0 B;  3T8T A;  2YR2 A;  3S1M J;  5GTH C;  3RPU A;  1D5V A;  3N97 A;  3HYI A;  3KEO A;  1TL8 A;  1XMX A;  1OCT C;  2FEZ A;  1XPX A;  2LKP A;  2P5K A;  2L02 A;  1ZG5 A;  4AVP A;  4AM3 A;  5D5X B;  5L3B A;  3HSF A;  2F6C A;  4XID A;  5J8C A;  2FSW A;  3OYI A;  4AIH A;  2HXO A;  2XPW A;  4QWQ A;  1OCO H;  3GF2 A;  4O3M A;  1T33 A;  1OR7 C;  3ZQG A;  2LNB A;  2K3P A;  4ZYG A;  2L2O A;  3J80 K;  1VQL I;  4PJL A;  4JX4 A;  1X4O A;  5HS7 A;  4BBR J;  1OQY A;  1FOY A;  3CES A;  3OMY A;  1E0E A;  1F43 A;  4XSZ F;  3M4O J;  2EIN H;  4P1W A;  5IT3 A;  1TNS A;  3L09 A;  5A2Q K;  2CG4 A;  2E5N A;  2XUB A;  3P5J A;  4BQO A;  1HQC A;  3GTO J;  4ETS A;  5E3M A;  4IJA A;  5HS9 A;  4G9Y A;  4F52 A;  2DA4 A;  1IN8 A;  4ZC3 A;  1H89 C;  3RDI A;  1SD5 A;  4XON A;  5K5R A;  4OIN F;  3CMM A;  4NC7 A;  4XLC A;  2QQ9 A;  3CUQ A;  5LEJ A;  2W85 A;  2ETH A;  2IS1 A;  2J5O A;  4PSX A;  3FM3 A;  2KT0 A;  3S8P A;  2M34 A;  5JFR A;  5ICE A;  5GAH J;  1BI0 A;  2WAF A;  2IBD A;  3FKJ A;  2MG4 A;  3WTW C;  1U8R A;  2HZD A;  3GVA A;  3HHH A;  3IKT A;  2KDZ A;  1FEX A;  1P92 A;  3WTZ A;  2LC2 A;  2PN6 A;  4LIU A;  4MTD A;  5E1X A;  3AG2 H;  2ZXJ A;  5CPR B;  1Z05 A;  4XR6 A;  1JXS A;  4L9V A;  2WTE A;  1OPC A;  3NWS A; 
#chains in the Genus database with same CATH homology
 4O6J A;  3TOA A;  2IJL A;  2W25 A;  1GXP A;  2HQR A;  2Z9O A;  4R79 A;  5HDG A;  4P9F A;  1CGP A;  2VT2 A;  3FHZ A;  5HLH A;  2VC0 A;  2PMH A;  1EH6 A;  1IN5 A;  2RV8 A;  4LLL A;  4KFC A;  4HF1 A;  1OR7 A;  3KLO A;  2CO5 A;  4RGR A;  1A04 A;  2R7D A;  4P9U A;  2DFI A;  3QPH A;  3JSO A;  3IHU A;  2GWR A;  5F64 A;  5HVQ C;  1I6X A;  1QO0 D;  3BY6 A;  4UV9 A;  2PEX A;  1MKM A;  1FT9 A;  1P6R A;  5DEQ A;  2HEO A;  2EFW A;  3ABU A;  2MA3 A;  3LQR A;  1ZYR F;  2DQL A;  1G6N A;  3HRT A;  1IUY A;  5CVR A;  2O03 A;  2FRH A;  2JZY A;  1BN5 A;  3V7S A;  3R4K A;  1H9G A;  2A3S A;  4MQ9 F;  4M72 A;  3ABT A;  1P4W A;  2FA5 A;  2EA2 A;  2FOK A;  1Z6R A;  2BBY A;  2D1H A;  3EET A;  4HLX A;  3CLO A;  4YG2 F;  4WF2 A;  3NRV A;  3JTG A;  2O3F A;  2YX7 A;  1PUE E;  2LF8 A;  5LRS A;  1XB4 A;  4ON0 A;  4PGH A;  3RTR A;  4KDP A;  1SFU A;  1OYY A;  4RGX A;  1ONV A;  1L0O C;  2FMY A;  1REP C;  2FQ3 A;  2GXB A;  3HTS B;  3D0S A;  1F1Z A;  3RKW A;  1G3W A;  3GWZ A;  2VBZ A;  2K02 A;  4HA8 A;  1I27 A;  4M9Z A;  4JQF A;  3GFM A;  3V8K A;  5DUK A;  4YIF A;  1TTY A;  2KKO A;  2R7F A;  2PMU A;  5HLI A;  2MLK A;  4B8X A;  3MFK A;  2C6Y A;  2EV0 A;  4Y13 A;  2AXL A;  3ZMZ A;  2HGC A;  4GYI A;  1OYW A;  3PQJ A;  1DPU A;  5L3G A;  5CYV A;  5LGT A;  1SFX A;  3Q9S A;  3F8N A;  2QLZ A;  2G7H A;  2ADU A;  5L3E A;  4M71 A;  2DT5 A;  1TQP A;  2ZJ2 A;  2FXA A;  5ILS A;  4CHU A;  2VN2 A;  3F8B A;  1UHW A;  1W5T A;  3R61 A;  4HX7 A;  1KU7 A;  3IC7 A;  1E2X A;  2STT A;  2F5F A;  1T98 A;  3E97 A;  4CIC A;  2LF7 A;  4LJZ F;  1GHC A;  4S04 A;  3FZV A;  1STZ A;  1XGS A;  3RI4 A;  2OU2 A;  4P55 A;  2IA2 A;  3EDP A;  4HW0 A;  4EJT A;  2PG4 A;  3B02 A;  3GEZ A;  2PBI A;  1KYZ A;  1P4A A;  1HBX G;  1IRG A;  2F5E A;  2NNY A;  4M9X A;  1PP8 F;  4WX9 A;  4HBL A;  4PGG A;  1YW9 A;  1MJA A;  4Q47 A;  4N9H A;  4ZYH A;  4RB0 A;  2PLY A;  4EVI A;  2EWN A;  4I98 B;  1WI9 A;  1RNL A;  3BWG A;  2DPU A;  3WG9 A;  1KU2 A;  1UB9 A;  4M74 A;  1Q1H A;  1TQI A;  3BRO A;  3CTA A;  5FD5 A;  4RB3 C;  3I54 A;  1DUX C;  4A2U A;  1I1G A;  2H09 A;  2FF4 A;  4G94 A;  2LSO A;  1QPM A;  3Q9V A;  3M8F A;  2O0Y A;  4GXO A;  1R1V A;  5HDK A;  3E6M A;  3HUG A;  2A6E F;  2QQB A;  2HS5 A;  3L9F A;  2LDU A;  3C18 A;  2FBH A;  3ISP A;  3BP8 A;  3KEQ A;  1W5S A;  4EM0 B;  1BIB A;  1FYL A;  4LD5 A;  5CVJ A;  2M45 A;  1FYK A;  3KP2 A;  1TBX A;  1K6O A;  1XDS A;  3I5U A;  1RI7 A;  5ICF A;  4BH9 A;  1G4D A;  3K9T A;  5IT9 Z;  1L3L A;  3RYP A;  3E6B A;  2ZNZ A;  4RB1 A;  5ERI A;  5LGU A;  2RN7 A;  2PFB A;  4Y17 A;  3E5U A;  2CSO A;  2HYF A;  1Z6T A;  3EYY A;  2P6T A;  2W24 A;  3ZMD A;  2BEO A;  1F5T A;  3I53 A;  2DPD A;  1BI2 A;  4XBF A;  2FML A;  2CGP A;  1BOA A;  1KQ0 A;  2ZFW A;  5BPI A;  3V8L A;  1FBQ A;  3FX3 A;  2CW0 F;  1YS6 A;  2XAQ A;  4BQA A;  3ZN0 A;  1MJ9 A;  3GFI A;  1BBY A;  1YIO A;  3WE2 A;  1DDN A;  2K86 A;  3KZZ A;  4WK8 F;  3J81 Z;  5ILU A;  1B6A A;  2HWV A;  4BHC A;  2K4J A;  4IF4 A;  1MD0 A;  4HV5 A;  4RGU A;  3F8F A;  2HDC A;  4GYG A;  1WQ2 A;  1YO5 C;  1B1B A;  2IA0 A;  4L9N A;  4KIF A;  4G6Q A;  1U5T B;  3P9I A;  3DFG A;  2V79 A;  1XCV A;  3M7G A;  3NEU A;  2UZK A;  4H0E A;  2VOO A;  2YX4 A;  3ZPL A;  3TGN A;  2HR3 A;  4PDK A;  4UVB A;  5K5O A;  1W4M A;  2WC2 A;  1R7J A;  4M73 A;  2QVO A;  2V9V A;  3GX4 X;  3JTH A;  3WGI A;  1ULY A;  3F22 A;  4WXC A;  3KP5 A;  2A07 F;  3HRM A;  4M6X A;  3ZMV A;  1SAX A;  4CO8 A;  5FD6 A;  2EJR A;  1WSU A;  2L3D A;  3LWF A;  2DW4 A;  4HX4 A;  2QYO A;  2V1X A;  1H0M A;  4LGW A;  2FBI A;  1F4K A;  3CUO A;  1QGP A;  3SXY A;  4KT5 C;  4EM2 A;  2DO7 A;  2XAS A;  1YYV A;  2RC4 A;  4DNC A;  2RVC A;  2DK5 A;  2IP2 A;  1HKS A;  3R60 A;  1MDM A;  1ZAO A;  3G73 A;  5TRD A;  5ICG A;  3WTS C;  3TOB A;  3ZMU A;  1LB2 A;  1CF7 B;  2XGX A;  3WU1 B;  3M9A A;  4K2E A;  2QM3 A;  5FB2 A;  2NS0 A;  1IN7 A;  1V4R A;  1BIA A;  3KP4 A;  3RKY A;  2A69 F;  2P5L C;  3DV8 A;  5L3C A;  2P8T A;  3QU6 A;  3CO7 C;  2L54 A;  3GFL A;  3IWZ A;  3BOQ A;  3FXQ A;  3F72 A;  4A5N A;  3J7A O;  3VEP A;  3J81 K;  5J8F A;  3K1M A;  2CYY A;  1QBJ A;  3JAM Z;  3CO6 C;  1BC8 C;  2Y75 A;  1B9M A;  2Z33 A;  2ZO4 A;  4ESB A;  1S8N A;  4RAY A;  1D8K A;  2O61 A;  1R1T A;  1PDN C;  2PI0 A;  5ED4 A;  4L18 B;  3K1N A;  5KVR A;  4KNY A;  2BGC A;  2GXG A;  3DPL C;  2HZT A;  5LHI A;  2ZBK A;  2HOE A;  4IRH A;  2VOP A;  1FY7 A;  5H6Q A;  1U78 A;  3QPT A;  4UV8 A;  4HOB A;  3QAH A;  1MZB A;  4A6D A;  2NNN A;  4WXH A;  3KLN A;  4BHB A;  1I1S A;  3GW2 A;  4CGZ A;  3U1D A;  1FP1 D;  2M5W A;  3KFW X;  3VFZ A;  3I59 A;  5DCM A;  4O5V A;  2E1C A;  1O7F A;  2Y0M A;  3DXJ F;  3FMS A;  5L3F A;  3DP7 A;  3I71 A;  1B4A A;  1P2F A;  3GFJ A;  1T39 A;  5E8G A;  1BI3 A;  1TW3 A;  4AD9 A;  5HLG A;  2JT1 A;  2F5D A;  5D8L B;  4WCG A;  2KJB A;  2PJP A;  2GA2 A;  3T5X A;  1PP7 U;  1YLF A;  2OBP A;  3U9G A;  4OU0 A;  2BYV E;  1W7P A;  2VBW A;  1XGN A;  2STW A;  4D0P A;  4U0Y A;  1HW5 A;  4XLN F;  1Y0U A;  3F6O A;  3R0A A;  1XDU A;  2OZU A;  1SD7 A;  4GCV A;  5DDG A;  5D5V B;  1R22 A;  4E70 A;  5D4R A;  2J5P A;  2GIV A;  1VTN C;  1JE8 A;  5FGM A;  3KZY A;  5JHU A;  4AWX B;  3E6D A;  4ASN A;  4RB2 C;  1HXD A;  3S2W A;  3FWE A;  4GO1 A;  1YTY A;  2HKO A;  2ZKZ A;  2D1V A;  1T38 A;  3GLX A;  2ISZ A;  2FE3 A;  3F6V A;  1USS A;  3CDH A;  3CUQ B;  1FOK A;  1FC3 A;  1J9I A;  4KA4 A;  4XSX F;  5E18 F;  2G9W A;  3GZ6 A;  4UUV A;  2V1U A;  2EB7 A;  2P5V A;  1K78 A;  4AIK A;  3O3K A;  3U2R A;  3RYR A;  2RNJ A;  3EUH A;  1B9N A;  3IRR A;  3FF5 A;  3F8C A;  1HST A;  3E6C C;  1XSV A;  1ZRD A;  3M8E A;  5CVI A;  4N9I A;  1IN4 A;  1ZN2 A;  3KP6 A;  3VOD A;  3B73 A;  3P9K A;  4HV6 A;  1JGS A;  3L7W A;  5ILV A;  4LB5 A;  3KP7 A;  1MJB A;  2NAZ A;  2P6S A;  2QBY A;  5FLX Z;  2RDP A;  1DP7 P;  5LRR A;  2ZME A;  2QWW A;  2XV4 S;  4L5J A;  3V7R A;  3K0L A;  4EJU A;  5DCM B;  3R0J A;  4XLP F;  3MEX A;  3O6B B;  1YQA A;  2OD5 A;  1U6G A;  1HKT A;  2EV5 A;  1BJA A;  4MEX F;  4DQ2 A;  3MZH A;  2O8X A;  1J75 A;  2Z99 A;  1FP2 A;  2ISY A;  3H92 A;  3RPQ A;  2GQQ A;  5AIP A;  5J6X A;  1AWC A;  4EV0 A;  4YFK F;  1TW2 A;  1XSD A;  3IKV A;  1KU9 A;  3BJA A;  4M6Y A;  2Z3Y A;  2XKO A;  1BM9 A;  2V6C A;  1QZY A;  5HOO A;  3LA7 A;  2Q2E A;  4UVC A;  2QUF A;  2CQK A;  2D2W A;  4RAZ A;  4R8H A;  4KUM A;  3BDD A;  1XGO A;  5LBQ A;  2EV6 A;  4EGY A;  5D6F A;  4EJO A;  3CJN A;  3MZY A;  4ENJ A;  3HIF A;  1MGT A;  3E5X A;  1B59 A;  1RIO H;  1FZP B;  2KRF A;  2Y48 A;  1Z7U A;  4AIJ A;  4LK1 F;  4ESF A;  3HTU A;  5DYM A;  2TDX A;  4FT8 A;  2COM A;  3SQN A;  1S3J A;  2FBK A;  4Q48 A;  3BPX A;  4IPA A;  3R6S A;  3HHG A;  4LLG F;  3E5Q A;  2YSR A;  3OV8 A;  1FBS A;  4OMZ A;  2XHK A;  4KMU X;  5FLX K;  4IXA A;  3GYH X;  2BE5 F;  1LNW A;  3K2Z A;  1FX7 A;  5AON A;  4ZZL A;  2P4W A;  3QU3 A;  3QOP A;  4JK1 X;  4OOI A;  1ZG3 A;  2HFH A;  2XRN A;  3RJP A;  4LB6 B;  1YG2 A;  1ZRF A;  1TQM A;  2NYX A;  1UST A;  3TO9 A;  2RGV A;  3BJO A;  4UHT A;  3GZ5 A;  4LG0 A;  4KIG A;  2ZME B;  1GXQ A;  1YS7 A;  4Q5S F;  3ZN1 A;  4A6E A;  3MAJ A;  2P7V B;  1SD6 A;  2JPB A;  4L0Z B;  4HQM A;  5LLQ A;  1O3R A;  3GO5 A;  1G3T A;  2AS5 F;  1J0R A;  4MEY F;  3W6K B;  3C1D A;  3TKY A;  1LDK B;  4A5M A;  1ZRE A;  4RGS A;  3BPV A;  3EYI A;  4R1H A;  1OMI A;  1QQI A;  1ZG1 A;  2WV0 A;  2E1N A;  2MBF A;  3ECO A;  2VE8 A;  5F6F A;  4EJV A;  3JW4 A;  3MWM A;  4EGZ A;  2QQA A;  3FMQ A;  2A5Y B;  4EMS A;  3J80 Z;  2OA4 A;  3HOT A;  4ZZD A;  1LDJ A;  3BZ6 A;  5JR3 A;  4KIC A;  3I0T A;  1EH7 A;  3WTY C;  1ZGJ A;  2DQR A;  2JRT A;  3WTT C;  3ZMT A;  2A61 A;  5A2Q Z;  1O57 A;  3N4M A;  5LEK A;  1WKM A;  1R23 A;  4G7H F;  4N0B A;  3GXO A;  1FPQ A;  4MHG A;  4F7Z A;  5BMZ A;  2EFQ A;  4MGR A;  1FNN A;  4YFX F;  3E3V A;  1XMK A;  1J59 A;  1FSE A;  1LDD A;  4U0W A;  2EFP A;  3DF8 A;  3L2C A;  1XD7 A;  2L4M A;  3PFI A;  1U3E M;  3PQK A;  4OIO F;  4UNO A;  2XRO A;  2HKX A;  2K4B A;  1IN6 A;  5D5U B;  3K1P A;  2GA1 A;  3COA C;  3MCZ A;  5AIQ A;  4U88 A;  2RKH A;  2DLL A;  2ESN A;  3TQN A;  5JVT A;  4TV7 A;  5IT9 K;  3DQV C;  1S7O A;  3WU0 A;  1LJ9 A;  4CZZ A;  2X4H A;  3G3Z A;  1S29 A;  2JPC A;  2IA1 A;  5E8I A;  1JHH A;  4LFU A;  3LFK A;  2G7U A;  1H9T A;  3HRS A;  4YFN F;  1IRF A;  3KE2 A;  3DPT A;  3LA3 A;  5E17 F;  3H3Z A;  3LQQ A;  5DCF A;  2L01 A;  4Z2Y A;  4HZF A;  3V4G A;  4HLY A;  2IPQ X;  3BJ6 A;  5CLS A;  1G3Y A;  1S7A A;  3I4P A;  2WWY A;  5D5W B;  2VON A;  1TLH B;  3LA2 A;  2QZ8 A;  5D4S A;  1O3T A;  3MQ0 A;  4BNC A;  3FM5 A;  4CXF A;  2XIG A;  1HKQ A;  6PAX A;  2H94 A;  1RUN A;  3HOS A;  1SD4 A;  3REO A;  2Z5U A;  4IVN A;  2GZW A;  3NQO A;  2L4A A;  5CVV A;  4LK0 F;  3I64 A;  2E7X A;  3SHF A;  2XVC A;  4ZYE A;  4FHT A;  1ZGA A;  4BYY A;  5BS6 A;  2ZCW A;  1LEB A;  4YII A;  1FLI A;  4I2O A;  2DAO A;  1TNT A;  1Z1D A;  4P5O A;  3LAJ A;  2YU3 A;  1SMY F;  1G3S A;  4HQE A;  1I5Z A;  3T8R A;  4OIQ F;  2ESH A;  3WGH A;  2E7W A;  1ZHF A;  4I7H A;  4ENM A;  1KU3 A;  4S05 A;  3P7N A;  2H6C A;  4WWC A;  1FWZ A;  2A68 F;  4FX4 A;  2B0L A;  1YW7 A;  4G7O F;  2VBX A;  3KCC A;  1R5H A;  3LAP A;  1SFE A;  3O2P E;  4OMY A;  1O3Q A;  2K7L A;  3ELK A;  4LLN A;  3QP6 A;  4G8X A;  3SZT A;  2K27 A;  2VT3 A;  2EFO A;  1R00 A;  3IWF A;  4M9S A;  3TO7 A;  4L0Y B;  2XKP A;  1ZH5 A;  2KIM A;  5K5Q A;  1T2K A;  3HSE A;  2UWM A;  3WE3 A;  5LHH A;  4P96 A;  5EEH A;  2O6G E;  1R58 A;  1XGM A;  3AAF A;  5KK1 A;  3WOD F;  4G7Z F;  1Z9C A;  2ACJ A;  5F1R A;  3WTU C;  2XAF A;  4IRI A;  4L9T A;  2QEN A;  5FFX A;  4HF2 A;  3FXR A;  4ZH4 F;  3VOE A;  1X3U A;  4HDV A;  2Q8K A;  4A0X A;  1IF1 A;  1EV7 A;  1J2X A;  1AOY A;  5H6R A;  2OZ6 A;  2H27 A;  1KYW A;  1MDM B;  2HTJ A;  5JI6 A;  2MD5 A;  1FSH A;  2PQ8 A;  2EFN A;  1XCB A;  1UFM A;  3JAM K;  1FBU A;  3C3W A;  3ECH A;  1K7A A;  2DK8 A;  4EM1 A;  1E17 A;  5CJ9 A;  1V3F A;  3KET A;  4HAM A;  5EEG A;  2M1B A;  5DD4 A;  2DU9 A;  2W57 A;  2OAZ A;  4OIR F;  4A0Y A;  3ULQ B;  1O7L A;  1LEA A;  3EQL F;  1S6L A;  2X0L A;  4KN4 X;  2DBB A;  4CYD A;  4OIP F;  2MH2 A;  1XN7 A;  4GGG A;  3QP5 A;  2XAH A;  1DPR A;  3GUD A;  3F8M A;  4L5I A;  2Q0O A;  3HRU A;  1Z91 A;  5E1Z B;  2RQP A;  4ENN A;  2YPR A;  1WRJ A;  4U0V A;  3I59 B;  4KMF A;  1HSJ A;  2FNA A;  5HS8 A;  4PCQ A;  2MLG A;  1U5T C;  1ZLJ A;  2VBY A;  4A0Z A;  1UCR A;  1OKR A;  2MH9 A;  3QRF F;  1IXS B;  1D3Y A;  1RUO A;  4NQW A;  5LGN A;  1T0F A;  4ESJ A;  4I0B A;  4LMY A;  2EA4 A;  3TDU C;  1W7P B;  3ROU A;  4QLC U;  4I01 A;  4KIB A;  4MTE A;  1IZ1 A;  3P9C A;  4NB5 A;  4EJW A;  2VOD A;  3LST A;  2NRA C;  2GAU A;  3ZQ7 A;  5D6E A;  2H6B A;  1IAW A;  5L3D A;  1ON2 A;  4XRF A;  1C0W A;  4Y15 A;  5BPD A;  4HX8 A;  3T1B A;  1OYI A;  3WTV C;  1GVJ A;  1XSX A;  5E1W A;  4EQQ A;  1IXR C;  1ODD A;  4MQV A;  3F23 A;  2VC1 A;  2IT0 A;  4HYE A;  2JSC A;  2R3S A;  1KQ8 A;  1HW1 A;  5ICC A;  2ZNY A;  4A12 A;  1K79 A;  1KA8 A;  2DTR A;  1KGS A;  5FO5 A;  3TO6 A;  1U5T A;  2JTV A;  2CWE A;  2BV6 A;  2D45 A;  1K78 B;  1IXC A;  2P7C B;  4MNU A;  1EH8 A;  3FMR A;  4JBA A;  1HW2 A;  2UXN A;  1RZ4 A;  3DKW A;  2KIF A;  2W84 A;  4WXD A;  1F9N A;  1O3S A;  5K1Y A;  4U7D A;  3T0Y A;  1P4X A;  5DD8 A;  5LHG A;  2IRF G;  3W6J B;  1R36 A;  4HDU A;  4I09 A;  3SFZ A;  2QBY B;  1T6S A;  1R1U A;  3Q5F A;  2KIU A;  3ZP5 A;  1J7K A;  1KQ9 A;  2ELH A;  3ERE D;  3TDZ C;  5CVU A;  4KN7 X;  2F2E A;  5BOX A;  4RS8 A;  3C7J A;  3HSR A;  2KJC A;  4ENK A;  3F3X A;  4BHP A;  5DV5 A;  4NHJ A;  2UXX A;  4UVA A;  2OQR A;  1W7P D;  1CF7 A;  2HYG D;  1D8J A;  1ZRC A;  1YW8 A;  5E20 A;  3IRQ A;  4IHT A;  4G6D A;  4U7B A;  3SZP A;  5H20 A;  4Q4Z F;  2IVM A;  2VXZ A;  2DI3 A;  3K69 A;  3ML6 A;  4HF0 A;  4UXN A;  4IRG A;  4I02 A;  3RKX A;  3FXU A;  1QZZ A;  2F5C A;  3IL2 A;  3D5L A;  2M87 A;  2FNP A;  4I0A A;  1YFH A;  4KYW A;  3JSP A;  2HQN A;  3VB2 A;  3V7C A;  1SMT A;  1IW7 F;  3V8J A;  1JHF A;  2M30 A;  2MC3 A;  1ZLK A;  1BC7 C;  1R5G A;  2A6H F;  5DUI A;  1WWX A;  2XAJ A;  3F21 A;  2M8E A;  2V1D A;  1BI1 A;  3DEU A;  2XAG A;  1LVA A;  2OQG A;  5FFZ A;  4CDG A;  4BAY A;  2CFX A;  1ZAR A;  4IHS A;  5BQT A;  3CUQ C;  1QNT A;  1ON1 A;  1FYM A;  3H3U A;  4BXU A;  3ZMS A;  4ZYD A;  3L00 A;  5TJJ A;  3WGG A;  3KP3 A;  4B09 A;  1NHA A;  5D8K B;  2VE9 A;  1UHM A;  3RIR A;  1U2W A;  2HTS A;  3OOP A;  1J5Y A;  4FX0 A;  3I58 A;  5HDN A;  2FU4 A;  3WTX C;  4PZJ A;  2IW5 A;  3M1E A;  2EK5 A;  1XMA A;  4L9J A;  1LQ1 A;  4LG0 B;  3T8T A;  2YR2 A;  3RPU A;  1D5V A;  3N97 A;  3HYI A;  3KEO A;  2FEZ A;  2LKP A;  2P5K A;  2L02 A;  1ZG5 A;  4AVP A;  5D5X B;  5L3B A;  3HSF A;  5J8C A;  2FSW A;  4AIH A;  4QWQ A;  3GF2 A;  4O3M A;  2LNB A;  4ZYG A;  3J80 K;  5HS7 A;  4XSZ F;  5IT3 A;  1TNS A;  3L09 A;  5A2Q K;  2CG4 A;  2XUB A;  1HQC A;  4ETS A;  4IJA A;  5HS9 A;  4G9Y A;  1IN8 A;  3RDI A;  1SD5 A;  5K5R A;  4OIN F;  2QQ9 A;  3CUQ A;  5LEJ A;  2W85 A;  2ETH A;  2J5O A;  3FM3 A;  5JFR A;  5ICE A;  1BI0 A;  3WTW C;  1U8R A;  3GVA A;  3HHH A;  3IKT A;  1P92 A;  3WTZ A;  2PN6 A;  4MTD A;  5E1X A;  2ZXJ A;  1Z05 A;  1JXS A;  4L9V A;  2WTE A;  1OPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...