1BJAA

Activation domain of the phage t4 transcription factor mota
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
b'SKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION REGULATORY PROTEIN MOTA
publication title The activation domain of the MotA transcription factor from bacteriophage T4.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Activation domain
total genus 33
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09114 MotA_activ Transcription factor MotA, activation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bjaA00
4XLPF 3DFGA 3HTUA 3I4PA 4AVPA 3QOPA 3NRVA 3DEUA 3F6VA 3N4MA 4A12A 4L9JA 2L54A 1L0OC 3GFMA 4P55A 3NEUA 4BNCA 4KFCA 4R79A 2GWRA 5CLSA 3D0SA 2ADUA 2VOPA 1U6GA 2D1HA 1ONVA 1K6OA 5D5VB 3P9IA 5LHHA 3CUQA 2GZWA 5DUIA 1IN5A 4ZYDA 3F8BA 4CZZA 2STTA 2Y75A 4CHUA 1UFMA 3PFIA 5BPDA 3ECHA 3ZMSA 5E1ZB 4GYGA 4G7HF 2ZMEA 2K02A 2H94A 1FP2A 3ELKA 3SXYA 4M6YA 3TO6A 1ZLJA 2HTJA 3F8MA 3FZVA 3NQOA 5ICEA 3P9KA 1UHMA 3ISPA 3RI4A 4BHCA 4EGZA 1IUYA 1SFEA 1HW5A 3C1DA 5DEQA 1LDJA 2FF4A 3V7SA 2RDPA 3R60A 1KQ9A 3H92A 4U7BA 2DBBA 1G3WA 1FBQA 4I0BA 4M9ZA 5FB2A 3BDDA 4EGYA 3JTGA 4EJVA 1QZZA 1X3UA 5D6FA 3WTUC 1G4DA 2HZTA 1TLHB 4UVBA 1BBYA 3WGGA 4WXCA 4LFUA 1GXQA 1KU7A 3U2RA 1OPCA 1TQMA 4LG0A 2QBYA 3HIFA 1R1UA 5D8LB 5HDNA 2VE9A 1O3RA 1XDUA 2AXLA 2GAUA 1CF7A 2HQRA 5DV5A 2QQAA 4OOIA 3HHGA 4FHTA 4LK0F 1D3YA 2XAFA 4UXNA 3KCCA 3WE2A 3LFKA 5ILUA 3I59A 2QENA 3RJPA 1XGOA 2P7CB 5DCMB 4MEYF 1HKSA 1R00A 5L3DA 3FXUA 1HW2A 2YPRA 5ILSA 1OYWA 3KP4A 2VC0A 5CVJA 4I02A 4P5OA 2IA1A 1AOYA 1U78A 3S2WA 1IXCA 4RAZA 5DDGA 1EH6A 1DUXC 3ECOA 4HA8A 4S04A 1ON1A 1W5TA 3HOTA 4JBAA 4R1HA 1SAXA 4KICA 1HKTA 3IL2A 3VB2A 4N9IA 1ZRFA 3IWFA 2OU2A 1XMKA 4M9SA 1UB9A 4U0VA 1IN7A 1GHCA 2TDXA 2VODA 1F4KA 5LEJA 1Y0UA 1OMIA 3F3XA 4P9FA 2P5LC 2MC3A 1P4WA 3ABTA 5IT9K 5ICFA 3VEPA 4Y17A 3ZQ7A 2Z5UA 3RTRA 1F5TA 3HUGA 2DPUA 1FZPB 4HOBA 1UCRA 1FOKA 2GQQA 1RIOH 4AIHA 2A6EF 1XB4A 2WC2A 3KLNA 1R23A 1T39A 2LSOA 1RZ4A 1V3FA 2YX4A 3R6SA 2XHKA 3T0YA 1KU2A 1WQ2A 2OD5A 5HS8A 3M9AA 4P96A 2H27A 1VTNC 5JHUA 3KP5A 4RGUA 1KQ8A 2ESNA 1KU3A 2LDUA 2OZ6A 2R7FA 3ZMZA 4KIFA 3COAC 1ZREA 1LDDA 1BI2A 3JAMK 4DNCA 2JPBA 4B09A 2ZBKA 2UXNA 4MTEA 4O3MA 2EK5A 4EM0B 2XVCA 5BS6A 2FEZA 2PLYA 2VE8A 1K78A 1BOAA 1R58A 4GYIA 6PAXA 3RDIA 1P2FA 3E6BA 3RKXA 3RYRA 1K7AA 2GXGA 5HS9A 2VONA 3IWZA 1TW2A 2DT5A 1SD4A 4M72A 2DAOA 2O6GE 3JW4A 4G6DA 3K2ZA 3KP3A 3E6DA 3GO5A 1HQCA 1F9NA 2HYGD 4DQ2A 2XAQA 2PQ8A 5HLHA 2FMYA 3K1MA 3IC7A 5K5RA 2D45A 1L3LA 4XRFA 4RS8A 1W7PB 1U8RA 3B02A 4HW0A 2W85A 2FBKA 2V79A 3BJOA 4BHPA 4Q4ZF 2M87A 3FHZA 3O2PE 3LQQA 1F1ZA 4IJAA 3EDPA 1USSA 2IPQX 3KZZA 1HKQA 1IRGA 2EFWA 2K86A 4KA4A 1O3QA 1B6AA 5LEKA 5DD8A 2BBYA 2EV6A 4G9YA 1QPMA 1CGPA 4AWXB 3C18A 4WX9A 4R8HA 1WRJA 2VXZA 1IXSB 2Z33A 3EYIA 2M1BA 3Q9SA 2RV8A 5FFXA 1HW1A 1OKRA 2FRHA 2E7XA 2PI0A 2M45A 3ZMVA 2HTSA 2EA2A 1B4AA 3R61A 5LLQA 3TO9A 3N97A 3RIRA 1TBXA 2DK5A 3HRUA 3V4GA 3GFJA 5FGMA 2DTRA 2EV0A 4M71A 4EJUA 1LDKB 3F72A 5E20A 1O57A 2XAJA 4HDUA 4G6QA 3CJNA 1C0WA 3FWEA 1YO5C 4UNOA 2FNPA 2DQRA 2RKHA 4RB3C 4U0YA 4IHTA 2GXBA 2XKPA 2IA2A 5F6FA 3J80K 1HSJA 2G9WA 1TNSA 3QP5A 4K2EA 1IXRC 1FLIA 4RAYA 2GIVA 2PN6A 1D8JA 2ZXJA 2CG4A 1PDNC 1JHFA 4LMYA 3J81K 4FX4A 2KJCA 3ZMDA 2ZO4A 1IZ1A 2AS5F 5D5UB 1HSTA 2ETHA 5E8GA 4AIJA 5H6RA 5LBQA 4MGRA 1GVJA 5AONA 2UZKA 3V8JA 3CUQB 3CO6C 4IHSA 4KNYA 5BMZA 4OIRF 5A2QK 2XASA 4ETSA 2A5YB 2ZNYA 4MQ9F 2P5KA 3F8NA 3CO7C 4I09A 1U5TA 2JZYA 2XROA 1TQPA 3BJAA 1B59A 2ZMEB 3H3ZA 1O7FA 5TRDA 4HBLA 1T38A 3WTXC 3GXOA 2W84A 1BC8C 5DCFA 2BEOA 1RNLA 2Z99A 1IN4A 5DD4A 1JE8A 1XD7A 1S7OA 2FNAA 1J7KA 5BQTA 2L4MA 3CDHA 5TJJA 1I27A 1O7LA 4HLXA 1G3YA 2QVOA 2A07F 4HQMA 2EFQA 2Q2EA 2YX7A 4A2UA 2DK8A 1P6RA 2FOKA 2NNYA 4XBFA 2PG4A 2IVMA 1Z1DA 3FX3A 3BPXA 2FSWA 2DLLA 2V9VA 5CJ9A 2CYYA 2CWEA 3EQLF 1D8KA 1EH7A 1Q1HA 4ESBA 4KN7X 4NHJA 1BN5A 3IKTA 1CF7B 3FM5A 3KEQA 1KU9A 2MLGA 4YIIA 1STZA 3ULQB 4P9UA 3BPVA 1SFUA 1FNNA 1EH8A 5K1YA 1U3EM 5J6XA 5L3EA 4OIPF 1IN8A 2XUBA 3CUQC 3I59B 3TDUC 4XLNF 2ZKZA 4KDPA 3P7NA 2IRFG 3C3WA 4OINF 3FXRA 3F23A 4N9HA 3BY6A 4ZH4F 2VT2A 2L3DA 3I71A 1OR7A 4BYYA 2E1CA 1LEAA 5FLXK 2V1UA 2JRTA 5F64A 3TQNA 2GA2A 4ZYHA 4GGGA 3ABUA 2NYXA 2DQLA 4Y13A 3GX4X 1PUEE 3HTSB 3T8RA 4YFXF 2YU3A 3FMSA 4BXUA 4EJTA 3LA7A 3ERED 1RI7A 4FT8A 4LB5A 2STWA 1REPC 4LLLA 3VFZA 1JGSA 4AD9A 1A04A 5FO5A 1J5YA 1FX7A 2MH2A 2J5OA 3KLOA 3VOEA 3VODA 4L0ZB 4Y15A 1SD7A 1TW3A 1XGSA 2P4WA 3J7AO 1KGSA 2QQ9A 4HAMA 3MZYA 2KJBA 3BZ6A 1LEBA 4ZZDA 4M6XA 4FX0A 5J8CA 4KUMA 4IRGA 3TOAA 1BI0A 2C6YA 2K7LA 1XGNA 3H3UA 4O6JA 4OIOF 5CYVA 3R4KA 2BE5F 2X4HA 1ZRCA 1W4MA 2RN7A 3D5LA 2WWYA 1NHAA 3V7RA 2EJRA 1OYYA 2ACJA 1R1TA 3K9TA 2V6CA 1FSEA 3LQRA 1O3TA 3F8FA 3F21A 4KN4X 2OA4A 1K78B 2IA0A 1FPQA 2OAZA 1K79A 2F5FA 5LGUA 4A5MA 3O6BB 3ZN0A 2HGCA 3F6OA 3P9CA 2P8TA 2CW0F 3TOBA 5LHIA 5CVRA 1YW9A 2JT1A 3O3KA 1D5VA 1LJ9A 4L5IA 1BI1A 4EMSA 4RB0A 2O3FA 4KMUX 5HLIA 4WXDA 1XSXA 3WTTC 3F22A 2F5EA 1SD5A 3GYHX 2PMHA 1ZGAA 3MCZA 1R36A 1S3JA 4Q48A 3DXJF 4L9TA 1Z9CA 2EA4A 2M8EA 5DCMA 3R0JA 2H6CA 2XAHA 4L9NA 2H09A 3MQ0A 4ZYEA 2F5DA 2CFXA 2H6BA 4N0BA 2COMA 3QPHA 5FFZA 1I6XA 3QP6A 3RKWA 2HOEA 4U88A 4MEXF 2HYFA 3BOQA 2JSCA 1MDMA 2XAGA 1H0MA 2L01A 2XIGA 4PDKA 4IPAA 5E1WA 2ZJ2A 1B9MA 3KP6A 3BROA 4EM1A 1QBJA 4LD5A 5BPIA 3DPTA 2K4BA 2FBHA 4A5NA 3ZPLA 1YS7A 2RC4A 2XRNA 5H20A 4MHGA 4CGZA 4EJOA 4KT5C 4G8XA 4I2OA 1YLFA 5HS7A 3TDZC 2DFIA 4HDVA 1SMTA 2PBIA 1PP7U 3C7JA 3WTVC 2O61A 4BHBA 2E7WA 3E97A 2CO5A 4BQAA 1FBSA 2FA5A 2K27A 2ELHA 3ZN1A 4KIGA 4G94A 4HV6A 2F5CA 3GFIA 2XV4S 4GCVA 2L4AA 2PFBA 2WV0A 1T98A 3KE2A 2W24A 1HBXG 3R0AA 2PMUA 4ON0A 2OQRA 1ZLKA 1BC7C 3LAPA 3DP7A 1LQ1A 4U7DA 3SFZA 3K1NA 1U5TB 3QPTA 4I98B 4HX7A 2PEXA 1P4XA 4A0YA 1O3SA 3ZMUA 3SZTA 4BAYA 5L3FA 2IW5A 4GO1A 2UWMA 4O5VA 4L18B 4NB5A 2UXXA 3W6KB 1RUOA 3E5QA 5F1RA 4G7OF 1IF1A 1YW8A 5AIQA 1B1BA 3ZMTA 4ZYGA 1KA8A 1XSVA 1P92A 5HVQC 1J0RA 2RVCA 2L02A 1E17A 5K5QA 1KQ0A 1USTA 4PGHA 1T0FA 4EV0A 1BIAA 3T8TA 4YFNF 2HQNA 4D0PA 5CVUA 1XCBA 3KP7A 2BGCA 1DPUA 4EJWA 4UUVA 1J9IA 2P6SA 4XSZF 4LB6B 5LGTA 2HR3A 4WXHA 1WSUA 2WTEA 4MQVA 3HYIA 2HDCA 3E5UA 1YFHA 2Q8KA 3Q5FA 4F7ZA 2P6TA 3M7GA 2JTVA 2J5PA 2RNJA 2ISZA 1J59A 3CLOA 4KYWA 3RPUA 4M73A 2D1VA 3DPLC 2HKOA 2NS0A 1DPRA 3DKWA 3HRSA 1OYIA 2DI3A 2YSRA 1G3TA 1ZAOA 3FMQA 2DPDA 1MKMA 3GWZA 1FP1D 1S6LA 4WWCA 1YS6A 3I0TA 2KIFA 3GFLA 3E6MA 2XGXA 3I64A 3GZ5A 3U9GA 2EV5A 3KP2A 1FT9A 2EFOA 1YG2A 4YFKF 3IHUA 4Q5SF 1XDSA 1GXPA 4A6DA 2HWVA 3GVAA 3F8CA 5EEGA 5JVTA 1TTYA 1FYLA 4HF1A 4IRIA 2QLZA 2QUFA 1LNWA 3LWFA 5IT9Z 1XSDA 4AIKA 3GLXA 3MEXA 1HXDA 4LG0B 2VBYA 3T1BA 2QBYB 1IAWA 3QAHA 1ZGJA 3LA2A 4B8XA 1JXSA 2MLKA 1V4RA 1QNTA 2HEOA 1RUNA 4BH9A 5HLGA 3G73A 3FXQA 2Y0MA 1YIOA 1J2XA 4U0WA 2Y48A 4ENKA 1LB2A 2DO7A 3DQVC 1FYMA 3HSRA 4EQQA 1R1VA 3HRMA 2LNBA 3I54A 3L00A 2CQKA 5H6QA 1ZRDA 3ZP5A 2KIMA 2V1XA 1BIBA 4XSXF 1Z91A 1ULYA 3JAMZ 5ED4A 4HLYA 2QZ8A 1QQIA 1MJ9A 4KMFA 5D6EA 2F2EA 3W6JB 5FD5A 4M9XA 4L5JA 4RGRA 2A68F 1ON2A 1BI3A 1T6SA 3QRFF 4HQEA 1XGMA 4HV5A 5D5XB 1MJAA 1WWXA 5E18F 1DDNA 1ZHFA 5D5WB 3EETA 3GEZA 3M8FA 3WG9A 3U1DA 4IXAA 3K0LA 2EFPA 3K69A 2VBWA 4ENJA 2HKXA 3KFWX 4I01A 4PZJA 1QGPA 3K1PA 3LSTA 3M8EA 2IJLA 3DF8A 5K5OA 2A69F 1FC3A 5JFRA 1Z7UA 2NRAC 2VBZA 1UHWA 1B9NA 3WTYC 4YG2F 1LVAA 3I5UA 5IT3A 3IRRA 2O8XA 3KEOA 2LF8A 3HSEA 4I0AA 5HDKA 1FWZA 1R5HA 3CTAA 4PCQA 3WTSC 1MGTA 2YR2A 5L3BA 3L9FA 1ZG1A 3TGNA 4I7HA 2EWNA 4IVNA 2ZFWA 3M1EA 1DP7P 4LK1F 2HFHA 4E70A 2FMLA 3SZPA 4CO8A 2VOOA 1MJBA 1H9GA 2P7VB 1TQIA 3CUOA 4YIFA 3AAFA 4RGXA 1I1GA 3WE3A 3I58A 4ENNA 2FE3A 1IW7F 4RGSA 3V8KA 1QZYA 3E3VA 4PGGA 4CYDA 2A61A 1MDMB 1ZYRF 4LGWA 5D4RA 1EV7A 2ZCWA 4HX8A 2FXAA 5LRSA 2X0LA 4A0XA 3ML6A 2FQ3A 3RKYA 3MFKA 2QYOA 1IRFA 3J80Z 5HDGA 3TKYA 2HS5A 1FSHA 1S7AA 4Q47A 2KIUA 5ICGA 3E5XA 2Q0OA 1XN7A 1ODDA 1QO0D 1I5ZA 2K4JA 4MTDA 2EFNA 3J81Z 3WGHA 2G7UA 3V7CA 2OBPA 5E1XA 2GA1A 2FBIA 4OIQF 4HX4A 3KZYA 2IP2A 4IRHA 5EEHA 1BJAA 1FY7A 2RGVA 3QU3A 5J8FA 3L2CA 2MH9A 4UVCA 5A2QZ 3L09A 5CVIA 2A3SA 2XKOA 5CVVA 1I1SA 2RQPA 2QQBA 3GF2A 2O0YA 4ZZLA 4L0YB 5KK1A 4WF2A 3MAJA 5LGNA 1SD6A 2VC1A 2QWWA 1FYKA 2E1NA 1ZG3A 2PJPA 5BOXA 2W57A 4CDGA 1WKMA 2ZNZA 2MA3A 1Z6RA 3QU6A 4QLCU 1Z6TA 1H9TA 2ESHA 4S05A 3RPQA 3WODF 3WU0A 1SFXA 1YTYA 3JTHA 3BJ6A 4JK1X 5AIPA 2MBFA 2OZUA 3PQKA 3E6CC 3ROUA 5FD6A 4MNUA 5HOOA 4UHTA 4OMZA 1JHHA 2FU4A 1G3SA 1BM9A 2W25A 3WTWC 1Z05A 1YW7A 4RB1A 2CSOA 3GW2A 3REOA 1R22A 5LHGA 1R7JA 2DU9A 1SMYF 1ZN2A 3RYPA 2R7DA 3TO7A 3V8LA 3BWGA 4KIBA 3JSPA 2NNNA 4EVIA 2KKOA 5DUKA 3GUDA 5ILVA 2ISYA 1R5GA 4G7ZF 4ESFA 2JPCA 2EB7A 3IKVA 3WGIA 1E2XA 2O03A 4HF0A 1KYZA 1FBUA 2VN2A 3KETA 3HOSA 2LF7A 5FLXZ 5D8KB 3WU1B 4QWQA 4HF2A 3LAJA 4HZFA 5E17F 1MD0A 5L3GA 4UVAA 3Q9VA 3SQNA 1U2WA 4OMYA 2OQGA 5DYMA 1ZH5A 2V1DA 2BV6A 1G6NA 3JSOA 1T2KA 4HYEA 5LRRA 5D4SA 3MZHA 3FMRA 1MZBA 3WTZA 4NQWA 3G3ZA 4ASNA 3L7WA 4TV7A 1AWCA 1S29A 2Z9OA 1W7PA 4H0EA 3T5XA 4RB2C 1WI9A 2R3SA 3HSFA 1J75A 4ESJA 4M74A 4EM2A 2DW4A 4CICA 3GZ6A 5ICCA 4LLGF 1XMAA 3EUHA 1TNTA 2QM3A 4Z2YA 5JI6A 2VBXA 4IF4A 3LA3A 3OOPA 1W5SA 5E8IA 3OV8A 4LJZF 3PQJA 4L9VA 4WCGA 5L3CA 2CGPA 2A6HF 4CXFA 5KVRA 2G7HA 4UV8A 2VT3A 3B73A 2KRFA 1ZARA 3EYYA 4GXOA 2LKPA 1P4AA 1U5TC 2BYVE 2B0LA 1YYVA 1W7PD 3HRTA 2M5WA 2NAZA 4OU0A 1XCVA 3SHFA 3IRQA 2M30A 3FF5A 1IN6A 3DV8A 3HHHA 2MD5A 4LLNA 2P5VA 2IT0A 3FM3A 4A6EA 1PP8F 2Z3YA 1S8NA 4JQFA 4UV9A 4ENMA 2D2WA 5ERIA 1KYWA 5JR3A 1YQAA 3MWMA 3BP8A 1ZG5A 4A0ZA 3I53A 4WK8F
chains in the Genus database with same CATH superfamily
3HKZA 4XLPF 2MYSA 4M6VA 1E3PA 3DFGA 4XLHA 5HLTA 3HTUA 1ETVA 4H4KC 3I4PA 4C30A 4AVPA 2Y0SA 3G1LA 3QOPA 4X6AJ 3FIWA 3DWLE 3NRVA 2IBDA 3DEUA 3GTGJ 3F6VA 2RAEA 1P7IA 3N4MA 4A12A 2M0MA 2JN6A 4L9JA 2F6CA 2L54A 1L0OC 2AHQA 3OYKA 1MMGA 3GFMA 3OOUA 3NEUA 4P55A 1RRJA 3S32A 1A5JA 3HJEA 4BNCA 5KAFC 1MNMC 4IOCF 2E2HJ 1YX5A 4QIWN 4KFCA 3MMYB 4MLOA 4R79A 2GWRA 5CLSA 3D0SA 2ADUA 2VOPA 1U6GA 3LSJA 2D1HA 4ZC3A 1ONVA 1K6OA 5D5VB 2TRTA 3P9IA 1D1AA 5LHHA 3CUQA 2GZWA 5DUIA 1B8IA 1IN5A 2M2EA 4ZYDA 1Y1WJ 3HG9A 2LP0A 3PNVA 1QHHD 3F8BA 4CZZA 2XB5A 4DGWB 1HDDC 2STTA 2Y75A 3EPZA 4CHUA 1UFMA 2E5ZA 3PFIA 2GLOA 4PJ0C 1K83J 1MSEC 5BPDA 1AKHB 1IV8A 3ECHA 3ZMSA 2LY2A 2R7OA 5E1ZB 4GYGA 4G7HF 1FJLA 2ZMEA 2K02A 2R7ZJ 1OCCH 1FP2A 2H94A 3AG3H 3ELKA 3HL2A 3SXYA 4M6YA 3TO6A 2W7NA 1ZLJA 4XKCA 2HTJA 3OMYA 1WCMJ 3F8MA 2QQ8A 3FZVA 1DGRM 3MN2A 3NQOA 2JRMA 5ICEA 3P9KA 2IS4A 1UHMA 2CUEA 3ISPA 1IRZA 1Z77A 3PSFA 4PSWA 1VNDA 3RI4A 3BTCA 2R7XA 3S1MJ 2FOWA 4D5CA 2ZJPF 2R5ZA 1JUMA 4BHCA 1X1BA 1SAUA 2E35A 4EGZA 1IUYA 1SFEA 1HW5A 3C1DA 2V26A 5DEQA 1LDJA 3KX2A 2FF4A 3QWLA 3V7SA 2RDPA 3R60A 3MKYB 1KQ9A 1X1AA 3NWTA 3H92A 4U7BA 2V6EA 2DBBA 1G3WA 2NS7A 4AC0A 2BY3A 2E2IJ 4B4CA 2DJIA 2HVQA 2DCEA 5CKTA 2E1MB 3WHCA 1OR7C 1MBGA 1FBQA 4I0BA 3BG9A 4M9ZA 5FB2A 1EA3A 3BDDA 4EGYA 2HYJA 4E7ZA 3JTGA 2R7VA 1X3WB 1MBHA 4EJVA 1Z3YA 3LMMA 1QZZA 4XK4A 1X3UA 5D6FA 3WTUC 1G4DA 2HZTA 2VJ5A 1TLHB 3ESWB 1BBYA 4UVBA 3WGGA 1JTYA 4WXCA 3BR3A 1LFPA 3HC7A 3S1QJ 4LFUA 1GXQA 3OS0A 1KU7A 3OYBA 1AHDP 3U2RA 1OPCA 1TQMA 4LG0A 2QBYA 3HIFA 1R1UA 1V5EA 3I4MJ 3MVPA 3PNYA 5D8LB 5HDNA 1TWHJ 4AIDA 4HNTA 2VE9A 1O3RA 1XDUA 2AXLA 2GAUA 1CF7A 1E3HA 2HQRA 3BQZA 5DV5A 4C2MJ 2QQAA 4RLQA 2KFDA 2LY9A 2DOFA 3OIQA 3HBLA 4C2TA 4OOIA 3HHGA 4FHTA 3KEYA 4LK0F 1D3YA 2XAFA 2ZB9A 4UXNA 3KCCA 3WE2A 1NG6A 2DMTA 3LFKA 5ILUA 4BBRJ 1RC9A 2EINH 3LSIA 3I59A 2ZJRF 2QENA 2LYCA 3RJPA 4G12A 1XGOA 4NNJA 4B43A 2P7CB 3BC8A 4UB8C 2HVRA 2MFZA 4JP0A 2XSJC 2XAUA 3LFUA 5DCMB 3K10A 4MEYF 1HKSA 1R00A 2VKEA 5L3DA 3FXUA 1HW2A 2YPRA 1APLC 1HOMA 5ILSA 3BR5A 1Z21A 1OYWA 2KP6A 3KP4A 2VC0A 3A03A 4M3GA 5CVJA 4I02A 4P5OA 3UR3C 1FOWA 2IA1A 3C2HA 1AOYA 5J40A 1U78A 3G2BA 3S2WA 4I99C 1LE8B 3ASOH 1IXCA 4CZCA 4RAZA 5DDGA 1EH6A 1DUXC 3JRFA 1Y56A 3CCMI 3ECOA 3PO2J 4HA8A 3ZQFA 4S04A 1ON1A 3CCYA 2R5YB 1W5TA 2NVXJ 3HOTA 3OR1C 4A3JJ 1K4TA 4GDFA 4JBAA 4MFDA 4A3DJ 4R1HA 1GLNA 2DOAA 1SAXA 4KICA 1XMXA 1HKTA 3IL2A 3KYCB 3S8PA 2DT6A 3VB2A 4N9IA 1ZRFA 3IWFA 2GOXB 2OU2A 1XMKA 4M9SA 1UB9A 4U0VA 1IN7A 1D0ZA 1A6QA 1GHCA 2TDXA 4C3JJ 2ZSHB 2VODA 1F4KA 3DKXA 5LEJA 1XTAA 1Y0UA 1OMIA 4YRVA 3F3XA 1QA6A 4P9FA 2P5LC 2MC3A 4ZYAA 1GV2A 1P4WA 1RESA 3ABTA 1VFCA 4Z6YA 4DYCA 4PUSA 3FDYA 2KMUA 5IT9K 3BCAA 5GPAA 5ICFA 3GBGA 3VEPA 4Y17A 5FJ8J 3ZQ7A 3FBNB 4RLFA 2Z5UA 3RTRA 1F5TA 4YEJA 2CUJA 3HUGA 5EZGA 2DPUA 2NOJB 2XGDA 3KIOA 1NH3A 4HOBA 1FZPB 1YE9A 1UCRA 1FOKA 2GQQA 1RIOH 1IUFA 2KQRA 1EKEA 4AIHA 2A6EF 1XB4A 2WC2A 3KLNA 1R23A 1D0XA 2WAFA 3ABKH 4XONA 1T39A 2LSOA 5E3OA 1RZ4A 1VQNI 1V3FA 2YX4A 1RR7A 5FROA 3R6SA 2P81A 2KLOA 2XHKA 4II2A 2VLAA 3T0YA 1KU2A 1WQ2A 2OD5A 5HS8A 5F0CA 1T33A 2X6WA 3FXOA 4CCOA 3M9AA 4JX5A 3QYFA 2NXNB 4P96A 2H27A 1VTNC 3ZQQA 3GLLA 2V1NA 2X6OA 5JHUA 5EEAA 3KP5A 3S3OA 2GXAA 4RGUA 1KQ8A 2ESNA 1KU3A 2LDUA 3W6VA 2OZ6A 2OV7A 5EDNA 2R7FA 3ZMZA 4KIFA 1Y8RB 5J1RA 2NVTJ 2R0QC 1G8XA 2Y2ZA 2K40A 3I56I 3COAC 4NC6A 1GDTA 1WHUA 1ZREA 1LDDA 1BI2A 3JAMK 4DNCA 2JPBA 4B09A 2ZBKA 4BJ6C 2UXNA 3DEWA 4MTEA 4O3MA 2EK5A 4EM0B 3M4OJ 2XVCA 5BS6A 2L2OA 2FEZA 1NTCA 2WAQA 2PLYA 2VE8A 1K78A 1BOAA 3HB9A 4RDUA 1R58A 4FISA 4GYIA 2CW8A 2M9HA 2HOAA 2L0KA 3K70D 6PAXA 2X6YA 3RDIA 3OY9A 1P2FA 3E6BA 2R7SA 1G59A 3RKXA 3RYRA 1K7AA 2GXGA 5HS9A 4BEHA 1VQ9I 2VONA 3IWZA 1Z0XA 2I10A 1TW2A 2DT5A 1SD4A 3ZCOA 1B72A 2IEKA 4M72A 2DAOA 2O6GE 3JW4A 4LIUA 3U21A 3H9GA 4LIVA 2IS6A 3BLYA 4G6DA 1FTZA 3K2ZA 5DS9A 1I3QJ 3KP3A 3E6DA 3GO5A 1HQCA 3DLLF 1F9NA 2HYGD 1YRNB 4PFPA 4DQ2A 4D1QA 2WV1A 2PQ8A 2XAQA 4JYKA 5HLHA 2FMYA 3K1MA 3OYEA 3IC7A 4NQWB 3AG2H 4V2GA 5K5RA 2JA2A 2DYRH 4XLFA 4ABZA 2D45A 1WJFA 2PMZA 4PK4A 4XRFA 1L3LA 4RS8A 1W7PB 1U8RA 3B02A 1ZQ3P 4HW0A 3OYHA 2W85A 2FBKA 1X58A 4V19K 2V79A 3BJOA 4A3LJ 4BHPA 4Q4ZF 4BDZA 4P1WA 2M87A 2JSPA 2F5VA 3FHZA 3O2PE 3LQQA 1F1ZA 4IJAA 1R49A 3EDPA 1USSA 3OL3A 4CSWA 4HRIA 1BW5A 1LFUP 4FE4A 2IPQX 1D1CA 1X19A 2RNGA 4Y33A 3LSMA 3D1NI 3HOZJ 1JKRC 3CCRI 3HOVJ 3KZZA 2LC2A 1HKQA 4E6KG 1IRGA 2EFWA 2EZKA 2K86A 4KA4A 1O3QA 2QSGX 2F48A 2KZGA 1OCRH 4B48A 2GM4A 1B6AA 5LEKA 5DD8A 2F4IA 2BBYA 2EV6A 4G9YA 1QPMA 1CGPA 4LITA 4AWXB 3C18A 1JJ6C 4WX9A 4R8HA 1A35A 5E79C 2BY1A 1WRJA 2VXZA 4QTRA 1IXSB 1OJLA 3KYLA 2Z33A 3VYSB 3EYIA 2KRCA 2DODA 4B44A 2VIXA 4IHVA 2M1BA 3Q9SA 1FOYA 2RV8A 5FFXA 1HW1A 1X1CA 1OKRA 3ZR8X 2FRHA 2CUFA 3OR2C 1PUFA 2FQ4A 3ONQA 2E7XA 2PI0A 1R4NB 2M45A 3ZMVA 3I55I 2HTSA 2EA2A 1I39A 1B4AA 5FKOA 4CCMA 3R61A 3LSHA 5LLQA 3RQIA 2ID3A 3A0HC 3TO9A 2CFOA 1R6RA 4XLCA 3RIRA 1TBXA 2DK5A 3ZQGA 3N97A 3HRUA 3V4GA 1WH5A 3H0DA 4BACA 3GFJA 5M5YJ 5FGMA 2Y9YA 2DTRA 2EH3A 2EV0A 3J7ZI 4M71A 4EJUA 1LDKB 3F72A 4YIRX 4FE7A 1ETXA 2W4SA 5E20A 1O57A 2XAJA 3S3NA 2EPFA 4HDUA 2JK3A 1S72I 3RZOJ 4G6QA 3CJNA 3VYTB 5J1YA 1C0WA 4FQGA 1RKTA 1FMWA 3FWEA 3IH4A 3K4BA 1YO5C 4UNOA 2FNPA 2DQRA 5IY5H 4IOAF 2RKHA 4RB3C 4U0YA 4IHTA 1MBFA 3LSKA 2VI6A 3TP0A 2GXBA 2CQXA 5HODA 2XKPA 2IA2A 5IYCJ 2BHYA 1TP4A 5F6FA 3J80K 1HSJA 3DBLB 2G9WA 1TNSA 3QP5A 4K2EA 1IXRC 1FLIA 4DZPA 4RAYA 3SDBA 3CQZJ 2GIVA 3BQYA 2PN6A 3BTJA 3P5JA 3DU5A 1D8JA 1ITYA 2ZXJA 2CG4A 5F1JA 1PDNC 4D7NA 3IAM2 1JHFA 2VPLA 4LMYA 3J81K 3HKZN 4FX4A 3A01A 2KJCA 2XF5A 3ZMDA 2ZO4A 1IZ1A 2AS5F 4V2FA 5D5UB 1XS9A 2Z16A 1HSTA 2DN0A 2ETHA 5E8GA 3VYUB 4AIJA 5H6RA 2K3PA 3IAS2 4KT6A 4E7JA 1V5GA 3KYDB 3RQ4A 5KHDA 1I50J 5LBQA 4MGRA 1GVJA 2DA7A 1VQPI 5AONA 2UZKA 1YJ9I 4HSTA 3V8JA 2OC6A 1JKQC 3CUQB 3CO6C 4IHSA 1WPKA 1B8IB 5BMZA 3OYNA 2MD0A 4KNYA 1DGWY 4OIRF 5A2QK 2XASA 4ETSA 2A5YB 2ZNYA 4MQ9F 2P5KA 3F8NA 3CO7C 4I09A 4Y7NJ 1U5TA 5B3SH 2WA0A 1X4OA 2JZYA 2ZC2A 2XSDC 3D5SC 2CQNA 2XROA 1TQPA 5FRNA 3BJAA 2M4KA 1B59A 2ZMEB 4AM3A 3H3ZA 1O7FA 1N77A 5TRDA 4HBLA 1T38A 2MG4A 3WTXC 3JRIA 4BGDA 3GXOA 2W84A 1BC8C 1MBEA 1BA5A 5DCFA 1U9OA 2BEOA 1I3AA 1RNLA 2Z99A 1IN4A 2FUG2 2WB1A 5DD4A 2LY1A 3ZQLA 1JE8A 3DBRB 2VJJA 3QQAA 1BW6A 3OIOA 1XD7A 1S7OA 2L7ZA 4ZDPA 2FNAA 2UUZA 2HVSA 1JUSA 1VF9A 1J7KA 3LL7A 5BQTA 1Z3XA 2L4MA 2Z2SB 3CDHA 5TJJA 2R5ZB 1I27A 1O7LA 4HLXA 3OYCA 3CESA 1G3YA 4RBOA 2WADA 2QVOA 3X2QH 2HPMA 3HOXJ 2A07F 3PL8A 2HDWA 4HQMA 5M5XJ 2EFQA 2Q2EA 2YX7A 4LG3A 3JRHA 4ZTFA 2R93J 3SDGA 4A2UA 2DK8A 1YHQI 4IHWA 2JUGA 4BL0B 1P6RA 5TGTA 2FOKA 2NNYA 4XBFA 2PG4A 2IVMA 2VPRA 2LKSA 2OCCH 1Z1DA 2K5CA 3FX3A 2LH9A 3BPXA 1X2NA 2FSWA 2ZFUA 5FKNA 4LOCA 1MSFC 2I5UA 1I6HJ 1Y0NA 2DLLA 2V9VA 4N4NB 4X0GA 5CJ9A 1W36D 2O8KA 2CYYA 2E71A 2B7EA 2CWEA 1QRYA 2OPTA 1QVTA 4IX7A 2DDAA 1OCTC 3EQLF 1D8KA 2KDZA 1EH7A 1Q1HA 4ESBA 4KN7X 4NHJA 1JGGA 4XORA 4F3QA 2IS1A 1BN5A 3IKTA 1CF7B 2LR8A 3FM5A 3KEQA 4JX6A 1KU9A 3JRGA 1MBKA 2MLGA 4RAGA 2VQCA 4YIIA 2LREA 1STZA 3ULQB 4P9UA 2K9MA 3BPVA 5BNGA 1SFUA 1FNNA 3EUKL 2AXTC 2CQ7A 1EH8A 4CH7A 1DU6A 5K1YA 3CZ6A 1U3EM 5J6XA 1AU7A 5L3EA 2N8GA 4OIPF 1U0JA 4BXFA 1K4SA 1IN8A 1ETKA 3HEFA 3SEZA 4KJZA 2XUBA 1TC3C 1N78A 3CUQC 3I59B 4BDYA 4IL6C 3BG3A 3TDUC 2IGMA 4XLNF 2ZKZA 4KDPA 2KPMA 1JKOC 3P7NA 4A3EJ 2IRFG 3C3WA 4OINF 1ZTRA 3GTJJ 3FXRA 4BBSJ 4N9HA 4RA2A 3BY6A 4ZH4F 3F23A 2VT2A 2L3DA 2NOGA 3I71A 1JTXA 3H0GJ 4E7IA 3S1NJ 1BJZA 4UUSA 3CP2A 2FD5A 2ZMEC 3B6CA 1TWAJ 2M8GX 1OR7A 4BYYA 2E1CA 1LEAA 5FLXK 4OAZA 2V1UA 2JRTA 5F64A 1ZELA 3TQNA 2GA2A 4ZYHA 4GGGA 1IRXA 3ABUA 1YITI 2NYXA 2DQLA 4Y13A 4DYQA 2GIZA 4ANJA 1MH3A 3GX4X 1PUEE 3HTSB 4E7SA 2E1OA 2I8DA 3T8RA 4YFXF 3GMEA 4MFEA 2K9QA 4BS9A 2YU3A 1F36A 3K4CA 3AG1H 1BR1A 1LVKA 3FMSA 3VYRB 4A3IJ 1HCRA 1IDZA 1SEUA 4BXUA 3I4NJ 4J01A 2PJRA 4BQQA 3CCEI 4EJTA 4C3HJ 1T08B 3GTMJ 1UMQA 3LA7A 3ERED 5JLXA 1D1BA 3Q3SA 2LG4A 1TL8A 1RI7A 4FT8A 5KAIC 4C9YA 3BTLA 4LB5A 2STWA 5F04A 3CC4I 2L7KA 1REPC 4LLLA 3VFZA 1JGSA 4AD9A 1A04A 2LTPA 3K4NA 5FO5A 4C2UA 1J5YA 1FX7A 2MH2A 2J5OA 3CCQI 3KLOA 2ELKA 3VOEA 5C4XJ 1Z7LA 2VKHA 3VODA 4L0ZB 4Y15A 1SD7A 1Y39A 3HUGB 5B5EC 1OCOH 1TW3A 2OJED 3MZ8A 1XGSA 2P4WA 3CCJI 4BXXJ 3VWBA 3J7AO 5IOZA 3BR0A 1KGSA 1S5LC 2QQ9A 4HAMA 1TWFJ 3C2BA 3MZYA 2KJBA 3K4KA 3BZ6A 1LEBA 1WJAA 2OTJI 4ZZDA 5GP9A 4M6XA 4FX0A 4NDLA 1EF4A 5J8CA 4KUMA 2EZIA 4IRGA 1HDPA 3TOAA 1BI0A 2L9NA 2A05A 4MO7A 2C6YA 1MBJA 3KZIC 2CJJA 2X51A 2JMWA 2K7LA 4QSHA 1XGNA 3RZDJ 4DJAA 3H3UA 2HQ5A 4O6JA 4OIOF 3GCMA 5CYVA 3R4KA 3PFYA 3KPHA 5B1AH 1SVLA 2BE5F 2X4HA 1ZRCA 2TCTA 3HXLA 1W4MA 2DXIA 5EF6A 3QODA 2RN7A 4B3XA 3D5LA 1LUJB 3TW7A 2WWYA 1OCPA 1NHAA 2DA2A 2EJRA 4HEA2 1OYYA 3V7RA 3QYBA 2ACJA 1R1TA 3K9TA 3RSNA 1Q1VA 3K4JA 2V6CA 3OSGA 1FSEA 2EILH 2LRDA 1P9QC 1ZK8A 3TEDA 5B66C 3LQRA 3MKWB 1O3TA 3F8FA 3F21A 2VL8A 4KN4X 2X1CA 3IH3A 2OA4A 1K78B 2IA0A 3OS2A 1FPQA 3RCOA 5H2FC 2OAZA 3FXKA 3SJMA 2DA5A 3CMYA 4BE0A 4CUGA 1K79A 5EGOA 3JRAA 2E1MC 2XDVA 2F5FA 1N75A 3GTQJ 5J4YA 5LGUA 4XR6A 3L2RA 4II3A 4A5MA 2ECCA 3O6BB 3ZN0A 2HGCA 3L2VA 3A4CA 2H1LA 1GT0C 3F6OA 3P9CA 1D0YA 2P8TA 2CW0F 3TOBA 5LHIA 5CVRA 2LLKA 1XX5A 1YW9A 4DW6A 2JT1A 2LBFA 3O3KA 4N4OB 1D5VA 3BZCA 1LJ9A 2CRGA 4PJLA 4L5IA 1B72B 1BI1A 2ME0A 4EMSA 4RB0A 5IP7J 3OWTA 4XICA 2O3FA 4KMUX 5HLIA 4WXDA 3W2WA 4XKWA 1XSXA 1DU0A 1WJDA 3WTTC 3S14J 3F22A 2F5EA 1SD5A 3GYHX 2PMHA 1ZGAA 3ZRGA 4M3DA 4XN0A 3MCZA 2COBA 4XLAA 1R36A 1FIPA 3VPRA 4L5EA 1S3JA 2ID6A 1JT6A 3CC7I 3L2QA 2L5QA 2M4GA 2KIQA 3L1PA 1YIJI 2LK2A 4FTHA 4Q48A 3DXJF 3DTEA 4L9TA 1VQOI 1Z9CA 2JA5J 2CMPA 2EA4A 4PJMA 3K70C 2PMZN 5IYDJ 2M8EA 3JRCA 5DCMA 4XQFA 3R0JA 2H6CA 2IGOA 3S3MA 2XAHA 4L9NA 2H09A 2WAEA 3MQ0A 2LMDA 4ZYEA 2F5DA 3AFHA 5F08A 4E7LA 2CFXA 3MD2A 2X85A 2PX9A 3OYGA 3NAUA 1TT0A 1JKPC 2H6BA 3NARA 4CCKA 4N0BA 2COMA 2GBYA 3QPHA 4AYBN 2JJ7A 2KDOA 2CW7A 3H5RA 5FFZA 4A3FJ 4BE1A 1ZGWA 1I6XA 3H9QA 4NC7A 3QP6A 2ZXWH 1FIAA 3RKWA 4HG2A 2HOEA 3H36A 4U88A 4D9JA 4MEXF 1LKXA 2DFHA 2M0CA 4QPQA 2CV0A 2HYFA 4DZJA 1GV5A 3BR1A 2HXOA 3BOQA 4ZJZA 4J19A 3CD6I 2KL4A 2JSCA 1ZR4A 1MDMA 3TBIA 1UJ8A 2XAGA 1H0MA 1GVDA 2L01A 2XIGA 4PDKA 2LFBA 4IPAA 2DA6A 2XF7A 1S9HA 3O8GA 1FTTA 3H9JA 5E1WA 3E7LA 2ZJ2A 1PUFB 1B9MA 3KP6A 3BROA 2JQ7A 4EM1A 1QBJA 3HOYJ 4AUXA 2KRHA 4LD5A 2E19A 3BG6A 3DPTA 5BPIA 2K4BA 2FBHA 5LD2C 4A5NA 1V5FA 1YS7A 3ZPLA 1SFOJ 2RC4A 3AL0B 2XRNA 1CQTA 5H20A 4MHGA 4CGZA 4EJOA 4KT5C 1WJCA 4G8XA 4I2OA 1YLFA 5HS7A 3TDZC 2DFIA 4HDVA 1SMTA 2PBIA 1PP7U 2YU9J 1ORKA 3C7JA 1R5ID 2W48A 4KISA 4XRSG 4DBQA 3WTVC 3HM5A 2O61A 4E4HA 4BHBA 2BOLA 2E7WA 3E97A 4F93B 1FOXA 2CO5A 2F4OB 2QGUA 2IAIA 4BQAA 2HNHA 1FBSA 2FA5A 2EZHA 2ELHA 2K27A 4XNFA 3ZN1A 5FKMA 1NK2P 2ELJA 3TL4X 1TWCJ 5K7FA 4QPOA 3RKQA 2WY8Q 1BR4A 1IV6A 3JRBA 2M7BA 1VQ8I 2E2JJ 3CMMA 5GTHC 5M3FJ 4KIGA 4G94A 4HV6A 2F5CA 3TP3A 3A01B 3GFIA 2HU9A 1QVUA 2XV4S 3M1CA 4GCVA 1XG1A 2L4AA 2PFBA 2WV0A 1T98A 3B6AA 1ZKGA 2YS9A 3KE2A 2W24A 1HBXG 3R0AA 2PMUA 2BXZA 2DA4A 4ON0A 4F92B 2OQRA 1ZLKA 4BY1J 1BC7C 3LAPA 2JA8J 3DP7A 3ZXSA 1Z67A 1A31A 1LQ1A 5DM7F 4U7DA 4IEJA 3SFZA 3K1NA 1U5TB 5FLMJ 4A69C 3QPTA 2JVHA 4B1RA 3DPUA 2AQFA 2F4MB 4HX7A 4I98B 3OYAA 2PEXA 1P4XA 2DMUA 4W97A 1MIJA 4A0YA 4DIQA 2D5VA 1O3SA 3ZMUA 1FEXA 2LKXA 1MMNA 3PO3J 3SZTA 4BAYA 5L3FA 2IW5A 5F27A 5J3LA 2XF6A 3DLAA 4GO1A 9ANTA 2UWMA 4O5VA 1A36A 4L18B 3PIOF 1ZR2A 3H3VK 3F9KA 4NB5A 2UXXA 3W6KB 1RUOA 2BW3A 3E5QA 2M7AA 5F1RA 2K3FA 5EZHA 4G7OF 1IC8A 1IF1A 1YW8A 1ERDA 5FKKA 2IGNA 2CS3A 5AIQA 1B1BA 3LNQA 3BT9A 2EBIA 3ZMTA 4ZYGA 4F91B 2XPWA 4DOZA 1YRNA 5IP9J 3FK7A 2Q1ZB 2BXYA 3MKLA 1KA8A 1XSVA 2Q2EB 1OQYA 1P92A 3IP4B 5HVQC 4BQOA 1J0RA 2L9RA 3ZQCA 3FK6A 2RREA 1VQ6I 2RVCA 2L02A 1E17A 5K5QA 5DTDA 2JA7J 1KQ0A 1USTA 4PGHA 3BZKA 1T0FA 5EG0A 1BL0A 4RM2A 2Y0SN 4EV0A 1SFKA 5C3EJ 5E3MA 1BIAA 3T8TA 4YFNF 2HQNA 4D0PA 5CVUA 1XCBA 3BR6A 5J4VA 5FRMA 3KP7A 2BGCA 1VQLI 1DPUA 4EJWA 4UUVA 2VQLA 1J9IA 2DT7B 2P6SA 4XSZF 4XLEA 4LB6B 2HR3A 5LGTA 2W1OA 2L9SA 4WXHA 4S0HB 1WSUA 3V42A 2WTEA 4MQVA 3OYMA 3HYIA 2QEXI 3EUHC 2HDCA 3JREA 2DA1A 4J00A 2E34A 3E5UA 1MNDA 1YFHA 4NBQA 2Q8KA 1VQMI 3Q5FA 4F7ZA 2P6TA 3M7GA 2JTVA 2J5PA 4W1UA 2RNJA 5LFAA 2ISZA 3OYJA 1J59A 1GUUA 2XRLA 3CLOA 2JVGA 4KYWA 3GTKJ 4NUBA 4M73A 3RPUA 2D1VA 3DPLC 1V54H 2HKOA 2NS0A 1FMVA 2CQQA 2HOTA 2NVQJ 1Y1VJ 1DPRA 3A2KA 3DKWA 4PSXA 4ZTJA 3HRSA 1A6IA 2YSRA 1OYIA 2DI3A 1G3TA 1ZAOA 3FMQA 2DPDA 1MKMA 3GWZA 1FP1D 1W36C 5IOYA 2KZVA 2M3AA 1S6LA 4WWCA 1YS6A 3I0TA 2KIFA 4XIDA 1X1PA 3GFLA 3E6MA 4CYCA 2XGXA 3O8HA 3I64A 4AVZA 4UUSB 2CV2A 3HZJA 3S2HJ 3GZ5A 1YX3A 3VSLA 2BY2A 2KT0A 3U9GA 2EV5A 3KP2A 5GAEJ 2BY0A 1FT9A 2EFOA 3FHNA 1YG2A 3K4LA 2QKMB 4YFKF 3W2AA 2DFEA 2E5NA 4Y4RA 2L7MP 3IHUA 4Q5SF 1OCZH 2K9NA 4IZZA 3HOUJ 1BOBA 1P7JA 1XDSA 1GXPA 4D7MA 4A6DA 1H88C 2HWVA 3GVAA 1R4MB 3E0JB 3F8CA 1BR2A 2HZDA 1F43A 5EEGA 1XPXA 5JVTA 2VJIA 1SVMA 1TTYA 3VSKA 3PUBA 3CMEI 1FYLA 4HF1A 2ZXIA 4IRIA 3ABLH 2PJRB 4BY7J 2O7OA 2VKDA 3UKGA 2QLZA 3PM1A 4XKBA 2QUFA 1LNWA 3LWFA 5IT9Z 1V55H 2EIJH 2MABA 1XSDA 4AIKA 3GLXA 3MEXA 1HXDA 4LG0B 2VBYA 3T1BA 2QBYB 1IAWA 3M3YJ 3QAHA 1ZGJA 2ZXHA 4JOMA 1VI0A 3LA2A 1MMSA 4C3IJ 2CUZA 3RPUD 4B8XA 2MLKA 1V4RA 3J7AY 1JXSA 1QNTA 3AKZA 2MGQA 3FBIB 1WJEA 2DMNA 2HEOA 1RUNA 2LOOA 4BH9A 3MKZA 5HLGA 3G73A 3FXQA 2Y0MA 1WI3A 2JUCA 1W1WE 1YIOA 4ITVA 1J2XA 4U0WA 2Y48A 3AG4H 3OL4A 2LD5A 5IYBJ 4ENKA 4Y3OA 1LB2A 2DO7A 3DQVC 4I6ZA 1WH7A 3I3LA 1ETQA 2OTLI 1FYMA 3HSRA 4KITB 1JUPA 4EQQA 1R1VA 3HRMA 2LNBA 3I54A 5J47A 3GTOJ 3L00A 3QPLA 2CQKA 5IP6A 4M3FA 1IG7A 2XGCA 1UG0A 5H6QA 3S93A 3VDXA 1SVOA 5C4JJ 1ZRDA 3ZP5A 2KIMA 4XOTA 2V1XA 4E7HA 2R4GA 1BIBA 4XSXF 2A5WA 3ZQIA 1Z91A 1ULYA 3PSIA 3JAMZ 2HPIA 3NWSA 3LSPA 4XM3A 3A02A 2OUMA 5ED4A 4HLYA 2A6TA 2QZ8A 1QQIA 1ENHA 3Q0WA 1YJWI 1MJ9A 2DJNA 3W2VA 5D6EA 4KMFA 2F2EA 3W6JB 4BJTA 2VASA 4FASD 2NS8A 5FD5A 4BJ5C 4M9XA 4L5JA 4RGRA 4BKXA 2DTZA 2A68F 4G6TB 3H35A 2GOMA 4A3GJ 4HNVA 1ON2A 1T6SA 1BI3A 3QRFF 1POGA 3K2AA 4XRSA 3IUOA 4HQEA 1XGMA 3OS1A 1QZEA 4FCYA 4CCJA 1KONA 4HV5A 1MJAA 5D5XB 3CC2I 1WWXA 5E18F 1DDNA 1ZHFA 4XRMA 1DP3A 4F52A 3FXMA 5D5WB 3EETA 3GEZA 5CQGA 3M8FA 1VQKI 1WZ2A 3WG9A 2UV1A 1WVRA 5IPAA 3JR9A 3U1DA 4RAFA 4IXAA 3K0LA 2EFPA 3K69A 5M5WJ 5EGOB 2VBWA 5K7HA 4B47A 2CU7A 2IGKA 3ZQHA 4ENJA 1R9TJ 2HKXA 3KFWX 4I01A 4YELA 4PZJA 1QGPA 1O4XA 2M34A 3K1PA 2XPUA 3LSTA 3M8EA 1UELB 2IJLA 4CA0A 3DF8A 3PUFA 5TISC 3M07A 3G1MA 2K85A 2LBFB 3IH2A 3WG7H 5K5OA 2A69F 2W00A 2MC4A 5JVGF 3A0BC 1FC3A 2P0WA 5JFRA 2R7WA 1G2HA 1Z7UA 2NVYJ 2E36A 4MIMA 4FETA 2NRAC 2VBZA 1T95A 1UHWA 1B9NA 2O5RA 3WTYC 3DKYA 4YG2F 2DMPA 1Y8QB 1OISA 2ICWG 1AKHA 1LVAA 3CP8A 3I5UA 2HDDA 5IT3A 3IRRA 2O8XA 3KEOA 3CJRB 2HQAA 1WJ5A 2LF8A 3HSEA 1N25A 4I0AA 5HDKA 3S16J 1FWZA 3DTIA 1R5HA 3DEEA 3CTAA 3WU2C 3FXLA 5CPRB 3SZGA 4PCQA 3WTSC 1S7EA 1MGTA 2HXIA 2YR2A 5L3BA 1X2MA 1PJRA 3L9FA 2R7QA 1ZG1A 3TGNA 1K61A 4I7HA 2EWNA 4PFOA 4IVNA 2WY7Q 3S1RJ 3CCLI 2ZFWA 2E60A 3E1SA 3M1EA 3CF2A 1DP7P 4LK1F 3ERMA 2HFHA 4E70A 2FMLA 3SZPA 4CO8A 5FLVA 2VOOA 3DCFA 2X1DA 3HOWJ 1MJBA 2QSHX 3DTKA 1H9GA 4IQ4A 2P7VB 1TQIA 3CUOA 4YIFA 4DYRA 3AAFA 4RGXA 1I1GA 3WE3A 4RM3A 1RKWA 2ECBA 2ZSIB 3I58A 3CDLA 4E7KA 3G71I 4ENNA 1RPWA 2FE3A 2ME6A 1IW7F 2V7FA 4RGSA 3V8KA 1QZYA 3E3VA 2AO9A 3BG7A 3K4MA 4PGGA 4CYDA 2XPVA 2RQQA 2NVUB 2A61A 4A3MJ 1Y6IA 1ZYRF 2B9SA 1MDMB 3G6EI 1RETA 2WAQN 4LGWA 5D4RA 1EV7A 2EIKH 2ZCWA 3CCUI 3G4SI 3H5AA 4BU2A 4HX8A 2H8WA 2FXAA 4BEHB 2FX0A 3CJTB 3WHBA 2VXDA 1T8IA 5LRSA 2X0LA 4A0XA 3ML6A 5GAGJ 2FQ3A 1MNEA 5F0FA 4B3AA 3RKYA 2B63J 3S17J 3MFKA 3FKJA 2QYOA 1IRFA 1ETYA 5C44J 3J80Z 2LVSA 5HDGA 1MW7A 3TKYA 4IKFA 2HS5A 3S2DJ 1FSHA 1S7AA 4Q47A 2H8RA 2KIUA 5GTIC 2DA3A 5ICGA 3E5XA 2Q0OA 1XN7A 3Q0VA 1ODDA 1QO0D 3G1OA 1I5ZA 4BUPA 2K4JA 4MTDA 3JRDA 3FISA 2EFNA 3J81Z 1VQ4I 3BTIA 2BZTA 3WGHA 2DOEA 2G7UA 3V7CA 1WFXA 3CMAI 5F0HA 2QSFX 2OBPA 5E1XA 2GA1A 5M3MJ 4HPQA 4F55A 2FBIA 2DMQA 1LPQA 2K9LA 4XN3A 4OIQF 1JT0A 4HX4A 4JX4A 3BCBA 1TT5B 1JJ8C 1WJBA 3L2WA 3SFIA 3KZYA 1E0EA 2X48A 4GFBA 4A3KJ 2IP2A 4IRHA 5EEHA 1YJNI 1BJAA 2BHZA 1FY7A 2RGVA 3QU3A 5J8FA 2OCEA 3L2CA 2MH9A 4UVCA 3BG5A 5A2QZ 3L09A 1XC5A 3H1CA 5CVIA 2QA4I 2KHMA 4DBRA 3TW6A 1HC8A 1TWGJ 4AU7A 2A3SA 1LE8A 3H5NA 2XKOA 5CVVA 1I1SA 2X1EA 3QPSA 3CLQA 2RQPA 2QQBA 1VQ5I 4M3EA 1E3OC 3GF2A 3GZNB 4XOPA 2O0YA 4ZZLA 3GTPJ 2R5YA 4L0YB 5KK1A 5DM6F 4WF2A 3MAJA 3LSRA 1H8AC 4OAYA 5LGNA 1J09A 1PVEA 4CCLA 1X1DA 1SD6A 2VC1A 2QWWA 3OYLA 4UUTA 2E1NA 1OLTA 1ZG3A 2VB6A 2ZJQF 1FYKA 2PJPA 5BOXA 2W57A 4CDGA 1W0UA 1WKMA 1UAAA 2W82A 2EZLA 1UZCA 2ZNZA 2MA3A 1MMDA 4BE2A 1Z6RA 1U8BA 3FXJA 3QU6A 4QLCU 5K7ZA 1Z6TA 1H9TA 2ESHA 4S05A 3BR2A 3RPQA 1SC7A 2X9DA 1UHSA 1QPIA 1OFCX 3WODF 2L9VA 3WU0A 3OYIA 3DBHB 3K6GA 1TZLA 1SFXA 1YTYA 3JTHA 3Q0UA 4A3CJ 3BJ6A 4JK1X 5KNLA 5AIPA 2BW3B 2MBFA 2OZUA 3PQKA 3E6CC 3PJRA 1IDYA 3ROUA 5FD6A 4MNUA 5HOOA 4UHTA 2DDBA 4OMZA 4UB6C 1JHHA 2EIMH 3K7AJ 5E3NA 2FU4A 1G3SA 1BM9A 2W25A 3WTWC 3OYDA 4U87A 4GRIA 1Z05A 1YW7A 2R7RA 2CSOA 4RB1A 1ACIA 3GW2A 3REOA 4HNUA 2DYSH 3SYTA 1R22A 4IHXA 5LHGA 2V9PA 2JWTA 2QCOA 3PNTA 3ZOBA 2OF7A 3JCUC 3EUAA 1R7JA 2DU9A 3L2UA 2G0EA 3QYEA 4IHYA 4PJNA 1SMYF 2VUMJ 1ETWA 1ZN2A 3RYPA 1IJWC 2R7DA 3TO7A 3V8LA 2FJ1A 4IQJA 3ABMH 3BWGA 2L7FP 4KIBA 4X1EA 1HA8A 5EG0B 4XKVA 1MH4A 3N05A 3JSPA 2NNNA 4EVIA 2KKOA 2WBMA 5DUKA 3GUDA 5ILVA 4AYBA 2XC7A 2ISYA 3HGGA 1U9NA 1R5GA 1WGXA 1X4PA 1UG2A 4G7ZF 2IXSA 2IS2A 4ESFA 2JPCA 2MSYA 1HF0A 2JA6J 2EB7A 2V4JC 3J7YJ 3IKVA 2K9SA 2Y69H 1DQUA 3WGIA 1E2XA 1YI2I 1ETOA 1MMAA 3OSFA 2O03A 4A3BJ 4Y52J 2H1KA 4HF0A 3FKIJ 3TMOA 4EEFG 2CH0A 1KYZA 1M1EB 1PYVA 2XB0X 1IGNA 2VJ4A 5E3LA 1FBUA 3ASNH 1W5CC 2O9LA 2VN2A 3KETA 3HOSA 2R92J 2LF7A 5FLXZ 5FKLA 4XMYA 5D8KB 3WU1B 4QWQA 5KCMA 4HF2A 3LAJA 1IO2A 3M8JA 4HZFA 5E17F 3I9V2 1MD0A 3UNGC 5JHFA 5L3GA 4UVAA 3HPHA 3Q9VA 1KZHA 3SQNA 4A93J 1U2WA 4OMYA 2OQGA 5DYMA 1ZH5A 3CDIA 2DFFA 2V1DA 2WB1N 2BV6A 1SANA 1G6NA 3JSOA 4CYCB 3IV5A 5B1BH 1T2KA 2VKVA 1K6YA 3OYFA 4HYEA 4BQNA 5LRRA 5D4SA 2HI3A 2Y30A 3MZHA 3F0CA 3FMRA 1MZBA 4D5FA 3CJQB 3WTZA 3AL0C 3HGYA 4NQWA 3G3ZA 3ZGKA 4ASNA 3L7WA 4TV7A 1AWCA 1S29A 2QKLB 2Z9OA 1W7PA 4UY8I 1VQ7I 4H0EA 3T5XA 4RB2C 3CCSI 3LSGA 4EATA 1WI9A 2R3SA 1HLVA 1LFBA 2X6XA 3HSFA 1J75A 4ESJA 4M74A 4EM2A 3U1KA 3LOCA 2DW4A 2KISA 1QHGA 2Y31A 4CICA 3GZ6A 5EJCA 5ICCA 3SEQA 4LLGF 1XMAA 4OWRB 3HDDA 3PIPF 3C2GA 3EUHA 1TNTA 5J1UA 2CV1A 2BVMA 2QM3A 5GPCA 1NG7A 4Z2YA 2Z1DA 1JI8A 5JI6A 2VBXA 4IF4A 3LA3A 3OOPA 1W5SA 5E8IA 3OV8A 4XL9A 4LJZF 1T0FC 3PQJA 4L9VA 2BVLA 4WCGA 1D5YA 4I76A 5L3CA 2CGPA 2A6HF 3S15J 3QOEA 1H89C 1ZG5A 2Y9ZA 4CXFA 5KVRA 2G7HA 4ZDLA 1VZ0A 3CCVI 4IO9F 2XGEA 4RMNA 2MW8A 3A1YA 4UV8A 3HPGA 1YOVB 4M3BA 3CF5F 2VT3A 4NC8A 4HSRA 3B73A 2KRFA 1ZARA 3EYYA 5HNHA 2AQEA 4GXOA 2R7TA 2LKPA 1P4AA 1R71A 3DU6A 1EJ9A 1U5TC 3W3CA 2BYVE 2EQRA 2B0LA 1YYVA 1W7PD 3HRTA 5GAHJ 5EYRA 2VQGA 2V9KA 5CQEA 1RR8C 2HOSA 1X3ZB 2VQHA 2M5WA 2NAZA 4OU0A 2R7UA 1XCVA 1T56A 4ZDOA 3SHFA 3IRQA 3OIPA 2M30A 3FF5A 4CCNA 1QU3A 1IN6A 3DV8A 3HHHA 4PJJA 2MD5A 4LLNA 2P5VA 1AA7A 5GADJ 5JLWA 2IT0A 3FM3A 4A6EA 1PP8F 2Z3YA 1NK3P 1S8NA 4JQFA 4UV9A 4ENMA 2D2WA 5HNFA 5ERIA 1KYWA 5JR3A 2QF7A 2YUSA 3GTLJ 1YQAA 1W0TA 3MWMA 3BP8A 3D5RC 4A0ZA 3I53A 4WK8F
chains in the Genus database with same CATH topology
4XLPF 3DFGA 3HTUA 3I4PA 4AVPA 3QOPA 3NRVA 3DEUA 3F6VA 3N4MA 4A12A 4L9JA 2L54A 1L0OC 3GFMA 4P55A 3NEUA 4BNCA 4KFCA 4R79A 2GWRA 5CLSA 3D0SA 2ADUA 2VOPA 1U6GA 2D1HA 1ONVA 1K6OA 5D5VB 3P9IA 5LHHA 3CUQA 2GZWA 5DUIA 1IN5A 4ZYDA 3F8BA 4CZZA 2STTA 2Y75A 4CHUA 1UFMA 3PFIA 5BPDA 3ECHA 3ZMSA 5E1ZB 4GYGA 4G7HF 2ZMEA 2K02A 2H94A 1FP2A 3ELKA 3SXYA 4M6YA 3TO6A 1ZLJA 2HTJA 3F8MA 3FZVA 3NQOA 5ICEA 3P9KA 1UHMA 3ISPA 3RI4A 4BHCA 4EGZA 1IUYA 1SFEA 1HW5A 3C1DA 5DEQA 1LDJA 2FF4A 3V7SA 2RDPA 3R60A 1KQ9A 3H92A 4U7BA 2DBBA 1G3WA 1FBQA 4I0BA 4M9ZA 5FB2A 3BDDA 4EGYA 3JTGA 4EJVA 1QZZA 1X3UA 5D6FA 3WTUC 1G4DA 2HZTA 1TLHB 4UVBA 1BBYA 3WGGA 4WXCA 4LFUA 1GXQA 1KU7A 3U2RA 1OPCA 1TQMA 4LG0A 2QBYA 3HIFA 1R1UA 5D8LB 5HDNA 2VE9A 1O3RA 1XDUA 2AXLA 2GAUA 1CF7A 2HQRA 5DV5A 2QQAA 4OOIA 3HHGA 4FHTA 4LK0F 1D3YA 2XAFA 4UXNA 3KCCA 3WE2A 3LFKA 5ILUA 3I59A 2QENA 3RJPA 1XGOA 2P7CB 5DCMB 4MEYF 1HKSA 1R00A 5L3DA 3FXUA 1HW2A 2YPRA 5ILSA 1OYWA 3KP4A 2VC0A 5CVJA 4I02A 4P5OA 2IA1A 1AOYA 1U78A 3S2WA 1IXCA 4RAZA 5DDGA 1EH6A 1DUXC 3ECOA 4HA8A 4S04A 1ON1A 1W5TA 3HOTA 4JBAA 4R1HA 1SAXA 4KICA 1HKTA 3IL2A 3VB2A 4N9IA 1ZRFA 3IWFA 2OU2A 1XMKA 4M9SA 1UB9A 4U0VA 1IN7A 1GHCA 2TDXA 2VODA 1F4KA 5LEJA 1Y0UA 1OMIA 3F3XA 4P9FA 2P5LC 2MC3A 1P4WA 3ABTA 5IT9K 5ICFA 3VEPA 4Y17A 3ZQ7A 2Z5UA 3RTRA 1F5TA 3HUGA 2DPUA 1FZPB 4HOBA 1UCRA 1FOKA 2GQQA 1RIOH 4AIHA 2A6EF 1XB4A 2WC2A 3KLNA 1R23A 1T39A 2LSOA 1RZ4A 1V3FA 2YX4A 3R6SA 2XHKA 3T0YA 1KU2A 1WQ2A 2OD5A 5HS8A 3M9AA 4P96A 2H27A 1VTNC 5JHUA 3KP5A 4RGUA 1KQ8A 2ESNA 1KU3A 2LDUA 2OZ6A 2R7FA 3ZMZA 4KIFA 3COAC 1ZREA 1LDDA 1BI2A 3JAMK 4DNCA 2JPBA 4B09A 2ZBKA 2UXNA 4MTEA 4O3MA 2EK5A 4EM0B 2XVCA 5BS6A 2FEZA 2PLYA 2VE8A 1K78A 1BOAA 1R58A 4GYIA 6PAXA 3RDIA 1P2FA 3E6BA 3RKXA 3RYRA 1K7AA 2GXGA 5HS9A 2VONA 3IWZA 1TW2A 2DT5A 1SD4A 4M72A 2DAOA 2O6GE 3JW4A 4G6DA 3K2ZA 3KP3A 3E6DA 3GO5A 1HQCA 1F9NA 2HYGD 4DQ2A 2XAQA 2PQ8A 5HLHA 2FMYA 3K1MA 3IC7A 5K5RA 2D45A 1L3LA 4XRFA 4RS8A 1W7PB 1U8RA 3B02A 4HW0A 2W85A 2FBKA 2V79A 3BJOA 4BHPA 4Q4ZF 2M87A 3FHZA 3O2PE 3LQQA 1F1ZA 4IJAA 3EDPA 1USSA 2IPQX 3KZZA 1HKQA 1IRGA 2EFWA 2K86A 4KA4A 1O3QA 1B6AA 5LEKA 5DD8A 2BBYA 2EV6A 4G9YA 1QPMA 1CGPA 4AWXB 3C18A 4WX9A 4R8HA 1WRJA 2VXZA 1IXSB 2Z33A 3EYIA 2M1BA 3Q9SA 2RV8A 5FFXA 1HW1A 1OKRA 2FRHA 2E7XA 2PI0A 2M45A 3ZMVA 2HTSA 2EA2A 1B4AA 3R61A 5LLQA 3TO9A 3N97A 3RIRA 1TBXA 2DK5A 3HRUA 3V4GA 3GFJA 5FGMA 2DTRA 2EV0A 4M71A 4EJUA 1LDKB 3F72A 5E20A 1O57A 2XAJA 4HDUA 4G6QA 3CJNA 1C0WA 3FWEA 1YO5C 4UNOA 2FNPA 2DQRA 2RKHA 4RB3C 4U0YA 4IHTA 2GXBA 2XKPA 2IA2A 5F6FA 3J80K 1HSJA 2G9WA 1TNSA 3QP5A 4K2EA 1IXRC 1FLIA 4RAYA 2GIVA 2PN6A 1D8JA 2ZXJA 2CG4A 1PDNC 1JHFA 4LMYA 3J81K 4FX4A 2KJCA 3ZMDA 2ZO4A 1IZ1A 2AS5F 5D5UB 1HSTA 2ETHA 5E8GA 4AIJA 5H6RA 5LBQA 4MGRA 1GVJA 5AONA 2UZKA 3V8JA 3CUQB 3CO6C 4IHSA 4KNYA 5BMZA 4OIRF 5A2QK 2XASA 4ETSA 2A5YB 2ZNYA 4MQ9F 2P5KA 3F8NA 3CO7C 4I09A 1U5TA 2JZYA 2XROA 1TQPA 3BJAA 1B59A 2ZMEB 3H3ZA 1O7FA 5TRDA 4HBLA 1T38A 3WTXC 3GXOA 2W84A 1BC8C 5DCFA 2BEOA 1RNLA 2Z99A 1IN4A 5DD4A 1JE8A 1XD7A 1S7OA 2FNAA 1J7KA 5BQTA 2L4MA 3CDHA 5TJJA 1I27A 1O7LA 4HLXA 1G3YA 2QVOA 2A07F 4HQMA 2EFQA 2Q2EA 2YX7A 4A2UA 2DK8A 1P6RA 2FOKA 2NNYA 4XBFA 2PG4A 2IVMA 1Z1DA 3FX3A 3BPXA 2FSWA 2DLLA 2V9VA 5CJ9A 2CYYA 2CWEA 3EQLF 1D8KA 1EH7A 1Q1HA 4ESBA 4KN7X 4NHJA 1BN5A 3IKTA 1CF7B 3FM5A 3KEQA 1KU9A 2MLGA 4YIIA 1STZA 3ULQB 4P9UA 3BPVA 1SFUA 1FNNA 1EH8A 5K1YA 1U3EM 5J6XA 5L3EA 4OIPF 1IN8A 2XUBA 3CUQC 3I59B 3TDUC 4XLNF 2ZKZA 4KDPA 3P7NA 2IRFG 3C3WA 4OINF 3FXRA 3F23A 4N9HA 3BY6A 4ZH4F 2VT2A 2L3DA 3I71A 1OR7A 4BYYA 2E1CA 1LEAA 5FLXK 2V1UA 2JRTA 5F64A 3TQNA 2GA2A 4ZYHA 4GGGA 3ABUA 2NYXA 2DQLA 4Y13A 3GX4X 1PUEE 3HTSB 3T8RA 4YFXF 2YU3A 3FMSA 4BXUA 4EJTA 3LA7A 3ERED 1RI7A 4FT8A 4LB5A 2STWA 1REPC 4LLLA 3VFZA 1JGSA 4AD9A 1A04A 5FO5A 1J5YA 1FX7A 2MH2A 2J5OA 3KLOA 3VOEA 3VODA 4L0ZB 4Y15A 1SD7A 1TW3A 1XGSA 2P4WA 3J7AO 1KGSA 2QQ9A 4HAMA 3MZYA 2KJBA 3BZ6A 1LEBA 4ZZDA 4M6XA 4FX0A 5J8CA 4KUMA 4IRGA 3TOAA 1BI0A 2C6YA 2K7LA 1XGNA 3H3UA 4O6JA 4OIOF 5CYVA 3R4KA 2BE5F 2X4HA 1ZRCA 1W4MA 2RN7A 3D5LA 2WWYA 1NHAA 3V7RA 2EJRA 1OYYA 2ACJA 1R1TA 3K9TA 2V6CA 1FSEA 3LQRA 1O3TA 3F8FA 3F21A 4KN4X 2OA4A 1K78B 2IA0A 1FPQA 2OAZA 1K79A 2F5FA 5LGUA 4A5MA 3O6BB 3ZN0A 2HGCA 3F6OA 3P9CA 2P8TA 2CW0F 3TOBA 5LHIA 5CVRA 1YW9A 2JT1A 3O3KA 1D5VA 1LJ9A 4L5IA 1BI1A 4EMSA 4RB0A 2O3FA 4KMUX 5HLIA 4WXDA 1XSXA 3WTTC 3F22A 2F5EA 1SD5A 3GYHX 2PMHA 1ZGAA 3MCZA 1R36A 1S3JA 4Q48A 3DXJF 4L9TA 1Z9CA 2EA4A 2M8EA 5DCMA 3R0JA 2H6CA 2XAHA 4L9NA 2H09A 3MQ0A 4ZYEA 2F5DA 2CFXA 2H6BA 4N0BA 2COMA 3QPHA 5FFZA 1I6XA 3QP6A 3RKWA 2HOEA 4U88A 4MEXF 2HYFA 3BOQA 2JSCA 1MDMA 2XAGA 1H0MA 2L01A 2XIGA 4PDKA 4IPAA 5E1WA 2ZJ2A 1B9MA 3KP6A 3BROA 4EM1A 1QBJA 4LD5A 5BPIA 3DPTA 2K4BA 2FBHA 4A5NA 3ZPLA 1YS7A 2RC4A 2XRNA 5H20A 4MHGA 4CGZA 4EJOA 4KT5C 4G8XA 4I2OA 1YLFA 5HS7A 3TDZC 2DFIA 4HDVA 1SMTA 2PBIA 1PP7U 3C7JA 3WTVC 2O61A 4BHBA 2E7WA 3E97A 2CO5A 4BQAA 1FBSA 2FA5A 2K27A 2ELHA 3ZN1A 4KIGA 4G94A 4HV6A 2F5CA 3GFIA 2XV4S 4GCVA 2L4AA 2PFBA 2WV0A 1T98A 3KE2A 2W24A 1HBXG 3R0AA 2PMUA 4ON0A 2OQRA 1ZLKA 1BC7C 3LAPA 3DP7A 1LQ1A 4U7DA 3SFZA 3K1NA 1U5TB 3QPTA 4I98B 4HX7A 2PEXA 1P4XA 4A0YA 1O3SA 3ZMUA 3SZTA 4BAYA 5L3FA 2IW5A 4GO1A 2UWMA 4O5VA 4L18B 4NB5A 2UXXA 3W6KB 1RUOA 3E5QA 5F1RA 4G7OF 1IF1A 1YW8A 5AIQA 1B1BA 3ZMTA 4ZYGA 1KA8A 1XSVA 1P92A 5HVQC 1J0RA 2RVCA 2L02A 1E17A 5K5QA 1KQ0A 1USTA 4PGHA 1T0FA 4EV0A 1BIAA 3T8TA 4YFNF 2HQNA 4D0PA 5CVUA 1XCBA 3KP7A 2BGCA 1DPUA 4EJWA 4UUVA 1J9IA 2P6SA 4XSZF 4LB6B 5LGTA 2HR3A 4WXHA 1WSUA 2WTEA 4MQVA 3HYIA 2HDCA 3E5UA 1YFHA 2Q8KA 3Q5FA 4F7ZA 2P6TA 3M7GA 2JTVA 2J5PA 2RNJA 2ISZA 1J59A 3CLOA 4KYWA 3RPUA 4M73A 2D1VA 3DPLC 2HKOA 2NS0A 1DPRA 3DKWA 3HRSA 1OYIA 2DI3A 2YSRA 1G3TA 1ZAOA 3FMQA 2DPDA 1MKMA 3GWZA 1FP1D 1S6LA 4WWCA 1YS6A 3I0TA 2KIFA 3GFLA 3E6MA 2XGXA 3I64A 3GZ5A 3U9GA 2EV5A 3KP2A 1FT9A 2EFOA 1YG2A 4YFKF 3IHUA 4Q5SF 1XDSA 1GXPA 4A6DA 2HWVA 3GVAA 3F8CA 5EEGA 5JVTA 1TTYA 1FYLA 4HF1A 4IRIA 2QLZA 2QUFA 1LNWA 3LWFA 5IT9Z 1XSDA 4AIKA 3GLXA 3MEXA 1HXDA 4LG0B 2VBYA 3T1BA 2QBYB 1IAWA 3QAHA 1ZGJA 3LA2A 4B8XA 1JXSA 2MLKA 1V4RA 1QNTA 2HEOA 1RUNA 4BH9A 5HLGA 3G73A 3FXQA 2Y0MA 1YIOA 1J2XA 4U0WA 2Y48A 4ENKA 1LB2A 2DO7A 3DQVC 1FYMA 3HSRA 4EQQA 1R1VA 3HRMA 2LNBA 3I54A 3L00A 2CQKA 5H6QA 1ZRDA 3ZP5A 2KIMA 2V1XA 1BIBA 4XSXF 1Z91A 1ULYA 3JAMZ 5ED4A 4HLYA 2QZ8A 1QQIA 1MJ9A 4KMFA 5D6EA 2F2EA 3W6JB 5FD5A 4M9XA 4L5JA 4RGRA 2A68F 1ON2A 1BI3A 1T6SA 3QRFF 4HQEA 1XGMA 4HV5A 5D5XB 1MJAA 1WWXA 5E18F 1DDNA 1ZHFA 5D5WB 3EETA 3GEZA 3M8FA 3WG9A 3U1DA 4IXAA 3K0LA 2EFPA 3K69A 2VBWA 4ENJA 2HKXA 3KFWX 4I01A 4PZJA 1QGPA 3K1PA 3LSTA 3M8EA 2IJLA 3DF8A 5K5OA 2A69F 1FC3A 5JFRA 1Z7UA 2NRAC 2VBZA 1UHWA 1B9NA 3WTYC 4YG2F 1LVAA 3I5UA 5IT3A 3IRRA 2O8XA 3KEOA 2LF8A 3HSEA 4I0AA 5HDKA 1FWZA 1R5HA 3CTAA 4PCQA 3WTSC 1MGTA 2YR2A 5L3BA 3L9FA 1ZG1A 3TGNA 4I7HA 2EWNA 4IVNA 2ZFWA 3M1EA 1DP7P 4LK1F 2HFHA 4E70A 2FMLA 3SZPA 4CO8A 2VOOA 1MJBA 1H9GA 2P7VB 1TQIA 3CUOA 4YIFA 3AAFA 4RGXA 1I1GA 3WE3A 3I58A 4ENNA 2FE3A 1IW7F 4RGSA 3V8KA 1QZYA 3E3VA 4PGGA 4CYDA 2A61A 1MDMB 1ZYRF 4LGWA 5D4RA 1EV7A 2ZCWA 4HX8A 2FXAA 5LRSA 2X0LA 4A0XA 3ML6A 2FQ3A 3RKYA 3MFKA 2QYOA 1IRFA 3J80Z 5HDGA 3TKYA 2HS5A 1FSHA 1S7AA 4Q47A 2KIUA 5ICGA 3E5XA 2Q0OA 1XN7A 1ODDA 1QO0D 1I5ZA 2K4JA 4MTDA 2EFNA 3J81Z 3WGHA 2G7UA 3V7CA 2OBPA 5E1XA 2GA1A 2FBIA 4OIQF 4HX4A 3KZYA 2IP2A 4IRHA 5EEHA 1BJAA 1FY7A 2RGVA 3QU3A 5J8FA 3L2CA 2MH9A 4UVCA 5A2QZ 3L09A 5CVIA 2A3SA 2XKOA 5CVVA 1I1SA 2RQPA 2QQBA 3GF2A 2O0YA 4ZZLA 4L0YB 5KK1A 4WF2A 3MAJA 5LGNA 1SD6A 2VC1A 2QWWA 1FYKA 2E1NA 1ZG3A 2PJPA 5BOXA 2W57A 4CDGA 1WKMA 2ZNZA 2MA3A 1Z6RA 3QU6A 4QLCU 1Z6TA 1H9TA 2ESHA 4S05A 3RPQA 3WODF 3WU0A 1SFXA 1YTYA 3JTHA 3BJ6A 4JK1X 5AIPA 2MBFA 2OZUA 3PQKA 3E6CC 3ROUA 5FD6A 4MNUA 5HOOA 4UHTA 4OMZA 1JHHA 2FU4A 1G3SA 1BM9A 2W25A 3WTWC 1Z05A 1YW7A 4RB1A 2CSOA 3GW2A 3REOA 1R22A 5LHGA 1R7JA 2DU9A 1SMYF 1ZN2A 3RYPA 2R7DA 3TO7A 3V8LA 3BWGA 4KIBA 3JSPA 2NNNA 4EVIA 2KKOA 5DUKA 3GUDA 5ILVA 2ISYA 1R5GA 4G7ZF 4ESFA 2JPCA 2EB7A 3IKVA 3WGIA 1E2XA 2O03A 4HF0A 1KYZA 1FBUA 2VN2A 3KETA 3HOSA 2LF7A 5FLXZ 5D8KB 3WU1B 4QWQA 4HF2A 3LAJA 4HZFA 5E17F 1MD0A 5L3GA 4UVAA 3Q9VA 3SQNA 1U2WA 4OMYA 2OQGA 5DYMA 1ZH5A 2V1DA 2BV6A 1G6NA 3JSOA 1T2KA 4HYEA 5LRRA 5D4SA 3MZHA 3FMRA 1MZBA 3WTZA 4NQWA 3G3ZA 4ASNA 3L7WA 4TV7A 1AWCA 1S29A 2Z9OA 1W7PA 4H0EA 3T5XA 4RB2C 1WI9A 2R3SA 3HSFA 1J75A 4ESJA 4M74A 4EM2A 2DW4A 4CICA 3GZ6A 5ICCA 4LLGF 1XMAA 3EUHA 1TNTA 2QM3A 4Z2YA 5JI6A 2VBXA 4IF4A 3LA3A 3OOPA 1W5SA 5E8IA 3OV8A 4LJZF 3PQJA 4L9VA 4WCGA 5L3CA 2CGPA 2A6HF 4CXFA 5KVRA 2G7HA 4UV8A 2VT3A 3B73A 2KRFA 1ZARA 3EYYA 4GXOA 2LKPA 1P4AA 1U5TC 2BYVE 2B0LA 1YYVA 1W7PD 3HRTA 2M5WA 2NAZA 4OU0A 1XCVA 3SHFA 3IRQA 2M30A 3FF5A 1IN6A 3DV8A 3HHHA 2MD5A 4LLNA 2P5VA 2IT0A 3FM3A 4A6EA 1PP8F 2Z3YA 1S8NA 4JQFA 4UV9A 4ENMA 2D2WA 5ERIA 1KYWA 5JR3A 1YQAA 3MWMA 3BP8A 1ZG5A 4A0ZA 3I53A 4WK8F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLP F;  3DFG A;  3HTU A;  3I4P A;  4AVP A;  3QOP A;  3NRV A;  3DEU A;  3F6V A;  3N4M A;  4A12 A;  4L9J A;  2L54 A;  1L0O C;  3GFM A;  4P55 A;  3NEU A;  4BNC A;  4KFC A;  4R79 A;  2GWR A;  5CLS A;  3D0S A;  2ADU A;  2VOP A;  1U6G A;  2D1H A;  1ONV A;  1K6O A;  5D5V B;  3P9I A;  5LHH A;  3CUQ A;  2GZW A;  5DUI A;  1IN5 A;  4ZYD A;  3F8B A;  4CZZ A;  2STT A;  2Y75 A;  4CHU A;  1UFM A;  3PFI A;  5BPD A;  3ECH A;  3ZMS A;  5E1Z B;  4GYG A;  4G7H F;  2ZME A;  2K02 A;  2H94 A;  1FP2 A;  3ELK A;  3SXY A;  4M6Y A;  3TO6 A;  1ZLJ A;  2HTJ A;  3F8M A;  3FZV A;  3NQO A;  5ICE A;  3P9K A;  1UHM A;  3ISP A;  3RI4 A;  4BHC A;  4EGZ A;  1IUY A;  1SFE A;  1HW5 A;  3C1D A;  5DEQ A;  1LDJ A;  2FF4 A;  3V7S A;  2RDP A;  3R60 A;  1KQ9 A;  3H92 A;  4U7B A;  2DBB A;  1G3W A;  1FBQ A;  4I0B A;  4M9Z A;  5FB2 A;  3BDD A;  4EGY A;  3JTG A;  4EJV A;  1QZZ A;  1X3U A;  5D6F A;  3WTU C;  1G4D A;  2HZT A;  1TLH B;  4UVB A;  1BBY A;  3WGG A;  4WXC A;  4LFU A;  1GXQ A;  1KU7 A;  3U2R A;  1OPC A;  1TQM A;  4LG0 A;  2QBY A;  3HIF A;  1R1U A;  5D8L B;  5HDN A;  2VE9 A;  1O3R A;  1XDU A;  2AXL A;  2GAU A;  1CF7 A;  2HQR A;  5DV5 A;  2QQA A;  4OOI A;  3HHG A;  4FHT A;  4LK0 F;  1D3Y A;  2XAF A;  4UXN A;  3KCC A;  3WE2 A;  3LFK A;  5ILU A;  3I59 A;  2QEN A;  3RJP A;  1XGO A;  2P7C B;  5DCM B;  4MEY F;  1HKS A;  1R00 A;  5L3D A;  3FXU A;  1HW2 A;  2YPR A;  5ILS A;  1OYW A;  3KP4 A;  2VC0 A;  5CVJ A;  4I02 A;  4P5O A;  2IA1 A;  1AOY A;  1U78 A;  3S2W A;  1IXC A;  4RAZ A;  5DDG A;  1EH6 A;  1DUX C;  3ECO A;  4HA8 A;  4S04 A;  1ON1 A;  1W5T A;  3HOT A;  4JBA A;  4R1H A;  1SAX A;  4KIC A;  1HKT A;  3IL2 A;  3VB2 A;  4N9I A;  1ZRF A;  3IWF A;  2OU2 A;  1XMK A;  4M9S A;  1UB9 A;  4U0V A;  1IN7 A;  1GHC A;  2TDX A;  2VOD A;  1F4K A;  5LEJ A;  1Y0U A;  1OMI A;  3F3X A;  4P9F A;  2P5L C;  2MC3 A;  1P4W A;  3ABT A;  5IT9 K;  5ICF A;  3VEP A;  4Y17 A;  3ZQ7 A;  2Z5U A;  3RTR A;  1F5T A;  3HUG A;  2DPU A;  1FZP B;  4HOB A;  1UCR A;  1FOK A;  2GQQ A;  1RIO H;  4AIH A;  2A6E F;  1XB4 A;  2WC2 A;  3KLN A;  1R23 A;  1T39 A;  2LSO A;  1RZ4 A;  1V3F A;  2YX4 A;  3R6S A;  2XHK A;  3T0Y A;  1KU2 A;  1WQ2 A;  2OD5 A;  5HS8 A;  3M9A A;  4P96 A;  2H27 A;  1VTN C;  5JHU A;  3KP5 A;  4RGU A;  1KQ8 A;  2ESN A;  1KU3 A;  2LDU A;  2OZ6 A;  2R7F A;  3ZMZ A;  4KIF A;  3COA C;  1ZRE A;  1LDD A;  1BI2 A;  3JAM K;  4DNC A;  2JPB A;  4B09 A;  2ZBK A;  2UXN A;  4MTE A;  4O3M A;  2EK5 A;  4EM0 B;  2XVC A;  5BS6 A;  2FEZ A;  2PLY A;  2VE8 A;  1K78 A;  1BOA A;  1R58 A;  4GYI A;  6PAX A;  3RDI A;  1P2F A;  3E6B A;  3RKX A;  3RYR A;  1K7A A;  2GXG A;  5HS9 A;  2VON A;  3IWZ A;  1TW2 A;  2DT5 A;  1SD4 A;  4M72 A;  2DAO A;  2O6G E;  3JW4 A;  4G6D A;  3K2Z A;  3KP3 A;  3E6D A;  3GO5 A;  1HQC A;  1F9N A;  2HYG D;  4DQ2 A;  2XAQ A;  2PQ8 A;  5HLH A;  2FMY A;  3K1M A;  3IC7 A;  5K5R A;  2D45 A;  1L3L A;  4XRF A;  4RS8 A;  1W7P B;  1U8R A;  3B02 A;  4HW0 A;  2W85 A;  2FBK A;  2V79 A;  3BJO A;  4BHP A;  4Q4Z F;  2M87 A;  3FHZ A;  3O2P E;  3LQQ A;  1F1Z A;  4IJA A;  3EDP A;  1USS A;  2IPQ X;  3KZZ A;  1HKQ A;  1IRG A;  2EFW A;  2K86 A;  4KA4 A;  1O3Q A;  1B6A A;  5LEK A;  5DD8 A;  2BBY A;  2EV6 A;  4G9Y A;  1QPM A;  1CGP A;  4AWX B;  3C18 A;  4WX9 A;  4R8H A;  1WRJ A;  2VXZ A;  1IXS B;  2Z33 A;  3EYI A;  2M1B A;  3Q9S A;  2RV8 A;  5FFX A;  1HW1 A;  1OKR A;  2FRH A;  2E7X A;  2PI0 A;  2M45 A;  3ZMV A;  2HTS A;  2EA2 A;  1B4A A;  3R61 A;  5LLQ A;  3TO9 A;  3N97 A;  3RIR A;  1TBX A;  2DK5 A;  3HRU A;  3V4G A;  3GFJ A;  5FGM A;  2DTR A;  2EV0 A;  4M71 A;  4EJU A;  1LDK B;  3F72 A;  5E20 A;  1O57 A;  2XAJ A;  4HDU A;  4G6Q A;  3CJN A;  1C0W A;  3FWE A;  1YO5 C;  4UNO A;  2FNP A;  2DQR A;  2RKH A;  4RB3 C;  4U0Y A;  4IHT A;  2GXB A;  2XKP A;  2IA2 A;  5F6F A;  3J80 K;  1HSJ A;  2G9W A;  1TNS A;  3QP5 A;  4K2E A;  1IXR C;  1FLI A;  4RAY A;  2GIV A;  2PN6 A;  1D8J A;  2ZXJ A;  2CG4 A;  1PDN C;  1JHF A;  4LMY A;  3J81 K;  4FX4 A;  2KJC A;  3ZMD A;  2ZO4 A;  1IZ1 A;  2AS5 F;  5D5U B;  1HST A;  2ETH A;  5E8G A;  4AIJ A;  5H6R A;  5LBQ A;  4MGR A;  1GVJ A;  5AON A;  2UZK A;  3V8J A;  3CUQ B;  3CO6 C;  4IHS A;  4KNY A;  5BMZ A;  4OIR F;  5A2Q K;  2XAS A;  4ETS A;  2A5Y B;  2ZNY A;  4MQ9 F;  2P5K A;  3F8N A;  3CO7 C;  4I09 A;  1U5T A;  2JZY A;  2XRO A;  1TQP A;  3BJA A;  1B59 A;  2ZME B;  3H3Z A;  1O7F A;  5TRD A;  4HBL A;  1T38 A;  3WTX C;  3GXO A;  2W84 A;  1BC8 C;  5DCF A;  2BEO A;  1RNL A;  2Z99 A;  1IN4 A;  5DD4 A;  1JE8 A;  1XD7 A;  1S7O A;  2FNA A;  1J7K A;  5BQT A;  2L4M A;  3CDH A;  5TJJ A;  1I27 A;  1O7L A;  4HLX A;  1G3Y A;  2QVO A;  2A07 F;  4HQM A;  2EFQ A;  2Q2E A;  2YX7 A;  4A2U A;  2DK8 A;  1P6R A;  2FOK A;  2NNY A;  4XBF A;  2PG4 A;  2IVM A;  1Z1D A;  3FX3 A;  3BPX A;  2FSW A;  2DLL A;  2V9V A;  5CJ9 A;  2CYY A;  2CWE A;  3EQL F;  1D8K A;  1EH7 A;  1Q1H A;  4ESB A;  4KN7 X;  4NHJ A;  1BN5 A;  3IKT A;  1CF7 B;  3FM5 A;  3KEQ A;  1KU9 A;  2MLG A;  4YII A;  1STZ A;  3ULQ B;  4P9U A;  3BPV A;  1SFU A;  1FNN A;  1EH8 A;  5K1Y A;  1U3E M;  5J6X A;  5L3E A;  4OIP F;  1IN8 A;  2XUB A;  3CUQ C;  3I59 B;  3TDU C;  4XLN F;  2ZKZ A;  4KDP A;  3P7N A;  2IRF G;  3C3W A;  4OIN F;  3FXR A;  3F23 A;  4N9H A;  3BY6 A;  4ZH4 F;  2VT2 A;  2L3D A;  3I71 A;  1OR7 A;  4BYY A;  2E1C A;  1LEA A;  5FLX K;  2V1U A;  2JRT A;  5F64 A;  3TQN A;  2GA2 A;  4ZYH A;  4GGG A;  3ABU A;  2NYX A;  2DQL A;  4Y13 A;  3GX4 X;  1PUE E;  3HTS B;  3T8R A;  4YFX F;  2YU3 A;  3FMS A;  4BXU A;  4EJT A;  3LA7 A;  3ERE D;  1RI7 A;  4FT8 A;  4LB5 A;  2STW A;  1REP C;  4LLL A;  3VFZ A;  1JGS A;  4AD9 A;  1A04 A;  5FO5 A;  1J5Y A;  1FX7 A;  2MH2 A;  2J5O A;  3KLO A;  3VOE A;  3VOD A;  4L0Z B;  4Y15 A;  1SD7 A;  1TW3 A;  1XGS A;  2P4W A;  3J7A O;  1KGS A;  2QQ9 A;  4HAM A;  3MZY A;  2KJB A;  3BZ6 A;  1LEB A;  4ZZD A;  4M6X A;  4FX0 A;  5J8C A;  4KUM A;  4IRG A;  3TOA A;  1BI0 A;  2C6Y A;  2K7L A;  1XGN A;  3H3U A;  4O6J A;  4OIO F;  5CYV A;  3R4K A;  2BE5 F;  2X4H A;  1ZRC A;  1W4M A;  2RN7 A;  3D5L A;  2WWY A;  1NHA A;  3V7R A;  2EJR A;  1OYY A;  2ACJ A;  1R1T A;  3K9T A;  2V6C A;  1FSE A;  3LQR A;  1O3T A;  3F8F A;  3F21 A;  4KN4 X;  2OA4 A;  1K78 B;  2IA0 A;  1FPQ A;  2OAZ A;  1K79 A;  2F5F A;  5LGU A;  4A5M A;  3O6B B;  3ZN0 A;  2HGC A;  3F6O A;  3P9C A;  2P8T A;  2CW0 F;  3TOB A;  5LHI A;  5CVR A;  1YW9 A;  2JT1 A;  3O3K A;  1D5V A;  1LJ9 A;  4L5I A;  1BI1 A;  4EMS A;  4RB0 A;  2O3F A;  4KMU X;  5HLI A;  4WXD A;  1XSX A;  3WTT C;  3F22 A;  2F5E A;  1SD5 A;  3GYH X;  2PMH A;  1ZGA A;  3MCZ A;  1R36 A;  1S3J A;  4Q48 A;  3DXJ F;  4L9T A;  1Z9C A;  2EA4 A;  2M8E A;  5DCM A;  3R0J A;  2H6C A;  2XAH A;  4L9N A;  2H09 A;  3MQ0 A;  4ZYE A;  2F5D A;  2CFX A;  2H6B A;  4N0B A;  2COM A;  3QPH A;  5FFZ A;  1I6X A;  3QP6 A;  3RKW A;  2HOE A;  4U88 A;  4MEX F;  2HYF A;  3BOQ A;  2JSC A;  1MDM A;  2XAG A;  1H0M A;  2L01 A;  2XIG A;  4PDK A;  4IPA A;  5E1W A;  2ZJ2 A;  1B9M A;  3KP6 A;  3BRO A;  4EM1 A;  1QBJ A;  4LD5 A;  5BPI A;  3DPT A;  2K4B A;  2FBH A;  4A5N A;  3ZPL A;  1YS7 A;  2RC4 A;  2XRN A;  5H20 A;  4MHG A;  4CGZ A;  4EJO A;  4KT5 C;  4G8X A;  4I2O A;  1YLF A;  5HS7 A;  3TDZ C;  2DFI A;  4HDV A;  1SMT A;  2PBI A;  1PP7 U;  3C7J A;  3WTV C;  2O61 A;  4BHB A;  2E7W A;  3E97 A;  2CO5 A;  4BQA A;  1FBS A;  2FA5 A;  2K27 A;  2ELH A;  3ZN1 A;  4KIG A;  4G94 A;  4HV6 A;  2F5C A;  3GFI A;  2XV4 S;  4GCV A;  2L4A A;  2PFB A;  2WV0 A;  1T98 A;  3KE2 A;  2W24 A;  1HBX G;  3R0A A;  2PMU A;  4ON0 A;  2OQR A;  1ZLK A;  1BC7 C;  3LAP A;  3DP7 A;  1LQ1 A;  4U7D A;  3SFZ A;  3K1N A;  1U5T B;  3QPT A;  4I98 B;  4HX7 A;  2PEX A;  1P4X A;  4A0Y A;  1O3S A;  3ZMU A;  3SZT A;  4BAY A;  5L3F A;  2IW5 A;  4GO1 A;  2UWM A;  4O5V A;  4L18 B;  4NB5 A;  2UXX A;  3W6K B;  1RUO A;  3E5Q A;  5F1R A;  4G7O F;  1IF1 A;  1YW8 A;  5AIQ A;  1B1B A;  3ZMT A;  4ZYG A;  1KA8 A;  1XSV A;  1P92 A;  5HVQ C;  1J0R A;  2RVC A;  2L02 A;  1E17 A;  5K5Q A;  1KQ0 A;  1UST A;  4PGH A;  1T0F A;  4EV0 A;  1BIA A;  3T8T A;  4YFN F;  2HQN A;  4D0P A;  5CVU A;  1XCB A;  3KP7 A;  2BGC A;  1DPU A;  4EJW A;  4UUV A;  1J9I A;  2P6S A;  4XSZ F;  4LB6 B;  5LGT A;  2HR3 A;  4WXH A;  1WSU A;  2WTE A;  4MQV A;  3HYI A;  2HDC A;  3E5U A;  1YFH A;  2Q8K A;  3Q5F A;  4F7Z A;  2P6T A;  3M7G A;  2JTV A;  2J5P A;  2RNJ A;  2ISZ A;  1J59 A;  3CLO A;  4KYW A;  3RPU A;  4M73 A;  2D1V A;  3DPL C;  2HKO A;  2NS0 A;  1DPR A;  3DKW A;  3HRS A;  1OYI A;  2DI3 A;  2YSR A;  1G3T A;  1ZAO A;  3FMQ A;  2DPD A;  1MKM A;  3GWZ A;  1FP1 D;  1S6L A;  4WWC A;  1YS6 A;  3I0T A;  2KIF A;  3GFL A;  3E6M A;  2XGX A;  3I64 A;  3GZ5 A;  3U9G A;  2EV5 A;  3KP2 A;  1FT9 A;  2EFO A;  1YG2 A;  4YFK F;  3IHU A;  4Q5S F;  1XDS A;  1GXP A;  4A6D A;  2HWV A;  3GVA A;  3F8C A;  5EEG A;  5JVT A;  1TTY A;  1FYL A;  4HF1 A;  4IRI A;  2QLZ A;  2QUF A;  1LNW A;  3LWF A;  5IT9 Z;  1XSD A;  4AIK A;  3GLX A;  3MEX A;  1HXD A;  4LG0 B;  2VBY A;  3T1B A;  2QBY B;  1IAW A;  3QAH A;  1ZGJ A;  3LA2 A;  4B8X A;  1JXS A;  2MLK A;  1V4R A;  1QNT A;  2HEO A;  1RUN A;  4BH9 A;  5HLG A;  3G73 A;  3FXQ A;  2Y0M A;  1YIO A;  1J2X A;  4U0W A;  2Y48 A;  4ENK A;  1LB2 A;  2DO7 A;  3DQV C;  1FYM A;  3HSR A;  4EQQ A;  1R1V A;  3HRM A;  2LNB A;  3I54 A;  3L00 A;  2CQK A;  5H6Q A;  1ZRD A;  3ZP5 A;  2KIM A;  2V1X A;  1BIB A;  4XSX F;  1Z91 A;  1ULY A;  3JAM Z;  5ED4 A;  4HLY A;  2QZ8 A;  1QQI A;  1MJ9 A;  4KMF A;  5D6E A;  2F2E A;  3W6J B;  5FD5 A;  4M9X A;  4L5J A;  4RGR A;  2A68 F;  1ON2 A;  1BI3 A;  1T6S A;  3QRF F;  4HQE A;  1XGM A;  4HV5 A;  5D5X B;  1MJA A;  1WWX A;  5E18 F;  1DDN A;  1ZHF A;  5D5W B;  3EET A;  3GEZ A;  3M8F A;  3WG9 A;  3U1D A;  4IXA A;  3K0L A;  2EFP A;  3K69 A;  2VBW A;  4ENJ A;  2HKX A;  3KFW X;  4I01 A;  4PZJ A;  1QGP A;  3K1P A;  3LST A;  3M8E A;  2IJL A;  3DF8 A;  5K5O A;  2A69 F;  1FC3 A;  5JFR A;  1Z7U A;  2NRA C;  2VBZ A;  1UHW A;  1B9N A;  3WTY C;  4YG2 F;  1LVA A;  3I5U A;  5IT3 A;  3IRR A;  2O8X A;  3KEO A;  2LF8 A;  3HSE A;  4I0A A;  5HDK A;  1FWZ A;  1R5H A;  3CTA A;  4PCQ A;  3WTS C;  1MGT A;  2YR2 A;  5L3B A;  3L9F A;  1ZG1 A;  3TGN A;  4I7H A;  2EWN A;  4IVN A;  2ZFW A;  3M1E A;  1DP7 P;  4LK1 F;  2HFH A;  4E70 A;  2FML A;  3SZP A;  4CO8 A;  2VOO A;  1MJB A;  1H9G A;  2P7V B;  1TQI A;  3CUO A;  4YIF A;  3AAF A;  4RGX A;  1I1G A;  3WE3 A;  3I58 A;  4ENN A;  2FE3 A;  1IW7 F;  4RGS A;  3V8K A;  1QZY A;  3E3V A;  4PGG A;  4CYD A;  2A61 A;  1MDM B;  1ZYR F;  4LGW A;  5D4R A;  1EV7 A;  2ZCW A;  4HX8 A;  2FXA A;  5LRS A;  2X0L A;  4A0X A;  3ML6 A;  2FQ3 A;  3RKY A;  3MFK A;  2QYO A;  1IRF A;  3J80 Z;  5HDG A;  3TKY A;  2HS5 A;  1FSH A;  1S7A A;  4Q47 A;  2KIU A;  5ICG A;  3E5X A;  2Q0O A;  1XN7 A;  1ODD A;  1QO0 D;  1I5Z A;  2K4J A;  4MTD A;  2EFN A;  3J81 Z;  3WGH A;  2G7U A;  3V7C A;  2OBP A;  5E1X A;  2GA1 A;  2FBI A;  4OIQ F;  4HX4 A;  3KZY A;  2IP2 A;  4IRH A;  5EEH A;  1BJA A;  1FY7 A;  2RGV A;  3QU3 A;  5J8F A;  3L2C A;  2MH9 A;  4UVC A;  5A2Q Z;  3L09 A;  5CVI A;  2A3S A;  2XKO A;  5CVV A;  1I1S A;  2RQP A;  2QQB A;  3GF2 A;  2O0Y A;  4ZZL A;  4L0Y B;  5KK1 A;  4WF2 A;  3MAJ A;  5LGN A;  1SD6 A;  2VC1 A;  2QWW A;  1FYK A;  2E1N A;  1ZG3 A;  2PJP A;  5BOX A;  2W57 A;  4CDG A;  1WKM A;  2ZNZ A;  2MA3 A;  1Z6R A;  3QU6 A;  4QLC U;  1Z6T A;  1H9T A;  2ESH A;  4S05 A;  3RPQ A;  3WOD F;  3WU0 A;  1SFX A;  1YTY A;  3JTH A;  3BJ6 A;  4JK1 X;  5AIP A;  2MBF A;  2OZU A;  3PQK A;  3E6C C;  3ROU A;  5FD6 A;  4MNU A;  5HOO A;  4UHT A;  4OMZ A;  1JHH A;  2FU4 A;  1G3S A;  1BM9 A;  2W25 A;  3WTW C;  1Z05 A;  1YW7 A;  4RB1 A;  2CSO A;  3GW2 A;  3REO A;  1R22 A;  5LHG A;  1R7J A;  2DU9 A;  1SMY F;  1ZN2 A;  3RYP A;  2R7D A;  3TO7 A;  3V8L A;  3BWG A;  4KIB A;  3JSP A;  2NNN A;  4EVI A;  2KKO A;  5DUK A;  3GUD A;  5ILV A;  2ISY A;  1R5G A;  4G7Z F;  4ESF A;  2JPC A;  2EB7 A;  3IKV A;  3WGI A;  1E2X A;  2O03 A;  4HF0 A;  1KYZ A;  1FBU A;  2VN2 A;  3KET A;  3HOS A;  2LF7 A;  5FLX Z;  5D8K B;  3WU1 B;  4QWQ A;  4HF2 A;  3LAJ A;  4HZF A;  5E17 F;  1MD0 A;  5L3G A;  4UVA A;  3Q9V A;  3SQN A;  1U2W A;  4OMY A;  2OQG A;  5DYM A;  1ZH5 A;  2V1D A;  2BV6 A;  1G6N A;  3JSO A;  1T2K A;  4HYE A;  5LRR A;  5D4S A;  3MZH A;  3FMR A;  1MZB A;  3WTZ A;  4NQW A;  3G3Z A;  4ASN A;  3L7W A;  4TV7 A;  1AWC A;  1S29 A;  2Z9O A;  1W7P A;  4H0E A;  3T5X A;  4RB2 C;  1WI9 A;  2R3S A;  3HSF A;  1J75 A;  4ESJ A;  4M74 A;  4EM2 A;  2DW4 A;  4CIC A;  3GZ6 A;  5ICC A;  4LLG F;  1XMA A;  3EUH A;  1TNT A;  2QM3 A;  4Z2Y A;  5JI6 A;  2VBX A;  4IF4 A;  3LA3 A;  3OOP A;  1W5S A;  5E8I A;  3OV8 A;  4LJZ F;  3PQJ A;  4L9V A;  4WCG A;  5L3C A;  2CGP A;  2A6H F;  4CXF A;  5KVR A;  2G7H A;  4UV8 A;  2VT3 A;  3B73 A;  2KRF A;  1ZAR A;  3EYY A;  4GXO A;  2LKP A;  1P4A A;  1U5T C;  2BYV E;  2B0L A;  1YYV A;  1W7P D;  3HRT A;  2M5W A;  2NAZ A;  4OU0 A;  1XCV A;  3SHF A;  3IRQ A;  2M30 A;  3FF5 A;  1IN6 A;  3DV8 A;  3HHH A;  2MD5 A;  4LLN A;  2P5V A;  2IT0 A;  3FM3 A;  4A6E A;  1PP8 F;  2Z3Y A;  1S8N A;  4JQF A;  4UV9 A;  4ENM A;  2D2W A;  5ERI A;  1KYW A;  5JR3 A;  1YQA A;  3MWM A;  3BP8 A;  1ZG5 A;  4A0Z A;  3I53 A;  4WK8 F; 
#chains in the Genus database with same CATH topology
 3HKZ A;  4XLP F;  2MYS A;  4M6V A;  1E3P A;  3DFG A;  4XLH A;  5HLT A;  3HTU A;  1ETV A;  4H4K C;  3I4P A;  4C30 A;  4AVP A;  2Y0S A;  3G1L A;  3QOP A;  4X6A J;  3FIW A;  3DWL E;  3NRV A;  2IBD A;  3DEU A;  3GTG J;  3F6V A;  2RAE A;  1P7I A;  3N4M A;  4A12 A;  2M0M A;  2JN6 A;  4L9J A;  2F6C A;  2L54 A;  1L0O C;  2AHQ A;  3OYK A;  1MMG A;  3GFM A;  3OOU A;  3NEU A;  4P55 A;  1RRJ A;  3S32 A;  1A5J A;  3HJE A;  4BNC A;  5KAF C;  1MNM C;  4IOC F;  2E2H J;  1YX5 A;  4QIW N;  4KFC A;  3MMY B;  4MLO A;  4R79 A;  2GWR A;  5CLS A;  3D0S A;  2ADU A;  2VOP A;  1U6G A;  3LSJ A;  2D1H A;  4ZC3 A;  1ONV A;  1K6O A;  5D5V B;  2TRT A;  3P9I A;  1D1A A;  5LHH A;  3CUQ A;  2GZW A;  5DUI A;  1B8I A;  1IN5 A;  2M2E A;  4ZYD A;  1Y1W J;  3HG9 A;  2LP0 A;  3PNV A;  1QHH D;  3F8B A;  4CZZ A;  2XB5 A;  4DGW B;  1HDD C;  2STT A;  2Y75 A;  3EPZ A;  4CHU A;  1UFM A;  2E5Z A;  3PFI A;  2GLO A;  4PJ0 C;  1K83 J;  1MSE C;  5BPD A;  1AKH B;  1IV8 A;  3ECH A;  3ZMS A;  2LY2 A;  2R7O A;  5E1Z B;  4GYG A;  4G7H F;  1FJL A;  2ZME A;  2K02 A;  2R7Z J;  1OCC H;  1FP2 A;  2H94 A;  3AG3 H;  3ELK A;  3HL2 A;  3SXY A;  4M6Y A;  3TO6 A;  2W7N A;  1ZLJ A;  4XKC A;  2HTJ A;  3OMY A;  1WCM J;  3F8M A;  2QQ8 A;  3FZV A;  1DGR M;  3MN2 A;  3NQO A;  2JRM A;  5ICE A;  3P9K A;  2IS4 A;  1UHM A;  2CUE A;  3ISP A;  1IRZ A;  1Z77 A;  3PSF A;  4PSW A;  1VND A;  3RI4 A;  3BTC A;  2R7X A;  3S1M J;  2FOW A;  4D5C A;  2ZJP F;  2R5Z A;  1JUM A;  4BHC A;  1X1B A;  1SAU A;  2E35 A;  4EGZ A;  1IUY A;  1SFE A;  1HW5 A;  3C1D A;  2V26 A;  5DEQ A;  1LDJ A;  3KX2 A;  2FF4 A;  3QWL A;  3V7S A;  2RDP A;  3R60 A;  3MKY B;  1KQ9 A;  1X1A A;  3NWT A;  3H92 A;  4U7B A;  2V6E A;  2DBB A;  1G3W A;  2NS7 A;  4AC0 A;  2BY3 A;  2E2I J;  4B4C A;  2DJI A;  2HVQ A;  2DCE A;  5CKT A;  2E1M B;  3WHC A;  1OR7 C;  1MBG A;  1FBQ A;  4I0B A;  3BG9 A;  4M9Z A;  5FB2 A;  1EA3 A;  3BDD A;  4EGY A;  2HYJ A;  4E7Z A;  3JTG A;  2R7V A;  1X3W B;  1MBH A;  4EJV A;  1Z3Y A;  3LMM A;  1QZZ A;  4XK4 A;  1X3U A;  5D6F A;  3WTU C;  1G4D A;  2HZT A;  2VJ5 A;  1TLH B;  3ESW B;  1BBY A;  4UVB A;  3WGG A;  1JTY A;  4WXC A;  3BR3 A;  1LFP A;  3HC7 A;  3S1Q J;  4LFU A;  1GXQ A;  3OS0 A;  1KU7 A;  3OYB A;  1AHD P;  3U2R A;  1OPC A;  1TQM A;  4LG0 A;  2QBY A;  3HIF A;  1R1U A;  1V5E A;  3I4M J;  3MVP A;  3PNY A;  5D8L B;  5HDN A;  1TWH J;  4AID A;  4HNT A;  2VE9 A;  1O3R A;  1XDU A;  2AXL A;  2GAU A;  1CF7 A;  1E3H A;  2HQR A;  3BQZ A;  5DV5 A;  4C2M J;  2QQA A;  4RLQ A;  2KFD A;  2LY9 A;  2DOF A;  3OIQ A;  3HBL A;  4C2T A;  4OOI A;  3HHG A;  4FHT A;  3KEY A;  4LK0 F;  1D3Y A;  2XAF A;  2ZB9 A;  4UXN A;  3KCC A;  3WE2 A;  1NG6 A;  2DMT A;  3LFK A;  5ILU A;  4BBR J;  1RC9 A;  2EIN H;  3LSI A;  3I59 A;  2ZJR F;  2QEN A;  2LYC A;  3RJP A;  4G12 A;  1XGO A;  4NNJ A;  4B43 A;  2P7C B;  3BC8 A;  4UB8 C;  2HVR A;  2MFZ A;  4JP0 A;  2XSJ C;  2XAU A;  3LFU A;  5DCM B;  3K10 A;  4MEY F;  1HKS A;  1R00 A;  2VKE A;  5L3D A;  3FXU A;  1HW2 A;  2YPR A;  1APL C;  1HOM A;  5ILS A;  3BR5 A;  1Z21 A;  1OYW A;  2KP6 A;  3KP4 A;  2VC0 A;  3A03 A;  4M3G A;  5CVJ A;  4I02 A;  4P5O A;  3UR3 C;  1FOW A;  2IA1 A;  3C2H A;  1AOY A;  5J40 A;  1U78 A;  3G2B A;  3S2W A;  4I99 C;  1LE8 B;  3ASO H;  1IXC A;  4CZC A;  4RAZ A;  5DDG A;  1EH6 A;  1DUX C;  3JRF A;  1Y56 A;  3CCM I;  3ECO A;  3PO2 J;  4HA8 A;  3ZQF A;  4S04 A;  1ON1 A;  3CCY A;  2R5Y B;  1W5T A;  2NVX J;  3HOT A;  3OR1 C;  4A3J J;  1K4T A;  4GDF A;  4JBA A;  4MFD A;  4A3D J;  4R1H A;  1GLN A;  2DOA A;  1SAX A;  4KIC A;  1XMX A;  1HKT A;  3IL2 A;  3KYC B;  3S8P A;  2DT6 A;  3VB2 A;  4N9I A;  1ZRF A;  3IWF A;  2GOX B;  2OU2 A;  1XMK A;  4M9S A;  1UB9 A;  4U0V A;  1IN7 A;  1D0Z A;  1A6Q A;  1GHC A;  2TDX A;  4C3J J;  2ZSH B;  2VOD A;  1F4K A;  3DKX A;  5LEJ A;  1XTA A;  1Y0U A;  1OMI A;  4YRV A;  3F3X A;  1QA6 A;  4P9F A;  2P5L C;  2MC3 A;  4ZYA A;  1GV2 A;  1P4W A;  1RES A;  3ABT A;  1VFC A;  4Z6Y A;  4DYC A;  4PUS A;  3FDY A;  2KMU A;  5IT9 K;  3BCA A;  5GPA A;  5ICF A;  3GBG A;  3VEP A;  4Y17 A;  5FJ8 J;  3ZQ7 A;  3FBN B;  4RLF A;  2Z5U A;  3RTR A;  1F5T A;  4YEJ A;  2CUJ A;  3HUG A;  5EZG A;  2DPU A;  2NOJ B;  2XGD A;  3KIO A;  1NH3 A;  4HOB A;  1FZP B;  1YE9 A;  1UCR A;  1FOK A;  2GQQ A;  1RIO H;  1IUF A;  2KQR A;  1EKE A;  4AIH A;  2A6E F;  1XB4 A;  2WC2 A;  3KLN A;  1R23 A;  1D0X A;  2WAF A;  3ABK H;  4XON A;  1T39 A;  2LSO A;  5E3O A;  1RZ4 A;  1VQN I;  1V3F A;  2YX4 A;  1RR7 A;  5FRO A;  3R6S A;  2P81 A;  2KLO A;  2XHK A;  4II2 A;  2VLA A;  3T0Y A;  1KU2 A;  1WQ2 A;  2OD5 A;  5HS8 A;  5F0C A;  1T33 A;  2X6W A;  3FXO A;  4CCO A;  3M9A A;  4JX5 A;  3QYF A;  2NXN B;  4P96 A;  2H27 A;  1VTN C;  3ZQQ A;  3GLL A;  2V1N A;  2X6O A;  5JHU A;  5EEA A;  3KP5 A;  3S3O A;  2GXA A;  4RGU A;  1KQ8 A;  2ESN A;  1KU3 A;  2LDU A;  3W6V A;  2OZ6 A;  2OV7 A;  5EDN A;  2R7F A;  3ZMZ A;  4KIF A;  1Y8R B;  5J1R A;  2NVT J;  2R0Q C;  1G8X A;  2Y2Z A;  2K40 A;  3I56 I;  3COA C;  4NC6 A;  1GDT A;  1WHU A;  1ZRE A;  1LDD A;  1BI2 A;  3JAM K;  4DNC A;  2JPB A;  4B09 A;  2ZBK A;  4BJ6 C;  2UXN A;  3DEW A;  4MTE A;  4O3M A;  2EK5 A;  4EM0 B;  3M4O J;  2XVC A;  5BS6 A;  2L2O A;  2FEZ A;  1NTC A;  2WAQ A;  2PLY A;  2VE8 A;  1K78 A;  1BOA A;  3HB9 A;  4RDU A;  1R58 A;  4FIS A;  4GYI A;  2CW8 A;  2M9H A;  2HOA A;  2L0K A;  3K70 D;  6PAX A;  2X6Y A;  3RDI A;  3OY9 A;  1P2F A;  3E6B A;  2R7S A;  1G59 A;  3RKX A;  3RYR A;  1K7A A;  2GXG A;  5HS9 A;  4BEH A;  1VQ9 I;  2VON A;  3IWZ A;  1Z0X A;  2I10 A;  1TW2 A;  2DT5 A;  1SD4 A;  3ZCO A;  1B72 A;  2IEK A;  4M72 A;  2DAO A;  2O6G E;  3JW4 A;  4LIU A;  3U21 A;  3H9G A;  4LIV A;  2IS6 A;  3BLY A;  4G6D A;  1FTZ A;  3K2Z A;  5DS9 A;  1I3Q J;  3KP3 A;  3E6D A;  3GO5 A;  1HQC A;  3DLL F;  1F9N A;  2HYG D;  1YRN B;  4PFP A;  4DQ2 A;  4D1Q A;  2WV1 A;  2PQ8 A;  2XAQ A;  4JYK A;  5HLH A;  2FMY A;  3K1M A;  3OYE A;  3IC7 A;  4NQW B;  3AG2 H;  4V2G A;  5K5R A;  2JA2 A;  2DYR H;  4XLF A;  4ABZ A;  2D45 A;  1WJF A;  2PMZ A;  4PK4 A;  4XRF A;  1L3L A;  4RS8 A;  1W7P B;  1U8R A;  3B02 A;  1ZQ3 P;  4HW0 A;  3OYH A;  2W85 A;  2FBK A;  1X58 A;  4V19 K;  2V79 A;  3BJO A;  4A3L J;  4BHP A;  4Q4Z F;  4BDZ A;  4P1W A;  2M87 A;  2JSP A;  2F5V A;  3FHZ A;  3O2P E;  3LQQ A;  1F1Z A;  4IJA A;  1R49 A;  3EDP A;  1USS A;  3OL3 A;  4CSW A;  4HRI A;  1BW5 A;  1LFU P;  4FE4 A;  2IPQ X;  1D1C A;  1X19 A;  2RNG A;  4Y33 A;  3LSM A;  3D1N I;  3HOZ J;  1JKR C;  3CCR I;  3HOV J;  3KZZ A;  2LC2 A;  1HKQ A;  4E6K G;  1IRG A;  2EFW A;  2EZK A;  2K86 A;  4KA4 A;  1O3Q A;  2QSG X;  2F48 A;  2KZG A;  1OCR H;  4B48 A;  2GM4 A;  1B6A A;  5LEK A;  5DD8 A;  2F4I A;  2BBY A;  2EV6 A;  4G9Y A;  1QPM A;  1CGP A;  4LIT A;  4AWX B;  3C18 A;  1JJ6 C;  4WX9 A;  4R8H A;  1A35 A;  5E79 C;  2BY1 A;  1WRJ A;  2VXZ A;  4QTR A;  1IXS B;  1OJL A;  3KYL A;  2Z33 A;  3VYS B;  3EYI A;  2KRC A;  2DOD A;  4B44 A;  2VIX A;  4IHV A;  2M1B A;  3Q9S A;  1FOY A;  2RV8 A;  5FFX A;  1HW1 A;  1X1C A;  1OKR A;  3ZR8 X;  2FRH A;  2CUF A;  3OR2 C;  1PUF A;  2FQ4 A;  3ONQ A;  2E7X A;  2PI0 A;  1R4N B;  2M45 A;  3ZMV A;  3I55 I;  2HTS A;  2EA2 A;  1I39 A;  1B4A A;  5FKO A;  4CCM A;  3R61 A;  3LSH A;  5LLQ A;  3RQI A;  2ID3 A;  3A0H C;  3TO9 A;  2CFO A;  1R6R A;  4XLC A;  3RIR A;  1TBX A;  2DK5 A;  3ZQG A;  3N97 A;  3HRU A;  3V4G A;  1WH5 A;  3H0D A;  4BAC A;  3GFJ A;  5M5Y J;  5FGM A;  2Y9Y A;  2DTR A;  2EH3 A;  2EV0 A;  3J7Z I;  4M71 A;  4EJU A;  1LDK B;  3F72 A;  4YIR X;  4FE7 A;  1ETX A;  2W4S A;  5E20 A;  1O57 A;  2XAJ A;  3S3N A;  2EPF A;  4HDU A;  2JK3 A;  1S72 I;  3RZO J;  4G6Q A;  3CJN A;  3VYT B;  5J1Y A;  1C0W A;  4FQG A;  1RKT A;  1FMW A;  3FWE A;  3IH4 A;  3K4B A;  1YO5 C;  4UNO A;  2FNP A;  2DQR A;  5IY5 H;  4IOA F;  2RKH A;  4RB3 C;  4U0Y A;  4IHT A;  1MBF A;  3LSK A;  2VI6 A;  3TP0 A;  2GXB A;  2CQX A;  5HOD A;  2XKP A;  2IA2 A;  5IYC J;  2BHY A;  1TP4 A;  5F6F A;  3J80 K;  1HSJ A;  3DBL B;  2G9W A;  1TNS A;  3QP5 A;  4K2E A;  1IXR C;  1FLI A;  4DZP A;  4RAY A;  3SDB A;  3CQZ J;  2GIV A;  3BQY A;  2PN6 A;  3BTJ A;  3P5J A;  3DU5 A;  1D8J A;  1ITY A;  2ZXJ A;  2CG4 A;  5F1J A;  1PDN C;  4D7N A;  3IAM 2;  1JHF A;  2VPL A;  4LMY A;  3J81 K;  3HKZ N;  4FX4 A;  3A01 A;  2KJC A;  2XF5 A;  3ZMD A;  2ZO4 A;  1IZ1 A;  2AS5 F;  4V2F A;  5D5U B;  1XS9 A;  2Z16 A;  1HST A;  2DN0 A;  2ETH A;  5E8G A;  3VYU B;  4AIJ A;  5H6R A;  2K3P A;  3IAS 2;  4KT6 A;  4E7J A;  1V5G A;  3KYD B;  3RQ4 A;  5KHD A;  1I50 J;  5LBQ A;  4MGR A;  1GVJ A;  2DA7 A;  1VQP I;  5AON A;  2UZK A;  1YJ9 I;  4HST A;  3V8J A;  2OC6 A;  1JKQ C;  3CUQ B;  3CO6 C;  4IHS A;  1WPK A;  1B8I B;  5BMZ A;  3OYN A;  2MD0 A;  4KNY A;  1DGW Y;  4OIR F;  5A2Q K;  2XAS A;  4ETS A;  2A5Y B;  2ZNY A;  4MQ9 F;  2P5K A;  3F8N A;  3CO7 C;  4I09 A;  4Y7N J;  1U5T A;  5B3S H;  2WA0 A;  1X4O A;  2JZY A;  2ZC2 A;  2XSD C;  3D5S C;  2CQN A;  2XRO A;  1TQP A;  5FRN A;  3BJA A;  2M4K A;  1B59 A;  2ZME B;  4AM3 A;  3H3Z A;  1O7F A;  1N77 A;  5TRD A;  4HBL A;  1T38 A;  2MG4 A;  3WTX C;  3JRI A;  4BGD A;  3GXO A;  2W84 A;  1BC8 C;  1MBE A;  1BA5 A;  5DCF A;  1U9O A;  2BEO A;  1I3A A;  1RNL A;  2Z99 A;  1IN4 A;  2FUG 2;  2WB1 A;  5DD4 A;  2LY1 A;  3ZQL A;  1JE8 A;  3DBR B;  2VJJ A;  3QQA A;  1BW6 A;  3OIO A;  1XD7 A;  1S7O A;  2L7Z A;  4ZDP A;  2FNA A;  2UUZ A;  2HVS A;  1JUS A;  1VF9 A;  1J7K A;  3LL7 A;  5BQT A;  1Z3X A;  2L4M A;  2Z2S B;  3CDH A;  5TJJ A;  2R5Z B;  1I27 A;  1O7L A;  4HLX A;  3OYC A;  3CES A;  1G3Y A;  4RBO A;  2WAD A;  2QVO A;  3X2Q H;  2HPM A;  3HOX J;  2A07 F;  3PL8 A;  2HDW A;  4HQM A;  5M5X J;  2EFQ A;  2Q2E A;  2YX7 A;  4LG3 A;  3JRH A;  4ZTF A;  2R93 J;  3SDG A;  4A2U A;  2DK8 A;  1YHQ I;  4IHW A;  2JUG A;  4BL0 B;  1P6R A;  5TGT A;  2FOK A;  2NNY A;  4XBF A;  2PG4 A;  2IVM A;  2VPR A;  2LKS A;  2OCC H;  1Z1D A;  2K5C A;  3FX3 A;  2LH9 A;  3BPX A;  1X2N A;  2FSW A;  2ZFU A;  5FKN A;  4LOC A;  1MSF C;  2I5U A;  1I6H J;  1Y0N A;  2DLL A;  2V9V A;  4N4N B;  4X0G A;  5CJ9 A;  1W36 D;  2O8K A;  2CYY A;  2E71 A;  2B7E A;  2CWE A;  1QRY A;  2OPT A;  1QVT A;  4IX7 A;  2DDA A;  1OCT C;  3EQL F;  1D8K A;  2KDZ A;  1EH7 A;  1Q1H A;  4ESB A;  4KN7 X;  4NHJ A;  1JGG A;  4XOR A;  4F3Q A;  2IS1 A;  1BN5 A;  3IKT A;  1CF7 B;  2LR8 A;  3FM5 A;  3KEQ A;  4JX6 A;  1KU9 A;  3JRG A;  1MBK A;  2MLG A;  4RAG A;  2VQC A;  4YII A;  2LRE A;  1STZ A;  3ULQ B;  4P9U A;  2K9M A;  3BPV A;  5BNG A;  1SFU A;  1FNN A;  3EUK L;  2AXT C;  2CQ7 A;  1EH8 A;  4CH7 A;  1DU6 A;  5K1Y A;  3CZ6 A;  1U3E M;  5J6X A;  1AU7 A;  5L3E A;  2N8G A;  4OIP F;  1U0J A;  4BXF A;  1K4S A;  1IN8 A;  1ETK A;  3HEF A;  3SEZ A;  4KJZ A;  2XUB A;  1TC3 C;  1N78 A;  3CUQ C;  3I59 B;  4BDY A;  4IL6 C;  3BG3 A;  3TDU C;  2IGM A;  4XLN F;  2ZKZ A;  4KDP A;  2KPM A;  1JKO C;  3P7N A;  4A3E J;  2IRF G;  3C3W A;  4OIN F;  1ZTR A;  3GTJ J;  3FXR A;  4BBS J;  4N9H A;  4RA2 A;  3BY6 A;  4ZH4 F;  3F23 A;  2VT2 A;  2L3D A;  2NOG A;  3I71 A;  1JTX A;  3H0G J;  4E7I A;  3S1N J;  1BJZ A;  4UUS A;  3CP2 A;  2FD5 A;  2ZME C;  3B6C A;  1TWA J;  2M8G X;  1OR7 A;  4BYY A;  2E1C A;  1LEA A;  5FLX K;  4OAZ A;  2V1U A;  2JRT A;  5F64 A;  1ZEL A;  3TQN A;  2GA2 A;  4ZYH A;  4GGG A;  1IRX A;  3ABU A;  1YIT I;  2NYX A;  2DQL A;  4Y13 A;  4DYQ A;  2GIZ A;  4ANJ A;  1MH3 A;  3GX4 X;  1PUE E;  3HTS B;  4E7S A;  2E1O A;  2I8D A;  3T8R A;  4YFX F;  3GME A;  4MFE A;  2K9Q A;  4BS9 A;  2YU3 A;  1F36 A;  3K4C A;  3AG1 H;  1BR1 A;  1LVK A;  3FMS A;  3VYR B;  4A3I J;  1HCR A;  1IDZ A;  1SEU A;  4BXU A;  3I4N J;  4J01 A;  2PJR A;  4BQQ A;  3CCE I;  4EJT A;  4C3H J;  1T08 B;  3GTM J;  1UMQ A;  3LA7 A;  3ERE D;  5JLX A;  1D1B A;  3Q3S A;  2LG4 A;  1TL8 A;  1RI7 A;  4FT8 A;  5KAI C;  4C9Y A;  3BTL A;  4LB5 A;  2STW A;  5F04 A;  3CC4 I;  2L7K A;  1REP C;  4LLL A;  3VFZ A;  1JGS A;  4AD9 A;  1A04 A;  2LTP A;  3K4N A;  5FO5 A;  4C2U A;  1J5Y A;  1FX7 A;  2MH2 A;  2J5O A;  3CCQ I;  3KLO A;  2ELK A;  3VOE A;  5C4X J;  1Z7L A;  2VKH A;  3VOD A;  4L0Z B;  4Y15 A;  1SD7 A;  1Y39 A;  3HUG B;  5B5E C;  1OCO H;  1TW3 A;  2OJE D;  3MZ8 A;  1XGS A;  2P4W A;  3CCJ I;  4BXX J;  3VWB A;  3J7A O;  5IOZ A;  3BR0 A;  1KGS A;  1S5L C;  2QQ9 A;  4HAM A;  1TWF J;  3C2B A;  3MZY A;  2KJB A;  3K4K A;  3BZ6 A;  1LEB A;  1WJA A;  2OTJ I;  4ZZD A;  5GP9 A;  4M6X A;  4FX0 A;  4NDL A;  1EF4 A;  5J8C A;  4KUM A;  2EZI A;  4IRG A;  1HDP A;  3TOA A;  1BI0 A;  2L9N A;  2A05 A;  4MO7 A;  2C6Y A;  1MBJ A;  3KZI C;  2CJJ A;  2X51 A;  2JMW A;  2K7L A;  4QSH A;  1XGN A;  3RZD J;  4DJA A;  3H3U A;  2HQ5 A;  4O6J A;  4OIO F;  3GCM A;  5CYV A;  3R4K A;  3PFY A;  3KPH A;  5B1A H;  1SVL A;  2BE5 F;  2X4H A;  1ZRC A;  2TCT A;  3HXL A;  1W4M A;  2DXI A;  5EF6 A;  3QOD A;  2RN7 A;  4B3X A;  3D5L A;  1LUJ B;  3TW7 A;  2WWY A;  1OCP A;  1NHA A;  2DA2 A;  2EJR A;  4HEA 2;  1OYY A;  3V7R A;  3QYB A;  2ACJ A;  1R1T A;  3K9T A;  3RSN A;  1Q1V A;  3K4J A;  2V6C A;  3OSG A;  1FSE A;  2EIL H;  2LRD A;  1P9Q C;  1ZK8 A;  3TED A;  5B66 C;  3LQR A;  3MKW B;  1O3T A;  3F8F A;  3F21 A;  2VL8 A;  4KN4 X;  2X1C A;  3IH3 A;  2OA4 A;  1K78 B;  2IA0 A;  3OS2 A;  1FPQ A;  3RCO A;  5H2F C;  2OAZ A;  3FXK A;  3SJM A;  2DA5 A;  3CMY A;  4BE0 A;  4CUG A;  1K79 A;  5EGO A;  3JRA A;  2E1M C;  2XDV A;  2F5F A;  1N75 A;  3GTQ J;  5J4Y A;  5LGU A;  4XR6 A;  3L2R A;  4II3 A;  4A5M A;  2ECC A;  3O6B B;  3ZN0 A;  2HGC A;  3L2V A;  3A4C A;  2H1L A;  1GT0 C;  3F6O A;  3P9C A;  1D0Y A;  2P8T A;  2CW0 F;  3TOB A;  5LHI A;  5CVR A;  2LLK A;  1XX5 A;  1YW9 A;  4DW6 A;  2JT1 A;  2LBF A;  3O3K A;  4N4O B;  1D5V A;  3BZC A;  1LJ9 A;  2CRG A;  4PJL A;  4L5I A;  1B72 B;  1BI1 A;  2ME0 A;  4EMS A;  4RB0 A;  5IP7 J;  3OWT A;  4XIC A;  2O3F A;  4KMU X;  5HLI A;  4WXD A;  3W2W A;  4XKW A;  1XSX A;  1DU0 A;  1WJD A;  3WTT C;  3S14 J;  3F22 A;  2F5E A;  1SD5 A;  3GYH X;  2PMH A;  1ZGA A;  3ZRG A;  4M3D A;  4XN0 A;  3MCZ A;  2COB A;  4XLA A;  1R36 A;  1FIP A;  3VPR A;  4L5E A;  1S3J A;  2ID6 A;  1JT6 A;  3CC7 I;  3L2Q A;  2L5Q A;  2M4G A;  2KIQ A;  3L1P A;  1YIJ I;  2LK2 A;  4FTH A;  4Q48 A;  3DXJ F;  3DTE A;  4L9T A;  1VQO I;  1Z9C A;  2JA5 J;  2CMP A;  2EA4 A;  4PJM A;  3K70 C;  2PMZ N;  5IYD J;  2M8E A;  3JRC A;  5DCM A;  4XQF A;  3R0J A;  2H6C A;  2IGO A;  3S3M A;  2XAH A;  4L9N A;  2H09 A;  2WAE A;  3MQ0 A;  2LMD A;  4ZYE A;  2F5D A;  3AFH A;  5F08 A;  4E7L A;  2CFX A;  3MD2 A;  2X85 A;  2PX9 A;  3OYG A;  3NAU A;  1TT0 A;  1JKP C;  2H6B A;  3NAR A;  4CCK A;  4N0B A;  2COM A;  2GBY A;  3QPH A;  4AYB N;  2JJ7 A;  2KDO A;  2CW7 A;  3H5R A;  5FFZ A;  4A3F J;  4BE1 A;  1ZGW A;  1I6X A;  3H9Q A;  4NC7 A;  3QP6 A;  2ZXW H;  1FIA A;  3RKW A;  4HG2 A;  2HOE A;  3H36 A;  4U88 A;  4D9J A;  4MEX F;  1LKX A;  2DFH A;  2M0C A;  4QPQ A;  2CV0 A;  2HYF A;  4DZJ A;  1GV5 A;  3BR1 A;  2HXO A;  3BOQ A;  4ZJZ A;  4J19 A;  3CD6 I;  2KL4 A;  2JSC A;  1ZR4 A;  1MDM A;  3TBI A;  1UJ8 A;  2XAG A;  1H0M A;  1GVD A;  2L01 A;  2XIG A;  4PDK A;  2LFB A;  4IPA A;  2DA6 A;  2XF7 A;  1S9H A;  3O8G A;  1FTT A;  3H9J A;  5E1W A;  3E7L A;  2ZJ2 A;  1PUF B;  1B9M A;  3KP6 A;  3BRO A;  2JQ7 A;  4EM1 A;  1QBJ A;  3HOY J;  4AUX A;  2KRH A;  4LD5 A;  2E19 A;  3BG6 A;  3DPT A;  5BPI A;  2K4B A;  2FBH A;  5LD2 C;  4A5N A;  1V5F A;  1YS7 A;  3ZPL A;  1SFO J;  2RC4 A;  3AL0 B;  2XRN A;  1CQT A;  5H20 A;  4MHG A;  4CGZ A;  4EJO A;  4KT5 C;  1WJC A;  4G8X A;  4I2O A;  1YLF A;  5HS7 A;  3TDZ C;  2DFI A;  4HDV A;  1SMT A;  2PBI A;  1PP7 U;  2YU9 J;  1ORK A;  3C7J A;  1R5I D;  2W48 A;  4KIS A;  4XRS G;  4DBQ A;  3WTV C;  3HM5 A;  2O61 A;  4E4H A;  4BHB A;  2BOL A;  2E7W A;  3E97 A;  4F93 B;  1FOX A;  2CO5 A;  2F4O B;  2QGU A;  2IAI A;  4BQA A;  2HNH A;  1FBS A;  2FA5 A;  2EZH A;  2ELH A;  2K27 A;  4XNF A;  3ZN1 A;  5FKM A;  1NK2 P;  2ELJ A;  3TL4 X;  1TWC J;  5K7F A;  4QPO A;  3RKQ A;  2WY8 Q;  1BR4 A;  1IV6 A;  3JRB A;  2M7B A;  1VQ8 I;  2E2J J;  3CMM A;  5GTH C;  5M3F J;  4KIG A;  4G94 A;  4HV6 A;  2F5C A;  3TP3 A;  3A01 B;  3GFI A;  2HU9 A;  1QVU A;  2XV4 S;  3M1C A;  4GCV A;  1XG1 A;  2L4A A;  2PFB A;  2WV0 A;  1T98 A;  3B6A A;  1ZKG A;  2YS9 A;  3KE2 A;  2W24 A;  1HBX G;  3R0A A;  2PMU A;  2BXZ A;  2DA4 A;  4ON0 A;  4F92 B;  2OQR A;  1ZLK A;  4BY1 J;  1BC7 C;  3LAP A;  2JA8 J;  3DP7 A;  3ZXS A;  1Z67 A;  1A31 A;  1LQ1 A;  5DM7 F;  4U7D A;  4IEJ A;  3SFZ A;  3K1N A;  1U5T B;  5FLM J;  4A69 C;  3QPT A;  2JVH A;  4B1R A;  3DPU A;  2AQF A;  2F4M B;  4HX7 A;  4I98 B;  3OYA A;  2PEX A;  1P4X A;  2DMU A;  4W97 A;  1MIJ A;  4A0Y A;  4DIQ A;  2D5V A;  1O3S A;  3ZMU A;  1FEX A;  2LKX A;  1MMN A;  3PO3 J;  3SZT A;  4BAY A;  5L3F A;  2IW5 A;  5F27 A;  5J3L A;  2XF6 A;  3DLA A;  4GO1 A;  9ANT A;  2UWM A;  4O5V A;  1A36 A;  4L18 B;  3PIO F;  1ZR2 A;  3H3V K;  3F9K A;  4NB5 A;  2UXX A;  3W6K B;  1RUO A;  2BW3 A;  3E5Q A;  2M7A A;  5F1R A;  2K3F A;  5EZH A;  4G7O F;  1IC8 A;  1IF1 A;  1YW8 A;  1ERD A;  5FKK A;  2IGN A;  2CS3 A;  5AIQ A;  1B1B A;  3LNQ A;  3BT9 A;  2EBI A;  3ZMT A;  4ZYG A;  4F91 B;  2XPW A;  4DOZ A;  1YRN A;  5IP9 J;  3FK7 A;  2Q1Z B;  2BXY A;  3MKL A;  1KA8 A;  1XSV A;  2Q2E B;  1OQY A;  1P92 A;  3IP4 B;  5HVQ C;  4BQO A;  1J0R A;  2L9R A;  3ZQC A;  3FK6 A;  2RRE A;  1VQ6 I;  2RVC A;  2L02 A;  1E17 A;  5K5Q A;  5DTD A;  2JA7 J;  1KQ0 A;  1UST A;  4PGH A;  3BZK A;  1T0F A;  5EG0 A;  1BL0 A;  4RM2 A;  2Y0S N;  4EV0 A;  1SFK A;  5C3E J;  5E3M A;  1BIA A;  3T8T A;  4YFN F;  2HQN A;  4D0P A;  5CVU A;  1XCB A;  3BR6 A;  5J4V A;  5FRM A;  3KP7 A;  2BGC A;  1VQL I;  1DPU A;  4EJW A;  4UUV A;  2VQL A;  1J9I A;  2DT7 B;  2P6S A;  4XSZ F;  4XLE A;  4LB6 B;  2HR3 A;  5LGT A;  2W1O A;  2L9S A;  4WXH A;  4S0H B;  1WSU A;  3V42 A;  2WTE A;  4MQV A;  3OYM A;  3HYI A;  2QEX I;  3EUH C;  2HDC A;  3JRE A;  2DA1 A;  4J00 A;  2E34 A;  3E5U A;  1MND A;  1YFH A;  4NBQ A;  2Q8K A;  1VQM I;  3Q5F A;  4F7Z A;  2P6T A;  3M7G A;  2JTV A;  2J5P A;  4W1U A;  2RNJ A;  5LFA A;  2ISZ A;  3OYJ A;  1J59 A;  1GUU A;  2XRL A;  3CLO A;  2JVG A;  4KYW A;  3GTK J;  4NUB A;  4M73 A;  3RPU A;  2D1V A;  3DPL C;  1V54 H;  2HKO A;  2NS0 A;  1FMV A;  2CQQ A;  2HOT A;  2NVQ J;  1Y1V J;  1DPR A;  3A2K A;  3DKW A;  4PSX A;  4ZTJ A;  3HRS A;  1A6I A;  2YSR A;  1OYI A;  2DI3 A;  1G3T A;  1ZAO A;  3FMQ A;  2DPD A;  1MKM A;  3GWZ A;  1FP1 D;  1W36 C;  5IOY A;  2KZV A;  2M3A A;  1S6L A;  4WWC A;  1YS6 A;  3I0T A;  2KIF A;  4XID A;  1X1P A;  3GFL A;  3E6M A;  4CYC A;  2XGX A;  3O8H A;  3I64 A;  4AVZ A;  4UUS B;  2CV2 A;  3HZJ A;  3S2H J;  3GZ5 A;  1YX3 A;  3VSL A;  2BY2 A;  2KT0 A;  3U9G A;  2EV5 A;  3KP2 A;  5GAE J;  2BY0 A;  1FT9 A;  2EFO A;  3FHN A;  1YG2 A;  3K4L A;  2QKM B;  4YFK F;  3W2A A;  2DFE A;  2E5N A;  4Y4R A;  2L7M P;  3IHU A;  4Q5S F;  1OCZ H;  2K9N A;  4IZZ A;  3HOU J;  1BOB A;  1P7J A;  1XDS A;  1GXP A;  4D7M A;  4A6D A;  1H88 C;  2HWV A;  3GVA A;  1R4M B;  3E0J B;  3F8C A;  1BR2 A;  2HZD A;  1F43 A;  5EEG A;  1XPX A;  5JVT A;  2VJI A;  1SVM A;  1TTY A;  3VSK A;  3PUB A;  3CME I;  1FYL A;  4HF1 A;  2ZXI A;  4IRI A;  3ABL H;  2PJR B;  4BY7 J;  2O7O A;  2VKD A;  3UKG A;  2QLZ A;  3PM1 A;  4XKB A;  2QUF A;  1LNW A;  3LWF A;  5IT9 Z;  1V55 H;  2EIJ H;  2MAB A;  1XSD A;  4AIK A;  3GLX A;  3MEX A;  1HXD A;  4LG0 B;  2VBY A;  3T1B A;  2QBY B;  1IAW A;  3M3Y J;  3QAH A;  1ZGJ A;  2ZXH A;  4JOM A;  1VI0 A;  3LA2 A;  1MMS A;  4C3I J;  2CUZ A;  3RPU D;  4B8X A;  2MLK A;  1V4R A;  3J7A Y;  1JXS A;  1QNT A;  3AKZ A;  2MGQ A;  3FBI B;  1WJE A;  2DMN A;  2HEO A;  1RUN A;  2LOO A;  4BH9 A;  3MKZ A;  5HLG A;  3G73 A;  3FXQ A;  2Y0M A;  1WI3 A;  2JUC A;  1W1W E;  1YIO A;  4ITV A;  1J2X A;  4U0W A;  2Y48 A;  3AG4 H;  3OL4 A;  2LD5 A;  5IYB J;  4ENK A;  4Y3O A;  1LB2 A;  2DO7 A;  3DQV C;  4I6Z A;  1WH7 A;  3I3L A;  1ETQ A;  2OTL I;  1FYM A;  3HSR A;  4KIT B;  1JUP A;  4EQQ A;  1R1V A;  3HRM A;  2LNB A;  3I54 A;  5J47 A;  3GTO J;  3L00 A;  3QPL A;  2CQK A;  5IP6 A;  4M3F A;  1IG7 A;  2XGC A;  1UG0 A;  5H6Q A;  3S93 A;  3VDX A;  1SVO A;  5C4J J;  1ZRD A;  3ZP5 A;  2KIM A;  4XOT A;  2V1X A;  4E7H A;  2R4G A;  1BIB A;  4XSX F;  2A5W A;  3ZQI A;  1Z91 A;  1ULY A;  3PSI A;  3JAM Z;  2HPI A;  3NWS A;  3LSP A;  4XM3 A;  3A02 A;  2OUM A;  5ED4 A;  4HLY A;  2A6T A;  2QZ8 A;  1QQI A;  1ENH A;  3Q0W A;  1YJW I;  1MJ9 A;  2DJN A;  3W2V A;  5D6E A;  4KMF A;  2F2E A;  3W6J B;  4BJT A;  2VAS A;  4FAS D;  2NS8 A;  5FD5 A;  4BJ5 C;  4M9X A;  4L5J A;  4RGR A;  4BKX A;  2DTZ A;  2A68 F;  4G6T B;  3H35 A;  2GOM A;  4A3G J;  4HNV A;  1ON2 A;  1T6S A;  1BI3 A;  3QRF F;  1POG A;  3K2A A;  4XRS A;  3IUO A;  4HQE A;  1XGM A;  3OS1 A;  1QZE A;  4FCY A;  4CCJ A;  1KON A;  4HV5 A;  1MJA A;  5D5X B;  3CC2 I;  1WWX A;  5E18 F;  1DDN A;  1ZHF A;  4XRM A;  1DP3 A;  4F52 A;  3FXM A;  5D5W B;  3EET A;  3GEZ A;  5CQG A;  3M8F A;  1VQK I;  1WZ2 A;  3WG9 A;  2UV1 A;  1WVR A;  5IPA A;  3JR9 A;  3U1D A;  4RAF A;  4IXA A;  3K0L A;  2EFP A;  3K69 A;  5M5W J;  5EGO B;  2VBW A;  5K7H A;  4B47 A;  2CU7 A;  2IGK A;  3ZQH A;  4ENJ A;  1R9T J;  2HKX A;  3KFW X;  4I01 A;  4YEL A;  4PZJ A;  1QGP A;  1O4X A;  2M34 A;  3K1P A;  2XPU A;  3LST A;  3M8E A;  1UEL B;  2IJL A;  4CA0 A;  3DF8 A;  3PUF A;  5TIS C;  3M07 A;  3G1M A;  2K85 A;  2LBF B;  3IH2 A;  3WG7 H;  5K5O A;  2A69 F;  2W00 A;  2MC4 A;  5JVG F;  3A0B C;  1FC3 A;  2P0W A;  5JFR A;  2R7W A;  1G2H A;  1Z7U A;  2NVY J;  2E36 A;  4MIM A;  4FET A;  2NRA C;  2VBZ A;  1T95 A;  1UHW A;  1B9N A;  2O5R A;  3WTY C;  3DKY A;  4YG2 F;  2DMP A;  1Y8Q B;  1OIS A;  2ICW G;  1AKH A;  1LVA A;  3CP8 A;  3I5U A;  2HDD A;  5IT3 A;  3IRR A;  2O8X A;  3KEO A;  3CJR B;  2HQA A;  1WJ5 A;  2LF8 A;  3HSE A;  1N25 A;  4I0A A;  5HDK A;  3S16 J;  1FWZ A;  3DTI A;  1R5H A;  3DEE A;  3CTA A;  3WU2 C;  3FXL A;  5CPR B;  3SZG A;  4PCQ A;  3WTS C;  1S7E A;  1MGT A;  2HXI A;  2YR2 A;  5L3B A;  1X2M A;  1PJR A;  3L9F A;  2R7Q A;  1ZG1 A;  3TGN A;  1K61 A;  4I7H A;  2EWN A;  4PFO A;  4IVN A;  2WY7 Q;  3S1R J;  3CCL I;  2ZFW A;  2E60 A;  3E1S A;  3M1E A;  3CF2 A;  1DP7 P;  4LK1 F;  3ERM A;  2HFH A;  4E70 A;  2FML A;  3SZP A;  4CO8 A;  5FLV A;  2VOO A;  3DCF A;  2X1D A;  3HOW J;  1MJB A;  2QSH X;  3DTK A;  1H9G A;  4IQ4 A;  2P7V B;  1TQI A;  3CUO A;  4YIF A;  4DYR A;  3AAF A;  4RGX A;  1I1G A;  3WE3 A;  4RM3 A;  1RKW A;  2ECB A;  2ZSI B;  3I58 A;  3CDL A;  4E7K A;  3G71 I;  4ENN A;  1RPW A;  2FE3 A;  2ME6 A;  1IW7 F;  2V7F A;  4RGS A;  3V8K A;  1QZY A;  3E3V A;  2AO9 A;  3BG7 A;  3K4M A;  4PGG A;  4CYD A;  2XPV A;  2RQQ A;  2NVU B;  2A61 A;  4A3M J;  1Y6I A;  1ZYR F;  2B9S A;  1MDM B;  3G6E I;  1RET A;  2WAQ N;  4LGW A;  5D4R A;  1EV7 A;  2EIK H;  2ZCW A;  3CCU I;  3G4S I;  3H5A A;  4BU2 A;  4HX8 A;  2H8W A;  2FXA A;  4BEH B;  2FX0 A;  3CJT B;  3WHB A;  2VXD A;  1T8I A;  5LRS A;  2X0L A;  4A0X A;  3ML6 A;  5GAG J;  2FQ3 A;  1MNE A;  5F0F A;  4B3A A;  3RKY A;  2B63 J;  3S17 J;  3MFK A;  3FKJ A;  2QYO A;  1IRF A;  1ETY A;  5C44 J;  3J80 Z;  2LVS A;  5HDG A;  1MW7 A;  3TKY A;  4IKF A;  2HS5 A;  3S2D J;  1FSH A;  1S7A A;  4Q47 A;  2H8R A;  2KIU A;  5GTI C;  2DA3 A;  5ICG A;  3E5X A;  2Q0O A;  1XN7 A;  3Q0V A;  1ODD A;  1QO0 D;  3G1O A;  1I5Z A;  4BUP A;  2K4J A;  4MTD A;  3JRD A;  3FIS A;  2EFN A;  3J81 Z;  1VQ4 I;  3BTI A;  2BZT A;  3WGH A;  2DOE A;  2G7U A;  3V7C A;  1WFX A;  3CMA I;  5F0H A;  2QSF X;  2OBP A;  5E1X A;  2GA1 A;  5M3M J;  4HPQ A;  4F55 A;  2FBI A;  2DMQ A;  1LPQ A;  2K9L A;  4XN3 A;  4OIQ F;  1JT0 A;  4HX4 A;  4JX4 A;  3BCB A;  1TT5 B;  1JJ8 C;  1WJB A;  3L2W A;  3SFI A;  3KZY A;  1E0E A;  2X48 A;  4GFB A;  4A3K J;  2IP2 A;  4IRH A;  5EEH A;  1YJN I;  1BJA A;  2BHZ A;  1FY7 A;  2RGV A;  3QU3 A;  5J8F A;  2OCE A;  3L2C A;  2MH9 A;  4UVC A;  3BG5 A;  5A2Q Z;  3L09 A;  1XC5 A;  3H1C A;  5CVI A;  2QA4 I;  2KHM A;  4DBR A;  3TW6 A;  1HC8 A;  1TWG J;  4AU7 A;  2A3S A;  1LE8 A;  3H5N A;  2XKO A;  5CVV A;  1I1S A;  2X1E A;  3QPS A;  3CLQ A;  2RQP A;  2QQB A;  1VQ5 I;  4M3E A;  1E3O C;  3GF2 A;  3GZN B;  4XOP A;  2O0Y A;  4ZZL A;  3GTP J;  2R5Y A;  4L0Y B;  5KK1 A;  5DM6 F;  4WF2 A;  3MAJ A;  3LSR A;  1H8A C;  4OAY A;  5LGN A;  1J09 A;  1PVE A;  4CCL A;  1X1D A;  1SD6 A;  2VC1 A;  2QWW A;  3OYL A;  4UUT A;  2E1N A;  1OLT A;  1ZG3 A;  2VB6 A;  2ZJQ F;  1FYK A;  2PJP A;  5BOX A;  2W57 A;  4CDG A;  1W0U A;  1WKM A;  1UAA A;  2W82 A;  2EZL A;  1UZC A;  2ZNZ A;  2MA3 A;  1MMD A;  4BE2 A;  1Z6R A;  1U8B A;  3FXJ A;  3QU6 A;  4QLC U;  5K7Z A;  1Z6T A;  1H9T A;  2ESH A;  4S05 A;  3BR2 A;  3RPQ A;  1SC7 A;  2X9D A;  1UHS A;  1QPI A;  1OFC X;  3WOD F;  2L9V A;  3WU0 A;  3OYI A;  3DBH B;  3K6G A;  1TZL A;  1SFX A;  1YTY A;  3JTH A;  3Q0U A;  4A3C J;  3BJ6 A;  4JK1 X;  5KNL A;  5AIP A;  2BW3 B;  2MBF A;  2OZU A;  3PQK A;  3E6C C;  3PJR A;  1IDY A;  3ROU A;  5FD6 A;  4MNU A;  5HOO A;  4UHT A;  2DDB A;  4OMZ A;  4UB6 C;  1JHH A;  2EIM H;  3K7A J;  5E3N A;  2FU4 A;  1G3S A;  1BM9 A;  2W25 A;  3WTW C;  3OYD A;  4U87 A;  4GRI A;  1Z05 A;  1YW7 A;  2R7R A;  2CSO A;  4RB1 A;  1ACI A;  3GW2 A;  3REO A;  4HNU A;  2DYS H;  3SYT A;  1R22 A;  4IHX A;  5LHG A;  2V9P A;  2JWT A;  2QCO A;  3PNT A;  3ZOB A;  2OF7 A;  3JCU C;  3EUA A;  1R7J A;  2DU9 A;  3L2U A;  2G0E A;  3QYE A;  4IHY A;  4PJN A;  1SMY F;  2VUM J;  1ETW A;  1ZN2 A;  3RYP A;  1IJW C;  2R7D A;  3TO7 A;  3V8L A;  2FJ1 A;  4IQJ A;  3ABM H;  3BWG A;  2L7F P;  4KIB A;  4X1E A;  1HA8 A;  5EG0 B;  4XKV A;  1MH4 A;  3N05 A;  3JSP A;  2NNN A;  4EVI A;  2KKO A;  2WBM A;  5DUK A;  3GUD A;  5ILV A;  4AYB A;  2XC7 A;  2ISY A;  3HGG A;  1U9N A;  1R5G A;  1WGX A;  1X4P A;  1UG2 A;  4G7Z F;  2IXS A;  2IS2 A;  4ESF A;  2JPC A;  2MSY A;  1HF0 A;  2JA6 J;  2EB7 A;  2V4J C;  3J7Y J;  3IKV A;  2K9S A;  2Y69 H;  1DQU A;  3WGI A;  1E2X A;  1YI2 I;  1ETO A;  1MMA A;  3OSF A;  2O03 A;  4A3B J;  4Y52 J;  2H1K A;  4HF0 A;  3FKI J;  3TMO A;  4EEF G;  2CH0 A;  1KYZ A;  1M1E B;  1PYV A;  2XB0 X;  1IGN A;  2VJ4 A;  5E3L A;  1FBU A;  3ASN H;  1W5C C;  2O9L A;  2VN2 A;  3KET A;  3HOS A;  2R92 J;  2LF7 A;  5FLX Z;  5FKL A;  4XMY A;  5D8K B;  3WU1 B;  4QWQ A;  5KCM A;  4HF2 A;  3LAJ A;  1IO2 A;  3M8J A;  4HZF A;  5E17 F;  3I9V 2;  1MD0 A;  3UNG C;  5JHF A;  5L3G A;  4UVA A;  3HPH A;  3Q9V A;  1KZH A;  3SQN A;  4A93 J;  1U2W A;  4OMY A;  2OQG A;  5DYM A;  1ZH5 A;  3CDI A;  2DFF A;  2V1D A;  2WB1 N;  2BV6 A;  1SAN A;  1G6N A;  3JSO A;  4CYC B;  3IV5 A;  5B1B H;  1T2K A;  2VKV A;  1K6Y A;  3OYF A;  4HYE A;  4BQN A;  5LRR A;  5D4S A;  2HI3 A;  2Y30 A;  3MZH A;  3F0C A;  3FMR A;  1MZB A;  4D5F A;  3CJQ B;  3WTZ A;  3AL0 C;  3HGY A;  4NQW A;  3G3Z A;  3ZGK A;  4ASN A;  3L7W A;  4TV7 A;  1AWC A;  1S29 A;  2QKL B;  2Z9O A;  1W7P A;  4UY8 I;  1VQ7 I;  4H0E A;  3T5X A;  4RB2 C;  3CCS I;  3LSG A;  4EAT A;  1WI9 A;  2R3S A;  1HLV A;  1LFB A;  2X6X A;  3HSF A;  1J75 A;  4ESJ A;  4M74 A;  4EM2 A;  3U1K A;  3LOC A;  2DW4 A;  2KIS A;  1QHG A;  2Y31 A;  4CIC A;  3GZ6 A;  5EJC A;  5ICC A;  3SEQ A;  4LLG F;  1XMA A;  4OWR B;  3HDD A;  3PIP F;  3C2G A;  3EUH A;  1TNT A;  5J1U A;  2CV1 A;  2BVM A;  2QM3 A;  5GPC A;  1NG7 A;  4Z2Y A;  2Z1D A;  1JI8 A;  5JI6 A;  2VBX A;  4IF4 A;  3LA3 A;  3OOP A;  1W5S A;  5E8I A;  3OV8 A;  4XL9 A;  4LJZ F;  1T0F C;  3PQJ A;  4L9V A;  2BVL A;  4WCG A;  1D5Y A;  4I76 A;  5L3C A;  2CGP A;  2A6H F;  3S15 J;  3QOE A;  1H89 C;  1ZG5 A;  2Y9Z A;  4CXF A;  5KVR A;  2G7H A;  4ZDL A;  1VZ0 A;  3CCV I;  4IO9 F;  2XGE A;  4RMN A;  2MW8 A;  3A1Y A;  4UV8 A;  3HPG A;  1YOV B;  4M3B A;  3CF5 F;  2VT3 A;  4NC8 A;  4HSR A;  3B73 A;  2KRF A;  1ZAR A;  3EYY A;  5HNH A;  2AQE A;  4GXO A;  2R7T A;  2LKP A;  1P4A A;  1R71 A;  3DU6 A;  1EJ9 A;  1U5T C;  3W3C A;  2BYV E;  2EQR A;  2B0L A;  1YYV A;  1W7P D;  3HRT A;  5GAH J;  5EYR A;  2VQG A;  2V9K A;  5CQE A;  1RR8 C;  2HOS A;  1X3Z B;  2VQH A;  2M5W A;  2NAZ A;  4OU0 A;  2R7U A;  1XCV A;  1T56 A;  4ZDO A;  3SHF A;  3IRQ A;  3OIP A;  2M30 A;  3FF5 A;  4CCN A;  1QU3 A;  1IN6 A;  3DV8 A;  3HHH A;  4PJJ A;  2MD5 A;  4LLN A;  2P5V A;  1AA7 A;  5GAD J;  5JLW A;  2IT0 A;  3FM3 A;  4A6E A;  1PP8 F;  2Z3Y A;  1NK3 P;  1S8N A;  4JQF A;  4UV9 A;  4ENM A;  2D2W A;  5HNF A;  5ERI A;  1KYW A;  5JR3 A;  2QF7 A;  2YUS A;  3GTL J;  1YQA A;  1W0T A;  3MWM A;  3BP8 A;  3D5R C;  4A0Z A;  3I53 A;  4WK8 F; 
#chains in the Genus database with same CATH homology
 4XLP F;  3DFG A;  3HTU A;  3I4P A;  4AVP A;  3QOP A;  3NRV A;  3DEU A;  3F6V A;  3N4M A;  4A12 A;  4L9J A;  2L54 A;  1L0O C;  3GFM A;  4P55 A;  3NEU A;  4BNC A;  4KFC A;  4R79 A;  2GWR A;  5CLS A;  3D0S A;  2ADU A;  2VOP A;  1U6G A;  2D1H A;  1ONV A;  1K6O A;  5D5V B;  3P9I A;  5LHH A;  3CUQ A;  2GZW A;  5DUI A;  1IN5 A;  4ZYD A;  3F8B A;  4CZZ A;  2STT A;  2Y75 A;  4CHU A;  1UFM A;  3PFI A;  5BPD A;  3ECH A;  3ZMS A;  5E1Z B;  4GYG A;  4G7H F;  2ZME A;  2K02 A;  2H94 A;  1FP2 A;  3ELK A;  3SXY A;  4M6Y A;  3TO6 A;  1ZLJ A;  2HTJ A;  3F8M A;  3FZV A;  3NQO A;  5ICE A;  3P9K A;  1UHM A;  3ISP A;  3RI4 A;  4BHC A;  4EGZ A;  1IUY A;  1SFE A;  1HW5 A;  3C1D A;  5DEQ A;  1LDJ A;  2FF4 A;  3V7S A;  2RDP A;  3R60 A;  1KQ9 A;  3H92 A;  4U7B A;  2DBB A;  1G3W A;  1FBQ A;  4I0B A;  4M9Z A;  5FB2 A;  3BDD A;  4EGY A;  3JTG A;  4EJV A;  1QZZ A;  1X3U A;  5D6F A;  3WTU C;  1G4D A;  2HZT A;  1TLH B;  4UVB A;  1BBY A;  3WGG A;  4WXC A;  4LFU A;  1GXQ A;  1KU7 A;  3U2R A;  1OPC A;  1TQM A;  4LG0 A;  2QBY A;  3HIF A;  1R1U A;  5D8L B;  5HDN A;  2VE9 A;  1O3R A;  1XDU A;  2AXL A;  2GAU A;  1CF7 A;  2HQR A;  5DV5 A;  2QQA A;  4OOI A;  3HHG A;  4FHT A;  4LK0 F;  1D3Y A;  2XAF A;  4UXN A;  3KCC A;  3WE2 A;  3LFK A;  5ILU A;  3I59 A;  2QEN A;  3RJP A;  1XGO A;  2P7C B;  5DCM B;  4MEY F;  1HKS A;  1R00 A;  5L3D A;  3FXU A;  1HW2 A;  2YPR A;  5ILS A;  1OYW A;  3KP4 A;  2VC0 A;  5CVJ A;  4I02 A;  4P5O A;  2IA1 A;  1AOY A;  1U78 A;  3S2W A;  1IXC A;  4RAZ A;  5DDG A;  1EH6 A;  1DUX C;  3ECO A;  4HA8 A;  4S04 A;  1ON1 A;  1W5T A;  3HOT A;  4JBA A;  4R1H A;  1SAX A;  4KIC A;  1HKT A;  3IL2 A;  3VB2 A;  4N9I A;  1ZRF A;  3IWF A;  2OU2 A;  1XMK A;  4M9S A;  1UB9 A;  4U0V A;  1IN7 A;  1GHC A;  2TDX A;  2VOD A;  1F4K A;  5LEJ A;  1Y0U A;  1OMI A;  3F3X A;  4P9F A;  2P5L C;  2MC3 A;  1P4W A;  3ABT A;  5IT9 K;  5ICF A;  3VEP A;  4Y17 A;  3ZQ7 A;  2Z5U A;  3RTR A;  1F5T A;  3HUG A;  2DPU A;  1FZP B;  4HOB A;  1UCR A;  1FOK A;  2GQQ A;  1RIO H;  4AIH A;  2A6E F;  1XB4 A;  2WC2 A;  3KLN A;  1R23 A;  1T39 A;  2LSO A;  1RZ4 A;  1V3F A;  2YX4 A;  3R6S A;  2XHK A;  3T0Y A;  1KU2 A;  1WQ2 A;  2OD5 A;  5HS8 A;  3M9A A;  4P96 A;  2H27 A;  1VTN C;  5JHU A;  3KP5 A;  4RGU A;  1KQ8 A;  2ESN A;  1KU3 A;  2LDU A;  2OZ6 A;  2R7F A;  3ZMZ A;  4KIF A;  3COA C;  1ZRE A;  1LDD A;  1BI2 A;  3JAM K;  4DNC A;  2JPB A;  4B09 A;  2ZBK A;  2UXN A;  4MTE A;  4O3M A;  2EK5 A;  4EM0 B;  2XVC A;  5BS6 A;  2FEZ A;  2PLY A;  2VE8 A;  1K78 A;  1BOA A;  1R58 A;  4GYI A;  6PAX A;  3RDI A;  1P2F A;  3E6B A;  3RKX A;  3RYR A;  1K7A A;  2GXG A;  5HS9 A;  2VON A;  3IWZ A;  1TW2 A;  2DT5 A;  1SD4 A;  4M72 A;  2DAO A;  2O6G E;  3JW4 A;  4G6D A;  3K2Z A;  3KP3 A;  3E6D A;  3GO5 A;  1HQC A;  1F9N A;  2HYG D;  4DQ2 A;  2XAQ A;  2PQ8 A;  5HLH A;  2FMY A;  3K1M A;  3IC7 A;  5K5R A;  2D45 A;  1L3L A;  4XRF A;  4RS8 A;  1W7P B;  1U8R A;  3B02 A;  4HW0 A;  2W85 A;  2FBK A;  2V79 A;  3BJO A;  4BHP A;  4Q4Z F;  2M87 A;  3FHZ A;  3O2P E;  3LQQ A;  1F1Z A;  4IJA A;  3EDP A;  1USS A;  2IPQ X;  3KZZ A;  1HKQ A;  1IRG A;  2EFW A;  2K86 A;  4KA4 A;  1O3Q A;  1B6A A;  5LEK A;  5DD8 A;  2BBY A;  2EV6 A;  4G9Y A;  1QPM A;  1CGP A;  4AWX B;  3C18 A;  4WX9 A;  4R8H A;  1WRJ A;  2VXZ A;  1IXS B;  2Z33 A;  3EYI A;  2M1B A;  3Q9S A;  2RV8 A;  5FFX A;  1HW1 A;  1OKR A;  2FRH A;  2E7X A;  2PI0 A;  2M45 A;  3ZMV A;  2HTS A;  2EA2 A;  1B4A A;  3R61 A;  5LLQ A;  3TO9 A;  3N97 A;  3RIR A;  1TBX A;  2DK5 A;  3HRU A;  3V4G A;  3GFJ A;  5FGM A;  2DTR A;  2EV0 A;  4M71 A;  4EJU A;  1LDK B;  3F72 A;  5E20 A;  1O57 A;  2XAJ A;  4HDU A;  4G6Q A;  3CJN A;  1C0W A;  3FWE A;  1YO5 C;  4UNO A;  2FNP A;  2DQR A;  2RKH A;  4RB3 C;  4U0Y A;  4IHT A;  2GXB A;  2XKP A;  2IA2 A;  5F6F A;  3J80 K;  1HSJ A;  2G9W A;  1TNS A;  3QP5 A;  4K2E A;  1IXR C;  1FLI A;  4RAY A;  2GIV A;  2PN6 A;  1D8J A;  2ZXJ A;  2CG4 A;  1PDN C;  1JHF A;  4LMY A;  3J81 K;  4FX4 A;  2KJC A;  3ZMD A;  2ZO4 A;  1IZ1 A;  2AS5 F;  5D5U B;  1HST A;  2ETH A;  5E8G A;  4AIJ A;  5H6R A;  5LBQ A;  4MGR A;  1GVJ A;  5AON A;  2UZK A;  3V8J A;  3CUQ B;  3CO6 C;  4IHS A;  4KNY A;  5BMZ A;  4OIR F;  5A2Q K;  2XAS A;  4ETS A;  2A5Y B;  2ZNY A;  4MQ9 F;  2P5K A;  3F8N A;  3CO7 C;  4I09 A;  1U5T A;  2JZY A;  2XRO A;  1TQP A;  3BJA A;  1B59 A;  2ZME B;  3H3Z A;  1O7F A;  5TRD A;  4HBL A;  1T38 A;  3WTX C;  3GXO A;  2W84 A;  1BC8 C;  5DCF A;  2BEO A;  1RNL A;  2Z99 A;  1IN4 A;  5DD4 A;  1JE8 A;  1XD7 A;  1S7O A;  2FNA A;  1J7K A;  5BQT A;  2L4M A;  3CDH A;  5TJJ A;  1I27 A;  1O7L A;  4HLX A;  1G3Y A;  2QVO A;  2A07 F;  4HQM A;  2EFQ A;  2Q2E A;  2YX7 A;  4A2U A;  2DK8 A;  1P6R A;  2FOK A;  2NNY A;  4XBF A;  2PG4 A;  2IVM A;  1Z1D A;  3FX3 A;  3BPX A;  2FSW A;  2DLL A;  2V9V A;  5CJ9 A;  2CYY A;  2CWE A;  3EQL F;  1D8K A;  1EH7 A;  1Q1H A;  4ESB A;  4KN7 X;  4NHJ A;  1BN5 A;  3IKT A;  1CF7 B;  3FM5 A;  3KEQ A;  1KU9 A;  2MLG A;  4YII A;  1STZ A;  3ULQ B;  4P9U A;  3BPV A;  1SFU A;  1FNN A;  1EH8 A;  5K1Y A;  1U3E M;  5J6X A;  5L3E A;  4OIP F;  1IN8 A;  2XUB A;  3CUQ C;  3I59 B;  3TDU C;  4XLN F;  2ZKZ A;  4KDP A;  3P7N A;  2IRF G;  3C3W A;  4OIN F;  3FXR A;  3F23 A;  4N9H A;  3BY6 A;  4ZH4 F;  2VT2 A;  2L3D A;  3I71 A;  1OR7 A;  4BYY A;  2E1C A;  1LEA A;  5FLX K;  2V1U A;  2JRT A;  5F64 A;  3TQN A;  2GA2 A;  4ZYH A;  4GGG A;  3ABU A;  2NYX A;  2DQL A;  4Y13 A;  3GX4 X;  1PUE E;  3HTS B;  3T8R A;  4YFX F;  2YU3 A;  3FMS A;  4BXU A;  4EJT A;  3LA7 A;  3ERE D;  1RI7 A;  4FT8 A;  4LB5 A;  2STW A;  1REP C;  4LLL A;  3VFZ A;  1JGS A;  4AD9 A;  1A04 A;  5FO5 A;  1J5Y A;  1FX7 A;  2MH2 A;  2J5O A;  3KLO A;  3VOE A;  3VOD A;  4L0Z B;  4Y15 A;  1SD7 A;  1TW3 A;  1XGS A;  2P4W A;  3J7A O;  1KGS A;  2QQ9 A;  4HAM A;  3MZY A;  2KJB A;  3BZ6 A;  1LEB A;  4ZZD A;  4M6X A;  4FX0 A;  5J8C A;  4KUM A;  4IRG A;  3TOA A;  1BI0 A;  2C6Y A;  2K7L A;  1XGN A;  3H3U A;  4O6J A;  4OIO F;  5CYV A;  3R4K A;  2BE5 F;  2X4H A;  1ZRC A;  1W4M A;  2RN7 A;  3D5L A;  2WWY A;  1NHA A;  3V7R A;  2EJR A;  1OYY A;  2ACJ A;  1R1T A;  3K9T A;  2V6C A;  1FSE A;  3LQR A;  1O3T A;  3F8F A;  3F21 A;  4KN4 X;  2OA4 A;  1K78 B;  2IA0 A;  1FPQ A;  2OAZ A;  1K79 A;  2F5F A;  5LGU A;  4A5M A;  3O6B B;  3ZN0 A;  2HGC A;  3F6O A;  3P9C A;  2P8T A;  2CW0 F;  3TOB A;  5LHI A;  5CVR A;  1YW9 A;  2JT1 A;  3O3K A;  1D5V A;  1LJ9 A;  4L5I A;  1BI1 A;  4EMS A;  4RB0 A;  2O3F A;  4KMU X;  5HLI A;  4WXD A;  1XSX A;  3WTT C;  3F22 A;  2F5E A;  1SD5 A;  3GYH X;  2PMH A;  1ZGA A;  3MCZ A;  1R36 A;  1S3J A;  4Q48 A;  3DXJ F;  4L9T A;  1Z9C A;  2EA4 A;  2M8E A;  5DCM A;  3R0J A;  2H6C A;  2XAH A;  4L9N A;  2H09 A;  3MQ0 A;  4ZYE A;  2F5D A;  2CFX A;  2H6B A;  4N0B A;  2COM A;  3QPH A;  5FFZ A;  1I6X A;  3QP6 A;  3RKW A;  2HOE A;  4U88 A;  4MEX F;  2HYF A;  3BOQ A;  2JSC A;  1MDM A;  2XAG A;  1H0M A;  2L01 A;  2XIG A;  4PDK A;  4IPA A;  5E1W A;  2ZJ2 A;  1B9M A;  3KP6 A;  3BRO A;  4EM1 A;  1QBJ A;  4LD5 A;  5BPI A;  3DPT A;  2K4B A;  2FBH A;  4A5N A;  3ZPL A;  1YS7 A;  2RC4 A;  2XRN A;  5H20 A;  4MHG A;  4CGZ A;  4EJO A;  4KT5 C;  4G8X A;  4I2O A;  1YLF A;  5HS7 A;  3TDZ C;  2DFI A;  4HDV A;  1SMT A;  2PBI A;  1PP7 U;  3C7J A;  3WTV C;  2O61 A;  4BHB A;  2E7W A;  3E97 A;  2CO5 A;  4BQA A;  1FBS A;  2FA5 A;  2K27 A;  2ELH A;  3ZN1 A;  4KIG A;  4G94 A;  4HV6 A;  2F5C A;  3GFI A;  2XV4 S;  4GCV A;  2L4A A;  2PFB A;  2WV0 A;  1T98 A;  3KE2 A;  2W24 A;  1HBX G;  3R0A A;  2PMU A;  4ON0 A;  2OQR A;  1ZLK A;  1BC7 C;  3LAP A;  3DP7 A;  1LQ1 A;  4U7D A;  3SFZ A;  3K1N A;  1U5T B;  3QPT A;  4I98 B;  4HX7 A;  2PEX A;  1P4X A;  4A0Y A;  1O3S A;  3ZMU A;  3SZT A;  4BAY A;  5L3F A;  2IW5 A;  4GO1 A;  2UWM A;  4O5V A;  4L18 B;  4NB5 A;  2UXX A;  3W6K B;  1RUO A;  3E5Q A;  5F1R A;  4G7O F;  1IF1 A;  1YW8 A;  5AIQ A;  1B1B A;  3ZMT A;  4ZYG A;  1KA8 A;  1XSV A;  1P92 A;  5HVQ C;  1J0R A;  2RVC A;  2L02 A;  1E17 A;  5K5Q A;  1KQ0 A;  1UST A;  4PGH A;  1T0F A;  4EV0 A;  1BIA A;  3T8T A;  4YFN F;  2HQN A;  4D0P A;  5CVU A;  1XCB A;  3KP7 A;  2BGC A;  1DPU A;  4EJW A;  4UUV A;  1J9I A;  2P6S A;  4XSZ F;  4LB6 B;  5LGT A;  2HR3 A;  4WXH A;  1WSU A;  2WTE A;  4MQV A;  3HYI A;  2HDC A;  3E5U A;  1YFH A;  2Q8K A;  3Q5F A;  4F7Z A;  2P6T A;  3M7G A;  2JTV A;  2J5P A;  2RNJ A;  2ISZ A;  1J59 A;  3CLO A;  4KYW A;  3RPU A;  4M73 A;  2D1V A;  3DPL C;  2HKO A;  2NS0 A;  1DPR A;  3DKW A;  3HRS A;  1OYI A;  2DI3 A;  2YSR A;  1G3T A;  1ZAO A;  3FMQ A;  2DPD A;  1MKM A;  3GWZ A;  1FP1 D;  1S6L A;  4WWC A;  1YS6 A;  3I0T A;  2KIF A;  3GFL A;  3E6M A;  2XGX A;  3I64 A;  3GZ5 A;  3U9G A;  2EV5 A;  3KP2 A;  1FT9 A;  2EFO A;  1YG2 A;  4YFK F;  3IHU A;  4Q5S F;  1XDS A;  1GXP A;  4A6D A;  2HWV A;  3GVA A;  3F8C A;  5EEG A;  5JVT A;  1TTY A;  1FYL A;  4HF1 A;  4IRI A;  2QLZ A;  2QUF A;  1LNW A;  3LWF A;  5IT9 Z;  1XSD A;  4AIK A;  3GLX A;  3MEX A;  1HXD A;  4LG0 B;  2VBY A;  3T1B A;  2QBY B;  1IAW A;  3QAH A;  1ZGJ A;  3LA2 A;  4B8X A;  1JXS A;  2MLK A;  1V4R A;  1QNT A;  2HEO A;  1RUN A;  4BH9 A;  5HLG A;  3G73 A;  3FXQ A;  2Y0M A;  1YIO A;  1J2X A;  4U0W A;  2Y48 A;  4ENK A;  1LB2 A;  2DO7 A;  3DQV C;  1FYM A;  3HSR A;  4EQQ A;  1R1V A;  3HRM A;  2LNB A;  3I54 A;  3L00 A;  2CQK A;  5H6Q A;  1ZRD A;  3ZP5 A;  2KIM A;  2V1X A;  1BIB A;  4XSX F;  1Z91 A;  1ULY A;  3JAM Z;  5ED4 A;  4HLY A;  2QZ8 A;  1QQI A;  1MJ9 A;  4KMF A;  5D6E A;  2F2E A;  3W6J B;  5FD5 A;  4M9X A;  4L5J A;  4RGR A;  2A68 F;  1ON2 A;  1BI3 A;  1T6S A;  3QRF F;  4HQE A;  1XGM A;  4HV5 A;  5D5X B;  1MJA A;  1WWX A;  5E18 F;  1DDN A;  1ZHF A;  5D5W B;  3EET A;  3GEZ A;  3M8F A;  3WG9 A;  3U1D A;  4IXA A;  3K0L A;  2EFP A;  3K69 A;  2VBW A;  4ENJ A;  2HKX A;  3KFW X;  4I01 A;  4PZJ A;  1QGP A;  3K1P A;  3LST A;  3M8E A;  2IJL A;  3DF8 A;  5K5O A;  2A69 F;  1FC3 A;  5JFR A;  1Z7U A;  2NRA C;  2VBZ A;  1UHW A;  1B9N A;  3WTY C;  4YG2 F;  1LVA A;  3I5U A;  5IT3 A;  3IRR A;  2O8X A;  3KEO A;  2LF8 A;  3HSE A;  4I0A A;  5HDK A;  1FWZ A;  1R5H A;  3CTA A;  4PCQ A;  3WTS C;  1MGT A;  2YR2 A;  5L3B A;  3L9F A;  1ZG1 A;  3TGN A;  4I7H A;  2EWN A;  4IVN A;  2ZFW A;  3M1E A;  1DP7 P;  4LK1 F;  2HFH A;  4E70 A;  2FML A;  3SZP A;  4CO8 A;  2VOO A;  1MJB A;  1H9G A;  2P7V B;  1TQI A;  3CUO A;  4YIF A;  3AAF A;  4RGX A;  1I1G A;  3WE3 A;  3I58 A;  4ENN A;  2FE3 A;  1IW7 F;  4RGS A;  3V8K A;  1QZY A;  3E3V A;  4PGG A;  4CYD A;  2A61 A;  1MDM B;  1ZYR F;  4LGW A;  5D4R A;  1EV7 A;  2ZCW A;  4HX8 A;  2FXA A;  5LRS A;  2X0L A;  4A0X A;  3ML6 A;  2FQ3 A;  3RKY A;  3MFK A;  2QYO A;  1IRF A;  3J80 Z;  5HDG A;  3TKY A;  2HS5 A;  1FSH A;  1S7A A;  4Q47 A;  2KIU A;  5ICG A;  3E5X A;  2Q0O A;  1XN7 A;  1ODD A;  1QO0 D;  1I5Z A;  2K4J A;  4MTD A;  2EFN A;  3J81 Z;  3WGH A;  2G7U A;  3V7C A;  2OBP A;  5E1X A;  2GA1 A;  2FBI A;  4OIQ F;  4HX4 A;  3KZY A;  2IP2 A;  4IRH A;  5EEH A;  1BJA A;  1FY7 A;  2RGV A;  3QU3 A;  5J8F A;  3L2C A;  2MH9 A;  4UVC A;  5A2Q Z;  3L09 A;  5CVI A;  2A3S A;  2XKO A;  5CVV A;  1I1S A;  2RQP A;  2QQB A;  3GF2 A;  2O0Y A;  4ZZL A;  4L0Y B;  5KK1 A;  4WF2 A;  3MAJ A;  5LGN A;  1SD6 A;  2VC1 A;  2QWW A;  1FYK A;  2E1N A;  1ZG3 A;  2PJP A;  5BOX A;  2W57 A;  4CDG A;  1WKM A;  2ZNZ A;  2MA3 A;  1Z6R A;  3QU6 A;  4QLC U;  1Z6T A;  1H9T A;  2ESH A;  4S05 A;  3RPQ A;  3WOD F;  3WU0 A;  1SFX A;  1YTY A;  3JTH A;  3BJ6 A;  4JK1 X;  5AIP A;  2MBF A;  2OZU A;  3PQK A;  3E6C C;  3ROU A;  5FD6 A;  4MNU A;  5HOO A;  4UHT A;  4OMZ A;  1JHH A;  2FU4 A;  1G3S A;  1BM9 A;  2W25 A;  3WTW C;  1Z05 A;  1YW7 A;  4RB1 A;  2CSO A;  3GW2 A;  3REO A;  1R22 A;  5LHG A;  1R7J A;  2DU9 A;  1SMY F;  1ZN2 A;  3RYP A;  2R7D A;  3TO7 A;  3V8L A;  3BWG A;  4KIB A;  3JSP A;  2NNN A;  4EVI A;  2KKO A;  5DUK A;  3GUD A;  5ILV A;  2ISY A;  1R5G A;  4G7Z F;  4ESF A;  2JPC A;  2EB7 A;  3IKV A;  3WGI A;  1E2X A;  2O03 A;  4HF0 A;  1KYZ A;  1FBU A;  2VN2 A;  3KET A;  3HOS A;  2LF7 A;  5FLX Z;  5D8K B;  3WU1 B;  4QWQ A;  4HF2 A;  3LAJ A;  4HZF A;  5E17 F;  1MD0 A;  5L3G A;  4UVA A;  3Q9V A;  3SQN A;  1U2W A;  4OMY A;  2OQG A;  5DYM A;  1ZH5 A;  2V1D A;  2BV6 A;  1G6N A;  3JSO A;  1T2K A;  4HYE A;  5LRR A;  5D4S A;  3MZH A;  3FMR A;  1MZB A;  3WTZ A;  4NQW A;  3G3Z A;  4ASN A;  3L7W A;  4TV7 A;  1AWC A;  1S29 A;  2Z9O A;  1W7P A;  4H0E A;  3T5X A;  4RB2 C;  1WI9 A;  2R3S A;  3HSF A;  1J75 A;  4ESJ A;  4M74 A;  4EM2 A;  2DW4 A;  4CIC A;  3GZ6 A;  5ICC A;  4LLG F;  1XMA A;  3EUH A;  1TNT A;  2QM3 A;  4Z2Y A;  5JI6 A;  2VBX A;  4IF4 A;  3LA3 A;  3OOP A;  1W5S A;  5E8I A;  3OV8 A;  4LJZ F;  3PQJ A;  4L9V A;  4WCG A;  5L3C A;  2CGP A;  2A6H F;  4CXF A;  5KVR A;  2G7H A;  4UV8 A;  2VT3 A;  3B73 A;  2KRF A;  1ZAR A;  3EYY A;  4GXO A;  2LKP A;  1P4A A;  1U5T C;  2BYV E;  2B0L A;  1YYV A;  1W7P D;  3HRT A;  2M5W A;  2NAZ A;  4OU0 A;  1XCV A;  3SHF A;  3IRQ A;  2M30 A;  3FF5 A;  1IN6 A;  3DV8 A;  3HHH A;  2MD5 A;  4LLN A;  2P5V A;  2IT0 A;  3FM3 A;  4A6E A;  1PP8 F;  2Z3Y A;  1S8N A;  4JQF A;  4UV9 A;  4ENM A;  2D2W A;  5ERI A;  1KYW A;  5JR3 A;  1YQA A;  3MWM A;  3BP8 A;  1ZG5 A;  4A0Z A;  3I53 A;  4WK8 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...