1BJNA

Structure of phosphoserine aminotransferase from escherichia coli
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
360
structure length
359
Chain Sequence
QIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTILSRPIDVSRYGVIYAGAQNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKRNRSRMNVPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFERRHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphoserine aminotransferase from Escherichia coli at 2.3 A resolution: comparison of the unligated enzyme and a complex with alpha-methyl-l-glutamate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminotransferase
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
total genus 119
structure length 359
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 1998-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1bjnA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1bjnA02
1M4NA 1D7RA 2CY8A 3MC6A 1FG3A 1AHYA 2BYJA 3G0TA 2W7HA 3ISLA 3PPLA 3HDOA 4P3MA 4XEWA 1RVUA 4ADCA 1WYUA 3N75A 4BQ0A 1IX6A 4K2MA 3R9AA 1AMQA 4LNMA 1CL2A 2VMZA 4WLHA 4OBUA 2ZY5A 1AMAA 1IBJA 3BCBA 3II0A 3DXWA 3JTXA 5G4IA 1X28A 1G4XA 3OP7A 3M5UA 3RBFA 3T32A 5F9SA 1DJEA 2W7JA 4Y0IA 1QGNA 5HHYA 1RV4A 1B9HA 3H14A 4WB0B 5D5SA 4OBVA 4OTLA 1W23A 2BWOA 4XQ2A 1QZ9A 3ATHA 3A8UX 4F5LA 3JWAA 1D7VA 2DR1A 1MDOA 1WSTA 1SZSA 1YOOA 5G2PA 2VMNA 2R5EA 4DQ6A 3JW9A 1MDZA 4ZDOA 3PDBB 4R5ZA 2PB0A 4R5FA 3BWNA 1X0MA 4H51A 5EIGB 3DYDA 4Y0HA 2HORA 2Z1ZA 1FG7A 1XI9A 1Z7DA 4ADEA 4PFNA 4GE4A 3VOMA 3RUYA 1S09A 4JEVA 4E77A 3IF2A 4AO9A 2D61A 2BIAA 3PIUA 2W7IA 4F5JA 1IVRA 3PGYA 4UHMA 1C9CA 1WYUB 3E9KA 1ARSA 3PDBA 1KMKA 1JG8A 1GBNA 1BKGA 3TATA 4RITA 3F9TA 5AX8A 3EIBA 3AOVA 2GB3A 1IAYA 2W8JA 5M4DA 4W8IA 1QITA 1KL1A 1MAPA 4MKJA 4R8DA 1P3WA 1DGEA 2CH2A 1B4XA 4UQVA 1TOEA 1GEYA 3NRAA 1N31A 1AKCA 3QI6A 2EGYA 4N0BA 1LC5A 2BI1A 2XH1A 2CFBA 4XJPA 4ZDPA 1QIRA 2YRRA 2HOXA 5DX5A 3FKDA 3NUIA 2W7KA 1N2TA 1OHYA 3F0HA 3MC6C 3P1TA 1D2FA 4EFFA 1FC4A 2ZP7A 3N0LA 3AEMC 2ZY4A 2CJDA 2DKBA 2YOBA 4N0WA 4JEWA 1TOKA 1EG5A 3ECDA 3WX9A 1AICA 4PIWA 2JJEA 2Z61A 2ZYJA 2QMAA 4DBCA 4WYGA 4GRXA 3FFHA 2JJHA 3ZRQA 4IX8A 3MKJA 1ASFA 1KKJA 1X2AA 2Z67A 1W7MA 3GSBA 2W7DA 3LVKA 4K2IA 3TFTA 1AMSA 3WGBA 1H1CA 3QGUA 1PFFA 4WB0A 2HUFA 2YRIA 5M46A 1AHXA 1CQ6A 4W1VA 4WYAA 3K7YA 4J5UA 3FZ6A 1EJIA 4M2JA 5DB5A 1ASDA 1KMJA 2VLHA 1AIBA 1GDEA 1JS6A 3ZRRA 4CXQA 3E6GA 4IYOA 2O0RA 5LHAA 3QHXA 5EQCA 3BWNC 3GZDA 4UHNA 5F8VA 1UU0A 1IX7A 2QBTA 5EAAA 2AY1A 2VGVA 2FNIA 3AOWA 3EUCA 1I29A 3NYUA 2WKAA 4F5IA 4ZSYA 3ZZJA 1C7NA 1CQ7A 2BWPA 4ITXA 3RI6A 2VIBA 3MEBA 4GSAA 1OATA 2BHXA 2Z9XA 3CQ5A 4OYTA 2VMVA 2OGEA 1CJ0A 4CBSA 1GCKA 3WCOA 1YAAA 3AENA 5LH9A 3DR4A 3EI9A 3P6KA 2QB3A 3FQAA 4LNLA 1GD9A 2YCPA 3Q8NA 5C6UA 2BI2A 2V1PA 2VGZA 1ASCA 1YJSA 3JWBA 8AATA 1CZCA 4WYDA 1ARTA 2D66A 2VGWA 1ARHA 4DGTA 4IXOA 2AY2A 3NNKA 2Z1YA 4RKDA 4F5MA 2O7CA 4MGRA 1LC7A 4B9BA 1SVVA 1I41A 1OXOA 1OHWA 3DRDA 3UE8A 2DKJA 2ZUKA 2CB1A 2AY5A 1TOJA 2QLRA 4JE5A 1CQ8A 2BKWA 4O6ZA 4OT8A 1BQDA 2BIEA 3B8XA 3BCXA 2V0YA 1UU2A 3EI8A 2D7YA 2Z9WA 4XJOA 2ZJGA 1RVYA 1LC8A 1O61A 1B9IA 2VMOA 3A9XA 2Z9VA 4OCAA 3COGA 3CQ4A 2JGTA 3E2ZA 3JZLA 4FL0A 3ZZKA 1LS3A 1ZOBA 5FT8A 4I8AA 3EI5A 2TPLA 4FFCA 4BA5A 3WKSA 2D63A 4TV7A 5E5IA 1YJYA 3AV7A 3WKRA 4ADDA 2EPJA 3FZ8A 3LWSA 2GQNA 2JJGA 3GR9A 4OC9A 2XBNA 3EI6A 4W1WA 2VI8A 1M0QA 3EI7A 1ARGA 3MBBA 4RJYA 2AY8A 3QPGA 3FTBA 1V72A 4GE7A 3W1IA 4MY5A 2ZC0A 3VK4A 2W7GA 1YNUA 2ORDA 3TCMA 1TARA 3G7QA 5K8BA 2ZSMA 1SFFA 2CANA 1LW5A 3MAFA 1AY4A 2OQXA 4J8LA 1WYVB 4MQQA 1GEXA 3BCAA 5EIGA 2AEUA 1AAMA 1AJSB 2DGMA 3UAKA 4KYOA 5EFSA 2VGUA 2W7MA 3ZRPA 2VMXA 2HOZA 4B98A 1IUGA 1Y4IA 2HZPA 1JF9A 5FT5A 2X5DA 2HUUA 1E5FA 1O4SA 1J04A 2YCTA 3W1JA 1BJNA 4A0GA 2Z9UA 3DXVA 4W91A 5BJ4A 2CTZA 1KKPA 4WD2A 1SZUA 2GMSA 3TQXA 3WGCA 1C7OA 3GJUA 4JEXA 1D7SA 4GDYA 4XAUA 3FCRA 3HL2A 4Q76A 2EZ2A 3MAFB 3R4TA 4A6TA 4JEZA 4WXFA 2CINA 3EZ1A 3FFRA 4PFFA 1B5PA 1M0OA 1BJWA 4A72A 1BJ4A 1AIAA 2AY7A 4EB5A 2VIAA 2D5YA 1D7UA 1DKAA 1ECXA 2VGTA 1H0CA 1WKHA 3G8MA 4RIZA 2D7ZA 2YKVA 2Q7WA 2OKKA 4K2BA 2WK8A 3PD6B 4ZM4A 2AEVA 3B1CA 3E77A 1JS3A 3EZSA 1PG8A 4GE9A 4ZASA 9AATA 5DJ1A 4W5KA 4ZAHA 1WYTA 2ZY3A 1ASGA 3GBXA 3WZFA 4A0FA 4RAEA 1TATA 2F8JA 5D95A 4ATPA 2D65A 1AHFA 4TMRA 1SPAA 4ZWVA 3NDNA 4IYOB 1LKCA 1YIZA 3AEMA 3HVYA 2FQ6A 5EAVA 2WK9A 1CS1A 1C4KA 4KXKA 4PVFA 1O69A 1W3UA 2C7TA 3BN1A 4JF0A 4ZWMA 1ASBA 4ITGA 4IY7A 1SF2A 2VMQA 1ZC9A 1M0NA 4AO4A 1AY5A 1B8GA 2AY4A 4EU1A 1BQAA 3NU8A 1UKJA 2X8UA 4TN4A 1G7XA 2EZ1A 4XK1A 2R5CB 3W1HA 1J32A 4CVQA 2E7UA 2GSAA 5M49A 1V2DA 3WY7A 1AHEA 3CQ6A 3AENB 2R2NA 4WLJA 2VLFA 2C44A 1AJRA 2JG2A 4XJMA 4RM1A 2C81A 1WYTB 1AKBA 5HXXA 2CSTA 3LG0A 2OATA 5G0AA 1VEFA 4ZLVA 1WKGA 3B1EA 3DZZA 2CJHA 5EUNA 3VK2A 5JAYA 2VMWA 1TOIA 3FZ7A 3FDBA 3CAIA 4LW4A 1DJUA 1GC0A 2VMSA 5E3KA 5TF5A 3GZCA 1O62A 1G4VA 1X29A 4JEYA 4MQPA 1XEYA 2FNUA 3K40A 3LVMA 2PO3A 2ZY2A 1AY8A 4ZSWA 3UWCA 3WLXA 3E2ZB 3LY1A 4AOAA 3BWOA 2YHKA 3F6TA 1S08A 5G09A 2GMUA 2YCNA 5E4ZA 2QB2A 2BI5A 1S0AA 2HP1A 3KE3A 3KGWA 4LW2A 4GEBA 2G6WA 4WYCA 3AEJA 3CBFA 4WP0A 4OMAA 1ASAA 2ZSLA 2D64A 3AELA 4EB7A 3MADA 2HUIA 3FRKA 2O1BA 4Q31A 1CZEA 3AEPA 4F4EA 4E3RA 3ELPA 4CBRA 3ELEA 5G4JA 4MQRA 2X5FA 1TASA 3FVUA 3NTJA 1MAQA 4IXZA 2R5CA 1N8PA 4WXGA 4AZKA 7AATA 3ACZA 2VMUA 4E1OA 1C7GA 3QBOA 2RFVA 4F5GA 3QM2A 1V2FA 3FQ7A 3A2BA 3PDXA 4NOGA 1RV3A 1VJOA 4LC3A 3HLMA 2JJFA 3I4JA 1GC3A 2W7EA 3HBXA 1I43A 3A9ZA 1E5EA 4ZDLA 1AAWA 3H7FA 1U08A 1DGDA 2W8TA 4CXRA 4A6UA 2CH1A 3NYSA 1BJOB 4IW7A 3NU7A 1QISA 3N5MA 3E2YA 2BI9A 1BJOA 5FT4A 2E7JA 3USFA 1ELUA 3FD0A 4ADBA 1BS0A 1M0PA 3D6KA 5EUEA 1LW4A 1MGVA 2YKXA 4QGRA 4A00A 3EIAA 3RBLA 4Q6RA 3PD6A 1M32A 3HT4A 3AATA 4EMYA 2W8UA 3QN6A 1ASMA 4WYFA 3BV0A 4A6RA 1DTYA 3FDDA 2EO5A 2YKYA 2VMYA 4ISYA 4W1XA 5M4BA 2AY3A 2E54A 4RJ0A 1LK9A 2Z20A 1ASNA 1B5OA 1ASEA 3ASBA 1I48A 1UU1A 4BMKA 1Z3ZA 3BS8A 4RKCA 4A0HA 1AHGA 1DJ9A 2W8VA 3K28A 3LVJA 4MSOA 3L44A 1OHVA 4U2HA 4HVKA 2VMRA 4LNJA 1CL1A 1OXPA 1AX4A 3PJ0A 5DJ9A 2X3LA 2FYFA 2HOYA 2WK7A 3IHJA 4JE5D 1IJIA 1IX8A 1GC4A 1EQBA 1MLYA 2BI3A 4WXBA 4M2KA 3E2FA 4F5KA 2VMPA 3RCHB 3RQ1A 1WYVA 3JU7A 3FVSA 4E3QA 4BA4A 3PA9A 1KL2A 2DGLA 2PB2A 1BT4A 2AY6A 2C0RA 3AEJC 3DU4A 2BWNA 3DR7A 2HP2A 2DOUA 2NMPA 1GC2A 3DODA 3NX3A 4AH3A 4L0OA 3HMUA 4P7YA 2CJGA 3GETA 5HDMA 1PMOA 4RLGA 4WBTA 1ARIA 4AZJA 3PAAA 4F5HA 2FN6A 1M7YA 1QJ3A 1W7NA 1G7WA 3WCNA 3FSLA 3NUBA 4BHDA 3VP6A 1YJZA 2VMTA 3LV2A 5EUDA 1T3IA 2FM1A 1BW0A 1S07A 2VGSA 1MDXA 3B46A 1C0NA 3I16A 4XJLA 3VAXA 3GWPA 2JISA 2AATA 4Q75A 3HQTA 5I92A 1ASLA 3BC8A 1YIYA 3I5TA 3GZDC 5J8QA 3DC1A 1ORDA 3VK3A 1TOGA 3FVXA 2E7IA 1DFOA 2OKJA 1V2EA 4UOYA 4R2NA 1M6SA 1AMRA 2W7LA 5FT6A 3BB8A 3NYTA 4UHOA 1PMMA 3ASAA 2QA3A 1ELQA 1AKAA 3RCHA 4F5FA 2AY9A 5IWQA 2EH6A 2BYLA 2W7FA 1TPLA 3KKIA 5G2QA 3OKSA 3FQ8A 1QJ5A 2OGAA 3KGXA 4KAMA 2BIGA 3LVLB 4IXSA 1S06A 4A0RA 2DGKA 4JF1A 5BJ3A 1MLZA 2R0TA 2W8WA 3AEOA 1GEWA 1IAXA 2VYCA 2YKUA 4MKKA 3B1DA 4WYEA 1W7LA 3TFUA 1ZODA 1SZKA 4Y0DA 4ATQA 1VP4A 1AJSA 2VI9A 3MAUA 4M2MA 4ZM3A 3L8AA 4U1TA 4HF8A 3A9YA
chains in the Genus database with same CATH superfamily
1M4NA 1D7RA 2CY8A 3MC6A 1FG3A 1AHYA 2BYJA 3G0TA 2W7HA 3ISLA 3PPLA 3HDOA 4P3MA 4XEWA 1RVUA 4ADCA 1WYUA 3N75A 4BQ0A 1IX6A 4K2MA 3R9AA 1AMQA 4LNMA 1CL2A 2VMZA 4WLHA 4OBUA 2ZY5A 3N4XA 1AMAA 1IBJA 3BCBA 3II0A 3DXWA 3JTXA 5G4IA 1X28A 1G4XA 3OP7A 3M5UA 3RBFA 3T32A 5F9SA 5KTBA 1DJEA 2W7JA 4Y0IA 1QGNA 5HHYA 1RV4A 1B9HA 3H14A 4WB0B 5D5SA 4OBVA 3N7NA 4OTLA 1W23A 2BWOA 4XQ2A 1QZ9A 3ATHA 3A8UX 4F5LA 3JWAA 1D7VA 2DR1A 1MDOA 1WSTA 1SZSA 1YOOA 5G2PA 2VMNA 2R5EA 4DQ6A 3JW9A 1MDZA 4ZDOA 3PDBB 4R5ZA 2PB0A 4R5FA 3BWNA 1X0MA 4H51A 5EIGB 3DYDA 4Y0HA 2HORA 2Z1ZA 1FG7A 1XI9A 1Z7DA 4ADEA 4PFNA 4GE4A 3VOMA 3RUYA 1S09A 4JEVA 4E77A 3IF2A 2EYQA 4AO9A 2D61A 2BIAA 3PIUA 2W7IA 4F5JA 1IVRA 3PGYA 4UHMA 1C9CA 1WYUB 3E9KA 1ARSA 3PDBA 1KMKA 1JG8A 1GBNA 1BKGA 3TATA 4RITA 3F9TA 5AX8A 3EIBA 3AOVA 2GB3A 1IAYA 2W8JA 5M4DA 4W8IA 1QITA 1KL1A 1MAPA 4MKJA 4R8DA 1P3WA 1DGEA 2CH2A 1B4XA 4UQVA 1TOEA 1GEYA 3NRAA 1N31A 1AKCA 3QI6A 2EGYA 4N0BA 1LC5A 2BI1A 2XH1A 2CFBA 4XJPA 4ZDPA 1QIRA 2YRRA 2HOXA 5DX5A 3FKDA 3NUIA 2W7KA 1N2TA 1OHYA 3F0HA 3MC6C 3P1TA 1D2FA 4EFFA 1FC4A 2ZP7A 3N0LA 3AEMC 2ZY4A 2CJDA 2DKBA 2YOBA 4N0WA 4JEWA 1TOKA 1EG5A 3ECDA 3WX9A 1AICA 4PIWA 2JJEA 2Z61A 2ZYJA 2QMAA 4DBCA 4WYGA 4GRXA 3FFHA 2JJHA 3ZRQA 4IX8A 3MKJA 1ASFA 1KKJA 1X2AA 2Z67A 1W7MA 3GSBA 2W7DA 3LVKA 4K2IA 3TFTA 1AMSA 3WGBA 1H1CA 3QGUA 2A1VA 1PFFA 4WB0A 2HUFA 2YRIA 5M46A 1AHXA 1CQ6A 4W1VA 4WYAA 3K7YA 4J5UA 3FZ6A 1EJIA 4M2JA 5DB5A 1ASDA 1KMJA 2VLHA 1AIBA 1GDEA 1JS6A 3ZRRA 4CXQA 3E6GA 4IYOA 2O0RA 5LHAA 3QHXA 5EQCA 3BWNC 3GZDA 4UHNA 5F8VA 1UU0A 1IX7A 2QBTA 5EAAA 2AY1A 2VGVA 2FNIA 3AOWA 3EUCA 1I29A 3NYUA 2WKAA 4F5IA 4ZSYA 3ZZJA 1C7NA 1CQ7A 2BWPA 4ITXA 3RI6A 2VIBA 3MEBA 4GSAA 1OATA 2BHXA 2Z9XA 3CQ5A 4OYTA 2VMVA 2OGEA 1CJ0A 4K05A 4CBSA 1GCKA 3WCOA 1YAAA 3AENA 5LH9A 3DR4A 3EI9A 3P6KA 2QB3A 3FQAA 4LNLA 1GD9A 2YCPA 3Q8NA 5C6UA 3H9XA 2BI2A 2V1PA 2VGZA 1ASCA 1YJSA 3JWBA 8AATA 1CZCA 4WYDA 1ARTA 2D66A 2VGWA 1ARHA 4DGTA 3N4SA 4IXOA 2KFPA 2AY2A 3NNKA 2Z1YA 4RKDA 4F5MA 2O7CA 4MGRA 1LC7A 4B9BA 1SVVA 1I41A 1OXOA 1OHWA 3DRDA 3UE8A 2DKJA 2ZUKA 2CB1A 2AY5A 1TOJA 2QLRA 4JE5A 1CQ8A 2BKWA 4O6ZA 4OT8A 1BQDA 2G7JA 2BIEA 3B8XA 3BCXA 2V0YA 1UU2A 3EI8A 2D7YA 2Z9WA 4XJOA 2ZJGA 1RVYA 1LC8A 1O61A 1B9IA 2VMOA 3A9XA 2Z9VA 4OCAA 3COGA 3CQ4A 2JGTA 3E2ZA 3JZLA 4FL0A 3ZZKA 1LS3A 1ZOBA 5FT8A 4I8AA 3EI5A 2TPLA 4FFCA 4BA5A 3WKSA 2D63A 4TV7A 5E5IA 1YJYA 3AV7A 3WKRA 4ADDA 2EPJA 3FZ8A 3LWSA 2GQNA 2JJGA 3GR9A 4OC9A 2XBNA 3EI6A 4W1WA 4H63Q 2VI8A 1M0QA 3EI7A 1ARGA 3MBBA 4RJYA 2FKIA 2AY8A 3QPGA 3FTBA 1V72A 4GE7A 3W1IA 4MY5A 2ZC0A 3VK4A 2W7GA 1YNUA 2ORDA 3TCMA 1TARA 3G7QA 5K8BA 2ZSMA 1SFFA 2CANA 1LW5A 3MAFA 1AY4A 2OQXA 4J8LA 1WYVB 4MQQA 1GEXA 3BCAA 5EIGA 2AEUA 1AAMA 1AJSB 2DGMA 3UAKA 4KYOA 5EFSA 2VGUA 2W7MA 3ZRPA 2VMXA 2HOZA 4B98A 1IUGA 1Y4IA 2HZPA 1JF9A 5FT5A 2X5DA 2HUUA 1E5FA 1O4SA 1J04A 2YCTA 3W1JA 1BJNA 4A0GA 2Z9UA 3DXVA 4W91A 5BJ4A 2CTZA 1KKPA 4WD2A 1SZUA 2GMSA 3TQXA 3WGCA 1C7OA 3GJUA 4JEXA 1D7SA 4GDYA 4XAUA 3FCRA 3HL2A 4Q76A 2EZ2A 3MAFB 3R4TA 4A6TA 4JEZA 4WXFA 2CINA 3EZ1A 3FFRA 4PFFA 1B5PA 1M0OA 1BJWA 4A72A 1BJ4A 1AIAA 2AY7A 4EB5A 2VIAA 2D5YA 1D7UA 1DKAA 1ECXA 2VGTA 1H0CA 1WKHA 3G8MA 4RIZA 2D7ZA 2YKVA 2Q7WA 2OKKA 4K2BA 2WK8A 3PD6B 4ZM4A 2AEVA 3B1CA 3E77A 1JS3A 3EZSA 1PG8A 4GE9A 4ZASA 9AATA 5DJ1A 4W5KA 4ZAHA 1WYTA 2ZY3A 1ASGA 3GBXA 3WZFA 4A0FA 4RAEA 1TATA 2F8JA 5D95A 4ATPA 2D65A 2WB6A 1AHFA 4TMRA 1SPAA 4ZWVA 3NDNA 4IYOB 1LKCA 1YIZA 3AEMA 3HVYA 2FQ6A 5EAVA 2WK9A 1CS1A 1C4KA 4KXKA 4PVFA 1O69A 1W3UA 2C7TA 3BN1A 4JF0A 4ZWMA 1ASBA 4ITGA 4IY7A 1SF2A 2VMQA 1ZC9A 1M0NA 4AO4A 1AY5A 1B8GA 2AY4A 4EU1A 1BQAA 3NU8A 1UKJA 2X8UA 4TN4A 1G7XA 2EZ1A 4XK1A 2R5CB 3W1HA 1J32A 4CVQA 2E7UA 2GSAA 5M49A 1V2DA 3WY7A 1AHEA 3CQ6A 3AENB 2R2NA 4WLJA 2VLFA 2C44A 1AJRA 2JG2A 4XJMA 4RM1A 2C81A 1WYTB 1AKBA 5HXXA 2CSTA 3LG0A 2OATA 5G0AA 1VEFA 4ZLVA 1WKGA 3B1EA 3DZZA 2CJHA 5EUNA 3VK2A 5JAYA 2VMWA 1TOIA 3FZ7A 3FDBA 3CAIA 4LW4A 1DJUA 1GC0A 2VMSA 5E3KA 5TF5A 3GZCA 1O62A 1G4VA 1X29A 4JEYA 4MQPA 1XEYA 2FNUA 3K40A 3LVMA 2PO3A 2ZY2A 1AY8A 4ZSWA 3UWCA 3WLXA 3E2ZB 3LY1A 4AOAA 3BWOA 2YHKA 3F6TA 1S08A 5G09A 2GMUA 2YCNA 5E4ZA 2QB2A 2BI5A 1S0AA 2HP1A 3KE3A 3KGWA 4LW2A 4GEBA 2G6WA 4WYCA 3AEJA 3CBFA 4WP0A 4OMAA 1ASAA 2ZSLA 2D64A 3AELA 4EB7A 3MADA 2HUIA 3FRKA 2O1BA 4Q31A 1CZEA 3AEPA 4F4EA 4E3RA 3ELPA 4CBRA 3ELEA 5G4JA 4MQRA 2QSRA 2X5FA 1TASA 3FVUA 3NTJA 1MAQA 4IXZA 2R5CA 1N8PA 4WXGA 4AZKA 7AATA 3ACZA 2VMUA 4E1OA 1C7GA 3QBOA 2RFVA 4F5GA 3QM2A 1V2FA 3FQ7A 3A2BA 3PDXA 4NOGA 1RV3A 1VJOA 4LC3A 3HLMA 2JJFA 3I4JA 1GC3A 2W7EA 3HBXA 1I43A 3A9ZA 1E5EA 4ZDLA 1AAWA 3H7FA 1U08A 1DGDA 2W8TA 4CXRA 4A6UA 2CH1A 3NYSA 1BJOB 4IW7A 3NU7A 1QISA 3N5MA 3E2YA 2BI9A 1BJOA 5FT4A 2E7JA 3USFA 1ELUA 3FD0A 4ADBA 1BS0A 1M0PA 3D6KA 5EUEA 1LW4A 1MGVA 2YKXA 4QGRA 4A00A 3EIAA 3RBLA 4Q6RA 3PD6A 1M32A 3HT4A 3AATA 4EMYA 2W8UA 3QN6A 1ASMA 4WYFA 3BV0A 4A6RA 1DTYA 1KAFA 3FDDA 2EO5A 2YKYA 2VMYA 4ISYA 4W1XA 5M4BA 2AY3A 2E54A 4RJ0A 1LK9A 2Z20A 1ASNA 1B5OA 1ASEA 3ASBA 1I48A 1UU1A 4BMKA 1Z3ZA 3BS8A 4RKCA 4A0HA 1AHGA 1DJ9A 2W8VA 3K28A 3LVJA 4MSOA 3L44A 1OHVA 4U2HA 4HVKA 2VMRA 4LNJA 1CL1A 1OXPA 1AX4A 3PJ0A 5DJ9A 2X3LA 2FYFA 2HOYA 2WK7A 3IHJA 4JE5D 1IJIA 1IX8A 1GC4A 1EQBA 1MLYA 2BI3A 4WXBA 4M2KA 3E2FA 4F5KA 2VMPA 3RCHB 3RQ1A 1WYVA 3JU7A 3FVSA 4E3QA 4BA4A 3PA9A 1KL2A 2DGLA 2PB2A 1BT4A 2AY6A 2C0RA 3AEJC 3DU4A 2BWNA 3DR7A 2HP2A 2DOUA 2NMPA 1GC2A 3DODA 3NX3A 4AH3A 4L0OA 3HMUA 4P7YA 2CJGA 3GETA 5HDMA 1PMOA 4RLGA 4WBTA 1ARIA 4AZJA 3PAAA 4F5HA 2FN6A 1M7YA 1QJ3A 1W7NA 1G7WA 3WCNA 3FSLA 3NUBA 4BHDA 3N4RA 3VP6A 1YJZA 2VMTA 3LV2A 5EUDA 1T3IA 2FM1A 1BW0A 1S07A 2VGSA 1MDXA 3B46A 1C0NA 3I16A 4XJLA 3VAXA 3GWPA 2JISA 2AATA 4Q75A 3HQTA 5I92A 1ASLA 3BC8A 1YIYA 3I5TA 3GZDC 5J8QA 3DC1A 1ORDA 3VK3A 1TOGA 3FVXA 2E7IA 1DFOA 2OKJA 1V2EA 4UOYA 4R2NA 1M6SA 1AMRA 2W7LA 5FT6A 3BB8A 3NYTA 4UHOA 1PMMA 3ASAA 2QA3A 1ELQA 1AKAA 3RCHA 4F5FA 2AY9A 5IWQA 2EH6A 2BYLA 2W7FA 1TPLA 3KKIA 5G2QA 3OKSA 3FQ8A 1QJ5A 2OGAA 3KGXA 4KAMA 2BIGA 3LVLB 4IXSA 1S06A 4A0RA 2DGKA 4JF1A 5BJ3A 1MLZA 2R0TA 2W8WA 3AEOA 1GEWA 1IAXA 2VYCA 2YKUA 4MKKA 3B1DA 4WYEA 1W7LA 3TFUA 1ZODA 1SZKA 4Y0DA 4ATQA 1VP4A 1AJSA 2VI9A 3MAUA 4M2MA 4ZM3A 3L8AA 4U1TA 4HF8A 3A9YA
chains in the Genus database with same CATH topology
1M4NA 1D7RA 2CY8A 3MC6A 1FG3A 1AHYA 2BYJA 3G0TA 2W7HA 3ISLA 3PPLA 3HDOA 4P3MA 4XEWA 1RVUA 4ADCA 1WYUA 3N75A 4BQ0A 1IX6A 4K2MA 3R9AA 1AMQA 4LNMA 1CL2A 2VMZA 4WLHA 4OBUA 2ZY5A 3N4XA 1AMAA 1IBJA 3BCBA 3II0A 3DXWA 3JTXA 5G4IA 1X28A 1G4XA 3OP7A 3M5UA 3RBFA 3T32A 5F9SA 5KTBA 1DJEA 2W7JA 4Y0IA 1QGNA 5HHYA 1RV4A 1B9HA 3H14A 4WB0B 5D5SA 4OBVA 3N7NA 4OTLA 1W23A 2BWOA 4XQ2A 1QZ9A 3ATHA 3A8UX 4F5LA 3JWAA 1D7VA 2DR1A 1MDOA 1WSTA 1SZSA 1YOOA 5G2PA 2VMNA 2R5EA 4DQ6A 3JW9A 1MDZA 4ZDOA 3PDBB 4R5ZA 2PB0A 4R5FA 3BWNA 1X0MA 4H51A 5EIGB 3DYDA 4Y0HA 2HORA 2Z1ZA 1FG7A 1XI9A 1Z7DA 4ADEA 4PFNA 4GE4A 3VOMA 3RUYA 1S09A 4JEVA 4E77A 3IF2A 2EYQA 4AO9A 2D61A 2BIAA 3PIUA 2W7IA 4F5JA 1IVRA 3PGYA 4UHMA 1C9CA 1WYUB 3E9KA 1ARSA 3PDBA 1KMKA 1JG8A 1GBNA 1BKGA 3TATA 4RITA 3F9TA 5AX8A 3EIBA 3AOVA 2GB3A 1IAYA 2W8JA 5M4DA 4W8IA 1QITA 1KL1A 1MAPA 4MKJA 4R8DA 1P3WA 1DGEA 2CH2A 1B4XA 4UQVA 1TOEA 1GEYA 3NRAA 1N31A 1AKCA 3QI6A 2EGYA 4N0BA 1LC5A 2BI1A 2XH1A 2CFBA 4XJPA 4ZDPA 1QIRA 2YRRA 2HOXA 5DX5A 3FKDA 3NUIA 2W7KA 1N2TA 1OHYA 3F0HA 3MC6C 3P1TA 1D2FA 4EFFA 1FC4A 2ZP7A 3N0LA 3AEMC 2ZY4A 2CJDA 2DKBA 2YOBA 4N0WA 4JEWA 1TOKA 1EG5A 3ECDA 3WX9A 1AICA 4PIWA 2JJEA 2Z61A 2ZYJA 2QMAA 4DBCA 4WYGA 4GRXA 3FFHA 2JJHA 3ZRQA 4IX8A 3MKJA 1ASFA 1KKJA 1X2AA 2Z67A 1W7MA 3GSBA 2W7DA 3LVKA 4K2IA 3TFTA 1AMSA 3WGBA 1H1CA 3QGUA 2A1VA 1PFFA 4WB0A 2HUFA 2YRIA 5M46A 1AHXA 1CQ6A 4W1VA 4WYAA 3K7YA 4J5UA 3FZ6A 1EJIA 4M2JA 5DB5A 1ASDA 1KMJA 2VLHA 1AIBA 1GDEA 1JS6A 3ZRRA 4CXQA 3E6GA 4IYOA 2O0RA 5LHAA 3QHXA 5EQCA 3BWNC 3GZDA 4UHNA 5F8VA 1UU0A 1IX7A 2QBTA 5EAAA 2AY1A 2VGVA 2FNIA 3AOWA 3EUCA 1I29A 3NYUA 2WKAA 4F5IA 4ZSYA 3ZZJA 1C7NA 1CQ7A 2BWPA 4ITXA 3RI6A 2VIBA 3MEBA 4GSAA 1OATA 2BHXA 2Z9XA 3CQ5A 4OYTA 2VMVA 2OGEA 1CJ0A 4K05A 4CBSA 1GCKA 3WCOA 1YAAA 3AENA 5LH9A 3DR4A 3EI9A 3P6KA 2QB3A 3FQAA 4LNLA 1GD9A 2YCPA 3Q8NA 5C6UA 3H9XA 2BI2A 2V1PA 2VGZA 1ASCA 1YJSA 3JWBA 8AATA 1CZCA 4WYDA 1ARTA 2D66A 2VGWA 1ARHA 4DGTA 3N4SA 4IXOA 2KFPA 2AY2A 3NNKA 2Z1YA 4RKDA 4F5MA 2O7CA 4MGRA 1LC7A 4B9BA 1SVVA 1I41A 1OXOA 1OHWA 3DRDA 3UE8A 2DKJA 2ZUKA 2CB1A 2AY5A 1TOJA 2QLRA 4JE5A 1CQ8A 2BKWA 4O6ZA 4OT8A 1BQDA 2G7JA 2BIEA 3B8XA 3BCXA 2V0YA 1UU2A 3EI8A 2D7YA 2Z9WA 4XJOA 2ZJGA 1RVYA 1LC8A 1O61A 1B9IA 2VMOA 3A9XA 2Z9VA 4OCAA 3COGA 3CQ4A 2JGTA 3E2ZA 3JZLA 4FL0A 3ZZKA 1LS3A 1ZOBA 5FT8A 4I8AA 3EI5A 2TPLA 4FFCA 4BA5A 3WKSA 2D63A 4TV7A 5E5IA 1YJYA 3AV7A 3WKRA 4ADDA 2EPJA 3FZ8A 3LWSA 2GQNA 2JJGA 3GR9A 4OC9A 2XBNA 3EI6A 4W1WA 4H63Q 2VI8A 1M0QA 3EI7A 1ARGA 3MBBA 4RJYA 2FKIA 2AY8A 3QPGA 3FTBA 1V72A 4GE7A 3W1IA 4MY5A 2ZC0A 3VK4A 2W7GA 1YNUA 2ORDA 3TCMA 1TARA 3G7QA 5K8BA 2ZSMA 1SFFA 2CANA 1LW5A 3MAFA 1AY4A 2OQXA 4J8LA 1WYVB 4MQQA 1GEXA 3BCAA 5EIGA 2AEUA 1AAMA 1AJSB 2DGMA 3UAKA 4KYOA 5EFSA 2VGUA 2W7MA 3ZRPA 2VMXA 2HOZA 4B98A 1IUGA 1Y4IA 2HZPA 1JF9A 5FT5A 2X5DA 2HUUA 1E5FA 1O4SA 1J04A 2YCTA 3W1JA 1BJNA 4A0GA 2Z9UA 3DXVA 4W91A 5BJ4A 2CTZA 1KKPA 4WD2A 1SZUA 2GMSA 3TQXA 3WGCA 1C7OA 3GJUA 4JEXA 1D7SA 4GDYA 4XAUA 3FCRA 3HL2A 4Q76A 2EZ2A 3MAFB 3R4TA 4A6TA 4JEZA 4WXFA 2CINA 3EZ1A 3FFRA 4PFFA 1B5PA 1M0OA 1BJWA 4A72A 1BJ4A 1AIAA 2AY7A 4EB5A 2VIAA 2D5YA 1D7UA 1DKAA 1ECXA 2VGTA 1H0CA 1WKHA 3G8MA 4RIZA 2D7ZA 2YKVA 2Q7WA 2OKKA 4K2BA 2WK8A 3PD6B 4ZM4A 2AEVA 3B1CA 3E77A 1JS3A 3EZSA 1PG8A 4GE9A 4ZASA 9AATA 5DJ1A 4W5KA 4ZAHA 1WYTA 2ZY3A 1ASGA 3GBXA 3WZFA 4A0FA 4RAEA 1TATA 2F8JA 5D95A 4ATPA 2D65A 2WB6A 1AHFA 4TMRA 1SPAA 4ZWVA 3NDNA 4IYOB 1LKCA 1YIZA 3AEMA 3HVYA 2FQ6A 5EAVA 2WK9A 1CS1A 1C4KA 4KXKA 4PVFA 1O69A 1W3UA 2C7TA 3BN1A 4JF0A 4ZWMA 1ASBA 4ITGA 4IY7A 1SF2A 2VMQA 1ZC9A 1M0NA 4AO4A 1AY5A 1B8GA 2AY4A 4EU1A 1BQAA 3NU8A 1UKJA 2X8UA 4TN4A 1G7XA 2EZ1A 4XK1A 2R5CB 3W1HA 1J32A 4CVQA 2E7UA 2GSAA 5M49A 1V2DA 3WY7A 1AHEA 3CQ6A 3AENB 2R2NA 4WLJA 2VLFA 2C44A 1AJRA 2JG2A 4XJMA 4RM1A 2C81A 1WYTB 1AKBA 5HXXA 2CSTA 3LG0A 2OATA 5G0AA 1VEFA 4ZLVA 1WKGA 3B1EA 3DZZA 2CJHA 5EUNA 3VK2A 5JAYA 2VMWA 1TOIA 3FZ7A 3FDBA 3CAIA 4LW4A 1DJUA 1GC0A 2VMSA 5E3KA 5TF5A 3GZCA 1O62A 1G4VA 1X29A 4JEYA 4MQPA 1XEYA 2FNUA 3K40A 3LVMA 2PO3A 2ZY2A 1AY8A 4ZSWA 3UWCA 3WLXA 3E2ZB 3LY1A 4AOAA 3BWOA 2YHKA 3F6TA 1S08A 5G09A 2GMUA 2YCNA 5E4ZA 2QB2A 2BI5A 1S0AA 2HP1A 3KE3A 3KGWA 4LW2A 4GEBA 2G6WA 4WYCA 3AEJA 3CBFA 4WP0A 4OMAA 1ASAA 2ZSLA 2D64A 3AELA 4EB7A 3MADA 2HUIA 3FRKA 2O1BA 4Q31A 1CZEA 3AEPA 4F4EA 4E3RA 3ELPA 4CBRA 3ELEA 5G4JA 4MQRA 2QSRA 2X5FA 1TASA 3FVUA 3NTJA 1MAQA 4IXZA 2R5CA 1N8PA 4WXGA 4AZKA 7AATA 3ACZA 2VMUA 4E1OA 1C7GA 3QBOA 2RFVA 4F5GA 3QM2A 1V2FA 3FQ7A 3A2BA 3PDXA 4NOGA 1RV3A 1VJOA 4LC3A 3HLMA 2JJFA 3I4JA 1GC3A 2W7EA 3HBXA 1I43A 3A9ZA 1E5EA 4ZDLA 1AAWA 3H7FA 1U08A 1DGDA 2W8TA 4CXRA 4A6UA 2CH1A 3NYSA 1BJOB 4IW7A 3NU7A 1QISA 3N5MA 3E2YA 2BI9A 1BJOA 5FT4A 2E7JA 3USFA 1ELUA 3FD0A 4ADBA 1BS0A 1M0PA 3D6KA 5EUEA 1LW4A 1MGVA 2YKXA 4QGRA 4A00A 3EIAA 3RBLA 4Q6RA 3PD6A 1M32A 3HT4A 3AATA 4EMYA 2W8UA 3QN6A 1ASMA 4WYFA 3BV0A 4A6RA 1DTYA 3FDDA 2EO5A 2YKYA 2VMYA 4ISYA 4W1XA 5M4BA 2AY3A 2E54A 4RJ0A 1LK9A 2Z20A 1ASNA 1B5OA 1ASEA 3ASBA 1I48A 1UU1A 4BMKA 1Z3ZA 3BS8A 4RKCA 4A0HA 1AHGA 1DJ9A 2W8VA 3K28A 3LVJA 4MSOA 3L44A 1OHVA 4U2HA 4HVKA 2VMRA 4LNJA 1CL1A 1OXPA 1AX4A 3PJ0A 5DJ9A 2X3LA 2FYFA 2HOYA 2WK7A 3IHJA 4JE5D 1IJIA 1IX8A 1GC4A 1EQBA 1MLYA 2BI3A 4WXBA 4M2KA 3E2FA 4F5KA 2VMPA 3RCHB 3RQ1A 1WYVA 3JU7A 3FVSA 4E3QA 4BA4A 3PA9A 1KL2A 2DGLA 2PB2A 1BT4A 2AY6A 2C0RA 3AEJC 3DU4A 2BWNA 3DR7A 2HP2A 2DOUA 2NMPA 1GC2A 3DODA 3NX3A 4AH3A 4L0OA 3HMUA 4P7YA 2CJGA 3GETA 5HDMA 1PMOA 4RLGA 4WBTA 1ARIA 4AZJA 3PAAA 4F5HA 2FN6A 1M7YA 1QJ3A 1W7NA 1G7WA 3WCNA 3FSLA 3NUBA 4BHDA 3N4RA 3VP6A 1YJZA 2VMTA 3LV2A 5EUDA 1T3IA 2FM1A 1BW0A 1S07A 2VGSA 1MDXA 3B46A 1C0NA 3I16A 4XJLA 3VAXA 3GWPA 2JISA 2AATA 4Q75A 3HQTA 5I92A 1ASLA 3BC8A 1YIYA 3I5TA 3GZDC 5J8QA 3DC1A 1ORDA 3VK3A 1TOGA 3FVXA 2E7IA 1DFOA 2OKJA 1V2EA 4UOYA 4R2NA 1M6SA 1AMRA 2W7LA 5FT6A 3BB8A 3NYTA 4UHOA 1PMMA 3ASAA 2QA3A 1ELQA 1AKAA 3RCHA 4F5FA 2AY9A 5IWQA 2EH6A 2BYLA 2W7FA 1TPLA 3KKIA 5G2QA 3OKSA 3FQ8A 1QJ5A 2OGAA 3KGXA 4KAMA 2BIGA 3LVLB 4IXSA 1S06A 4A0RA 2DGKA 4JF1A 5BJ3A 1MLZA 2R0TA 2W8WA 3AEOA 1GEWA 1IAXA 2VYCA 2YKUA 4MKKA 3B1DA 4WYEA 1W7LA 3TFUA 1ZODA 1SZKA 4Y0DA 4ATQA 1VP4A 1AJSA 2VI9A 3MAUA 4M2MA 4ZM3A 3L8AA 4U1TA 4HF8A 3A9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4N A;  1D7R A;  2CY8 A;  3MC6 A;  1FG3 A;  1AHY A;  2BYJ A;  3G0T A;  2W7H A;  3ISL A;  3PPL A;  3HDO A;  4P3M A;  4XEW A;  1RVU A;  4ADC A;  1WYU A;  3N75 A;  4BQ0 A;  1IX6 A;  4K2M A;  3R9A A;  1AMQ A;  4LNM A;  1CL2 A;  2VMZ A;  4WLH A;  4OBU A;  2ZY5 A;  1AMA A;  1IBJ A;  3BCB A;  3II0 A;  3DXW A;  3JTX A;  5G4I A;  1X28 A;  1G4X A;  3OP7 A;  3M5U A;  3RBF A;  3T32 A;  5F9S A;  1DJE A;  2W7J A;  4Y0I A;  1QGN A;  5HHY A;  1RV4 A;  1B9H A;  3H14 A;  4WB0 B;  5D5S A;  4OBV A;  4OTL A;  1W23 A;  2BWO A;  4XQ2 A;  1QZ9 A;  3ATH A;  3A8U X;  4F5L A;  3JWA A;  1D7V A;  2DR1 A;  1MDO A;  1WST A;  1SZS A;  1YOO A;  5G2P A;  2VMN A;  2R5E A;  4DQ6 A;  3JW9 A;  1MDZ A;  4ZDO A;  3PDB B;  4R5Z A;  2PB0 A;  4R5F A;  3BWN A;  1X0M A;  4H51 A;  5EIG B;  3DYD A;  4Y0H A;  2HOR A;  2Z1Z A;  1FG7 A;  1XI9 A;  1Z7D A;  4ADE A;  4PFN A;  4GE4 A;  3VOM A;  3RUY A;  1S09 A;  4JEV A;  4E77 A;  3IF2 A;  4AO9 A;  2D61 A;  2BIA A;  3PIU A;  2W7I A;  4F5J A;  1IVR A;  3PGY A;  4UHM A;  1C9C A;  1WYU B;  3E9K A;  1ARS A;  3PDB A;  1KMK A;  1JG8 A;  1GBN A;  1BKG A;  3TAT A;  4RIT A;  3F9T A;  5AX8 A;  3EIB A;  3AOV A;  2GB3 A;  1IAY A;  2W8J A;  5M4D A;  4W8I A;  1QIT A;  1KL1 A;  1MAP A;  4MKJ A;  4R8D A;  1P3W A;  1DGE A;  2CH2 A;  1B4X A;  4UQV A;  1TOE A;  1GEY A;  3NRA A;  1N31 A;  1AKC A;  3QI6 A;  2EGY A;  4N0B A;  1LC5 A;  2BI1 A;  2XH1 A;  2CFB A;  4XJP A;  4ZDP A;  1QIR A;  2YRR A;  2HOX A;  5DX5 A;  3FKD A;  3NUI A;  2W7K A;  1N2T A;  1OHY A;  3F0H A;  3MC6 C;  3P1T A;  1D2F A;  4EFF A;  1FC4 A;  2ZP7 A;  3N0L A;  3AEM C;  2ZY4 A;  2CJD A;  2DKB A;  2YOB A;  4N0W A;  4JEW A;  1TOK A;  1EG5 A;  3ECD A;  3WX9 A;  1AIC A;  4PIW A;  2JJE A;  2Z61 A;  2ZYJ A;  2QMA A;  4DBC A;  4WYG A;  4GRX A;  3FFH A;  2JJH A;  3ZRQ A;  4IX8 A;  3MKJ A;  1ASF A;  1KKJ A;  1X2A A;  2Z67 A;  1W7M A;  3GSB A;  2W7D A;  3LVK A;  4K2I A;  3TFT A;  1AMS A;  3WGB A;  1H1C A;  3QGU A;  1PFF A;  4WB0 A;  2HUF A;  2YRI A;  5M46 A;  1AHX A;  1CQ6 A;  4W1V A;  4WYA A;  3K7Y A;  4J5U A;  3FZ6 A;  1EJI A;  4M2J A;  5DB5 A;  1ASD A;  1KMJ A;  2VLH A;  1AIB A;  1GDE A;  1JS6 A;  3ZRR A;  4CXQ A;  3E6G A;  4IYO A;  2O0R A;  5LHA A;  3QHX A;  5EQC A;  3BWN C;  3GZD A;  4UHN A;  5F8V A;  1UU0 A;  1IX7 A;  2QBT A;  5EAA A;  2AY1 A;  2VGV A;  2FNI A;  3AOW A;  3EUC A;  1I29 A;  3NYU A;  2WKA A;  4F5I A;  4ZSY A;  3ZZJ A;  1C7N A;  1CQ7 A;  2BWP A;  4ITX A;  3RI6 A;  2VIB A;  3MEB A;  4GSA A;  1OAT A;  2BHX A;  2Z9X A;  3CQ5 A;  4OYT A;  2VMV A;  2OGE A;  1CJ0 A;  4CBS A;  1GCK A;  3WCO A;  1YAA A;  3AEN A;  5LH9 A;  3DR4 A;  3EI9 A;  3P6K A;  2QB3 A;  3FQA A;  4LNL A;  1GD9 A;  2YCP A;  3Q8N A;  5C6U A;  2BI2 A;  2V1P A;  2VGZ A;  1ASC A;  1YJS A;  3JWB A;  8AAT A;  1CZC A;  4WYD A;  1ART A;  2D66 A;  2VGW A;  1ARH A;  4DGT A;  4IXO A;  2AY2 A;  3NNK A;  2Z1Y A;  4RKD A;  4F5M A;  2O7C A;  4MGR A;  1LC7 A;  4B9B A;  1SVV A;  1I41 A;  1OXO A;  1OHW A;  3DRD A;  3UE8 A;  2DKJ A;  2ZUK A;  2CB1 A;  2AY5 A;  1TOJ A;  2QLR A;  4JE5 A;  1CQ8 A;  2BKW A;  4O6Z A;  4OT8 A;  1BQD A;  2BIE A;  3B8X A;  3BCX A;  2V0Y A;  1UU2 A;  3EI8 A;  2D7Y A;  2Z9W A;  4XJO A;  2ZJG A;  1RVY A;  1LC8 A;  1O61 A;  1B9I A;  2VMO A;  3A9X A;  2Z9V A;  4OCA A;  3COG A;  3CQ4 A;  2JGT A;  3E2Z A;  3JZL A;  4FL0 A;  3ZZK A;  1LS3 A;  1ZOB A;  5FT8 A;  4I8A A;  3EI5 A;  2TPL A;  4FFC A;  4BA5 A;  3WKS A;  2D63 A;  4TV7 A;  5E5I A;  1YJY A;  3AV7 A;  3WKR A;  4ADD A;  2EPJ A;  3FZ8 A;  3LWS A;  2GQN A;  2JJG A;  3GR9 A;  4OC9 A;  2XBN A;  3EI6 A;  4W1W A;  2VI8 A;  1M0Q A;  3EI7 A;  1ARG A;  3MBB A;  4RJY A;  2AY8 A;  3QPG A;  3FTB A;  1V72 A;  4GE7 A;  3W1I A;  4MY5 A;  2ZC0 A;  3VK4 A;  2W7G A;  1YNU A;  2ORD A;  3TCM A;  1TAR A;  3G7Q A;  5K8B A;  2ZSM A;  1SFF A;  2CAN A;  1LW5 A;  3MAF A;  1AY4 A;  2OQX A;  4J8L A;  1WYV B;  4MQQ A;  1GEX A;  3BCA A;  5EIG A;  2AEU A;  1AAM A;  1AJS B;  2DGM A;  3UAK A;  4KYO A;  5EFS A;  2VGU A;  2W7M A;  3ZRP A;  2VMX A;  2HOZ A;  4B98 A;  1IUG A;  1Y4I A;  2HZP A;  1JF9 A;  5FT5 A;  2X5D A;  2HUU A;  1E5F A;  1O4S A;  1J04 A;  2YCT A;  3W1J A;  1BJN A;  4A0G A;  2Z9U A;  3DXV A;  4W91 A;  5BJ4 A;  2CTZ A;  1KKP A;  4WD2 A;  1SZU A;  2GMS A;  3TQX A;  3WGC A;  1C7O A;  3GJU A;  4JEX A;  1D7S A;  4GDY A;  4XAU A;  3FCR A;  3HL2 A;  4Q76 A;  2EZ2 A;  3MAF B;  3R4T A;  4A6T A;  4JEZ A;  4WXF A;  2CIN A;  3EZ1 A;  3FFR A;  4PFF A;  1B5P A;  1M0O A;  1BJW A;  4A72 A;  1BJ4 A;  1AIA A;  2AY7 A;  4EB5 A;  2VIA A;  2D5Y A;  1D7U A;  1DKA A;  1ECX A;  2VGT A;  1H0C A;  1WKH A;  3G8M A;  4RIZ A;  2D7Z A;  2YKV A;  2Q7W A;  2OKK A;  4K2B A;  2WK8 A;  3PD6 B;  4ZM4 A;  2AEV A;  3B1C A;  3E77 A;  1JS3 A;  3EZS A;  1PG8 A;  4GE9 A;  4ZAS A;  9AAT A;  5DJ1 A;  4W5K A;  4ZAH A;  1WYT A;  2ZY3 A;  1ASG A;  3GBX A;  3WZF A;  4A0F A;  4RAE A;  1TAT A;  2F8J A;  5D95 A;  4ATP A;  2D65 A;  1AHF A;  4TMR A;  1SPA A;  4ZWV A;  3NDN A;  4IYO B;  1LKC A;  1YIZ A;  3AEM A;  3HVY A;  2FQ6 A;  5EAV A;  2WK9 A;  1CS1 A;  1C4K A;  4KXK A;  4PVF A;  1O69 A;  1W3U A;  2C7T A;  3BN1 A;  4JF0 A;  4ZWM A;  1ASB A;  4ITG A;  4IY7 A;  1SF2 A;  2VMQ A;  1ZC9 A;  1M0N A;  4AO4 A;  1AY5 A;  1B8G A;  2AY4 A;  4EU1 A;  1BQA A;  3NU8 A;  1UKJ A;  2X8U A;  4TN4 A;  1G7X A;  2EZ1 A;  4XK1 A;  2R5C B;  3W1H A;  1J32 A;  4CVQ A;  2E7U A;  2GSA A;  5M49 A;  1V2D A;  3WY7 A;  1AHE A;  3CQ6 A;  3AEN B;  2R2N A;  4WLJ A;  2VLF A;  2C44 A;  1AJR A;  2JG2 A;  4XJM A;  4RM1 A;  2C81 A;  1WYT B;  1AKB A;  5HXX A;  2CST A;  3LG0 A;  2OAT A;  5G0A A;  1VEF A;  4ZLV A;  1WKG A;  3B1E A;  3DZZ A;  2CJH A;  5EUN A;  3VK2 A;  5JAY A;  2VMW A;  1TOI A;  3FZ7 A;  3FDB A;  3CAI A;  4LW4 A;  1DJU A;  1GC0 A;  2VMS A;  5E3K A;  5TF5 A;  3GZC A;  1O62 A;  1G4V A;  1X29 A;  4JEY A;  4MQP A;  1XEY A;  2FNU A;  3K40 A;  3LVM A;  2PO3 A;  2ZY2 A;  1AY8 A;  4ZSW A;  3UWC A;  3WLX A;  3E2Z B;  3LY1 A;  4AOA A;  3BWO A;  2YHK A;  3F6T A;  1S08 A;  5G09 A;  2GMU A;  2YCN A;  5E4Z A;  2QB2 A;  2BI5 A;  1S0A A;  2HP1 A;  3KE3 A;  3KGW A;  4LW2 A;  4GEB A;  2G6W A;  4WYC A;  3AEJ A;  3CBF A;  4WP0 A;  4OMA A;  1ASA A;  2ZSL A;  2D64 A;  3AEL A;  4EB7 A;  3MAD A;  2HUI A;  3FRK A;  2O1B A;  4Q31 A;  1CZE A;  3AEP A;  4F4E A;  4E3R A;  3ELP A;  4CBR A;  3ELE A;  5G4J A;  4MQR A;  2X5F A;  1TAS A;  3FVU A;  3NTJ A;  1MAQ A;  4IXZ A;  2R5C A;  1N8P A;  4WXG A;  4AZK A;  7AAT A;  3ACZ A;  2VMU A;  4E1O A;  1C7G A;  3QBO A;  2RFV A;  4F5G A;  3QM2 A;  1V2F A;  3FQ7 A;  3A2B A;  3PDX A;  4NOG A;  1RV3 A;  1VJO A;  4LC3 A;  3HLM A;  2JJF A;  3I4J A;  1GC3 A;  2W7E A;  3HBX A;  1I43 A;  3A9Z A;  1E5E A;  4ZDL A;  1AAW A;  3H7F A;  1U08 A;  1DGD A;  2W8T A;  4CXR A;  4A6U A;  2CH1 A;  3NYS A;  1BJO B;  4IW7 A;  3NU7 A;  1QIS A;  3N5M A;  3E2Y A;  2BI9 A;  1BJO A;  5FT4 A;  2E7J A;  3USF A;  1ELU A;  3FD0 A;  4ADB A;  1BS0 A;  1M0P A;  3D6K A;  5EUE A;  1LW4 A;  1MGV A;  2YKX A;  4QGR A;  4A00 A;  3EIA A;  3RBL A;  4Q6R A;  3PD6 A;  1M32 A;  3HT4 A;  3AAT A;  4EMY A;  2W8U A;  3QN6 A;  1ASM A;  4WYF A;  3BV0 A;  4A6R A;  1DTY A;  3FDD A;  2EO5 A;  2YKY A;  2VMY A;  4ISY A;  4W1X A;  5M4B A;  2AY3 A;  2E54 A;  4RJ0 A;  1LK9 A;  2Z20 A;  1ASN A;  1B5O A;  1ASE A;  3ASB A;  1I48 A;  1UU1 A;  4BMK A;  1Z3Z A;  3BS8 A;  4RKC A;  4A0H A;  1AHG A;  1DJ9 A;  2W8V A;  3K28 A;  3LVJ A;  4MSO A;  3L44 A;  1OHV A;  4U2H A;  4HVK A;  2VMR A;  4LNJ A;  1CL1 A;  1OXP A;  1AX4 A;  3PJ0 A;  5DJ9 A;  2X3L A;  2FYF A;  2HOY A;  2WK7 A;  3IHJ A;  4JE5 D;  1IJI A;  1IX8 A;  1GC4 A;  1EQB A;  1MLY A;  2BI3 A;  4WXB A;  4M2K A;  3E2F A;  4F5K A;  2VMP A;  3RCH B;  3RQ1 A;  1WYV A;  3JU7 A;  3FVS A;  4E3Q A;  4BA4 A;  3PA9 A;  1KL2 A;  2DGL A;  2PB2 A;  1BT4 A;  2AY6 A;  2C0R A;  3AEJ C;  3DU4 A;  2BWN A;  3DR7 A;  2HP2 A;  2DOU A;  2NMP A;  1GC2 A;  3DOD A;  3NX3 A;  4AH3 A;  4L0O A;  3HMU A;  4P7Y A;  2CJG A;  3GET A;  5HDM A;  1PMO A;  4RLG A;  4WBT A;  1ARI A;  4AZJ A;  3PAA A;  4F5H A;  2FN6 A;  1M7Y A;  1QJ3 A;  1W7N A;  1G7W A;  3WCN A;  3FSL A;  3NUB A;  4BHD A;  3VP6 A;  1YJZ A;  2VMT A;  3LV2 A;  5EUD A;  1T3I A;  2FM1 A;  1BW0 A;  1S07 A;  2VGS A;  1MDX A;  3B46 A;  1C0N A;  3I16 A;  4XJL A;  3VAX A;  3GWP A;  2JIS A;  2AAT A;  4Q75 A;  3HQT A;  5I92 A;  1ASL A;  3BC8 A;  1YIY A;  3I5T A;  3GZD C;  5J8Q A;  3DC1 A;  1ORD A;  3VK3 A;  1TOG A;  3FVX A;  2E7I A;  1DFO A;  2OKJ A;  1V2E A;  4UOY A;  4R2N A;  1M6S A;  1AMR A;  2W7L A;  5FT6 A;  3BB8 A;  3NYT A;  4UHO A;  1PMM A;  3ASA A;  2QA3 A;  1ELQ A;  1AKA A;  3RCH A;  4F5F A;  2AY9 A;  5IWQ A;  2EH6 A;  2BYL A;  2W7F A;  1TPL A;  3KKI A;  5G2Q A;  3OKS A;  3FQ8 A;  1QJ5 A;  2OGA A;  3KGX A;  4KAM A;  2BIG A;  3LVL B;  4IXS A;  1S06 A;  4A0R A;  2DGK A;  4JF1 A;  5BJ3 A;  1MLZ A;  2R0T A;  2W8W A;  3AEO A;  1GEW A;  1IAX A;  2VYC A;  2YKU A;  4MKK A;  3B1D A;  4WYE A;  1W7L A;  3TFU A;  1ZOD A;  1SZK A;  4Y0D A;  4ATQ A;  1VP4 A;  1AJS A;  2VI9 A;  3MAU A;  4M2M A;  4ZM3 A;  3L8A A;  4U1T A;  4HF8 A;  3A9Y A; 
#chains in the Genus database with same CATH topology
 1M4N A;  1D7R A;  2CY8 A;  3MC6 A;  1FG3 A;  1AHY A;  2BYJ A;  3G0T A;  2W7H A;  3ISL A;  3PPL A;  3HDO A;  4P3M A;  4XEW A;  1RVU A;  4ADC A;  1WYU A;  3N75 A;  4BQ0 A;  1IX6 A;  4K2M A;  3R9A A;  1AMQ A;  4LNM A;  1CL2 A;  2VMZ A;  4WLH A;  4OBU A;  2ZY5 A;  3N4X A;  1AMA A;  1IBJ A;  3BCB A;  3II0 A;  3DXW A;  3JTX A;  5G4I A;  1X28 A;  1G4X A;  3OP7 A;  3M5U A;  3RBF A;  3T32 A;  5F9S A;  5KTB A;  1DJE A;  2W7J A;  4Y0I A;  1QGN A;  5HHY A;  1RV4 A;  1B9H A;  3H14 A;  4WB0 B;  5D5S A;  4OBV A;  3N7N A;  4OTL A;  1W23 A;  2BWO A;  4XQ2 A;  1QZ9 A;  3ATH A;  3A8U X;  4F5L A;  3JWA A;  1D7V A;  2DR1 A;  1MDO A;  1WST A;  1SZS A;  1YOO A;  5G2P A;  2VMN A;  2R5E A;  4DQ6 A;  3JW9 A;  1MDZ A;  4ZDO A;  3PDB B;  4R5Z A;  2PB0 A;  4R5F A;  3BWN A;  1X0M A;  4H51 A;  5EIG B;  3DYD A;  4Y0H A;  2HOR A;  2Z1Z A;  1FG7 A;  1XI9 A;  1Z7D A;  4ADE A;  4PFN A;  4GE4 A;  3VOM A;  3RUY A;  1S09 A;  4JEV A;  4E77 A;  3IF2 A;  2EYQ A;  4AO9 A;  2D61 A;  2BIA A;  3PIU A;  2W7I A;  4F5J A;  1IVR A;  3PGY A;  4UHM A;  1C9C A;  1WYU B;  3E9K A;  1ARS A;  3PDB A;  1KMK A;  1JG8 A;  1GBN A;  1BKG A;  3TAT A;  4RIT A;  3F9T A;  5AX8 A;  3EIB A;  3AOV A;  2GB3 A;  1IAY A;  2W8J A;  5M4D A;  4W8I A;  1QIT A;  1KL1 A;  1MAP A;  4MKJ A;  4R8D A;  1P3W A;  1DGE A;  2CH2 A;  1B4X A;  4UQV A;  1TOE A;  1GEY A;  3NRA A;  1N31 A;  1AKC A;  3QI6 A;  2EGY A;  4N0B A;  1LC5 A;  2BI1 A;  2XH1 A;  2CFB A;  4XJP A;  4ZDP A;  1QIR A;  2YRR A;  2HOX A;  5DX5 A;  3FKD A;  3NUI A;  2W7K A;  1N2T A;  1OHY A;  3F0H A;  3MC6 C;  3P1T A;  1D2F A;  4EFF A;  1FC4 A;  2ZP7 A;  3N0L A;  3AEM C;  2ZY4 A;  2CJD A;  2DKB A;  2YOB A;  4N0W A;  4JEW A;  1TOK A;  1EG5 A;  3ECD A;  3WX9 A;  1AIC A;  4PIW A;  2JJE A;  2Z61 A;  2ZYJ A;  2QMA A;  4DBC A;  4WYG A;  4GRX A;  3FFH A;  2JJH A;  3ZRQ A;  4IX8 A;  3MKJ A;  1ASF A;  1KKJ A;  1X2A A;  2Z67 A;  1W7M A;  3GSB A;  2W7D A;  3LVK A;  4K2I A;  3TFT A;  1AMS A;  3WGB A;  1H1C A;  3QGU A;  2A1V A;  1PFF A;  4WB0 A;  2HUF A;  2YRI A;  5M46 A;  1AHX A;  1CQ6 A;  4W1V A;  4WYA A;  3K7Y A;  4J5U A;  3FZ6 A;  1EJI A;  4M2J A;  5DB5 A;  1ASD A;  1KMJ A;  2VLH A;  1AIB A;  1GDE A;  1JS6 A;  3ZRR A;  4CXQ A;  3E6G A;  4IYO A;  2O0R A;  5LHA A;  3QHX A;  5EQC A;  3BWN C;  3GZD A;  4UHN A;  5F8V A;  1UU0 A;  1IX7 A;  2QBT A;  5EAA A;  2AY1 A;  2VGV A;  2FNI A;  3AOW A;  3EUC A;  1I29 A;  3NYU A;  2WKA A;  4F5I A;  4ZSY A;  3ZZJ A;  1C7N A;  1CQ7 A;  2BWP A;  4ITX A;  3RI6 A;  2VIB A;  3MEB A;  4GSA A;  1OAT A;  2BHX A;  2Z9X A;  3CQ5 A;  4OYT A;  2VMV A;  2OGE A;  1CJ0 A;  4K05 A;  4CBS A;  1GCK A;  3WCO A;  1YAA A;  3AEN A;  5LH9 A;  3DR4 A;  3EI9 A;  3P6K A;  2QB3 A;  3FQA A;  4LNL A;  1GD9 A;  2YCP A;  3Q8N A;  5C6U A;  3H9X A;  2BI2 A;  2V1P A;  2VGZ A;  1ASC A;  1YJS A;  3JWB A;  8AAT A;  1CZC A;  4WYD A;  1ART A;  2D66 A;  2VGW A;  1ARH A;  4DGT A;  3N4S A;  4IXO A;  2KFP A;  2AY2 A;  3NNK A;  2Z1Y A;  4RKD A;  4F5M A;  2O7C A;  4MGR A;  1LC7 A;  4B9B A;  1SVV A;  1I41 A;  1OXO A;  1OHW A;  3DRD A;  3UE8 A;  2DKJ A;  2ZUK A;  2CB1 A;  2AY5 A;  1TOJ A;  2QLR A;  4JE5 A;  1CQ8 A;  2BKW A;  4O6Z A;  4OT8 A;  1BQD A;  2G7J A;  2BIE A;  3B8X A;  3BCX A;  2V0Y A;  1UU2 A;  3EI8 A;  2D7Y A;  2Z9W A;  4XJO A;  2ZJG A;  1RVY A;  1LC8 A;  1O61 A;  1B9I A;  2VMO A;  3A9X A;  2Z9V A;  4OCA A;  3COG A;  3CQ4 A;  2JGT A;  3E2Z A;  3JZL A;  4FL0 A;  3ZZK A;  1LS3 A;  1ZOB A;  5FT8 A;  4I8A A;  3EI5 A;  2TPL A;  4FFC A;  4BA5 A;  3WKS A;  2D63 A;  4TV7 A;  5E5I A;  1YJY A;  3AV7 A;  3WKR A;  4ADD A;  2EPJ A;  3FZ8 A;  3LWS A;  2GQN A;  2JJG A;  3GR9 A;  4OC9 A;  2XBN A;  3EI6 A;  4W1W A;  4H63 Q;  2VI8 A;  1M0Q A;  3EI7 A;  1ARG A;  3MBB A;  4RJY A;  2FKI A;  2AY8 A;  3QPG A;  3FTB A;  1V72 A;  4GE7 A;  3W1I A;  4MY5 A;  2ZC0 A;  3VK4 A;  2W7G A;  1YNU A;  2ORD A;  3TCM A;  1TAR A;  3G7Q A;  5K8B A;  2ZSM A;  1SFF A;  2CAN A;  1LW5 A;  3MAF A;  1AY4 A;  2OQX A;  4J8L A;  1WYV B;  4MQQ A;  1GEX A;  3BCA A;  5EIG A;  2AEU A;  1AAM A;  1AJS B;  2DGM A;  3UAK A;  4KYO A;  5EFS A;  2VGU A;  2W7M A;  3ZRP A;  2VMX A;  2HOZ A;  4B98 A;  1IUG A;  1Y4I A;  2HZP A;  1JF9 A;  5FT5 A;  2X5D A;  2HUU A;  1E5F A;  1O4S A;  1J04 A;  2YCT A;  3W1J A;  1BJN A;  4A0G A;  2Z9U A;  3DXV A;  4W91 A;  5BJ4 A;  2CTZ A;  1KKP A;  4WD2 A;  1SZU A;  2GMS A;  3TQX A;  3WGC A;  1C7O A;  3GJU A;  4JEX A;  1D7S A;  4GDY A;  4XAU A;  3FCR A;  3HL2 A;  4Q76 A;  2EZ2 A;  3MAF B;  3R4T A;  4A6T A;  4JEZ A;  4WXF A;  2CIN A;  3EZ1 A;  3FFR A;  4PFF A;  1B5P A;  1M0O A;  1BJW A;  4A72 A;  1BJ4 A;  1AIA A;  2AY7 A;  4EB5 A;  2VIA A;  2D5Y A;  1D7U A;  1DKA A;  1ECX A;  2VGT A;  1H0C A;  1WKH A;  3G8M A;  4RIZ A;  2D7Z A;  2YKV A;  2Q7W A;  2OKK A;  4K2B A;  2WK8 A;  3PD6 B;  4ZM4 A;  2AEV A;  3B1C A;  3E77 A;  1JS3 A;  3EZS A;  1PG8 A;  4GE9 A;  4ZAS A;  9AAT A;  5DJ1 A;  4W5K A;  4ZAH A;  1WYT A;  2ZY3 A;  1ASG A;  3GBX A;  3WZF A;  4A0F A;  4RAE A;  1TAT A;  2F8J A;  5D95 A;  4ATP A;  2D65 A;  2WB6 A;  1AHF A;  4TMR A;  1SPA A;  4ZWV A;  3NDN A;  4IYO B;  1LKC A;  1YIZ A;  3AEM A;  3HVY A;  2FQ6 A;  5EAV A;  2WK9 A;  1CS1 A;  1C4K A;  4KXK A;  4PVF A;  1O69 A;  1W3U A;  2C7T A;  3BN1 A;  4JF0 A;  4ZWM A;  1ASB A;  4ITG A;  4IY7 A;  1SF2 A;  2VMQ A;  1ZC9 A;  1M0N A;  4AO4 A;  1AY5 A;  1B8G A;  2AY4 A;  4EU1 A;  1BQA A;  3NU8 A;  1UKJ A;  2X8U A;  4TN4 A;  1G7X A;  2EZ1 A;  4XK1 A;  2R5C B;  3W1H A;  1J32 A;  4CVQ A;  2E7U A;  2GSA A;  5M49 A;  1V2D A;  3WY7 A;  1AHE A;  3CQ6 A;  3AEN B;  2R2N A;  4WLJ A;  2VLF A;  2C44 A;  1AJR A;  2JG2 A;  4XJM A;  4RM1 A;  2C81 A;  1WYT B;  1AKB A;  5HXX A;  2CST A;  3LG0 A;  2OAT A;  5G0A A;  1VEF A;  4ZLV A;  1WKG A;  3B1E A;  3DZZ A;  2CJH A;  5EUN A;  3VK2 A;  5JAY A;  2VMW A;  1TOI A;  3FZ7 A;  3FDB A;  3CAI A;  4LW4 A;  1DJU A;  1GC0 A;  2VMS A;  5E3K A;  5TF5 A;  3GZC A;  1O62 A;  1G4V A;  1X29 A;  4JEY A;  4MQP A;  1XEY A;  2FNU A;  3K40 A;  3LVM A;  2PO3 A;  2ZY2 A;  1AY8 A;  4ZSW A;  3UWC A;  3WLX A;  3E2Z B;  3LY1 A;  4AOA A;  3BWO A;  2YHK A;  3F6T A;  1S08 A;  5G09 A;  2GMU A;  2YCN A;  5E4Z A;  2QB2 A;  2BI5 A;  1S0A A;  2HP1 A;  3KE3 A;  3KGW A;  4LW2 A;  4GEB A;  2G6W A;  4WYC A;  3AEJ A;  3CBF A;  4WP0 A;  4OMA A;  1ASA A;  2ZSL A;  2D64 A;  3AEL A;  4EB7 A;  3MAD A;  2HUI A;  3FRK A;  2O1B A;  4Q31 A;  1CZE A;  3AEP A;  4F4E A;  4E3R A;  3ELP A;  4CBR A;  3ELE A;  5G4J A;  4MQR A;  2QSR A;  2X5F A;  1TAS A;  3FVU A;  3NTJ A;  1MAQ A;  4IXZ A;  2R5C A;  1N8P A;  4WXG A;  4AZK A;  7AAT A;  3ACZ A;  2VMU A;  4E1O A;  1C7G A;  3QBO A;  2RFV A;  4F5G A;  3QM2 A;  1V2F A;  3FQ7 A;  3A2B A;  3PDX A;  4NOG A;  1RV3 A;  1VJO A;  4LC3 A;  3HLM A;  2JJF A;  3I4J A;  1GC3 A;  2W7E A;  3HBX A;  1I43 A;  3A9Z A;  1E5E A;  4ZDL A;  1AAW A;  3H7F A;  1U08 A;  1DGD A;  2W8T A;  4CXR A;  4A6U A;  2CH1 A;  3NYS A;  1BJO B;  4IW7 A;  3NU7 A;  1QIS A;  3N5M A;  3E2Y A;  2BI9 A;  1BJO A;  5FT4 A;  2E7J A;  3USF A;  1ELU A;  3FD0 A;  4ADB A;  1BS0 A;  1M0P A;  3D6K A;  5EUE A;  1LW4 A;  1MGV A;  2YKX A;  4QGR A;  4A00 A;  3EIA A;  3RBL A;  4Q6R A;  3PD6 A;  1M32 A;  3HT4 A;  3AAT A;  4EMY A;  2W8U A;  3QN6 A;  1ASM A;  4WYF A;  3BV0 A;  4A6R A;  1DTY A;  1KAF A;  3FDD A;  2EO5 A;  2YKY A;  2VMY A;  4ISY A;  4W1X A;  5M4B A;  2AY3 A;  2E54 A;  4RJ0 A;  1LK9 A;  2Z20 A;  1ASN A;  1B5O A;  1ASE A;  3ASB A;  1I48 A;  1UU1 A;  4BMK A;  1Z3Z A;  3BS8 A;  4RKC A;  4A0H A;  1AHG A;  1DJ9 A;  2W8V A;  3K28 A;  3LVJ A;  4MSO A;  3L44 A;  1OHV A;  4U2H A;  4HVK A;  2VMR A;  4LNJ A;  1CL1 A;  1OXP A;  1AX4 A;  3PJ0 A;  5DJ9 A;  2X3L A;  2FYF A;  2HOY A;  2WK7 A;  3IHJ A;  4JE5 D;  1IJI A;  1IX8 A;  1GC4 A;  1EQB A;  1MLY A;  2BI3 A;  4WXB A;  4M2K A;  3E2F A;  4F5K A;  2VMP A;  3RCH B;  3RQ1 A;  1WYV A;  3JU7 A;  3FVS A;  4E3Q A;  4BA4 A;  3PA9 A;  1KL2 A;  2DGL A;  2PB2 A;  1BT4 A;  2AY6 A;  2C0R A;  3AEJ C;  3DU4 A;  2BWN A;  3DR7 A;  2HP2 A;  2DOU A;  2NMP A;  1GC2 A;  3DOD A;  3NX3 A;  4AH3 A;  4L0O A;  3HMU A;  4P7Y A;  2CJG A;  3GET A;  5HDM A;  1PMO A;  4RLG A;  4WBT A;  1ARI A;  4AZJ A;  3PAA A;  4F5H A;  2FN6 A;  1M7Y A;  1QJ3 A;  1W7N A;  1G7W A;  3WCN A;  3FSL A;  3NUB A;  4BHD A;  3N4R A;  3VP6 A;  1YJZ A;  2VMT A;  3LV2 A;  5EUD A;  1T3I A;  2FM1 A;  1BW0 A;  1S07 A;  2VGS A;  1MDX A;  3B46 A;  1C0N A;  3I16 A;  4XJL A;  3VAX A;  3GWP A;  2JIS A;  2AAT A;  4Q75 A;  3HQT A;  5I92 A;  1ASL A;  3BC8 A;  1YIY A;  3I5T A;  3GZD C;  5J8Q A;  3DC1 A;  1ORD A;  3VK3 A;  1TOG A;  3FVX A;  2E7I A;  1DFO A;  2OKJ A;  1V2E A;  4UOY A;  4R2N A;  1M6S A;  1AMR A;  2W7L A;  5FT6 A;  3BB8 A;  3NYT A;  4UHO A;  1PMM A;  3ASA A;  2QA3 A;  1ELQ A;  1AKA A;  3RCH A;  4F5F A;  2AY9 A;  5IWQ A;  2EH6 A;  2BYL A;  2W7F A;  1TPL A;  3KKI A;  5G2Q A;  3OKS A;  3FQ8 A;  1QJ5 A;  2OGA A;  3KGX A;  4KAM A;  2BIG A;  3LVL B;  4IXS A;  1S06 A;  4A0R A;  2DGK A;  4JF1 A;  5BJ3 A;  1MLZ A;  2R0T A;  2W8W A;  3AEO A;  1GEW A;  1IAX A;  2VYC A;  2YKU A;  4MKK A;  3B1D A;  4WYE A;  1W7L A;  3TFU A;  1ZOD A;  1SZK A;  4Y0D A;  4ATQ A;  1VP4 A;  1AJS A;  2VI9 A;  3MAU A;  4M2M A;  4ZM3 A;  3L8A A;  4U1T A;  4HF8 A;  3A9Y A; 
#chains in the Genus database with same CATH homology
 1M4N A;  1D7R A;  2CY8 A;  3MC6 A;  1FG3 A;  1AHY A;  2BYJ A;  3G0T A;  2W7H A;  3ISL A;  3PPL A;  3HDO A;  4P3M A;  4XEW A;  1RVU A;  4ADC A;  1WYU A;  3N75 A;  4BQ0 A;  1IX6 A;  4K2M A;  3R9A A;  1AMQ A;  4LNM A;  1CL2 A;  2VMZ A;  4WLH A;  4OBU A;  2ZY5 A;  3N4X A;  1AMA A;  1IBJ A;  3BCB A;  3II0 A;  3DXW A;  3JTX A;  5G4I A;  1X28 A;  1G4X A;  3OP7 A;  3M5U A;  3RBF A;  3T32 A;  5F9S A;  5KTB A;  1DJE A;  2W7J A;  4Y0I A;  1QGN A;  5HHY A;  1RV4 A;  1B9H A;  3H14 A;  4WB0 B;  5D5S A;  4OBV A;  3N7N A;  4OTL A;  1W23 A;  2BWO A;  4XQ2 A;  1QZ9 A;  3ATH A;  3A8U X;  4F5L A;  3JWA A;  1D7V A;  2DR1 A;  1MDO A;  1WST A;  1SZS A;  1YOO A;  5G2P A;  2VMN A;  2R5E A;  4DQ6 A;  3JW9 A;  1MDZ A;  4ZDO A;  3PDB B;  4R5Z A;  2PB0 A;  4R5F A;  3BWN A;  1X0M A;  4H51 A;  5EIG B;  3DYD A;  4Y0H A;  2HOR A;  2Z1Z A;  1FG7 A;  1XI9 A;  1Z7D A;  4ADE A;  4PFN A;  4GE4 A;  3VOM A;  3RUY A;  1S09 A;  4JEV A;  4E77 A;  3IF2 A;  2EYQ A;  4AO9 A;  2D61 A;  2BIA A;  3PIU A;  2W7I A;  4F5J A;  1IVR A;  3PGY A;  4UHM A;  1C9C A;  1WYU B;  3E9K A;  1ARS A;  3PDB A;  1KMK A;  1JG8 A;  1GBN A;  1BKG A;  3TAT A;  4RIT A;  3F9T A;  5AX8 A;  3EIB A;  3AOV A;  2GB3 A;  1IAY A;  2W8J A;  5M4D A;  4W8I A;  1QIT A;  1KL1 A;  1MAP A;  4MKJ A;  4R8D A;  1P3W A;  1DGE A;  2CH2 A;  1B4X A;  4UQV A;  1TOE A;  1GEY A;  3NRA A;  1N31 A;  1AKC A;  3QI6 A;  2EGY A;  4N0B A;  1LC5 A;  2BI1 A;  2XH1 A;  2CFB A;  4XJP A;  4ZDP A;  1QIR A;  2YRR A;  2HOX A;  5DX5 A;  3FKD A;  3NUI A;  2W7K A;  1N2T A;  1OHY A;  3F0H A;  3MC6 C;  3P1T A;  1D2F A;  4EFF A;  1FC4 A;  2ZP7 A;  3N0L A;  3AEM C;  2ZY4 A;  2CJD A;  2DKB A;  2YOB A;  4N0W A;  4JEW A;  1TOK A;  1EG5 A;  3ECD A;  3WX9 A;  1AIC A;  4PIW A;  2JJE A;  2Z61 A;  2ZYJ A;  2QMA A;  4DBC A;  4WYG A;  4GRX A;  3FFH A;  2JJH A;  3ZRQ A;  4IX8 A;  3MKJ A;  1ASF A;  1KKJ A;  1X2A A;  2Z67 A;  1W7M A;  3GSB A;  2W7D A;  3LVK A;  4K2I A;  3TFT A;  1AMS A;  3WGB A;  1H1C A;  3QGU A;  2A1V A;  1PFF A;  4WB0 A;  2HUF A;  2YRI A;  5M46 A;  1AHX A;  1CQ6 A;  4W1V A;  4WYA A;  3K7Y A;  4J5U A;  3FZ6 A;  1EJI A;  4M2J A;  5DB5 A;  1ASD A;  1KMJ A;  2VLH A;  1AIB A;  1GDE A;  1JS6 A;  3ZRR A;  4CXQ A;  3E6G A;  4IYO A;  2O0R A;  5LHA A;  3QHX A;  5EQC A;  3BWN C;  3GZD A;  4UHN A;  5F8V A;  1UU0 A;  1IX7 A;  2QBT A;  5EAA A;  2AY1 A;  2VGV A;  2FNI A;  3AOW A;  3EUC A;  1I29 A;  3NYU A;  2WKA A;  4F5I A;  4ZSY A;  3ZZJ A;  1C7N A;  1CQ7 A;  2BWP A;  4ITX A;  3RI6 A;  2VIB A;  3MEB A;  4GSA A;  1OAT A;  2BHX A;  2Z9X A;  3CQ5 A;  4OYT A;  2VMV A;  2OGE A;  1CJ0 A;  4K05 A;  4CBS A;  1GCK A;  3WCO A;  1YAA A;  3AEN A;  5LH9 A;  3DR4 A;  3EI9 A;  3P6K A;  2QB3 A;  3FQA A;  4LNL A;  1GD9 A;  2YCP A;  3Q8N A;  5C6U A;  3H9X A;  2BI2 A;  2V1P A;  2VGZ A;  1ASC A;  1YJS A;  3JWB A;  8AAT A;  1CZC A;  4WYD A;  1ART A;  2D66 A;  2VGW A;  1ARH A;  4DGT A;  3N4S A;  4IXO A;  2KFP A;  2AY2 A;  3NNK A;  2Z1Y A;  4RKD A;  4F5M A;  2O7C A;  4MGR A;  1LC7 A;  4B9B A;  1SVV A;  1I41 A;  1OXO A;  1OHW A;  3DRD A;  3UE8 A;  2DKJ A;  2ZUK A;  2CB1 A;  2AY5 A;  1TOJ A;  2QLR A;  4JE5 A;  1CQ8 A;  2BKW A;  4O6Z A;  4OT8 A;  1BQD A;  2G7J A;  2BIE A;  3B8X A;  3BCX A;  2V0Y A;  1UU2 A;  3EI8 A;  2D7Y A;  2Z9W A;  4XJO A;  2ZJG A;  1RVY A;  1LC8 A;  1O61 A;  1B9I A;  2VMO A;  3A9X A;  2Z9V A;  4OCA A;  3COG A;  3CQ4 A;  2JGT A;  3E2Z A;  3JZL A;  4FL0 A;  3ZZK A;  1LS3 A;  1ZOB A;  5FT8 A;  4I8A A;  3EI5 A;  2TPL A;  4FFC A;  4BA5 A;  3WKS A;  2D63 A;  4TV7 A;  5E5I A;  1YJY A;  3AV7 A;  3WKR A;  4ADD A;  2EPJ A;  3FZ8 A;  3LWS A;  2GQN A;  2JJG A;  3GR9 A;  4OC9 A;  2XBN A;  3EI6 A;  4W1W A;  4H63 Q;  2VI8 A;  1M0Q A;  3EI7 A;  1ARG A;  3MBB A;  4RJY A;  2FKI A;  2AY8 A;  3QPG A;  3FTB A;  1V72 A;  4GE7 A;  3W1I A;  4MY5 A;  2ZC0 A;  3VK4 A;  2W7G A;  1YNU A;  2ORD A;  3TCM A;  1TAR A;  3G7Q A;  5K8B A;  2ZSM A;  1SFF A;  2CAN A;  1LW5 A;  3MAF A;  1AY4 A;  2OQX A;  4J8L A;  1WYV B;  4MQQ A;  1GEX A;  3BCA A;  5EIG A;  2AEU A;  1AAM A;  1AJS B;  2DGM A;  3UAK A;  4KYO A;  5EFS A;  2VGU A;  2W7M A;  3ZRP A;  2VMX A;  2HOZ A;  4B98 A;  1IUG A;  1Y4I A;  2HZP A;  1JF9 A;  5FT5 A;  2X5D A;  2HUU A;  1E5F A;  1O4S A;  1J04 A;  2YCT A;  3W1J A;  1BJN A;  4A0G A;  2Z9U A;  3DXV A;  4W91 A;  5BJ4 A;  2CTZ A;  1KKP A;  4WD2 A;  1SZU A;  2GMS A;  3TQX A;  3WGC A;  1C7O A;  3GJU A;  4JEX A;  1D7S A;  4GDY A;  4XAU A;  3FCR A;  3HL2 A;  4Q76 A;  2EZ2 A;  3MAF B;  3R4T A;  4A6T A;  4JEZ A;  4WXF A;  2CIN A;  3EZ1 A;  3FFR A;  4PFF A;  1B5P A;  1M0O A;  1BJW A;  4A72 A;  1BJ4 A;  1AIA A;  2AY7 A;  4EB5 A;  2VIA A;  2D5Y A;  1D7U A;  1DKA A;  1ECX A;  2VGT A;  1H0C A;  1WKH A;  3G8M A;  4RIZ A;  2D7Z A;  2YKV A;  2Q7W A;  2OKK A;  4K2B A;  2WK8 A;  3PD6 B;  4ZM4 A;  2AEV A;  3B1C A;  3E77 A;  1JS3 A;  3EZS A;  1PG8 A;  4GE9 A;  4ZAS A;  9AAT A;  5DJ1 A;  4W5K A;  4ZAH A;  1WYT A;  2ZY3 A;  1ASG A;  3GBX A;  3WZF A;  4A0F A;  4RAE A;  1TAT A;  2F8J A;  5D95 A;  4ATP A;  2D65 A;  2WB6 A;  1AHF A;  4TMR A;  1SPA A;  4ZWV A;  3NDN A;  4IYO B;  1LKC A;  1YIZ A;  3AEM A;  3HVY A;  2FQ6 A;  5EAV A;  2WK9 A;  1CS1 A;  1C4K A;  4KXK A;  4PVF A;  1O69 A;  1W3U A;  2C7T A;  3BN1 A;  4JF0 A;  4ZWM A;  1ASB A;  4ITG A;  4IY7 A;  1SF2 A;  2VMQ A;  1ZC9 A;  1M0N A;  4AO4 A;  1AY5 A;  1B8G A;  2AY4 A;  4EU1 A;  1BQA A;  3NU8 A;  1UKJ A;  2X8U A;  4TN4 A;  1G7X A;  2EZ1 A;  4XK1 A;  2R5C B;  3W1H A;  1J32 A;  4CVQ A;  2E7U A;  2GSA A;  5M49 A;  1V2D A;  3WY7 A;  1AHE A;  3CQ6 A;  3AEN B;  2R2N A;  4WLJ A;  2VLF A;  2C44 A;  1AJR A;  2JG2 A;  4XJM A;  4RM1 A;  2C81 A;  1WYT B;  1AKB A;  5HXX A;  2CST A;  3LG0 A;  2OAT A;  5G0A A;  1VEF A;  4ZLV A;  1WKG A;  3B1E A;  3DZZ A;  2CJH A;  5EUN A;  3VK2 A;  5JAY A;  2VMW A;  1TOI A;  3FZ7 A;  3FDB A;  3CAI A;  4LW4 A;  1DJU A;  1GC0 A;  2VMS A;  5E3K A;  5TF5 A;  3GZC A;  1O62 A;  1G4V A;  1X29 A;  4JEY A;  4MQP A;  1XEY A;  2FNU A;  3K40 A;  3LVM A;  2PO3 A;  2ZY2 A;  1AY8 A;  4ZSW A;  3UWC A;  3WLX A;  3E2Z B;  3LY1 A;  4AOA A;  3BWO A;  2YHK A;  3F6T A;  1S08 A;  5G09 A;  2GMU A;  2YCN A;  5E4Z A;  2QB2 A;  2BI5 A;  1S0A A;  2HP1 A;  3KE3 A;  3KGW A;  4LW2 A;  4GEB A;  2G6W A;  4WYC A;  3AEJ A;  3CBF A;  4WP0 A;  4OMA A;  1ASA A;  2ZSL A;  2D64 A;  3AEL A;  4EB7 A;  3MAD A;  2HUI A;  3FRK A;  2O1B A;  4Q31 A;  1CZE A;  3AEP A;  4F4E A;  4E3R A;  3ELP A;  4CBR A;  3ELE A;  5G4J A;  4MQR A;  2QSR A;  2X5F A;  1TAS A;  3FVU A;  3NTJ A;  1MAQ A;  4IXZ A;  2R5C A;  1N8P A;  4WXG A;  4AZK A;  7AAT A;  3ACZ A;  2VMU A;  4E1O A;  1C7G A;  3QBO A;  2RFV A;  4F5G A;  3QM2 A;  1V2F A;  3FQ7 A;  3A2B A;  3PDX A;  4NOG A;  1RV3 A;  1VJO A;  4LC3 A;  3HLM A;  2JJF A;  3I4J A;  1GC3 A;  2W7E A;  3HBX A;  1I43 A;  3A9Z A;  1E5E A;  4ZDL A;  1AAW A;  3H7F A;  1U08 A;  1DGD A;  2W8T A;  4CXR A;  4A6U A;  2CH1 A;  3NYS A;  1BJO B;  4IW7 A;  3NU7 A;  1QIS A;  3N5M A;  3E2Y A;  2BI9 A;  1BJO A;  5FT4 A;  2E7J A;  3USF A;  1ELU A;  3FD0 A;  4ADB A;  1BS0 A;  1M0P A;  3D6K A;  5EUE A;  1LW4 A;  1MGV A;  2YKX A;  4QGR A;  4A00 A;  3EIA A;  3RBL A;  4Q6R A;  3PD6 A;  1M32 A;  3HT4 A;  3AAT A;  4EMY A;  2W8U A;  3QN6 A;  1ASM A;  4WYF A;  3BV0 A;  4A6R A;  1DTY A;  3FDD A;  2EO5 A;  2YKY A;  2VMY A;  4ISY A;  4W1X A;  5M4B A;  2AY3 A;  2E54 A;  4RJ0 A;  1LK9 A;  2Z20 A;  1ASN A;  1B5O A;  1ASE A;  3ASB A;  1I48 A;  1UU1 A;  4BMK A;  1Z3Z A;  3BS8 A;  4RKC A;  4A0H A;  1AHG A;  1DJ9 A;  2W8V A;  3K28 A;  3LVJ A;  4MSO A;  3L44 A;  1OHV A;  4U2H A;  4HVK A;  2VMR A;  4LNJ A;  1CL1 A;  1OXP A;  1AX4 A;  3PJ0 A;  5DJ9 A;  2X3L A;  2FYF A;  2HOY A;  2WK7 A;  3IHJ A;  4JE5 D;  1IJI A;  1IX8 A;  1GC4 A;  1EQB A;  1MLY A;  2BI3 A;  4WXB A;  4M2K A;  3E2F A;  4F5K A;  2VMP A;  3RCH B;  3RQ1 A;  1WYV A;  3JU7 A;  3FVS A;  4E3Q A;  4BA4 A;  3PA9 A;  1KL2 A;  2DGL A;  2PB2 A;  1BT4 A;  2AY6 A;  2C0R A;  3AEJ C;  3DU4 A;  2BWN A;  3DR7 A;  2HP2 A;  2DOU A;  2NMP A;  1GC2 A;  3DOD A;  3NX3 A;  4AH3 A;  4L0O A;  3HMU A;  4P7Y A;  2CJG A;  3GET A;  5HDM A;  1PMO A;  4RLG A;  4WBT A;  1ARI A;  4AZJ A;  3PAA A;  4F5H A;  2FN6 A;  1M7Y A;  1QJ3 A;  1W7N A;  1G7W A;  3WCN A;  3FSL A;  3NUB A;  4BHD A;  3N4R A;  3VP6 A;  1YJZ A;  2VMT A;  3LV2 A;  5EUD A;  1T3I A;  2FM1 A;  1BW0 A;  1S07 A;  2VGS A;  1MDX A;  3B46 A;  1C0N A;  3I16 A;  4XJL A;  3VAX A;  3GWP A;  2JIS A;  2AAT A;  4Q75 A;  3HQT A;  5I92 A;  1ASL A;  3BC8 A;  1YIY A;  3I5T A;  3GZD C;  5J8Q A;  3DC1 A;  1ORD A;  3VK3 A;  1TOG A;  3FVX A;  2E7I A;  1DFO A;  2OKJ A;  1V2E A;  4UOY A;  4R2N A;  1M6S A;  1AMR A;  2W7L A;  5FT6 A;  3BB8 A;  3NYT A;  4UHO A;  1PMM A;  3ASA A;  2QA3 A;  1ELQ A;  1AKA A;  3RCH A;  4F5F A;  2AY9 A;  5IWQ A;  2EH6 A;  2BYL A;  2W7F A;  1TPL A;  3KKI A;  5G2Q A;  3OKS A;  3FQ8 A;  1QJ5 A;  2OGA A;  3KGX A;  4KAM A;  2BIG A;  3LVL B;  4IXS A;  1S06 A;  4A0R A;  2DGK A;  4JF1 A;  5BJ3 A;  1MLZ A;  2R0T A;  2W8W A;  3AEO A;  1GEW A;  1IAX A;  2VYC A;  2YKU A;  4MKK A;  3B1D A;  4WYE A;  1W7L A;  3TFU A;  1ZOD A;  1SZK A;  4Y0D A;  4ATQ A;  1VP4 A;  1AJS A;  2VI9 A;  3MAU A;  4M2M A;  4ZM3 A;  3L8A A;  4U1T A;  4HF8 A;  3A9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...