1BJNA

Structure of phosphoserine aminotransferase from escherichia coli
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
360
structure length
359
Chain Sequence
b'QIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTILSRPIDVSRYGVIYAGAQNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKRNRSRMNVPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFERRHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Crystal structure of phosphoserine aminotransferase from Escherichia coli at 2.3 A resolution: comparison of the unligated enzyme and a complex with alpha-methyl-l-glutamate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminotransferase
total genus 119
structure length 359
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 1998-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1bjnA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1bjnA02
2ZY5A 7AATA 1LC8A 3W1HA 2YKUA 3NUIA 4DGTA 1DJUA 1E5EA 2YOBA 3GZCA 3N0LA 4BHDA 3FTBA 2QB2A 4WYAA 1X29A 1S08A 2E54A 4OCAA 4ZM4A 1TOEA 3QBOA 4UHOA 3DC1A 1YOOA 4MGRA 2X5FA 3PD6B 1BJOA 1IBJA 3PIUA 4F5LA 2X5DA 2VYCA 3AOVA 1BS0A 1O62A 1SVVA 2Z9VA 2W7DA 3EI6A 2EH6A 3UE8A 2QA3A 3NX3A 3FSLA 1GD9A 4JEWA 3FRKA 4MKKA 1ORDA 1AMRA 3WGCA 1V2DA 3AEMA 4I8AA 2D66A 4W1VA 1AHGA 1LW5A 3B1EA 3P6KA 1JF9A 1RV4A 2VGVA 3A9XA 3HBXA 2R5CB 1P3WA 4Q75A 4PIWA 3FZ6A 2HOYA 1VJOA 2FM1A 4KAMA 2JJGA 1W7NA 1B8GA 1LKCA 2VI9A 2VMSA 4BMKA 3E2YA 4MSOA 1B5PA 4RM1A 1S09A 5J8QA 3EIBA 4CXQA 4ITXA 1AMSA 4ATQA 1AKCA 1M0QA 4WLHA 3QM2A 3MBBA 3ZRPA 3BV0A 3AOWA 1GEXA 1BJ4A 2WK8A 4Y0IA 1QZ9A 4ITGA 1GC0A 1AAMA 3B8XA 3W1IA 4R5FA 1H1CA 2ZY2A 5AX8A 2CTZA 3FFHA 1ARIA 3EUCA 3CQ5A 1EQBA 3NYSA 2FN6A 1YAAA 4LNLA 1PMOA 1TASA 1DTYA 1GC3A 3QHXA 1WKGA 2EGYA 4NOGA 2BWNA 3WCOA 1GC4A 4FL0A 2YHKA 4A6UA 3FFRA 4WB0A 2W7IA 1ASGA 1FC4A 1AHFA 3BCAA 3E2ZA 1AAWA 4OMAA 2D63A 2AY5A 4R8DA 5LHAA 1ARGA 1GDEA 3WCNA 5D5SA 1WYUA 2D61A 2DGLA 1IX7A 1WYTB 3L44A 1UKJA 3ZZJA 1KMJA 1Z3ZA 3TFUA 2YCNA 3VP6A 3DYDA 1CZCA 1V2FA 3EZSA 3GWPA 3M5UA 1CL1A 3LG0A 4PFFA 5EUNA 3E9KA 3PJ0A 1ARTA 3ELPA 1FG3A 2D7ZA 4EU1A 1E5FA 4O6ZA 3FVXA 3GR9A 4JE5D 1J32A 2VGSA 1D7RA 3HLMA 2BKWA 4W8IA 4F5KA 2R0TA 3AELA 3RUYA 1C4KA 2CJHA 3GETA 4U2HA 4ADEA 1AY4A 5DX5A 1WSTA 1O61A 2V0YA 3DZZA 3HDOA 4ZASA 1AY8A 1PG8A 2BI9A 1V2EA 1AMAA 1QISA 1M0OA 1AKBA 2CH2A 4M2MA 2PB0A 3KKIA 9AATA 2W8JA 2E7IA 2OGAA 3GJUA 1M0NA 1GC2A 1WYVB 1ZOBA 3FQ7A 2WKAA 1JS3A 3K7YA 4LW4A 5FT6A 1BQDA 4AO9A 2YRIA 2VMUA 2VI8A 2VLHA 1UU0A 2BI5A 3ACZA 2Z1YA 2HP2A 1MAPA 4A0HA 1GBNA 5F8VA 3TCMA 2VMPA 1ARHA 1YIYA 1BJOB 2OKKA 4RJ0A 1KMKA 1IAXA 2W7LA 4ADDA 5M4DA 4AZKA 2AY1A 3AEJC 1AHEA 1DFOA 1I43A 1V72A 2JJEA 4OYTA 3AEPA 3CQ6A 2X3LA 2VGZA 1LC7A 4JEZA 4M2KA 3DXWA 3AEOA 4BQ0A 3AEMC 3DXVA 1LW4A 3OKSA 3IHJA 3WGBA 4ZM3A 1D7VA 3II0A 2AATA 3CQ4A 5EAVA 1C9CA 1KKJA 4XJPA 5IWQA 5E4ZA 4IYOB 4F4EA 1MDOA 1I29A 1DJEA 2GMSA 3JWAA 1G7WA 4LC3A 3DODA 5LH9A 1DGEA 1AIBA 1TOIA 5EIGA 4WBTA 3RI6A 1D2FA 1S07A 3BWNC 2DGKA 3HMUA 3NRAA 3FQ8A 4E1OA 2VMTA 4RITA 2BI2A 1I48A 1B9HA 1TPLA 2JGTA 2WK9A 2YKXA 3AENA 5EUEA 1YJSA 1ASBA 3F0HA 4RKCA 2W7GA 1ASFA 4M2JA 4GRXA 3VK3A 1VP4A 1TOJA 2ZY4A 1D7SA 3LY1A 1C7OA 2W7EA 2R2NA 1CQ6A 3I4JA 1AJSA 2CB1A 3PDBB 1JG8A 3G7QA 2W8WA 3ISLA 2ZY3A 2C44A 1SFFA 2GB3A 1T3IA 3ELEA 3I16A 3GZDC 1ASLA 1N2TA 1Z7DA 2VMZA 3GBXA 1SZSA 4HVKA 2Z61A 1M6SA 2VGWA 2Z9UA 4RIZA 3VAXA 1KKPA 1ASMA 3A9ZA 4UHMA 4WXGA 1SF2A 2HORA 1Y4IA 4WYGA 5I92A 4WB0B 3B1DA 2RFVA 4WYEA 2BWPA 1IX8A 2HUIA 2JISA 4K2BA 4U1TA 4Y0HA 4GE7A 4LNJA 4LNMA 1OATA 2YCTA 4XJMA 2YRRA 2W8VA 1X2AA 2W8TA 3P1TA 4IXSA 1ARSA 2JJFA 3BCXA 2D5YA 2YKVA 4XAUA 2VMQA 3WY7A 5HXXA 3QPGA 4ATPA 3ZZKA 3F6TA 3A2BA 4DBCA 5EUDA 4BA4A 1IUGA 1KL1A 2OQXA 1W3UA 4J5UA 1XI9A 2DKBA 4AH3A 1O4SA 5HDMA 2W7FA 3JU7A 1M7YA 1ECXA 1TOKA 3LVLB 4IX8A 4K2MA 5F9SA 1U08A 2YCPA 1G7XA 4MQQA 5G0AA 4E77A 1W23A 3RCHA 4PFNA 2VMRA 4W1XA 1W7LA 4K2IA 3ASBA 4ZWVA 4TV7A 4CBSA 4CXRA 2C0RA 3QI6A 4WLJA 2PB2A 4BA5A 4P3MA 4ZDLA 3PD6A 2VIBA 1RVYA 3DR4A 2BYJA 2VMNA 3E6GA 1IX6A 1YIZA 1H0CA 1CS1A 5JAYA 1C0NA 1UU2A 2W8UA 3G0TA 3EZ1A 4XK1A 4F5MA 1M32A 4WD2A 4TN4A 4RJYA 2WK7A 2XBNA 3ZRQA 2BHXA 1MLZA 2EO5A 4F5IA 1PMMA 3LVMA 3UWCA 4UHNA 1B9IA 4N0WA 5DJ1A 3EIAA 4ZSYA 4ZAHA 3NUBA 1N8PA 5G2QA 2AY3A 1ASCA 2NMPA 1OXOA 2R5CA 3LVKA 5DJ9A 5DB5A 2FYFA 4JF0A 1SZUA 1CQ7A 4F5HA 2PO3A 2YKYA 4WXFA 1MLYA 4ISYA 1ASNA 1FG7A 2VIAA 1LC5A 3PA9A 3BS8A 1X28A 5EAAA 1RV3A 1W7MA 4E3RA 4RAEA 4A0FA 1DKAA 2W7KA 4F5JA 5EIGB 2HOXA 3BB8A 3KGWA 4ADCA 1ASEA 1QJ5A 2HUUA 2JG2A 3JTXA 4XQ2A 3MKJA 4A72A 1IVRA 1IJIA 4CVQA 3HT4A 3LWSA 3L8AA 4ZLVA 2AY7A 1G4VA 3AENB 3CAIA 3NTJA 5C6UA 1IAYA 1YJYA 3NYTA 3I5TA 4WXBA 2W7HA 4EMYA 3BWOA 1CL2A 1QITA 1B5OA 2BWOA 5E3KA 1UU1A 4RLGA 3K28A 3FVSA 1N31A 4B98A 1AJSB 5BJ3A 1ZC9A 3PDXA 1TARA 4GDYA 3MAFA 3G8MA 2Z1ZA 4AO4A 2ZP7A 1BJNA 2W7JA 3FQAA 5G4JA 1WYTA 1J04A 1ZODA 3MEBA 3K40A 1B4XA 4W1WA 3Q8NA 1S06A 4ZWMA 2E7JA 3NDNA 2F8JA 1AMQA 2BIGA 3BC8A 3ZRRA 1TATA 4WYDA 1QJ3A 3R9AA 4B9BA 3B46A 3JW9A 2AY8A 4Y0DA 2EPJA 1X0MA 2C7TA 3MADA 4N0BA 2AEVA 1KL2A 3EI9A 4QGRA 4UOYA 3WKRA 3TFTA 5M46A 4XJOA 1GEWA 4UQVA 4H51A 5BJ4A 1XEYA 3AV7A 2O7CA 3ATHA 1WYVA 2GMUA 3FVUA 2AY9A 3WZFA 3FD0A 8AATA 2C81A 2D7YA 2XH1A 2CJGA 1VEFA 4WYFA 3RCHB 3KGXA 2DR1A 1MGVA 3MC6A 1JS6A 5FT4A 2QLRA 3A8UX 4OBVA 5TF5A 2HUFA 3E77A 4L0OA 4W5KA 1CJ0A 1OHYA 1PFFA 3NU8A 1QGNA 2Z67A 3MAUA 1BJWA 3RBLA 3E2ZB 1EG5A 4GSAA 1C7NA 5G09A 3E2FA 1CZEA 2FQ6A 3B1CA 1D7UA 1WYUB 3QN6A 4GE4A 1M4NA 4MY5A 3AEJA 4AZJA 3NYUA 1QIRA 2FNIA 2ZC0A 1DJ9A 3N5MA 1CQ8A 1BT4A 5EQCA 1YNUA 2ZSLA 4A0GA 1ASAA 3R4TA 4IYOA 4Q6RA 4EFFA 2R5EA 1BW0A 3NU7A 2EZ1A 3QGUA 4IY7A 1I41A 2AEUA 4GEBA 5E5IA 3H14A 2DGMA 1AICA 2Q7WA 2X8UA 4JE5A 3BWNA 2ZJGA 3PAAA 1MDZA 3AATA 4OT8A 4ZSWA 3VK4A 3WLXA 2O0RA 1LK9A 2CINA 5FT5A 3RQ1A 1MDXA 4OC9A 3LV2A 5D95A 5EFSA 3FCRA 2VMOA 3NNKA 4JF1A 1ELUA 2E7UA 4LW2A 2BI3A 2D64A 2ZYJA 1YJZA 3A9YA 4XEWA 1EJIA 3COGA 3TQXA 2G6WA 1MAQA 3PPLA 1GEYA 1OXPA 2HZPA 4MQRA 3PDBA 1OHWA 2QBTA 4GE9A 3GSBA 3VOMA 3FDDA 4ADBA 2GQNA 2CY8A 2VGTA 4AOAA 4A0RA 3GZDA 3BN1A 1SPAA 3H7FA 2VMYA 5HHYA 2W7MA 4IXOA 3EI5A 1DGDA 3ASAA 2TPLA 3HVYA 3W1JA 3OP7A 2OKJA 2D65A 4DQ6A 1AKAA 2VMWA 2AY6A 3MAFB 4JEXA 3TATA 5M4BA 1M0PA 3F9TA 2HOZA 2OGEA 2Z9WA 4E3QA 1ELQA 4KYOA 3HL2A 3WX9A 3JZLA 4TMRA 2CSTA 2ZSMA 3HQTA 4FFCA 4IXZA 1SZKA 4JEYA 2DOUA 5K8BA 1AX4A 4HF8A 3ECDA 4IW7A 4J8LA 4PVFA 3RBFA 2OATA 2O1BA 3USFA 1BQAA 3FZ7A 2Z9XA 4OTLA 4WYCA 2DKJA 1AY5A 1ASDA 4W91A 3FKDA 3T32A 3PGYA 3VK2A 4MKJA 3FDBA 1RVUA 3DU4A 2CFBA 3JWBA 1AHXA 1S0AA 3EI8A 3D6KA 4WP0A 1O69A 4CBRA 3LVJA 3CBFA 2CH1A 2V1PA 1OHVA 4ZDPA 4A6TA 1AJRA 3MC6C 1AHYA 3BCBA 3KE3A 2QB3A 2VGUA 2AY4A 2CANA 2HP1A 5G4IA 4OBUA 1WKHA 2BIEA 4F5FA 2VLFA 2ZUKA 3WKSA 2BIAA 2Z20A 3IF2A 5FT8A 2GSAA 2VMVA 2BI1A 5G2PA 4A00A 4R2NA 3FZ8A 3DRDA 1TOGA 4F5GA 1C7GA 1G4XA 1AIAA 2JJHA 5M49A 4A6RA 4EB5A 4RKDA 3DR7A 1BKGA 2QMAA 2VMXA 3EI7A 2BYLA 2EZ2A 4Q31A 4Q76A 3N75A 4JEVA 4EB7A 4ZDOA 2AY2A 2ORDA 1GCKA 4KXKA 4P7YA 2FNUA 1LS3A 4R5ZA 3UAKA 4MQPA 2CJDA 4XJLA
chains in the Genus database with same CATH superfamily
2ZY5A 7AATA 1LC8A 3W1HA 2YKUA 3NUIA 4DGTA 1DJUA 1E5EA 2YOBA 3GZCA 3N0LA 4BHDA 2A1VA 3FTBA 2QB2A 4WYAA 1X29A 1S08A 2E54A 3N7NA 4OCAA 4ZM4A 1TOEA 3QBOA 4UHOA 3H9XA 2QSRA 3DC1A 1YOOA 4MGRA 2X5FA 3PD6B 1BJOA 1IBJA 3PIUA 4F5LA 2X5DA 2VYCA 3AOVA 1BS0A 1O62A 1SVVA 2Z9VA 2W7DA 3EI6A 2EH6A 3UE8A 2QA3A 3NX3A 3FSLA 1GD9A 4JEWA 3FRKA 4MKKA 1ORDA 1AMRA 3WGCA 1V2DA 3AEMA 4I8AA 2D66A 4W1VA 1AHGA 1LW5A 3B1EA 3P6KA 1JF9A 1RV4A 2VGVA 3A9XA 3HBXA 2R5CB 1P3WA 4Q75A 4PIWA 3FZ6A 2HOYA 1VJOA 2FM1A 4KAMA 2JJGA 1W7NA 1B8GA 1LKCA 2VI9A 2VMSA 4BMKA 5KTBA 3E2YA 4MSOA 1B5PA 4RM1A 1S09A 5J8QA 3EIBA 4CXQA 4ITXA 1AMSA 4ATQA 1AKCA 1M0QA 4WLHA 3QM2A 3MBBA 3ZRPA 3BV0A 3AOWA 1GEXA 1BJ4A 2WK8A 4Y0IA 1QZ9A 4ITGA 1GC0A 1AAMA 3B8XA 3W1IA 4R5FA 1H1CA 4K05A 2ZY2A 5AX8A 2CTZA 3FFHA 1ARIA 3EUCA 3CQ5A 1EQBA 3NYSA 2FN6A 1YAAA 4LNLA 1PMOA 1TASA 1DTYA 1GC3A 3QHXA 1WKGA 2EGYA 4NOGA 2BWNA 3WCOA 4H63Q 1GC4A 4FL0A 2YHKA 4A6UA 3FFRA 4WB0A 2W7IA 1ASGA 1FC4A 1AHFA 3BCAA 3E2ZA 1AAWA 4OMAA 2D63A 2AY5A 4R8DA 5LHAA 1ARGA 1GDEA 3WCNA 5D5SA 1WYUA 2D61A 2DGLA 1IX7A 1WYTB 3L44A 1UKJA 3ZZJA 1KMJA 1Z3ZA 3TFUA 2YCNA 3VP6A 3DYDA 1CZCA 1V2FA 3EZSA 3GWPA 3M5UA 1CL1A 3LG0A 4PFFA 5EUNA 3E9KA 3PJ0A 1ARTA 3ELPA 1FG3A 2D7ZA 4EU1A 1E5FA 4O6ZA 3FVXA 3GR9A 4JE5D 1J32A 2VGSA 1D7RA 3HLMA 2BKWA 4W8IA 4F5KA 2R0TA 3AELA 3RUYA 1C4KA 2CJHA 3GETA 4U2HA 4ADEA 1AY4A 5DX5A 1WSTA 1O61A 2V0YA 3DZZA 3HDOA 4ZASA 1AY8A 1PG8A 2BI9A 1V2EA 1AMAA 1QISA 1M0OA 1AKBA 2CH2A 4M2MA 2PB0A 3KKIA 9AATA 2W8JA 2E7IA 2OGAA 3GJUA 1M0NA 1GC2A 1WYVB 1ZOBA 3FQ7A 2WKAA 1JS3A 3K7YA 4LW4A 5FT6A 1BQDA 4AO9A 2YRIA 2VMUA 2VI8A 2VLHA 1UU0A 2BI5A 3ACZA 2Z1YA 2HP2A 1MAPA 4A0HA 1GBNA 5F8VA 3TCMA 2VMPA 1ARHA 1YIYA 1BJOB 2OKKA 4RJ0A 1KMKA 1IAXA 2W7LA 4ADDA 5M4DA 4AZKA 2AY1A 3AEJC 1AHEA 1DFOA 1I43A 1V72A 2JJEA 4OYTA 3AEPA 3CQ6A 2X3LA 2VGZA 1LC7A 4JEZA 4M2KA 3DXWA 3AEOA 4BQ0A 3N4SA 3AEMC 3DXVA 1LW4A 3OKSA 3IHJA 3WGBA 4ZM3A 1D7VA 3II0A 2AATA 3CQ4A 5EAVA 1C9CA 1KKJA 4XJPA 5IWQA 5E4ZA 4IYOB 4F4EA 1MDOA 1I29A 1DJEA 2GMSA 3JWAA 1G7WA 4LC3A 3DODA 5LH9A 1DGEA 1AIBA 1TOIA 5EIGA 4WBTA 3RI6A 1D2FA 1S07A 3BWNC 2DGKA 3HMUA 3NRAA 3FQ8A 4E1OA 2VMTA 4RITA 2BI2A 1I48A 1B9HA 1TPLA 2JGTA 2WK9A 2YKXA 3AENA 5EUEA 1YJSA 1ASBA 3F0HA 4RKCA 2W7GA 1ASFA 4M2JA 4GRXA 3VK3A 1VP4A 1TOJA 2ZY4A 1D7SA 3LY1A 1C7OA 2W7EA 2R2NA 1CQ6A 3I4JA 1AJSA 2CB1A 3PDBB 1JG8A 3G7QA 2W8WA 3ISLA 2ZY3A 2C44A 1SFFA 2GB3A 1T3IA 3ELEA 3I16A 3GZDC 1ASLA 1N2TA 1Z7DA 2VMZA 3GBXA 1SZSA 4HVKA 2Z61A 1M6SA 2VGWA 2Z9UA 4RIZA 3VAXA 1KKPA 1ASMA 3A9ZA 4UHMA 4WXGA 1SF2A 2HORA 1Y4IA 4WYGA 5I92A 4WB0B 3B1DA 2RFVA 4WYEA 2BWPA 1IX8A 2HUIA 2JISA 4K2BA 4U1TA 4Y0HA 2EYQA 4GE7A 4LNJA 4LNMA 1OATA 2YCTA 4XJMA 2YRRA 2W8VA 1X2AA 2W8TA 3P1TA 4IXSA 1ARSA 2JJFA 3BCXA 2D5YA 2YKVA 4XAUA 2VMQA 3WY7A 5HXXA 3QPGA 4ATPA 3ZZKA 3F6TA 3A2BA 4DBCA 5EUDA 4BA4A 1IUGA 1KL1A 2OQXA 1W3UA 4J5UA 1XI9A 2DKBA 4AH3A 1O4SA 5HDMA 2W7FA 3JU7A 1M7YA 1ECXA 1TOKA 3LVLB 4IX8A 4K2MA 5F9SA 1U08A 2YCPA 1G7XA 4MQQA 5G0AA 4E77A 1W23A 3RCHA 4PFNA 2VMRA 4W1XA 1W7LA 4K2IA 3ASBA 4ZWVA 4TV7A 4CBSA 4CXRA 2C0RA 3QI6A 4WLJA 2PB2A 4BA5A 4P3MA 4ZDLA 3PD6A 2VIBA 1RVYA 3DR4A 2BYJA 2VMNA 3E6GA 1IX6A 1YIZA 1H0CA 1CS1A 5JAYA 1C0NA 1UU2A 2W8UA 3G0TA 3EZ1A 2KFPA 4XK1A 4F5MA 1M32A 4WD2A 4TN4A 4RJYA 2WK7A 2XBNA 3ZRQA 2BHXA 1MLZA 2EO5A 4F5IA 1PMMA 3LVMA 3UWCA 4UHNA 1B9IA 4N0WA 5DJ1A 3EIAA 4ZSYA 4ZAHA 3NUBA 1N8PA 5G2QA 2AY3A 1ASCA 2NMPA 1OXOA 2R5CA 3LVKA 5DJ9A 5DB5A 2FYFA 4JF0A 2WB6A 1SZUA 1CQ7A 4F5HA 2PO3A 2YKYA 4WXFA 1MLYA 4ISYA 1ASNA 1FG7A 2VIAA 1LC5A 3PA9A 3BS8A 1X28A 5EAAA 1RV3A 1W7MA 4E3RA 4RAEA 4A0FA 1DKAA 2W7KA 4F5JA 5EIGB 2HOXA 3BB8A 3KGWA 4ADCA 1ASEA 1QJ5A 2HUUA 2JG2A 3JTXA 4XQ2A 3MKJA 4A72A 1IVRA 1IJIA 4CVQA 3HT4A 3LWSA 3L8AA 4ZLVA 2AY7A 1G4VA 3AENB 3CAIA 3NTJA 5C6UA 1IAYA 1YJYA 3NYTA 3I5TA 4WXBA 2W7HA 4EMYA 3BWOA 1CL2A 1QITA 1B5OA 2BWOA 5E3KA 1UU1A 4RLGA 3K28A 3FVSA 1N31A 4B98A 1AJSB 5BJ3A 1ZC9A 3PDXA 1TARA 4GDYA 3MAFA 3G8MA 2Z1ZA 4AO4A 2ZP7A 1BJNA 2W7JA 3FQAA 5G4JA 1WYTA 1J04A 1ZODA 3MEBA 3K40A 1KAFA 1B4XA 4W1WA 3Q8NA 1S06A 4ZWMA 2E7JA 3NDNA 2F8JA 1AMQA 2BIGA 3BC8A 3ZRRA 1TATA 4WYDA 1QJ3A 3R9AA 4B9BA 3B46A 3JW9A 2AY8A 4Y0DA 2EPJA 1X0MA 2C7TA 3MADA 4N0BA 2AEVA 1KL2A 3EI9A 4QGRA 4UOYA 3WKRA 3TFTA 5M46A 4XJOA 1GEWA 4UQVA 4H51A 5BJ4A 1XEYA 3AV7A 2O7CA 3ATHA 1WYVA 2GMUA 3FVUA 2AY9A 3WZFA 3FD0A 8AATA 2C81A 2D7YA 2XH1A 2CJGA 1VEFA 4WYFA 3RCHB 3KGXA 2DR1A 1MGVA 3MC6A 1JS6A 5FT4A 2QLRA 3A8UX 4OBVA 5TF5A 2HUFA 3E77A 4L0OA 4W5KA 1CJ0A 1OHYA 1PFFA 3NU8A 1QGNA 2Z67A 3MAUA 1BJWA 3RBLA 3E2ZB 1EG5A 4GSAA 1C7NA 5G09A 3E2FA 1CZEA 2FQ6A 3B1CA 1D7UA 1WYUB 3QN6A 4GE4A 1M4NA 4MY5A 3AEJA 4AZJA 3NYUA 1QIRA 2FNIA 2ZC0A 1DJ9A 3N5MA 1CQ8A 1BT4A 5EQCA 1YNUA 2ZSLA 4A0GA 1ASAA 3R4TA 4IYOA 4Q6RA 4EFFA 2R5EA 1BW0A 3NU7A 2EZ1A 3QGUA 4IY7A 1I41A 2AEUA 4GEBA 5E5IA 3H14A 2DGMA 1AICA 2Q7WA 2X8UA 4JE5A 3BWNA 2ZJGA 3PAAA 1MDZA 3AATA 4OT8A 4ZSWA 3VK4A 3WLXA 2O0RA 1LK9A 2CINA 5FT5A 3RQ1A 1MDXA 4OC9A 3LV2A 5D95A 5EFSA 3FCRA 2VMOA 3NNKA 4JF1A 1ELUA 2E7UA 4LW2A 2BI3A 2D64A 2ZYJA 1YJZA 3A9YA 4XEWA 1EJIA 3COGA 3TQXA 2G6WA 1MAQA 3PPLA 1GEYA 1OXPA 2HZPA 4MQRA 3PDBA 1OHWA 2G7JA 2QBTA 4GE9A 3GSBA 3VOMA 3FDDA 4ADBA 3N4XA 2GQNA 2CY8A 2VGTA 4AOAA 4A0RA 3GZDA 3BN1A 1SPAA 3H7FA 2VMYA 5HHYA 2W7MA 4IXOA 3EI5A 1DGDA 3ASAA 2TPLA 3HVYA 3W1JA 3OP7A 2OKJA 2D65A 4DQ6A 1AKAA 2VMWA 2AY6A 3MAFB 4JEXA 3TATA 5M4BA 1M0PA 3F9TA 2HOZA 2OGEA 2Z9WA 4E3QA 1ELQA 4KYOA 3HL2A 3WX9A 3JZLA 4TMRA 2CSTA 2ZSMA 3HQTA 4FFCA 4IXZA 1SZKA 4JEYA 2DOUA 5K8BA 1AX4A 4HF8A 3ECDA 4IW7A 4J8LA 4PVFA 3RBFA 2OATA 2O1BA 3USFA 1BQAA 3FZ7A 2Z9XA 4OTLA 4WYCA 2DKJA 1AY5A 1ASDA 4W91A 3FKDA 3T32A 3PGYA 3VK2A 4MKJA 3FDBA 1RVUA 3DU4A 2CFBA 3JWBA 1AHXA 1S0AA 3EI8A 3D6KA 4WP0A 1O69A 4CBRA 3LVJA 3CBFA 2CH1A 2V1PA 1OHVA 4ZDPA 4A6TA 1AJRA 3MC6C 1AHYA 3BCBA 3KE3A 3N4RA 2QB3A 2VGUA 2AY4A 2CANA 2HP1A 5G4IA 4OBUA 1WKHA 2BIEA 4F5FA 2VLFA 2ZUKA 3WKSA 2BIAA 2Z20A 3IF2A 5FT8A 2GSAA 2VMVA 2BI1A 5G2PA 4A00A 4R2NA 3FZ8A 3DRDA 1TOGA 4F5GA 1C7GA 1G4XA 1AIAA 2JJHA 5M49A 4A6RA 4EB5A 4RKDA 3DR7A 1BKGA 2QMAA 2VMXA 3EI7A 2BYLA 2EZ2A 4Q31A 4Q76A 3N75A 4JEVA 4EB7A 4ZDOA 2AY2A 2ORDA 1GCKA 4KXKA 4P7YA 2FNUA 1LS3A 4R5ZA 3UAKA 4MQPA 2CJDA 4XJLA 2FKIA
chains in the Genus database with same CATH topology
2ZY5A 7AATA 1LC8A 3W1HA 2YKUA 3NUIA 4DGTA 1DJUA 1E5EA 2YOBA 3GZCA 3N0LA 4BHDA 2A1VA 3FTBA 2QB2A 4WYAA 1X29A 1S08A 2E54A 3N7NA 4OCAA 4ZM4A 1TOEA 3QBOA 4UHOA 3H9XA 2QSRA 3DC1A 1YOOA 4MGRA 2X5FA 3PD6B 1BJOA 1IBJA 3PIUA 4F5LA 2X5DA 2VYCA 3AOVA 1BS0A 1O62A 1SVVA 2Z9VA 2W7DA 3EI6A 2EH6A 3UE8A 2QA3A 3NX3A 3FSLA 1GD9A 4JEWA 3FRKA 4MKKA 1ORDA 1AMRA 3WGCA 1V2DA 3AEMA 4I8AA 2D66A 4W1VA 1AHGA 1LW5A 3B1EA 3P6KA 1JF9A 1RV4A 2VGVA 3A9XA 3HBXA 2R5CB 1P3WA 4Q75A 4PIWA 3FZ6A 2HOYA 1VJOA 2FM1A 4KAMA 2JJGA 1W7NA 1B8GA 1LKCA 2VI9A 2VMSA 4BMKA 5KTBA 3E2YA 4MSOA 1B5PA 4RM1A 1S09A 5J8QA 3EIBA 4CXQA 4ITXA 1AMSA 4ATQA 1AKCA 1M0QA 4WLHA 3QM2A 3MBBA 3ZRPA 3BV0A 3AOWA 1GEXA 1BJ4A 2WK8A 4Y0IA 1QZ9A 4ITGA 1GC0A 1AAMA 3B8XA 3W1IA 4R5FA 1H1CA 4K05A 2ZY2A 5AX8A 2CTZA 3FFHA 1ARIA 3EUCA 3CQ5A 1EQBA 3NYSA 2FN6A 1YAAA 4LNLA 1PMOA 1TASA 1DTYA 1GC3A 3QHXA 1WKGA 2EGYA 4NOGA 2BWNA 3WCOA 4H63Q 1GC4A 4FL0A 2YHKA 4A6UA 3FFRA 4WB0A 2W7IA 1ASGA 1FC4A 1AHFA 3BCAA 3E2ZA 1AAWA 4OMAA 2D63A 2AY5A 4R8DA 5LHAA 1ARGA 1GDEA 3WCNA 5D5SA 1WYUA 2D61A 2DGLA 1IX7A 1WYTB 3L44A 1UKJA 3ZZJA 1KMJA 1Z3ZA 3TFUA 2YCNA 3VP6A 3DYDA 1CZCA 1V2FA 3EZSA 3GWPA 3M5UA 1CL1A 3LG0A 4PFFA 5EUNA 3E9KA 3PJ0A 1ARTA 3ELPA 1FG3A 2D7ZA 4EU1A 1E5FA 4O6ZA 3FVXA 3GR9A 4JE5D 1J32A 2VGSA 1D7RA 3HLMA 2BKWA 4W8IA 4F5KA 2R0TA 3AELA 3RUYA 1C4KA 2CJHA 3GETA 4U2HA 4ADEA 1AY4A 5DX5A 1WSTA 1O61A 2V0YA 3DZZA 3HDOA 4ZASA 1AY8A 1PG8A 2BI9A 1V2EA 1AMAA 1QISA 1M0OA 1AKBA 2CH2A 4M2MA 2PB0A 3KKIA 9AATA 2W8JA 2E7IA 2OGAA 3GJUA 1M0NA 1GC2A 1WYVB 1ZOBA 3FQ7A 2WKAA 1JS3A 3K7YA 4LW4A 5FT6A 1BQDA 4AO9A 2YRIA 2VMUA 2VI8A 2VLHA 1UU0A 2BI5A 3ACZA 2Z1YA 2HP2A 1MAPA 4A0HA 1GBNA 5F8VA 3TCMA 2VMPA 1ARHA 1YIYA 1BJOB 2OKKA 4RJ0A 1KMKA 1IAXA 2W7LA 4ADDA 5M4DA 4AZKA 2AY1A 3AEJC 1AHEA 1DFOA 1I43A 1V72A 2JJEA 4OYTA 3AEPA 3CQ6A 2X3LA 2VGZA 1LC7A 4JEZA 4M2KA 3DXWA 3AEOA 4BQ0A 3N4SA 3AEMC 3DXVA 1LW4A 3OKSA 3IHJA 3WGBA 4ZM3A 1D7VA 3II0A 2AATA 3CQ4A 5EAVA 1C9CA 1KKJA 4XJPA 5IWQA 5E4ZA 4IYOB 4F4EA 1MDOA 1I29A 1DJEA 2GMSA 3JWAA 1G7WA 4LC3A 3DODA 5LH9A 1DGEA 1AIBA 1TOIA 5EIGA 4WBTA 3RI6A 1D2FA 1S07A 3BWNC 2DGKA 3HMUA 3NRAA 3FQ8A 4E1OA 2VMTA 4RITA 2BI2A 1I48A 1B9HA 1TPLA 2JGTA 2WK9A 2YKXA 3AENA 5EUEA 1YJSA 1ASBA 3F0HA 4RKCA 2W7GA 1ASFA 4M2JA 4GRXA 3VK3A 1VP4A 1TOJA 2ZY4A 1D7SA 3LY1A 1C7OA 2W7EA 2R2NA 1CQ6A 3I4JA 1AJSA 2CB1A 3PDBB 1JG8A 3G7QA 2W8WA 3ISLA 2ZY3A 2C44A 1SFFA 2GB3A 1T3IA 3ELEA 3I16A 3GZDC 1ASLA 1N2TA 1Z7DA 2VMZA 3GBXA 1SZSA 4HVKA 2Z61A 1M6SA 2VGWA 2Z9UA 4RIZA 3VAXA 1KKPA 1ASMA 3A9ZA 4UHMA 4WXGA 1SF2A 2HORA 1Y4IA 4WYGA 5I92A 4WB0B 3B1DA 2RFVA 4WYEA 2BWPA 1IX8A 2HUIA 2JISA 4K2BA 4U1TA 4Y0HA 2EYQA 4GE7A 4LNJA 4LNMA 1OATA 2YCTA 4XJMA 2YRRA 2W8VA 1X2AA 2W8TA 3P1TA 4IXSA 1ARSA 2JJFA 3BCXA 2D5YA 2YKVA 4XAUA 2VMQA 3WY7A 5HXXA 3QPGA 4ATPA 3ZZKA 3F6TA 3A2BA 4DBCA 5EUDA 4BA4A 1IUGA 1KL1A 2OQXA 1W3UA 4J5UA 1XI9A 2DKBA 4AH3A 1O4SA 5HDMA 2W7FA 3JU7A 1M7YA 1ECXA 1TOKA 3LVLB 4IX8A 4K2MA 5F9SA 1U08A 2YCPA 1G7XA 4MQQA 5G0AA 4E77A 1W23A 3RCHA 4PFNA 2VMRA 4W1XA 1W7LA 4K2IA 3ASBA 4ZWVA 4TV7A 4CBSA 4CXRA 2C0RA 3QI6A 4WLJA 2PB2A 4BA5A 4P3MA 4ZDLA 3PD6A 2VIBA 1RVYA 3DR4A 2BYJA 2VMNA 3E6GA 1IX6A 1YIZA 1H0CA 1CS1A 5JAYA 1C0NA 1UU2A 2W8UA 3G0TA 3EZ1A 2KFPA 4XK1A 4F5MA 1M32A 4WD2A 4TN4A 4RJYA 2WK7A 2XBNA 3ZRQA 2BHXA 1MLZA 2EO5A 4F5IA 1PMMA 3LVMA 3UWCA 4UHNA 1B9IA 4N0WA 5DJ1A 3EIAA 4ZSYA 4ZAHA 3NUBA 1N8PA 5G2QA 2AY3A 1ASCA 2NMPA 1OXOA 2R5CA 3LVKA 5DJ9A 5DB5A 2FYFA 4JF0A 2WB6A 1SZUA 1CQ7A 4F5HA 2PO3A 2YKYA 4WXFA 1MLYA 4ISYA 1ASNA 1FG7A 2VIAA 1LC5A 3PA9A 3BS8A 1X28A 5EAAA 1RV3A 1W7MA 4E3RA 4RAEA 4A0FA 1DKAA 2W7KA 4F5JA 5EIGB 2HOXA 3BB8A 3KGWA 4ADCA 1ASEA 1QJ5A 2HUUA 2JG2A 3JTXA 4XQ2A 3MKJA 4A72A 1IVRA 1IJIA 4CVQA 3HT4A 3LWSA 3L8AA 4ZLVA 2AY7A 1G4VA 3AENB 3CAIA 3NTJA 5C6UA 1IAYA 1YJYA 3NYTA 3I5TA 4WXBA 2W7HA 4EMYA 3BWOA 1CL2A 1QITA 1B5OA 2BWOA 5E3KA 1UU1A 4RLGA 3K28A 3FVSA 1N31A 4B98A 1AJSB 5BJ3A 1ZC9A 3PDXA 1TARA 4GDYA 3MAFA 3G8MA 2Z1ZA 4AO4A 2ZP7A 1BJNA 2W7JA 3FQAA 5G4JA 1WYTA 1J04A 1ZODA 3MEBA 3K40A 1B4XA 4W1WA 3Q8NA 1S06A 4ZWMA 2E7JA 3NDNA 2F8JA 1AMQA 2BIGA 3BC8A 3ZRRA 1TATA 4WYDA 1QJ3A 3R9AA 4B9BA 3B46A 3JW9A 2AY8A 4Y0DA 2EPJA 1X0MA 2C7TA 3MADA 4N0BA 2AEVA 1KL2A 3EI9A 4QGRA 4UOYA 3WKRA 3TFTA 5M46A 4XJOA 1GEWA 4UQVA 4H51A 5BJ4A 1XEYA 3AV7A 2O7CA 3ATHA 1WYVA 2GMUA 3FVUA 2AY9A 3WZFA 3FD0A 8AATA 2C81A 2D7YA 2XH1A 2CJGA 1VEFA 4WYFA 3RCHB 3KGXA 2DR1A 1MGVA 3MC6A 1JS6A 5FT4A 2QLRA 3A8UX 4OBVA 5TF5A 2HUFA 3E77A 4L0OA 4W5KA 1CJ0A 1OHYA 1PFFA 3NU8A 1QGNA 2Z67A 3MAUA 1BJWA 3RBLA 3E2ZB 1EG5A 4GSAA 1C7NA 5G09A 3E2FA 1CZEA 2FQ6A 3B1CA 1D7UA 1WYUB 3QN6A 4GE4A 1M4NA 4MY5A 3AEJA 4AZJA 3NYUA 1QIRA 2FNIA 2ZC0A 1DJ9A 3N5MA 1CQ8A 1BT4A 5EQCA 1YNUA 2ZSLA 4A0GA 1ASAA 3R4TA 4IYOA 4Q6RA 4EFFA 2R5EA 1BW0A 3NU7A 2EZ1A 3QGUA 4IY7A 1I41A 2AEUA 4GEBA 5E5IA 3H14A 2DGMA 1AICA 2Q7WA 2X8UA 4JE5A 3BWNA 2ZJGA 3PAAA 1MDZA 3AATA 4OT8A 4ZSWA 3VK4A 3WLXA 2O0RA 1LK9A 2CINA 5FT5A 3RQ1A 1MDXA 4OC9A 3LV2A 5D95A 5EFSA 3FCRA 2VMOA 3NNKA 4JF1A 1ELUA 2E7UA 4LW2A 2BI3A 2D64A 2ZYJA 1YJZA 3A9YA 4XEWA 1EJIA 3COGA 3TQXA 2G6WA 1MAQA 3PPLA 1GEYA 1OXPA 2HZPA 4MQRA 3PDBA 1OHWA 2G7JA 2QBTA 4GE9A 3GSBA 3VOMA 3FDDA 4ADBA 3N4XA 2GQNA 2CY8A 2VGTA 4AOAA 4A0RA 3GZDA 3BN1A 1SPAA 3H7FA 2VMYA 5HHYA 2W7MA 4IXOA 3EI5A 1DGDA 3ASAA 2TPLA 3HVYA 3W1JA 3OP7A 2OKJA 2D65A 4DQ6A 1AKAA 2VMWA 2AY6A 3MAFB 4JEXA 3TATA 5M4BA 1M0PA 3F9TA 2HOZA 2OGEA 2Z9WA 4E3QA 1ELQA 4KYOA 3HL2A 3WX9A 3JZLA 4TMRA 2CSTA 2ZSMA 3HQTA 4FFCA 4IXZA 1SZKA 4JEYA 2DOUA 5K8BA 1AX4A 4HF8A 3ECDA 4IW7A 4J8LA 4PVFA 3RBFA 2OATA 2O1BA 3USFA 1BQAA 3FZ7A 2Z9XA 4OTLA 4WYCA 2DKJA 1AY5A 1ASDA 4W91A 3FKDA 3T32A 3PGYA 3VK2A 4MKJA 3FDBA 1RVUA 3DU4A 2CFBA 3JWBA 1AHXA 1S0AA 3EI8A 3D6KA 4WP0A 1O69A 4CBRA 3LVJA 3CBFA 2CH1A 2V1PA 1OHVA 4ZDPA 4A6TA 1AJRA 3MC6C 1AHYA 3BCBA 3KE3A 3N4RA 2QB3A 2VGUA 2AY4A 2CANA 2HP1A 5G4IA 4OBUA 1WKHA 2BIEA 4F5FA 2VLFA 2ZUKA 3WKSA 2BIAA 2Z20A 3IF2A 5FT8A 2GSAA 2VMVA 2BI1A 5G2PA 4A00A 4R2NA 3FZ8A 3DRDA 1TOGA 4F5GA 1C7GA 1G4XA 1AIAA 2JJHA 5M49A 4A6RA 4EB5A 4RKDA 3DR7A 1BKGA 2QMAA 2VMXA 3EI7A 2BYLA 2EZ2A 4Q31A 4Q76A 3N75A 4JEVA 4EB7A 4ZDOA 2AY2A 2ORDA 1GCKA 4KXKA 4P7YA 2FNUA 1LS3A 4R5ZA 3UAKA 4MQPA 2CJDA 4XJLA 2FKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZY5 A;  7AAT A;  1LC8 A;  3W1H A;  2YKU A;  3NUI A;  4DGT A;  1DJU A;  1E5E A;  2YOB A;  3GZC A;  3N0L A;  4BHD A;  3FTB A;  2QB2 A;  4WYA A;  1X29 A;  1S08 A;  2E54 A;  4OCA A;  4ZM4 A;  1TOE A;  3QBO A;  4UHO A;  3DC1 A;  1YOO A;  4MGR A;  2X5F A;  3PD6 B;  1BJO A;  1IBJ A;  3PIU A;  4F5L A;  2X5D A;  2VYC A;  3AOV A;  1BS0 A;  1O62 A;  1SVV A;  2Z9V A;  2W7D A;  3EI6 A;  2EH6 A;  3UE8 A;  2QA3 A;  3NX3 A;  3FSL A;  1GD9 A;  4JEW A;  3FRK A;  4MKK A;  1ORD A;  1AMR A;  3WGC A;  1V2D A;  3AEM A;  4I8A A;  2D66 A;  4W1V A;  1AHG A;  1LW5 A;  3B1E A;  3P6K A;  1JF9 A;  1RV4 A;  2VGV A;  3A9X A;  3HBX A;  2R5C B;  1P3W A;  4Q75 A;  4PIW A;  3FZ6 A;  2HOY A;  1VJO A;  2FM1 A;  4KAM A;  2JJG A;  1W7N A;  1B8G A;  1LKC A;  2VI9 A;  2VMS A;  4BMK A;  3E2Y A;  4MSO A;  1B5P A;  4RM1 A;  1S09 A;  5J8Q A;  3EIB A;  4CXQ A;  4ITX A;  1AMS A;  4ATQ A;  1AKC A;  1M0Q A;  4WLH A;  3QM2 A;  3MBB A;  3ZRP A;  3BV0 A;  3AOW A;  1GEX A;  1BJ4 A;  2WK8 A;  4Y0I A;  1QZ9 A;  4ITG A;  1GC0 A;  1AAM A;  3B8X A;  3W1I A;  4R5F A;  1H1C A;  2ZY2 A;  5AX8 A;  2CTZ A;  3FFH A;  1ARI A;  3EUC A;  3CQ5 A;  1EQB A;  3NYS A;  2FN6 A;  1YAA A;  4LNL A;  1PMO A;  1TAS A;  1DTY A;  1GC3 A;  3QHX A;  1WKG A;  2EGY A;  4NOG A;  2BWN A;  3WCO A;  1GC4 A;  4FL0 A;  2YHK A;  4A6U A;  3FFR A;  4WB0 A;  2W7I A;  1ASG A;  1FC4 A;  1AHF A;  3BCA A;  3E2Z A;  1AAW A;  4OMA A;  2D63 A;  2AY5 A;  4R8D A;  5LHA A;  1ARG A;  1GDE A;  3WCN A;  5D5S A;  1WYU A;  2D61 A;  2DGL A;  1IX7 A;  1WYT B;  3L44 A;  1UKJ A;  3ZZJ A;  1KMJ A;  1Z3Z A;  3TFU A;  2YCN A;  3VP6 A;  3DYD A;  1CZC A;  1V2F A;  3EZS A;  3GWP A;  3M5U A;  1CL1 A;  3LG0 A;  4PFF A;  5EUN A;  3E9K A;  3PJ0 A;  1ART A;  3ELP A;  1FG3 A;  2D7Z A;  4EU1 A;  1E5F A;  4O6Z A;  3FVX A;  3GR9 A;  4JE5 D;  1J32 A;  2VGS A;  1D7R A;  3HLM A;  2BKW A;  4W8I A;  4F5K A;  2R0T A;  3AEL A;  3RUY A;  1C4K A;  2CJH A;  3GET A;  4U2H A;  4ADE A;  1AY4 A;  5DX5 A;  1WST A;  1O61 A;  2V0Y A;  3DZZ A;  3HDO A;  4ZAS A;  1AY8 A;  1PG8 A;  2BI9 A;  1V2E A;  1AMA A;  1QIS A;  1M0O A;  1AKB A;  2CH2 A;  4M2M A;  2PB0 A;  3KKI A;  9AAT A;  2W8J A;  2E7I A;  2OGA A;  3GJU A;  1M0N A;  1GC2 A;  1WYV B;  1ZOB A;  3FQ7 A;  2WKA A;  1JS3 A;  3K7Y A;  4LW4 A;  5FT6 A;  1BQD A;  4AO9 A;  2YRI A;  2VMU A;  2VI8 A;  2VLH A;  1UU0 A;  2BI5 A;  3ACZ A;  2Z1Y A;  2HP2 A;  1MAP A;  4A0H A;  1GBN A;  5F8V A;  3TCM A;  2VMP A;  1ARH A;  1YIY A;  1BJO B;  2OKK A;  4RJ0 A;  1KMK A;  1IAX A;  2W7L A;  4ADD A;  5M4D A;  4AZK A;  2AY1 A;  3AEJ C;  1AHE A;  1DFO A;  1I43 A;  1V72 A;  2JJE A;  4OYT A;  3AEP A;  3CQ6 A;  2X3L A;  2VGZ A;  1LC7 A;  4JEZ A;  4M2K A;  3DXW A;  3AEO A;  4BQ0 A;  3AEM C;  3DXV A;  1LW4 A;  3OKS A;  3IHJ A;  3WGB A;  4ZM3 A;  1D7V A;  3II0 A;  2AAT A;  3CQ4 A;  5EAV A;  1C9C A;  1KKJ A;  4XJP A;  5IWQ A;  5E4Z A;  4IYO B;  4F4E A;  1MDO A;  1I29 A;  1DJE A;  2GMS A;  3JWA A;  1G7W A;  4LC3 A;  3DOD A;  5LH9 A;  1DGE A;  1AIB A;  1TOI A;  5EIG A;  4WBT A;  3RI6 A;  1D2F A;  1S07 A;  3BWN C;  2DGK A;  3HMU A;  3NRA A;  3FQ8 A;  4E1O A;  2VMT A;  4RIT A;  2BI2 A;  1I48 A;  1B9H A;  1TPL A;  2JGT A;  2WK9 A;  2YKX A;  3AEN A;  5EUE A;  1YJS A;  1ASB A;  3F0H A;  4RKC A;  2W7G A;  1ASF A;  4M2J A;  4GRX A;  3VK3 A;  1VP4 A;  1TOJ A;  2ZY4 A;  1D7S A;  3LY1 A;  1C7O A;  2W7E A;  2R2N A;  1CQ6 A;  3I4J A;  1AJS A;  2CB1 A;  3PDB B;  1JG8 A;  3G7Q A;  2W8W A;  3ISL A;  2ZY3 A;  2C44 A;  1SFF A;  2GB3 A;  1T3I A;  3ELE A;  3I16 A;  3GZD C;  1ASL A;  1N2T A;  1Z7D A;  2VMZ A;  3GBX A;  1SZS A;  4HVK A;  2Z61 A;  1M6S A;  2VGW A;  2Z9U A;  4RIZ A;  3VAX A;  1KKP A;  1ASM A;  3A9Z A;  4UHM A;  4WXG A;  1SF2 A;  2HOR A;  1Y4I A;  4WYG A;  5I92 A;  4WB0 B;  3B1D A;  2RFV A;  4WYE A;  2BWP A;  1IX8 A;  2HUI A;  2JIS A;  4K2B A;  4U1T A;  4Y0H A;  4GE7 A;  4LNJ A;  4LNM A;  1OAT A;  2YCT A;  4XJM A;  2YRR A;  2W8V A;  1X2A A;  2W8T A;  3P1T A;  4IXS A;  1ARS A;  2JJF A;  3BCX A;  2D5Y A;  2YKV A;  4XAU A;  2VMQ A;  3WY7 A;  5HXX A;  3QPG A;  4ATP A;  3ZZK A;  3F6T A;  3A2B A;  4DBC A;  5EUD A;  4BA4 A;  1IUG A;  1KL1 A;  2OQX A;  1W3U A;  4J5U A;  1XI9 A;  2DKB A;  4AH3 A;  1O4S A;  5HDM A;  2W7F A;  3JU7 A;  1M7Y A;  1ECX A;  1TOK A;  3LVL B;  4IX8 A;  4K2M A;  5F9S A;  1U08 A;  2YCP A;  1G7X A;  4MQQ A;  5G0A A;  4E77 A;  1W23 A;  3RCH A;  4PFN A;  2VMR A;  4W1X A;  1W7L A;  4K2I A;  3ASB A;  4ZWV A;  4TV7 A;  4CBS A;  4CXR A;  2C0R A;  3QI6 A;  4WLJ A;  2PB2 A;  4BA5 A;  4P3M A;  4ZDL A;  3PD6 A;  2VIB A;  1RVY A;  3DR4 A;  2BYJ A;  2VMN A;  3E6G A;  1IX6 A;  1YIZ A;  1H0C A;  1CS1 A;  5JAY A;  1C0N A;  1UU2 A;  2W8U A;  3G0T A;  3EZ1 A;  4XK1 A;  4F5M A;  1M32 A;  4WD2 A;  4TN4 A;  4RJY A;  2WK7 A;  2XBN A;  3ZRQ A;  2BHX A;  1MLZ A;  2EO5 A;  4F5I A;  1PMM A;  3LVM A;  3UWC A;  4UHN A;  1B9I A;  4N0W A;  5DJ1 A;  3EIA A;  4ZSY A;  4ZAH A;  3NUB A;  1N8P A;  5G2Q A;  2AY3 A;  1ASC A;  2NMP A;  1OXO A;  2R5C A;  3LVK A;  5DJ9 A;  5DB5 A;  2FYF A;  4JF0 A;  1SZU A;  1CQ7 A;  4F5H A;  2PO3 A;  2YKY A;  4WXF A;  1MLY A;  4ISY A;  1ASN A;  1FG7 A;  2VIA A;  1LC5 A;  3PA9 A;  3BS8 A;  1X28 A;  5EAA A;  1RV3 A;  1W7M A;  4E3R A;  4RAE A;  4A0F A;  1DKA A;  2W7K A;  4F5J A;  5EIG B;  2HOX A;  3BB8 A;  3KGW A;  4ADC A;  1ASE A;  1QJ5 A;  2HUU A;  2JG2 A;  3JTX A;  4XQ2 A;  3MKJ A;  4A72 A;  1IVR A;  1IJI A;  4CVQ A;  3HT4 A;  3LWS A;  3L8A A;  4ZLV A;  2AY7 A;  1G4V A;  3AEN B;  3CAI A;  3NTJ A;  5C6U A;  1IAY A;  1YJY A;  3NYT A;  3I5T A;  4WXB A;  2W7H A;  4EMY A;  3BWO A;  1CL2 A;  1QIT A;  1B5O A;  2BWO A;  5E3K A;  1UU1 A;  4RLG A;  3K28 A;  3FVS A;  1N31 A;  4B98 A;  1AJS B;  5BJ3 A;  1ZC9 A;  3PDX A;  1TAR A;  4GDY A;  3MAF A;  3G8M A;  2Z1Z A;  4AO4 A;  2ZP7 A;  1BJN A;  2W7J A;  3FQA A;  5G4J A;  1WYT A;  1J04 A;  1ZOD A;  3MEB A;  3K40 A;  1B4X A;  4W1W A;  3Q8N A;  1S06 A;  4ZWM A;  2E7J A;  3NDN A;  2F8J A;  1AMQ A;  2BIG A;  3BC8 A;  3ZRR A;  1TAT A;  4WYD A;  1QJ3 A;  3R9A A;  4B9B A;  3B46 A;  3JW9 A;  2AY8 A;  4Y0D A;  2EPJ A;  1X0M A;  2C7T A;  3MAD A;  4N0B A;  2AEV A;  1KL2 A;  3EI9 A;  4QGR A;  4UOY A;  3WKR A;  3TFT A;  5M46 A;  4XJO A;  1GEW A;  4UQV A;  4H51 A;  5BJ4 A;  1XEY A;  3AV7 A;  2O7C A;  3ATH A;  1WYV A;  2GMU A;  3FVU A;  2AY9 A;  3WZF A;  3FD0 A;  8AAT A;  2C81 A;  2D7Y A;  2XH1 A;  2CJG A;  1VEF A;  4WYF A;  3RCH B;  3KGX A;  2DR1 A;  1MGV A;  3MC6 A;  1JS6 A;  5FT4 A;  2QLR A;  3A8U X;  4OBV A;  5TF5 A;  2HUF A;  3E77 A;  4L0O A;  4W5K A;  1CJ0 A;  1OHY A;  1PFF A;  3NU8 A;  1QGN A;  2Z67 A;  3MAU A;  1BJW A;  3RBL A;  3E2Z B;  1EG5 A;  4GSA A;  1C7N A;  5G09 A;  3E2F A;  1CZE A;  2FQ6 A;  3B1C A;  1D7U A;  1WYU B;  3QN6 A;  4GE4 A;  1M4N A;  4MY5 A;  3AEJ A;  4AZJ A;  3NYU A;  1QIR A;  2FNI A;  2ZC0 A;  1DJ9 A;  3N5M A;  1CQ8 A;  1BT4 A;  5EQC A;  1YNU A;  2ZSL A;  4A0G A;  1ASA A;  3R4T A;  4IYO A;  4Q6R A;  4EFF A;  2R5E A;  1BW0 A;  3NU7 A;  2EZ1 A;  3QGU A;  4IY7 A;  1I41 A;  2AEU A;  4GEB A;  5E5I A;  3H14 A;  2DGM A;  1AIC A;  2Q7W A;  2X8U A;  4JE5 A;  3BWN A;  2ZJG A;  3PAA A;  1MDZ A;  3AAT A;  4OT8 A;  4ZSW A;  3VK4 A;  3WLX A;  2O0R A;  1LK9 A;  2CIN A;  5FT5 A;  3RQ1 A;  1MDX A;  4OC9 A;  3LV2 A;  5D95 A;  5EFS A;  3FCR A;  2VMO A;  3NNK A;  4JF1 A;  1ELU A;  2E7U A;  4LW2 A;  2BI3 A;  2D64 A;  2ZYJ A;  1YJZ A;  3A9Y A;  4XEW A;  1EJI A;  3COG A;  3TQX A;  2G6W A;  1MAQ A;  3PPL A;  1GEY A;  1OXP A;  2HZP A;  4MQR A;  3PDB A;  1OHW A;  2QBT A;  4GE9 A;  3GSB A;  3VOM A;  3FDD A;  4ADB A;  2GQN A;  2CY8 A;  2VGT A;  4AOA A;  4A0R A;  3GZD A;  3BN1 A;  1SPA A;  3H7F A;  2VMY A;  5HHY A;  2W7M A;  4IXO A;  3EI5 A;  1DGD A;  3ASA A;  2TPL A;  3HVY A;  3W1J A;  3OP7 A;  2OKJ A;  2D65 A;  4DQ6 A;  1AKA A;  2VMW A;  2AY6 A;  3MAF B;  4JEX A;  3TAT A;  5M4B A;  1M0P A;  3F9T A;  2HOZ A;  2OGE A;  2Z9W A;  4E3Q A;  1ELQ A;  4KYO A;  3HL2 A;  3WX9 A;  3JZL A;  4TMR A;  2CST A;  2ZSM A;  3HQT A;  4FFC A;  4IXZ A;  1SZK A;  4JEY A;  2DOU A;  5K8B A;  1AX4 A;  4HF8 A;  3ECD A;  4IW7 A;  4J8L A;  4PVF A;  3RBF A;  2OAT A;  2O1B A;  3USF A;  1BQA A;  3FZ7 A;  2Z9X A;  4OTL A;  4WYC A;  2DKJ A;  1AY5 A;  1ASD A;  4W91 A;  3FKD A;  3T32 A;  3PGY A;  3VK2 A;  4MKJ A;  3FDB A;  1RVU A;  3DU4 A;  2CFB A;  3JWB A;  1AHX A;  1S0A A;  3EI8 A;  3D6K A;  4WP0 A;  1O69 A;  4CBR A;  3LVJ A;  3CBF A;  2CH1 A;  2V1P A;  1OHV A;  4ZDP A;  4A6T A;  1AJR A;  3MC6 C;  1AHY A;  3BCB A;  3KE3 A;  2QB3 A;  2VGU A;  2AY4 A;  2CAN A;  2HP1 A;  5G4I A;  4OBU A;  1WKH A;  2BIE A;  4F5F A;  2VLF A;  2ZUK A;  3WKS A;  2BIA A;  2Z20 A;  3IF2 A;  5FT8 A;  2GSA A;  2VMV A;  2BI1 A;  5G2P A;  4A00 A;  4R2N A;  3FZ8 A;  3DRD A;  1TOG A;  4F5G A;  1C7G A;  1G4X A;  1AIA A;  2JJH A;  5M49 A;  4A6R A;  4EB5 A;  4RKD A;  3DR7 A;  1BKG A;  2QMA A;  2VMX A;  3EI7 A;  2BYL A;  2EZ2 A;  4Q31 A;  4Q76 A;  3N75 A;  4JEV A;  4EB7 A;  4ZDO A;  2AY2 A;  2ORD A;  1GCK A;  4KXK A;  4P7Y A;  2FNU A;  1LS3 A;  4R5Z A;  3UAK A;  4MQP A;  2CJD A;  4XJL A; 
#chains in the Genus database with same CATH topology
 2ZY5 A;  7AAT A;  1LC8 A;  3W1H A;  2YKU A;  3NUI A;  4DGT A;  1DJU A;  1E5E A;  2YOB A;  3GZC A;  3N0L A;  4BHD A;  2A1V A;  3FTB A;  2QB2 A;  4WYA A;  1X29 A;  1S08 A;  2E54 A;  3N7N A;  4OCA A;  4ZM4 A;  1TOE A;  3QBO A;  4UHO A;  3H9X A;  2QSR A;  3DC1 A;  1YOO A;  4MGR A;  2X5F A;  3PD6 B;  1BJO A;  1IBJ A;  3PIU A;  4F5L A;  2X5D A;  2VYC A;  3AOV A;  1BS0 A;  1O62 A;  1SVV A;  2Z9V A;  2W7D A;  3EI6 A;  2EH6 A;  3UE8 A;  2QA3 A;  3NX3 A;  3FSL A;  1GD9 A;  4JEW A;  3FRK A;  4MKK A;  1ORD A;  1AMR A;  3WGC A;  1V2D A;  3AEM A;  4I8A A;  2D66 A;  4W1V A;  1AHG A;  1LW5 A;  3B1E A;  3P6K A;  1JF9 A;  1RV4 A;  2VGV A;  3A9X A;  3HBX A;  2R5C B;  1P3W A;  4Q75 A;  4PIW A;  3FZ6 A;  2HOY A;  1VJO A;  2FM1 A;  4KAM A;  2JJG A;  1W7N A;  1B8G A;  1LKC A;  2VI9 A;  2VMS A;  4BMK A;  5KTB A;  3E2Y A;  4MSO A;  1B5P A;  4RM1 A;  1S09 A;  5J8Q A;  3EIB A;  4CXQ A;  4ITX A;  1AMS A;  4ATQ A;  1AKC A;  1M0Q A;  4WLH A;  3QM2 A;  3MBB A;  3ZRP A;  3BV0 A;  3AOW A;  1GEX A;  1BJ4 A;  2WK8 A;  4Y0I A;  1QZ9 A;  4ITG A;  1GC0 A;  1AAM A;  3B8X A;  3W1I A;  4R5F A;  1H1C A;  4K05 A;  2ZY2 A;  5AX8 A;  2CTZ A;  3FFH A;  1ARI A;  3EUC A;  3CQ5 A;  1EQB A;  3NYS A;  2FN6 A;  1YAA A;  4LNL A;  1PMO A;  1TAS A;  1DTY A;  1GC3 A;  3QHX A;  1WKG A;  2EGY A;  4NOG A;  2BWN A;  3WCO A;  4H63 Q;  1GC4 A;  4FL0 A;  2YHK A;  4A6U A;  3FFR A;  4WB0 A;  2W7I A;  1ASG A;  1FC4 A;  1AHF A;  3BCA A;  3E2Z A;  1AAW A;  4OMA A;  2D63 A;  2AY5 A;  4R8D A;  5LHA A;  1ARG A;  1GDE A;  3WCN A;  5D5S A;  1WYU A;  2D61 A;  2DGL A;  1IX7 A;  1WYT B;  3L44 A;  1UKJ A;  3ZZJ A;  1KMJ A;  1Z3Z A;  3TFU A;  2YCN A;  3VP6 A;  3DYD A;  1CZC A;  1V2F A;  3EZS A;  3GWP A;  3M5U A;  1CL1 A;  3LG0 A;  4PFF A;  5EUN A;  3E9K A;  3PJ0 A;  1ART A;  3ELP A;  1FG3 A;  2D7Z A;  4EU1 A;  1E5F A;  4O6Z A;  3FVX A;  3GR9 A;  4JE5 D;  1J32 A;  2VGS A;  1D7R A;  3HLM A;  2BKW A;  4W8I A;  4F5K A;  2R0T A;  3AEL A;  3RUY A;  1C4K A;  2CJH A;  3GET A;  4U2H A;  4ADE A;  1AY4 A;  5DX5 A;  1WST A;  1O61 A;  2V0Y A;  3DZZ A;  3HDO A;  4ZAS A;  1AY8 A;  1PG8 A;  2BI9 A;  1V2E A;  1AMA A;  1QIS A;  1M0O A;  1AKB A;  2CH2 A;  4M2M A;  2PB0 A;  3KKI A;  9AAT A;  2W8J A;  2E7I A;  2OGA A;  3GJU A;  1M0N A;  1GC2 A;  1WYV B;  1ZOB A;  3FQ7 A;  2WKA A;  1JS3 A;  3K7Y A;  4LW4 A;  5FT6 A;  1BQD A;  4AO9 A;  2YRI A;  2VMU A;  2VI8 A;  2VLH A;  1UU0 A;  2BI5 A;  3ACZ A;  2Z1Y A;  2HP2 A;  1MAP A;  4A0H A;  1GBN A;  5F8V A;  3TCM A;  2VMP A;  1ARH A;  1YIY A;  1BJO B;  2OKK A;  4RJ0 A;  1KMK A;  1IAX A;  2W7L A;  4ADD A;  5M4D A;  4AZK A;  2AY1 A;  3AEJ C;  1AHE A;  1DFO A;  1I43 A;  1V72 A;  2JJE A;  4OYT A;  3AEP A;  3CQ6 A;  2X3L A;  2VGZ A;  1LC7 A;  4JEZ A;  4M2K A;  3DXW A;  3AEO A;  4BQ0 A;  3N4S A;  3AEM C;  3DXV A;  1LW4 A;  3OKS A;  3IHJ A;  3WGB A;  4ZM3 A;  1D7V A;  3II0 A;  2AAT A;  3CQ4 A;  5EAV A;  1C9C A;  1KKJ A;  4XJP A;  5IWQ A;  5E4Z A;  4IYO B;  4F4E A;  1MDO A;  1I29 A;  1DJE A;  2GMS A;  3JWA A;  1G7W A;  4LC3 A;  3DOD A;  5LH9 A;  1DGE A;  1AIB A;  1TOI A;  5EIG A;  4WBT A;  3RI6 A;  1D2F A;  1S07 A;  3BWN C;  2DGK A;  3HMU A;  3NRA A;  3FQ8 A;  4E1O A;  2VMT A;  4RIT A;  2BI2 A;  1I48 A;  1B9H A;  1TPL A;  2JGT A;  2WK9 A;  2YKX A;  3AEN A;  5EUE A;  1YJS A;  1ASB A;  3F0H A;  4RKC A;  2W7G A;  1ASF A;  4M2J A;  4GRX A;  3VK3 A;  1VP4 A;  1TOJ A;  2ZY4 A;  1D7S A;  3LY1 A;  1C7O A;  2W7E A;  2R2N A;  1CQ6 A;  3I4J A;  1AJS A;  2CB1 A;  3PDB B;  1JG8 A;  3G7Q A;  2W8W A;  3ISL A;  2ZY3 A;  2C44 A;  1SFF A;  2GB3 A;  1T3I A;  3ELE A;  3I16 A;  3GZD C;  1ASL A;  1N2T A;  1Z7D A;  2VMZ A;  3GBX A;  1SZS A;  4HVK A;  2Z61 A;  1M6S A;  2VGW A;  2Z9U A;  4RIZ A;  3VAX A;  1KKP A;  1ASM A;  3A9Z A;  4UHM A;  4WXG A;  1SF2 A;  2HOR A;  1Y4I A;  4WYG A;  5I92 A;  4WB0 B;  3B1D A;  2RFV A;  4WYE A;  2BWP A;  1IX8 A;  2HUI A;  2JIS A;  4K2B A;  4U1T A;  4Y0H A;  2EYQ A;  4GE7 A;  4LNJ A;  4LNM A;  1OAT A;  2YCT A;  4XJM A;  2YRR A;  2W8V A;  1X2A A;  2W8T A;  3P1T A;  4IXS A;  1ARS A;  2JJF A;  3BCX A;  2D5Y A;  2YKV A;  4XAU A;  2VMQ A;  3WY7 A;  5HXX A;  3QPG A;  4ATP A;  3ZZK A;  3F6T A;  3A2B A;  4DBC A;  5EUD A;  4BA4 A;  1IUG A;  1KL1 A;  2OQX A;  1W3U A;  4J5U A;  1XI9 A;  2DKB A;  4AH3 A;  1O4S A;  5HDM A;  2W7F A;  3JU7 A;  1M7Y A;  1ECX A;  1TOK A;  3LVL B;  4IX8 A;  4K2M A;  5F9S A;  1U08 A;  2YCP A;  1G7X A;  4MQQ A;  5G0A A;  4E77 A;  1W23 A;  3RCH A;  4PFN A;  2VMR A;  4W1X A;  1W7L A;  4K2I A;  3ASB A;  4ZWV A;  4TV7 A;  4CBS A;  4CXR A;  2C0R A;  3QI6 A;  4WLJ A;  2PB2 A;  4BA5 A;  4P3M A;  4ZDL A;  3PD6 A;  2VIB A;  1RVY A;  3DR4 A;  2BYJ A;  2VMN A;  3E6G A;  1IX6 A;  1YIZ A;  1H0C A;  1CS1 A;  5JAY A;  1C0N A;  1UU2 A;  2W8U A;  3G0T A;  3EZ1 A;  2KFP A;  4XK1 A;  4F5M A;  1M32 A;  4WD2 A;  4TN4 A;  4RJY A;  2WK7 A;  2XBN A;  3ZRQ A;  2BHX A;  1MLZ A;  2EO5 A;  4F5I A;  1PMM A;  3LVM A;  3UWC A;  4UHN A;  1B9I A;  4N0W A;  5DJ1 A;  3EIA A;  4ZSY A;  4ZAH A;  3NUB A;  1N8P A;  5G2Q A;  2AY3 A;  1ASC A;  2NMP A;  1OXO A;  2R5C A;  3LVK A;  5DJ9 A;  5DB5 A;  2FYF A;  4JF0 A;  2WB6 A;  1SZU A;  1CQ7 A;  4F5H A;  2PO3 A;  2YKY A;  4WXF A;  1MLY A;  4ISY A;  1ASN A;  1FG7 A;  2VIA A;  1LC5 A;  3PA9 A;  3BS8 A;  1X28 A;  5EAA A;  1RV3 A;  1W7M A;  4E3R A;  4RAE A;  4A0F A;  1DKA A;  2W7K A;  4F5J A;  5EIG B;  2HOX A;  3BB8 A;  3KGW A;  4ADC A;  1ASE A;  1QJ5 A;  2HUU A;  2JG2 A;  3JTX A;  4XQ2 A;  3MKJ A;  4A72 A;  1IVR A;  1IJI A;  4CVQ A;  3HT4 A;  3LWS A;  3L8A A;  4ZLV A;  2AY7 A;  1G4V A;  3AEN B;  3CAI A;  3NTJ A;  5C6U A;  1IAY A;  1YJY A;  3NYT A;  3I5T A;  4WXB A;  2W7H A;  4EMY A;  3BWO A;  1CL2 A;  1QIT A;  1B5O A;  2BWO A;  5E3K A;  1UU1 A;  4RLG A;  3K28 A;  3FVS A;  1N31 A;  4B98 A;  1AJS B;  5BJ3 A;  1ZC9 A;  3PDX A;  1TAR A;  4GDY A;  3MAF A;  3G8M A;  2Z1Z A;  4AO4 A;  2ZP7 A;  1BJN A;  2W7J A;  3FQA A;  5G4J A;  1WYT A;  1J04 A;  1ZOD A;  3MEB A;  3K40 A;  1KAF A;  1B4X A;  4W1W A;  3Q8N A;  1S06 A;  4ZWM A;  2E7J A;  3NDN A;  2F8J A;  1AMQ A;  2BIG A;  3BC8 A;  3ZRR A;  1TAT A;  4WYD A;  1QJ3 A;  3R9A A;  4B9B A;  3B46 A;  3JW9 A;  2AY8 A;  4Y0D A;  2EPJ A;  1X0M A;  2C7T A;  3MAD A;  4N0B A;  2AEV A;  1KL2 A;  3EI9 A;  4QGR A;  4UOY A;  3WKR A;  3TFT A;  5M46 A;  4XJO A;  1GEW A;  4UQV A;  4H51 A;  5BJ4 A;  1XEY A;  3AV7 A;  2O7C A;  3ATH A;  1WYV A;  2GMU A;  3FVU A;  2AY9 A;  3WZF A;  3FD0 A;  8AAT A;  2C81 A;  2D7Y A;  2XH1 A;  2CJG A;  1VEF A;  4WYF A;  3RCH B;  3KGX A;  2DR1 A;  1MGV A;  3MC6 A;  1JS6 A;  5FT4 A;  2QLR A;  3A8U X;  4OBV A;  5TF5 A;  2HUF A;  3E77 A;  4L0O A;  4W5K A;  1CJ0 A;  1OHY A;  1PFF A;  3NU8 A;  1QGN A;  2Z67 A;  3MAU A;  1BJW A;  3RBL A;  3E2Z B;  1EG5 A;  4GSA A;  1C7N A;  5G09 A;  3E2F A;  1CZE A;  2FQ6 A;  3B1C A;  1D7U A;  1WYU B;  3QN6 A;  4GE4 A;  1M4N A;  4MY5 A;  3AEJ A;  4AZJ A;  3NYU A;  1QIR A;  2FNI A;  2ZC0 A;  1DJ9 A;  3N5M A;  1CQ8 A;  1BT4 A;  5EQC A;  1YNU A;  2ZSL A;  4A0G A;  1ASA A;  3R4T A;  4IYO A;  4Q6R A;  4EFF A;  2R5E A;  1BW0 A;  3NU7 A;  2EZ1 A;  3QGU A;  4IY7 A;  1I41 A;  2AEU A;  4GEB A;  5E5I A;  3H14 A;  2DGM A;  1AIC A;  2Q7W A;  2X8U A;  4JE5 A;  3BWN A;  2ZJG A;  3PAA A;  1MDZ A;  3AAT A;  4OT8 A;  4ZSW A;  3VK4 A;  3WLX A;  2O0R A;  1LK9 A;  2CIN A;  5FT5 A;  3RQ1 A;  1MDX A;  4OC9 A;  3LV2 A;  5D95 A;  5EFS A;  3FCR A;  2VMO A;  3NNK A;  4JF1 A;  1ELU A;  2E7U A;  4LW2 A;  2BI3 A;  2D64 A;  2ZYJ A;  1YJZ A;  3A9Y A;  4XEW A;  1EJI A;  3COG A;  3TQX A;  2G6W A;  1MAQ A;  3PPL A;  1GEY A;  1OXP A;  2HZP A;  4MQR A;  3PDB A;  1OHW A;  2G7J A;  2QBT A;  4GE9 A;  3GSB A;  3VOM A;  3FDD A;  4ADB A;  3N4X A;  2GQN A;  2CY8 A;  2VGT A;  4AOA A;  4A0R A;  3GZD A;  3BN1 A;  1SPA A;  3H7F A;  2VMY A;  5HHY A;  2W7M A;  4IXO A;  3EI5 A;  1DGD A;  3ASA A;  2TPL A;  3HVY A;  3W1J A;  3OP7 A;  2OKJ A;  2D65 A;  4DQ6 A;  1AKA A;  2VMW A;  2AY6 A;  3MAF B;  4JEX A;  3TAT A;  5M4B A;  1M0P A;  3F9T A;  2HOZ A;  2OGE A;  2Z9W A;  4E3Q A;  1ELQ A;  4KYO A;  3HL2 A;  3WX9 A;  3JZL A;  4TMR A;  2CST A;  2ZSM A;  3HQT A;  4FFC A;  4IXZ A;  1SZK A;  4JEY A;  2DOU A;  5K8B A;  1AX4 A;  4HF8 A;  3ECD A;  4IW7 A;  4J8L A;  4PVF A;  3RBF A;  2OAT A;  2O1B A;  3USF A;  1BQA A;  3FZ7 A;  2Z9X A;  4OTL A;  4WYC A;  2DKJ A;  1AY5 A;  1ASD A;  4W91 A;  3FKD A;  3T32 A;  3PGY A;  3VK2 A;  4MKJ A;  3FDB A;  1RVU A;  3DU4 A;  2CFB A;  3JWB A;  1AHX A;  1S0A A;  3EI8 A;  3D6K A;  4WP0 A;  1O69 A;  4CBR A;  3LVJ A;  3CBF A;  2CH1 A;  2V1P A;  1OHV A;  4ZDP A;  4A6T A;  1AJR A;  3MC6 C;  1AHY A;  3BCB A;  3KE3 A;  3N4R A;  2QB3 A;  2VGU A;  2AY4 A;  2CAN A;  2HP1 A;  5G4I A;  4OBU A;  1WKH A;  2BIE A;  4F5F A;  2VLF A;  2ZUK A;  3WKS A;  2BIA A;  2Z20 A;  3IF2 A;  5FT8 A;  2GSA A;  2VMV A;  2BI1 A;  5G2P A;  4A00 A;  4R2N A;  3FZ8 A;  3DRD A;  1TOG A;  4F5G A;  1C7G A;  1G4X A;  1AIA A;  2JJH A;  5M49 A;  4A6R A;  4EB5 A;  4RKD A;  3DR7 A;  1BKG A;  2QMA A;  2VMX A;  3EI7 A;  2BYL A;  2EZ2 A;  4Q31 A;  4Q76 A;  3N75 A;  4JEV A;  4EB7 A;  4ZDO A;  2AY2 A;  2ORD A;  1GCK A;  4KXK A;  4P7Y A;  2FNU A;  1LS3 A;  4R5Z A;  3UAK A;  4MQP A;  2CJD A;  4XJL A;  2FKI A; 
#chains in the Genus database with same CATH homology
 2ZY5 A;  7AAT A;  1LC8 A;  3W1H A;  2YKU A;  3NUI A;  4DGT A;  1DJU A;  1E5E A;  2YOB A;  3GZC A;  3N0L A;  4BHD A;  2A1V A;  3FTB A;  2QB2 A;  4WYA A;  1X29 A;  1S08 A;  2E54 A;  3N7N A;  4OCA A;  4ZM4 A;  1TOE A;  3QBO A;  4UHO A;  3H9X A;  2QSR A;  3DC1 A;  1YOO A;  4MGR A;  2X5F A;  3PD6 B;  1BJO A;  1IBJ A;  3PIU A;  4F5L A;  2X5D A;  2VYC A;  3AOV A;  1BS0 A;  1O62 A;  1SVV A;  2Z9V A;  2W7D A;  3EI6 A;  2EH6 A;  3UE8 A;  2QA3 A;  3NX3 A;  3FSL A;  1GD9 A;  4JEW A;  3FRK A;  4MKK A;  1ORD A;  1AMR A;  3WGC A;  1V2D A;  3AEM A;  4I8A A;  2D66 A;  4W1V A;  1AHG A;  1LW5 A;  3B1E A;  3P6K A;  1JF9 A;  1RV4 A;  2VGV A;  3A9X A;  3HBX A;  2R5C B;  1P3W A;  4Q75 A;  4PIW A;  3FZ6 A;  2HOY A;  1VJO A;  2FM1 A;  4KAM A;  2JJG A;  1W7N A;  1B8G A;  1LKC A;  2VI9 A;  2VMS A;  4BMK A;  5KTB A;  3E2Y A;  4MSO A;  1B5P A;  4RM1 A;  1S09 A;  5J8Q A;  3EIB A;  4CXQ A;  4ITX A;  1AMS A;  4ATQ A;  1AKC A;  1M0Q A;  4WLH A;  3QM2 A;  3MBB A;  3ZRP A;  3BV0 A;  3AOW A;  1GEX A;  1BJ4 A;  2WK8 A;  4Y0I A;  1QZ9 A;  4ITG A;  1GC0 A;  1AAM A;  3B8X A;  3W1I A;  4R5F A;  1H1C A;  4K05 A;  2ZY2 A;  5AX8 A;  2CTZ A;  3FFH A;  1ARI A;  3EUC A;  3CQ5 A;  1EQB A;  3NYS A;  2FN6 A;  1YAA A;  4LNL A;  1PMO A;  1TAS A;  1DTY A;  1GC3 A;  3QHX A;  1WKG A;  2EGY A;  4NOG A;  2BWN A;  3WCO A;  4H63 Q;  1GC4 A;  4FL0 A;  2YHK A;  4A6U A;  3FFR A;  4WB0 A;  2W7I A;  1ASG A;  1FC4 A;  1AHF A;  3BCA A;  3E2Z A;  1AAW A;  4OMA A;  2D63 A;  2AY5 A;  4R8D A;  5LHA A;  1ARG A;  1GDE A;  3WCN A;  5D5S A;  1WYU A;  2D61 A;  2DGL A;  1IX7 A;  1WYT B;  3L44 A;  1UKJ A;  3ZZJ A;  1KMJ A;  1Z3Z A;  3TFU A;  2YCN A;  3VP6 A;  3DYD A;  1CZC A;  1V2F A;  3EZS A;  3GWP A;  3M5U A;  1CL1 A;  3LG0 A;  4PFF A;  5EUN A;  3E9K A;  3PJ0 A;  1ART A;  3ELP A;  1FG3 A;  2D7Z A;  4EU1 A;  1E5F A;  4O6Z A;  3FVX A;  3GR9 A;  4JE5 D;  1J32 A;  2VGS A;  1D7R A;  3HLM A;  2BKW A;  4W8I A;  4F5K A;  2R0T A;  3AEL A;  3RUY A;  1C4K A;  2CJH A;  3GET A;  4U2H A;  4ADE A;  1AY4 A;  5DX5 A;  1WST A;  1O61 A;  2V0Y A;  3DZZ A;  3HDO A;  4ZAS A;  1AY8 A;  1PG8 A;  2BI9 A;  1V2E A;  1AMA A;  1QIS A;  1M0O A;  1AKB A;  2CH2 A;  4M2M A;  2PB0 A;  3KKI A;  9AAT A;  2W8J A;  2E7I A;  2OGA A;  3GJU A;  1M0N A;  1GC2 A;  1WYV B;  1ZOB A;  3FQ7 A;  2WKA A;  1JS3 A;  3K7Y A;  4LW4 A;  5FT6 A;  1BQD A;  4AO9 A;  2YRI A;  2VMU A;  2VI8 A;  2VLH A;  1UU0 A;  2BI5 A;  3ACZ A;  2Z1Y A;  2HP2 A;  1MAP A;  4A0H A;  1GBN A;  5F8V A;  3TCM A;  2VMP A;  1ARH A;  1YIY A;  1BJO B;  2OKK A;  4RJ0 A;  1KMK A;  1IAX A;  2W7L A;  4ADD A;  5M4D A;  4AZK A;  2AY1 A;  3AEJ C;  1AHE A;  1DFO A;  1I43 A;  1V72 A;  2JJE A;  4OYT A;  3AEP A;  3CQ6 A;  2X3L A;  2VGZ A;  1LC7 A;  4JEZ A;  4M2K A;  3DXW A;  3AEO A;  4BQ0 A;  3N4S A;  3AEM C;  3DXV A;  1LW4 A;  3OKS A;  3IHJ A;  3WGB A;  4ZM3 A;  1D7V A;  3II0 A;  2AAT A;  3CQ4 A;  5EAV A;  1C9C A;  1KKJ A;  4XJP A;  5IWQ A;  5E4Z A;  4IYO B;  4F4E A;  1MDO A;  1I29 A;  1DJE A;  2GMS A;  3JWA A;  1G7W A;  4LC3 A;  3DOD A;  5LH9 A;  1DGE A;  1AIB A;  1TOI A;  5EIG A;  4WBT A;  3RI6 A;  1D2F A;  1S07 A;  3BWN C;  2DGK A;  3HMU A;  3NRA A;  3FQ8 A;  4E1O A;  2VMT A;  4RIT A;  2BI2 A;  1I48 A;  1B9H A;  1TPL A;  2JGT A;  2WK9 A;  2YKX A;  3AEN A;  5EUE A;  1YJS A;  1ASB A;  3F0H A;  4RKC A;  2W7G A;  1ASF A;  4M2J A;  4GRX A;  3VK3 A;  1VP4 A;  1TOJ A;  2ZY4 A;  1D7S A;  3LY1 A;  1C7O A;  2W7E A;  2R2N A;  1CQ6 A;  3I4J A;  1AJS A;  2CB1 A;  3PDB B;  1JG8 A;  3G7Q A;  2W8W A;  3ISL A;  2ZY3 A;  2C44 A;  1SFF A;  2GB3 A;  1T3I A;  3ELE A;  3I16 A;  3GZD C;  1ASL A;  1N2T A;  1Z7D A;  2VMZ A;  3GBX A;  1SZS A;  4HVK A;  2Z61 A;  1M6S A;  2VGW A;  2Z9U A;  4RIZ A;  3VAX A;  1KKP A;  1ASM A;  3A9Z A;  4UHM A;  4WXG A;  1SF2 A;  2HOR A;  1Y4I A;  4WYG A;  5I92 A;  4WB0 B;  3B1D A;  2RFV A;  4WYE A;  2BWP A;  1IX8 A;  2HUI A;  2JIS A;  4K2B A;  4U1T A;  4Y0H A;  2EYQ A;  4GE7 A;  4LNJ A;  4LNM A;  1OAT A;  2YCT A;  4XJM A;  2YRR A;  2W8V A;  1X2A A;  2W8T A;  3P1T A;  4IXS A;  1ARS A;  2JJF A;  3BCX A;  2D5Y A;  2YKV A;  4XAU A;  2VMQ A;  3WY7 A;  5HXX A;  3QPG A;  4ATP A;  3ZZK A;  3F6T A;  3A2B A;  4DBC A;  5EUD A;  4BA4 A;  1IUG A;  1KL1 A;  2OQX A;  1W3U A;  4J5U A;  1XI9 A;  2DKB A;  4AH3 A;  1O4S A;  5HDM A;  2W7F A;  3JU7 A;  1M7Y A;  1ECX A;  1TOK A;  3LVL B;  4IX8 A;  4K2M A;  5F9S A;  1U08 A;  2YCP A;  1G7X A;  4MQQ A;  5G0A A;  4E77 A;  1W23 A;  3RCH A;  4PFN A;  2VMR A;  4W1X A;  1W7L A;  4K2I A;  3ASB A;  4ZWV A;  4TV7 A;  4CBS A;  4CXR A;  2C0R A;  3QI6 A;  4WLJ A;  2PB2 A;  4BA5 A;  4P3M A;  4ZDL A;  3PD6 A;  2VIB A;  1RVY A;  3DR4 A;  2BYJ A;  2VMN A;  3E6G A;  1IX6 A;  1YIZ A;  1H0C A;  1CS1 A;  5JAY A;  1C0N A;  1UU2 A;  2W8U A;  3G0T A;  3EZ1 A;  2KFP A;  4XK1 A;  4F5M A;  1M32 A;  4WD2 A;  4TN4 A;  4RJY A;  2WK7 A;  2XBN A;  3ZRQ A;  2BHX A;  1MLZ A;  2EO5 A;  4F5I A;  1PMM A;  3LVM A;  3UWC A;  4UHN A;  1B9I A;  4N0W A;  5DJ1 A;  3EIA A;  4ZSY A;  4ZAH A;  3NUB A;  1N8P A;  5G2Q A;  2AY3 A;  1ASC A;  2NMP A;  1OXO A;  2R5C A;  3LVK A;  5DJ9 A;  5DB5 A;  2FYF A;  4JF0 A;  2WB6 A;  1SZU A;  1CQ7 A;  4F5H A;  2PO3 A;  2YKY A;  4WXF A;  1MLY A;  4ISY A;  1ASN A;  1FG7 A;  2VIA A;  1LC5 A;  3PA9 A;  3BS8 A;  1X28 A;  5EAA A;  1RV3 A;  1W7M A;  4E3R A;  4RAE A;  4A0F A;  1DKA A;  2W7K A;  4F5J A;  5EIG B;  2HOX A;  3BB8 A;  3KGW A;  4ADC A;  1ASE A;  1QJ5 A;  2HUU A;  2JG2 A;  3JTX A;  4XQ2 A;  3MKJ A;  4A72 A;  1IVR A;  1IJI A;  4CVQ A;  3HT4 A;  3LWS A;  3L8A A;  4ZLV A;  2AY7 A;  1G4V A;  3AEN B;  3CAI A;  3NTJ A;  5C6U A;  1IAY A;  1YJY A;  3NYT A;  3I5T A;  4WXB A;  2W7H A;  4EMY A;  3BWO A;  1CL2 A;  1QIT A;  1B5O A;  2BWO A;  5E3K A;  1UU1 A;  4RLG A;  3K28 A;  3FVS A;  1N31 A;  4B98 A;  1AJS B;  5BJ3 A;  1ZC9 A;  3PDX A;  1TAR A;  4GDY A;  3MAF A;  3G8M A;  2Z1Z A;  4AO4 A;  2ZP7 A;  1BJN A;  2W7J A;  3FQA A;  5G4J A;  1WYT A;  1J04 A;  1ZOD A;  3MEB A;  3K40 A;  1B4X A;  4W1W A;  3Q8N A;  1S06 A;  4ZWM A;  2E7J A;  3NDN A;  2F8J A;  1AMQ A;  2BIG A;  3BC8 A;  3ZRR A;  1TAT A;  4WYD A;  1QJ3 A;  3R9A A;  4B9B A;  3B46 A;  3JW9 A;  2AY8 A;  4Y0D A;  2EPJ A;  1X0M A;  2C7T A;  3MAD A;  4N0B A;  2AEV A;  1KL2 A;  3EI9 A;  4QGR A;  4UOY A;  3WKR A;  3TFT A;  5M46 A;  4XJO A;  1GEW A;  4UQV A;  4H51 A;  5BJ4 A;  1XEY A;  3AV7 A;  2O7C A;  3ATH A;  1WYV A;  2GMU A;  3FVU A;  2AY9 A;  3WZF A;  3FD0 A;  8AAT A;  2C81 A;  2D7Y A;  2XH1 A;  2CJG A;  1VEF A;  4WYF A;  3RCH B;  3KGX A;  2DR1 A;  1MGV A;  3MC6 A;  1JS6 A;  5FT4 A;  2QLR A;  3A8U X;  4OBV A;  5TF5 A;  2HUF A;  3E77 A;  4L0O A;  4W5K A;  1CJ0 A;  1OHY A;  1PFF A;  3NU8 A;  1QGN A;  2Z67 A;  3MAU A;  1BJW A;  3RBL A;  3E2Z B;  1EG5 A;  4GSA A;  1C7N A;  5G09 A;  3E2F A;  1CZE A;  2FQ6 A;  3B1C A;  1D7U A;  1WYU B;  3QN6 A;  4GE4 A;  1M4N A;  4MY5 A;  3AEJ A;  4AZJ A;  3NYU A;  1QIR A;  2FNI A;  2ZC0 A;  1DJ9 A;  3N5M A;  1CQ8 A;  1BT4 A;  5EQC A;  1YNU A;  2ZSL A;  4A0G A;  1ASA A;  3R4T A;  4IYO A;  4Q6R A;  4EFF A;  2R5E A;  1BW0 A;  3NU7 A;  2EZ1 A;  3QGU A;  4IY7 A;  1I41 A;  2AEU A;  4GEB A;  5E5I A;  3H14 A;  2DGM A;  1AIC A;  2Q7W A;  2X8U A;  4JE5 A;  3BWN A;  2ZJG A;  3PAA A;  1MDZ A;  3AAT A;  4OT8 A;  4ZSW A;  3VK4 A;  3WLX A;  2O0R A;  1LK9 A;  2CIN A;  5FT5 A;  3RQ1 A;  1MDX A;  4OC9 A;  3LV2 A;  5D95 A;  5EFS A;  3FCR A;  2VMO A;  3NNK A;  4JF1 A;  1ELU A;  2E7U A;  4LW2 A;  2BI3 A;  2D64 A;  2ZYJ A;  1YJZ A;  3A9Y A;  4XEW A;  1EJI A;  3COG A;  3TQX A;  2G6W A;  1MAQ A;  3PPL A;  1GEY A;  1OXP A;  2HZP A;  4MQR A;  3PDB A;  1OHW A;  2G7J A;  2QBT A;  4GE9 A;  3GSB A;  3VOM A;  3FDD A;  4ADB A;  3N4X A;  2GQN A;  2CY8 A;  2VGT A;  4AOA A;  4A0R A;  3GZD A;  3BN1 A;  1SPA A;  3H7F A;  2VMY A;  5HHY A;  2W7M A;  4IXO A;  3EI5 A;  1DGD A;  3ASA A;  2TPL A;  3HVY A;  3W1J A;  3OP7 A;  2OKJ A;  2D65 A;  4DQ6 A;  1AKA A;  2VMW A;  2AY6 A;  3MAF B;  4JEX A;  3TAT A;  5M4B A;  1M0P A;  3F9T A;  2HOZ A;  2OGE A;  2Z9W A;  4E3Q A;  1ELQ A;  4KYO A;  3HL2 A;  3WX9 A;  3JZL A;  4TMR A;  2CST A;  2ZSM A;  3HQT A;  4FFC A;  4IXZ A;  1SZK A;  4JEY A;  2DOU A;  5K8B A;  1AX4 A;  4HF8 A;  3ECD A;  4IW7 A;  4J8L A;  4PVF A;  3RBF A;  2OAT A;  2O1B A;  3USF A;  1BQA A;  3FZ7 A;  2Z9X A;  4OTL A;  4WYC A;  2DKJ A;  1AY5 A;  1ASD A;  4W91 A;  3FKD A;  3T32 A;  3PGY A;  3VK2 A;  4MKJ A;  3FDB A;  1RVU A;  3DU4 A;  2CFB A;  3JWB A;  1AHX A;  1S0A A;  3EI8 A;  3D6K A;  4WP0 A;  1O69 A;  4CBR A;  3LVJ A;  3CBF A;  2CH1 A;  2V1P A;  1OHV A;  4ZDP A;  4A6T A;  1AJR A;  3MC6 C;  1AHY A;  3BCB A;  3KE3 A;  3N4R A;  2QB3 A;  2VGU A;  2AY4 A;  2CAN A;  2HP1 A;  5G4I A;  4OBU A;  1WKH A;  2BIE A;  4F5F A;  2VLF A;  2ZUK A;  3WKS A;  2BIA A;  2Z20 A;  3IF2 A;  5FT8 A;  2GSA A;  2VMV A;  2BI1 A;  5G2P A;  4A00 A;  4R2N A;  3FZ8 A;  3DRD A;  1TOG A;  4F5G A;  1C7G A;  1G4X A;  1AIA A;  2JJH A;  5M49 A;  4A6R A;  4EB5 A;  4RKD A;  3DR7 A;  1BKG A;  2QMA A;  2VMX A;  3EI7 A;  2BYL A;  2EZ2 A;  4Q31 A;  4Q76 A;  3N75 A;  4JEV A;  4EB7 A;  4ZDO A;  2AY2 A;  2ORD A;  1GCK A;  4KXK A;  4P7Y A;  2FNU A;  1LS3 A;  4R5Z A;  3UAK A;  4MQP A;  2CJD A;  4XJL A;  2FKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...