1BJNA

Structure of phosphoserine aminotransferase from escherichia coli
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
360
structure length
359
Chain Sequence
QIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTILSRPIDVSRYGVIYAGAQNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKRNRSRMNVPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFERRHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Crystal structure of phosphoserine aminotransferase from Escherichia coli at 2.3 A resolution: comparison of the unligated enzyme and a complex with alpha-methyl-l-glutamate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminotransferase
total genus 119
structure length 359
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 1998-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1bjnA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1bjnA02
2BI2A 1O61A 1ZOBA 1I48A 3LVLB 4W1WA 2VI9A 2PO3A 3H7FA 4F5KA 1M0PA 3BCBA 1FG3A 2GMUA 5EIGA 3BCAA 4WD2A 1O62A 2AY6A 2BKWA 2YKYA 1ZODA 3F0HA 1SF2A 3BS8A 4L0OA 3FQ8A 2FQ6A 1AICA 2CFBA 4A72A 1C0NA 2DGLA 4A0GA 3RQ1A 1JS3A 1DGDA 4Q6RA 1KL2A 2RFVA 3EZ1A 3JWBA 3CQ5A 4WYFA 2W8TA 4LW2A 1AAWA 1PG8A 2X8UA 4PFFA 1YIZA 1BW0A 2R5CA 4JE5A 1G7WA 4UHMA 5IWQA 3ZRRA 4W91A 2JJFA 2BWPA 1BKGA 1VEFA 4A6UA 2VYCA 2F8JA 3NRAA 1GEXA 3W1JA 1CQ8A 3ACZA 3FVSA 3HL2A 1CS1A 1ECXA 5M46A 2VMSA 4O6ZA 3TFUA 1B9IA 1D2FA 3AEPA 3PD6B 4GE7A 2Q7WA 2VMZA 4Q75A 5F9SA 1MLYA 3RCHB 2HUIA 1QITA 3NU7A 4XAUA 5J8QA 1FC4A 4LNMA 3Q8NA 1M7YA 1DFOA 1EJIA 4GE4A 4MQRA 4OYTA 4IX8A 2C44A 1AMRA 2QB3A 4BQ0A 4B9BA 1TOIA 1JS6A 1AMAA 3ZZKA 3GZDC 4TV7A 1GEWA 1M32A 3FD0A 3E77A 4XJOA 4AO4A 1S06A 5HXXA 3GETA 2D7YA 2BI1A 2ZC0A 2VMVA 2DKBA 2D61A 3A9YA 5I92A 2ZYJA 4XEWA 4Y0IA 4XJPA 2VMTA 4EB7A 3AENB 4WYAA 1J04A 3RI6A 2PB0A 4LW4A 4AH3A 4W5KA 4MSOA 2W7JA 4HF8A 4WB0B 2VMQA 2VLHA 1IBJA 2D63A 3EI9A 1UKJA 4RLGA 4OBUA 2W7HA 1LW5A 4H51A 4DGTA 3JZLA 3FDBA 5AX8A 1PMOA 1H1CA 2YHKA 1G7XA 5M49A 3PPLA 1GC0A 1AMQA 2OGAA 1AKAA 3LVMA 2NMPA 2EO5A 3FCRA 3ZRQA 3A2BA 8AATA 2D5YA 1X0MA 1Z3ZA 4JEWA 3AELA 4OC9A 1AJSA 1IUGA 4RM1A 5EAVA 1PMMA 2OQXA 3BCXA 2C81A 3KE3A 4ADBA 3P1TA 3L8AA 2YCPA 4PFNA 1W7NA 1OXOA 2VMRA 2ZUKA 1ELQA 4RITA 2EGYA 4F4EA 1MDZA 3II0A 2AY1A 3NDNA 3E2ZB 3UWCA 1ORDA 3IF2A 1X28A 1QZ9A 4GSAA 1CJ0A 4Y0DA 4UOYA 2EPJA 1DGEA 4A00A 1KMKA 1OATA 2O0RA 3JWAA 1TOEA 3MAFA 1QJ5A 1W7LA 3EI5A 2WK8A 2QLRA 3DXWA 4IXZA 3P6KA 4RKCA 4CVQA 4EMYA 4A6TA 3NUIA 2ZSMA 2ZY3A 3AEJA 5HDMA 1AAMA 4MY5A 3BV0A 4F5IA 2AY9A 2JGTA 3E2FA 2AY5A 5EUNA 4CBRA 4LC3A 5DJ1A 4ZSYA 5D5SA 1C7NA 4W8IA 3LWSA 2HP2A 1MAQA 3JU7A 4TN4A 3WCNA 1GC4A 4DQ6A 5BJ3A 7AATA 2PB2A 3A9XA 4WBTA 2HOXA 3F9TA 3FQ7A 3MC6A 3HQTA 2BI5A 2YKXA 2WKAA 1CZEA 2AY2A 2HZPA 4K2BA 1OXPA 1N2TA 2YCNA 4RAEA 3FFHA 1ARTA 4GRXA 4WLHA 1WYVB 2QBTA 4WXBA 3HMUA 3F6TA 2YKVA 5E5IA 3PJ0A 5HHYA 3WX9A 2FN6A 2YCTA 1TATA 1C7GA 3L44A 2Z9XA 2D65A 3QBOA 1DJ9A 3GZCA 1AKCA 5DB5A 5EIGB 2JJHA 2AY7A 4KXKA 1TASA 2QB2A 3PDXA 3BN1A 1XEYA 1AHGA 3B8XA 1ARHA 4J8LA 2FM1A 5FT4A 4DBCA 4ZWVA 3BWNA 1MDOA 3VK3A 1CL2A 3NNKA 1JG8A 3ZZJA 1SFFA 3AEMA 3BB8A 3KGWA 1YJSA 4WYGA 2Z9WA 1P3WA 3PGYA 4M2MA 3OKSA 3HBXA 3EI7A 2AY8A 4RJ0A 1AY4A 3NYUA 1ASAA 3T32A 4A0FA 2E7JA 3WY7A 2BYLA 2R5CB 1LKCA 3FZ7A 5BJ4A 3VAXA 3E6GA 1LC7A 1YAAA 3DR7A 2AY4A 2XH1A 2VGZA 1V2FA 1I41A 4LNLA 4OTLA 4RIZA 4IY7A 3COGA 4AO9A 2OGEA 4MKJA 3VK4A 1LS3A 1N8PA 1M0OA 1D7SA 2VMWA 2BIGA 3G7QA 2GB3A 2C0RA 1BQDA 1FG7A 1B5OA 2W7DA 3ELPA 4WXFA 1AHEA 3GWPA 2DKJA 2W7MA 5E3KA 1QJ3A 4WP0A 3MBBA 3WLXA 3JTXA 4JF1A 3PA9A 1M0NA 1YJYA 4XK1A 1BS0A 3ASAA 2D64A 4XJMA 2Z1ZA 1OHVA 1MDXA 2VI8A 3NUBA 4U1TA 3DR4A 5EUEA 3KGXA 1ASFA 2X5DA 2WK7A 1QISA 1SZUA 2BI3A 2W7IA 3CQ6A 3PD6A 3LV2A 1IX8A 4F5FA 1BJWA 2BIAA 2R0TA 2ZJGA 1ZC9A 3FSLA 2HUUA 5D95A 3HVYA 2E7UA 2HOYA 3DU4A 2VIBA 1TPLA 3QN6A 4ZAHA 2CTZA 3FRKA 1IJIA 1KKPA 4W1XA 2AEVA 3FVUA 2BWOA 4E77A 1WSTA 1ELUA 3NYSA 5FT5A 2VMYA 2DOUA 2Z1YA 2HOZA 4IYOA 4KAMA 4KYOA 4ADEA 1IAXA 1ASCA 4ISYA 3MADA 4IW7A 4R5FA 4GDYA 1WKHA 2R5EA 2V0YA 4IXOA 4EU1A 1WYTA 4QGRA 4UHNA 3LVJA 3AOVA 3EUCA 2CB1A 1C9CA 3BC8A 2QA3A 3K7YA 1WKGA 4WXGA 4ITXA 3A9ZA 3EIBA 3NTJA 4ADCA 5C6UA 2W7GA 1IX7A 3NYTA 3CAIA 3N5MA 1ARSA 3W1IA 3M5UA 4F5HA 4J5UA 3QHXA 1W7MA 1AJSB 1V72A 1SPAA 3RBLA 2DR1A 4GEBA 3W1HA 4ZDPA 2YRIA 3ELEA 4ZDLA 4R8DA 5G09A 1M0QA 3AOWA 4K2MA 4M2JA 3D6KA 3AEOA 3K40A 3K28A 1BJ4A 1TOKA 2JJEA 3AEJC 3QM2A 3HLMA 1CZCA 3MAFB 3ATHA 1GD9A 2BI9A 3I4JA 4JEVA 1IVRA 2ZP7A 3B1EA 1M4NA 4EB5A 1ASDA 3PDBA 4Q76A 4FFCA 4BA4A 4N0WA 2AATA 2W7KA 3DC1A 3MC6C 2CINA 4OCAA 3WCOA 5LH9A 2EZ2A 1IAYA 4U2HA 4JEZA 2VMXA 2W8VA 4MQPA 3B1DA 1OHWA 4P3MA 5TF5A 2O7CA 2BYJA 2ZY4A 1AIBA 1B5PA 2Z61A 3UAKA 1T3IA 2GMSA 4FL0A 1DJUA 3CBFA 4PVFA 4ZLVA 1S08A 2D66A 1B9HA 1MLZA 5G4IA 2W7LA 1QGNA 1QIRA 1BJOA 1TARA 1GEYA 3LY1A 4N0BA 1AHFA 2E7IA 4WLJA 1WYUA 3ISLA 3GSBA 4PIWA 1X2AA 2YOBA 3BWNC 1AKBA 1AHYA 1X29A 1CL1A 3NU8A 3GR9A 2AY3A 2CSTA 4Q31A 1AMSA 1J32A 3HDOA 5F8VA 1MGVA 1DJEA 2TPLA 1VP4A 3AEMC 3LG0A 5DX5A 1V2DA 3PIUA 2CY8A 3G0TA 4ZM4A 1H0CA 3R9AA 4ZDOA 4ZSWA 1YJZA 3VP6A 1RVYA 4IXSA 3WKRA 2BHXA 2EZ1A 1RV4A 2GSAA 3PAAA 3RBFA 4ADDA 2R2NA 4P7YA 1S0AA 1SZKA 2CJGA 2FNIA 4ATQA 3ECDA 4RJYA 4AZKA 3AATA 4JF0A 4JEXA 1E5EA 1AJRA 1C7OA 3FZ8A 3MEBA 1GDEA 2X3LA 3EI6A 3E9KA 4JEYA 1AX4A 3HT4A 3NX3A 3OP7A 3I16A 2C7TA 3DZZA 5EQCA 2BWNA 4RKDA 4UHOA 4BMKA 2YKUA 5EUDA 3CQ4A 4BHDA 2VGWA 2W7EA 5G4JA 1JF9A 3TCMA 1LW4A 1AY5A 4LNJA 1ARIA 2YRRA 3TQXA 2G6WA 4I8AA 1UU0A 1VJOA 1TOGA 3GBXA 4A6RA 1CQ6A 2Z9VA 4WYDA 2VMOA 2VGSA 3DXVA 3N75A 3GJUA 1UU2A 1ASBA 1ASMA 1SVVA 2CJDA 2XBNA 3KKIA 3EI8A 2VLFA 3QGUA 1D7VA 1V2EA 4ATPA 1DTYA 4B98A 9AATA 1YNUA 3DYDA 4F5GA 2ORDA 1D7RA 2VGVA 1Y4IA 4ZM3A 3FQAA 4XQ2A 1BT4A 1ASNA 5G2PA 4E3RA 5JAYA 3RCHA 2OKKA 2HORA 1MAPA 5LHAA 2E54A 1I29A 1XI9A 1D7UA 1GC3A 3AV7A 5EAAA 1RVUA 1AHXA 3ZRPA 4Y0HA 1UU1A 4ZASA 4IYOB 3FZ6A 1TOJA 2W7FA 4AZJA 4F5MA 3B46A 2OKJA 1WYTB 3B1CA 3DRDA 4WYCA 4EFFA 1O4SA 2JJGA 1GBNA 4JE5D 3FDDA 1ASLA 4XJLA 3IHJA 4AOAA 4W1VA 4CXQA 1ASGA 1AIAA 2HP1A 3FFRA 2CH2A 3DODA 1W3UA 2Z67A 3USFA 3GZDA 4TMRA 1S09A 4UQVA 5DJ9A 3EZSA 2FNUA 2DGKA 3AENA 3FVXA 3WGCA 3WZFA 2VMUA 2D7ZA 4GE9A 1ASEA 2CJHA 2AEUA 1S07A 5G2QA 1LC5A 4WB0A 5E4ZA 3R4TA 4MKKA 3FKDA 4OT8A 4ITGA 2ZY2A 3VK2A 4MGRA 4F5JA 3N0LA 4R5ZA 4R2NA 2VMNA 2Z9UA 1YOOA 1B8GA 1U08A 1CQ7A 1GCKA 1EQBA 1OHYA 3FTBA 1BQAA 2FYFA 4ZWMA 1O69A 3VOMA 4E1OA 2Z20A 1ARGA 1PFFA 2X5FA 3A8UX 5G0AA 2BIEA 3WKSA 5K8BA 1E5FA 1IX6A 2GQNA 2CANA 3BWOA 1KMJA 2CH1A 1KKJA 3QPGA 3PDBB 5FT8A 3E2ZA 3G8MA 5FT6A 2VGTA 4A0HA 3RUYA 3MKJA 4CBSA 3TFTA 2VGUA 4MQQA 1G4VA 3UE8A 2WK9A 1DKAA 4BA5A 1C4KA 1M6SA 1B4XA 1I43A 4K2IA 1BJNA 2VIAA 2OATA 2EH6A 4HVKA 3WGBA 3MAUA 3ASBA 2DGMA 4OMAA 2QMAA 1AY8A 1N31A 1KL1A 2V1PA 1Z7DA 1LC8A 3TATA 3QI6A 1BJOB 2O1BA 1YIYA 2W8UA 4E3QA 1WYUB 4WYEA 2W8WA 3I5TA 2W8JA 4CXRA 1EG5A 3JW9A 1RV3A 4OBVA 2HUFA 3LVKA 1W23A 5M4BA 4F5LA 4A0RA 2ZSLA 4NOGA 1LK9A 1G4XA 1SZSA 3H14A 5EFSA 3E2YA 4M2KA 2JISA 2JG2A 1WYVA 2VMPA 1GC2A 2ZY5A 3EIAA 5M4DA
chains in the Genus database with same CATH superfamily
2BI2A 1O61A 1ZOBA 1I48A 3LVLB 4W1WA 2VI9A 2PO3A 3H7FA 4F5KA 1M0PA 3BCBA 1FG3A 2GMUA 5EIGA 3BCAA 4WD2A 1O62A 2AY6A 2BKWA 2YKYA 1ZODA 3F0HA 1SF2A 3BS8A 4L0OA 3FQ8A 2FQ6A 1AICA 2CFBA 4A72A 1C0NA 2DGLA 4A0GA 3RQ1A 1JS3A 1DGDA 4Q6RA 1KL2A 2RFVA 3EZ1A 3JWBA 3CQ5A 4WYFA 2W8TA 4LW2A 1AAWA 1PG8A 2X8UA 4PFFA 1YIZA 1BW0A 2R5CA 4JE5A 1G7WA 4UHMA 5IWQA 3ZRRA 4W91A 2JJFA 1KAFA 2BWPA 1BKGA 1VEFA 4A6UA 2VYCA 2F8JA 3NRAA 1GEXA 3W1JA 1CQ8A 3ACZA 3FVSA 3HL2A 1CS1A 1ECXA 5M46A 2VMSA 4O6ZA 3TFUA 1B9IA 1D2FA 3AEPA 3PD6B 4GE7A 2Q7WA 2VMZA 4Q75A 5F9SA 1MLYA 3RCHB 2HUIA 1QITA 3NU7A 4XAUA 5J8QA 1FC4A 4LNMA 3Q8NA 1M7YA 1DFOA 1EJIA 4GE4A 4MQRA 4OYTA 4IX8A 2QSRA 2C44A 1AMRA 2QB3A 4BQ0A 4B9BA 1TOIA 1JS6A 1AMAA 3ZZKA 3GZDC 4TV7A 1GEWA 1M32A 3FD0A 3E77A 4XJOA 4AO4A 1S06A 5HXXA 3GETA 2D7YA 2BI1A 2ZC0A 2VMVA 2DKBA 2D61A 3A9YA 5I92A 2FKIA 2ZYJA 4XEWA 4Y0IA 4XJPA 2VMTA 4EB7A 3AENB 4WYAA 1J04A 3RI6A 2PB0A 4LW4A 4AH3A 4W5KA 4MSOA 2W7JA 4HF8A 4WB0B 2VMQA 2VLHA 1IBJA 2D63A 3EI9A 1UKJA 4RLGA 4OBUA 2W7HA 1LW5A 4H51A 4DGTA 3JZLA 3FDBA 5AX8A 1PMOA 1H1CA 2YHKA 1G7XA 5M49A 3PPLA 1GC0A 1AMQA 2OGAA 1AKAA 3LVMA 2NMPA 2EO5A 3FCRA 3ZRQA 3A2BA 8AATA 2D5YA 1X0MA 1Z3ZA 4JEWA 3AELA 4OC9A 1AJSA 1IUGA 4RM1A 5EAVA 1PMMA 2OQXA 3BCXA 2C81A 3KE3A 4ADBA 3P1TA 3L8AA 2YCPA 4PFNA 1W7NA 1OXOA 2VMRA 2ZUKA 1ELQA 4RITA 2EGYA 4F4EA 1MDZA 3II0A 2AY1A 3NDNA 3E2ZB 3UWCA 1ORDA 3IF2A 1X28A 1QZ9A 4GSAA 1CJ0A 4Y0DA 4UOYA 2EPJA 1DGEA 4A00A 1KMKA 1OATA 2O0RA 3JWAA 1TOEA 3MAFA 1QJ5A 1W7LA 3EI5A 2WK8A 2QLRA 3DXWA 4IXZA 3P6KA 4RKCA 4CVQA 4EMYA 4A6TA 3NUIA 2ZSMA 2ZY3A 3AEJA 5HDMA 1AAMA 4MY5A 3BV0A 4F5IA 2AY9A 2JGTA 3E2FA 2AY5A 5EUNA 4CBRA 4LC3A 5DJ1A 4ZSYA 5D5SA 1C7NA 4W8IA 3LWSA 2HP2A 1MAQA 3JU7A 4TN4A 3WCNA 1GC4A 4DQ6A 5BJ3A 7AATA 2PB2A 3A9XA 4WBTA 2HOXA 3F9TA 3FQ7A 3MC6A 3HQTA 2BI5A 2YKXA 2WKAA 1CZEA 2AY2A 2HZPA 4K2BA 1OXPA 1N2TA 2YCNA 4RAEA 3FFHA 1ARTA 4GRXA 4WLHA 1WYVB 2QBTA 4WXBA 3HMUA 3F6TA 2YKVA 5E5IA 3PJ0A 5HHYA 3WX9A 2FN6A 2YCTA 1TATA 1C7GA 3L44A 2Z9XA 2D65A 3QBOA 1DJ9A 3GZCA 1AKCA 5DB5A 5EIGB 2JJHA 2AY7A 4KXKA 1TASA 2QB2A 3PDXA 3BN1A 1XEYA 1AHGA 3B8XA 1ARHA 4J8LA 2FM1A 5FT4A 4DBCA 4ZWVA 3BWNA 1MDOA 3VK3A 1CL2A 3NNKA 1JG8A 3ZZJA 1SFFA 3AEMA 3BB8A 3KGWA 1YJSA 4WYGA 2Z9WA 1P3WA 3PGYA 4M2MA 3OKSA 3HBXA 3EI7A 2AY8A 4RJ0A 1AY4A 3NYUA 1ASAA 3T32A 4A0FA 2E7JA 3WY7A 2BYLA 2R5CB 1LKCA 3FZ7A 5BJ4A 3VAXA 3E6GA 1LC7A 1YAAA 3DR7A 2AY4A 2XH1A 2VGZA 1V2FA 1I41A 4LNLA 4OTLA 4RIZA 4IY7A 3COGA 4AO9A 2OGEA 4MKJA 3VK4A 1LS3A 1N8PA 1M0OA 1D7SA 2VMWA 2BIGA 3G7QA 2GB3A 2C0RA 1BQDA 3N7NA 1FG7A 1B5OA 2W7DA 3ELPA 4WXFA 1AHEA 3GWPA 2DKJA 2W7MA 5E3KA 1QJ3A 4WP0A 3MBBA 3WLXA 3JTXA 4JF1A 3PA9A 1M0NA 1YJYA 4XK1A 1BS0A 3ASAA 2D64A 4XJMA 2Z1ZA 1OHVA 1MDXA 2VI8A 3NUBA 4U1TA 3DR4A 5EUEA 3KGXA 1ASFA 2X5DA 2WK7A 3N4XA 1QISA 1SZUA 2BI3A 2W7IA 3CQ6A 3PD6A 3LV2A 1IX8A 4F5FA 1BJWA 2BIAA 2R0TA 2ZJGA 1ZC9A 3FSLA 2HUUA 5D95A 3HVYA 2E7UA 2HOYA 3DU4A 2VIBA 1TPLA 3QN6A 4ZAHA 2CTZA 3FRKA 1IJIA 1KKPA 4W1XA 2AEVA 3FVUA 2BWOA 4E77A 1WSTA 1ELUA 3NYSA 5FT5A 2VMYA 2DOUA 2Z1YA 2HOZA 4IYOA 4KAMA 4KYOA 4ADEA 1IAXA 1ASCA 4ISYA 3MADA 4IW7A 4R5FA 4GDYA 1WKHA 2R5EA 2V0YA 4IXOA 4EU1A 1WYTA 4QGRA 4UHNA 3LVJA 3AOVA 3EUCA 2CB1A 1C9CA 3BC8A 2QA3A 3K7YA 1WKGA 4WXGA 5KTBA 4ITXA 3A9ZA 2EYQA 3EIBA 3NTJA 4ADCA 5C6UA 2W7GA 1IX7A 3NYTA 3CAIA 3N5MA 1ARSA 3W1IA 3M5UA 4F5HA 4J5UA 3QHXA 1W7MA 1AJSB 1V72A 1SPAA 3RBLA 2DR1A 4GEBA 2G7JA 3W1HA 4ZDPA 2YRIA 3ELEA 4ZDLA 4R8DA 5G09A 1M0QA 3AOWA 4K2MA 4M2JA 3D6KA 3AEOA 3K40A 3K28A 4K05A 1BJ4A 1TOKA 2JJEA 3AEJC 3QM2A 3HLMA 1CZCA 3MAFB 3ATHA 3N4RA 1GD9A 2BI9A 3I4JA 4JEVA 1IVRA 2KFPA 2ZP7A 3B1EA 1M4NA 4EB5A 1ASDA 3PDBA 4Q76A 4FFCA 4BA4A 4N0WA 2AATA 2W7KA 3DC1A 3MC6C 2CINA 4OCAA 3WCOA 5LH9A 2EZ2A 1IAYA 4U2HA 4JEZA 2VMXA 2W8VA 4MQPA 3B1DA 1OHWA 4P3MA 5TF5A 2O7CA 2BYJA 2ZY4A 1AIBA 1B5PA 2Z61A 3UAKA 1T3IA 2GMSA 4FL0A 1DJUA 3CBFA 4PVFA 3N4SA 4ZLVA 1S08A 2D66A 1B9HA 1MLZA 5G4IA 2W7LA 1QGNA 1QIRA 1BJOA 1TARA 1GEYA 3LY1A 4N0BA 1AHFA 2E7IA 4WLJA 1WYUA 3ISLA 3GSBA 4PIWA 1X2AA 2YOBA 3BWNC 1AKBA 1AHYA 1X29A 1CL1A 3NU8A 3GR9A 2AY3A 2CSTA 4Q31A 1AMSA 1J32A 3HDOA 5F8VA 3H9XA 1MGVA 1DJEA 2TPLA 1VP4A 3AEMC 3LG0A 5DX5A 1V2DA 3PIUA 2CY8A 3G0TA 4ZM4A 1H0CA 3R9AA 4ZDOA 4ZSWA 1YJZA 3VP6A 1RVYA 4IXSA 3WKRA 2BHXA 2EZ1A 1RV4A 2GSAA 3PAAA 3RBFA 4ADDA 2R2NA 4P7YA 1S0AA 1SZKA 2CJGA 2FNIA 4ATQA 3ECDA 4RJYA 4AZKA 3AATA 4JF0A 4JEXA 1E5EA 1AJRA 1C7OA 3FZ8A 3MEBA 1GDEA 2X3LA 3EI6A 3E9KA 4JEYA 1AX4A 3HT4A 3NX3A 3OP7A 3I16A 2C7TA 3DZZA 5EQCA 2BWNA 4RKDA 4UHOA 4BMKA 2YKUA 5EUDA 3CQ4A 4BHDA 2VGWA 2W7EA 5G4JA 1JF9A 3TCMA 1LW4A 1AY5A 4LNJA 1ARIA 2YRRA 3TQXA 2G6WA 4I8AA 1UU0A 1VJOA 1TOGA 3GBXA 4A6RA 4H63Q 1CQ6A 2Z9VA 4WYDA 2VMOA 2VGSA 3DXVA 3N75A 3GJUA 1UU2A 1ASBA 1ASMA 1SVVA 2CJDA 2XBNA 3KKIA 3EI8A 2VLFA 3QGUA 1D7VA 1V2EA 4ATPA 1DTYA 4B98A 9AATA 1YNUA 3DYDA 4F5GA 2ORDA 1D7RA 2VGVA 1Y4IA 4ZM3A 3FQAA 4XQ2A 1BT4A 1ASNA 5G2PA 4E3RA 5JAYA 3RCHA 2OKKA 2HORA 1MAPA 5LHAA 2E54A 1I29A 1XI9A 1D7UA 1GC3A 3AV7A 5EAAA 1RVUA 1AHXA 3ZRPA 4Y0HA 1UU1A 4ZASA 4IYOB 3FZ6A 1TOJA 2W7FA 4AZJA 4F5MA 3B46A 2OKJA 1WYTB 3B1CA 3DRDA 4WYCA 4EFFA 1O4SA 2JJGA 1GBNA 4JE5D 3FDDA 1ASLA 4XJLA 3IHJA 4AOAA 4W1VA 4CXQA 1ASGA 1AIAA 2HP1A 3FFRA 2CH2A 3DODA 1W3UA 2Z67A 3USFA 3GZDA 4TMRA 1S09A 4UQVA 5DJ9A 3EZSA 2FNUA 2DGKA 3AENA 3FVXA 3WGCA 3WZFA 2VMUA 2D7ZA 4GE9A 1ASEA 2CJHA 2AEUA 1S07A 5G2QA 1LC5A 4WB0A 5E4ZA 3R4TA 4MKKA 3FKDA 4OT8A 4ITGA 2ZY2A 3VK2A 4MGRA 4F5JA 2WB6A 3N0LA 4R5ZA 4R2NA 2VMNA 2Z9UA 1YOOA 1B8GA 1U08A 1CQ7A 1GCKA 1EQBA 1OHYA 3FTBA 1BQAA 2FYFA 4ZWMA 1O69A 3VOMA 4E1OA 2Z20A 1ARGA 1PFFA 2X5FA 3A8UX 5G0AA 2BIEA 3WKSA 5K8BA 1E5FA 2A1VA 1IX6A 2GQNA 2CANA 3BWOA 1KMJA 2CH1A 1KKJA 3QPGA 3PDBB 5FT8A 3E2ZA 3G8MA 5FT6A 2VGTA 4A0HA 3RUYA 3MKJA 4CBSA 3TFTA 2VGUA 4MQQA 1G4VA 3UE8A 2WK9A 1DKAA 4BA5A 1C4KA 1M6SA 1B4XA 1I43A 4K2IA 1BJNA 2VIAA 2OATA 2EH6A 4HVKA 3WGBA 3MAUA 3ASBA 2DGMA 4OMAA 2QMAA 1AY8A 1N31A 1KL1A 2V1PA 1Z7DA 1LC8A 3TATA 3QI6A 1BJOB 2O1BA 1YIYA 2W8UA 4E3QA 1WYUB 4WYEA 2W8WA 3I5TA 2W8JA 4CXRA 1EG5A 3JW9A 1RV3A 4OBVA 2HUFA 3LVKA 1W23A 5M4BA 4F5LA 4A0RA 2ZSLA 4NOGA 1LK9A 1G4XA 1SZSA 3H14A 5EFSA 3E2YA 4M2KA 2JISA 2JG2A 1WYVA 2VMPA 1GC2A 2ZY5A 3EIAA 5M4DA
chains in the Genus database with same CATH topology
2BI2A 1O61A 1ZOBA 1I48A 3LVLB 4W1WA 2VI9A 2PO3A 3H7FA 4F5KA 1M0PA 3BCBA 1FG3A 2GMUA 5EIGA 3BCAA 4WD2A 1O62A 2AY6A 2BKWA 2YKYA 1ZODA 3F0HA 1SF2A 3BS8A 4L0OA 3FQ8A 2FQ6A 1AICA 2CFBA 4A72A 1C0NA 2DGLA 4A0GA 3RQ1A 1JS3A 1DGDA 4Q6RA 1KL2A 2RFVA 3EZ1A 3JWBA 3CQ5A 4WYFA 2W8TA 4LW2A 1AAWA 1PG8A 2X8UA 4PFFA 1YIZA 1BW0A 2R5CA 4JE5A 1G7WA 4UHMA 5IWQA 3ZRRA 4W91A 2JJFA 2BWPA 1BKGA 1VEFA 4A6UA 2VYCA 2F8JA 3NRAA 1GEXA 3W1JA 1CQ8A 3ACZA 3FVSA 3HL2A 1CS1A 1ECXA 5M46A 2VMSA 4O6ZA 3TFUA 1B9IA 1D2FA 3AEPA 3PD6B 4GE7A 2Q7WA 2VMZA 4Q75A 5F9SA 1MLYA 3RCHB 2HUIA 1QITA 3NU7A 4XAUA 5J8QA 1FC4A 4LNMA 3Q8NA 1M7YA 1DFOA 1EJIA 4GE4A 4MQRA 4OYTA 4IX8A 2QSRA 2C44A 1AMRA 2QB3A 4BQ0A 4B9BA 1TOIA 1JS6A 1AMAA 3ZZKA 3GZDC 4TV7A 1GEWA 1M32A 3FD0A 3E77A 4XJOA 4AO4A 1S06A 5HXXA 3GETA 2D7YA 2BI1A 2ZC0A 2VMVA 2DKBA 2D61A 3A9YA 5I92A 2FKIA 2ZYJA 4XEWA 4Y0IA 4XJPA 2VMTA 4EB7A 3AENB 4WYAA 1J04A 3RI6A 2PB0A 4LW4A 4AH3A 4W5KA 4MSOA 2W7JA 4HF8A 4WB0B 2VMQA 2VLHA 1IBJA 2D63A 3EI9A 1UKJA 4RLGA 4OBUA 2W7HA 1LW5A 4H51A 4DGTA 3JZLA 3FDBA 5AX8A 1PMOA 1H1CA 2YHKA 1G7XA 5M49A 3PPLA 1GC0A 1AMQA 2OGAA 1AKAA 3LVMA 2NMPA 2EO5A 3FCRA 3ZRQA 3A2BA 8AATA 2D5YA 1X0MA 1Z3ZA 4JEWA 3AELA 4OC9A 1AJSA 1IUGA 4RM1A 5EAVA 1PMMA 2OQXA 3BCXA 2C81A 3KE3A 4ADBA 3P1TA 3L8AA 2YCPA 4PFNA 1W7NA 1OXOA 2VMRA 2ZUKA 1ELQA 4RITA 2EGYA 4F4EA 1MDZA 3II0A 2AY1A 3NDNA 3E2ZB 3UWCA 1ORDA 3IF2A 1X28A 1QZ9A 4GSAA 1CJ0A 4Y0DA 4UOYA 2EPJA 1DGEA 4A00A 1KMKA 1OATA 2O0RA 3JWAA 1TOEA 3MAFA 1QJ5A 1W7LA 3EI5A 2WK8A 2QLRA 3DXWA 4IXZA 3P6KA 4RKCA 4CVQA 4EMYA 4A6TA 3NUIA 2ZSMA 2ZY3A 3AEJA 5HDMA 1AAMA 4MY5A 3BV0A 4F5IA 2AY9A 2JGTA 3E2FA 2AY5A 5EUNA 4CBRA 4LC3A 5DJ1A 4ZSYA 5D5SA 1C7NA 4W8IA 3LWSA 2HP2A 1MAQA 3JU7A 4TN4A 3WCNA 1GC4A 4DQ6A 5BJ3A 7AATA 2PB2A 3A9XA 4WBTA 2HOXA 3F9TA 3FQ7A 3MC6A 3HQTA 2BI5A 2YKXA 2WKAA 1CZEA 2AY2A 2HZPA 4K2BA 1OXPA 1N2TA 2YCNA 4RAEA 3FFHA 1ARTA 4GRXA 4WLHA 1WYVB 2QBTA 4WXBA 3HMUA 3F6TA 2YKVA 5E5IA 3PJ0A 5HHYA 3WX9A 2FN6A 2YCTA 1TATA 1C7GA 3L44A 2Z9XA 2D65A 3QBOA 1DJ9A 3GZCA 1AKCA 5DB5A 5EIGB 2JJHA 2AY7A 4KXKA 1TASA 2QB2A 3PDXA 3BN1A 1XEYA 1AHGA 3B8XA 1ARHA 4J8LA 2FM1A 5FT4A 4DBCA 4ZWVA 3BWNA 1MDOA 3VK3A 1CL2A 3NNKA 1JG8A 3ZZJA 1SFFA 3AEMA 3BB8A 3KGWA 1YJSA 4WYGA 2Z9WA 1P3WA 3PGYA 4M2MA 3OKSA 3HBXA 3EI7A 2AY8A 4RJ0A 1AY4A 3NYUA 1ASAA 3T32A 4A0FA 2E7JA 3WY7A 2BYLA 2R5CB 1LKCA 3FZ7A 5BJ4A 3VAXA 3E6GA 1LC7A 1YAAA 3DR7A 2AY4A 2XH1A 2VGZA 1V2FA 1I41A 4LNLA 4OTLA 4RIZA 4IY7A 3COGA 4AO9A 2OGEA 4MKJA 3VK4A 1LS3A 1N8PA 1M0OA 1D7SA 2VMWA 2BIGA 3G7QA 2GB3A 2C0RA 1BQDA 3N7NA 1FG7A 1B5OA 2W7DA 3ELPA 4WXFA 1AHEA 3GWPA 2DKJA 2W7MA 5E3KA 1QJ3A 4WP0A 3MBBA 3WLXA 3JTXA 4JF1A 3PA9A 1M0NA 1YJYA 4XK1A 1BS0A 3ASAA 2D64A 4XJMA 2Z1ZA 1OHVA 1MDXA 2VI8A 3NUBA 4U1TA 3DR4A 5EUEA 3KGXA 1ASFA 2X5DA 2WK7A 3N4XA 1QISA 1SZUA 2BI3A 2W7IA 3CQ6A 3PD6A 3LV2A 1IX8A 4F5FA 1BJWA 2BIAA 2R0TA 2ZJGA 1ZC9A 3FSLA 2HUUA 5D95A 3HVYA 2E7UA 2HOYA 3DU4A 2VIBA 1TPLA 3QN6A 4ZAHA 2CTZA 3FRKA 1IJIA 1KKPA 4W1XA 2AEVA 3FVUA 2BWOA 4E77A 1WSTA 1ELUA 3NYSA 5FT5A 2VMYA 2DOUA 2Z1YA 2HOZA 4IYOA 4KAMA 4KYOA 4ADEA 1IAXA 1ASCA 4ISYA 3MADA 4IW7A 4R5FA 4GDYA 1WKHA 2R5EA 2V0YA 4IXOA 4EU1A 1WYTA 4QGRA 4UHNA 3LVJA 3AOVA 3EUCA 2CB1A 1C9CA 3BC8A 2QA3A 3K7YA 1WKGA 4WXGA 5KTBA 4ITXA 3A9ZA 2EYQA 3EIBA 3NTJA 4ADCA 5C6UA 2W7GA 1IX7A 3NYTA 3CAIA 3N5MA 1ARSA 3W1IA 3M5UA 4F5HA 4J5UA 3QHXA 1W7MA 1AJSB 1V72A 1SPAA 3RBLA 2DR1A 4GEBA 2G7JA 3W1HA 4ZDPA 2YRIA 3ELEA 4ZDLA 4R8DA 5G09A 1M0QA 3AOWA 4K2MA 4M2JA 3D6KA 3AEOA 3K40A 3K28A 4K05A 1BJ4A 1TOKA 2JJEA 3AEJC 3QM2A 3HLMA 1CZCA 3MAFB 3ATHA 3N4RA 1GD9A 2BI9A 3I4JA 4JEVA 1IVRA 2KFPA 2ZP7A 3B1EA 1M4NA 4EB5A 1ASDA 3PDBA 4Q76A 4FFCA 4BA4A 4N0WA 2AATA 2W7KA 3DC1A 3MC6C 2CINA 4OCAA 3WCOA 5LH9A 2EZ2A 1IAYA 4U2HA 4JEZA 2VMXA 2W8VA 4MQPA 3B1DA 1OHWA 4P3MA 5TF5A 2O7CA 2BYJA 2ZY4A 1AIBA 1B5PA 2Z61A 3UAKA 1T3IA 2GMSA 4FL0A 1DJUA 3CBFA 4PVFA 3N4SA 4ZLVA 1S08A 2D66A 1B9HA 1MLZA 5G4IA 2W7LA 1QGNA 1QIRA 1BJOA 1TARA 1GEYA 3LY1A 4N0BA 1AHFA 2E7IA 4WLJA 1WYUA 3ISLA 3GSBA 4PIWA 1X2AA 2YOBA 3BWNC 1AKBA 1AHYA 1X29A 1CL1A 3NU8A 3GR9A 2AY3A 2CSTA 4Q31A 1AMSA 1J32A 3HDOA 5F8VA 3H9XA 1MGVA 1DJEA 2TPLA 1VP4A 3AEMC 3LG0A 5DX5A 1V2DA 3PIUA 2CY8A 3G0TA 4ZM4A 1H0CA 3R9AA 4ZDOA 4ZSWA 1YJZA 3VP6A 1RVYA 4IXSA 3WKRA 2BHXA 2EZ1A 1RV4A 2GSAA 3PAAA 3RBFA 4ADDA 2R2NA 4P7YA 1S0AA 1SZKA 2CJGA 2FNIA 4ATQA 3ECDA 4RJYA 4AZKA 3AATA 4JF0A 4JEXA 1E5EA 1AJRA 1C7OA 3FZ8A 3MEBA 1GDEA 2X3LA 3EI6A 3E9KA 4JEYA 1AX4A 3HT4A 3NX3A 3OP7A 3I16A 2C7TA 3DZZA 5EQCA 2BWNA 4RKDA 4UHOA 4BMKA 2YKUA 5EUDA 3CQ4A 4BHDA 2VGWA 2W7EA 5G4JA 1JF9A 3TCMA 1LW4A 1AY5A 4LNJA 1ARIA 2YRRA 3TQXA 2G6WA 4I8AA 1UU0A 1VJOA 1TOGA 3GBXA 4A6RA 4H63Q 1CQ6A 2Z9VA 4WYDA 2VMOA 2VGSA 3DXVA 3N75A 3GJUA 1UU2A 1ASBA 1ASMA 1SVVA 2CJDA 2XBNA 3KKIA 3EI8A 2VLFA 3QGUA 1D7VA 1V2EA 4ATPA 1DTYA 4B98A 9AATA 1YNUA 3DYDA 4F5GA 2ORDA 1D7RA 2VGVA 1Y4IA 4ZM3A 3FQAA 4XQ2A 1BT4A 1ASNA 5G2PA 4E3RA 5JAYA 3RCHA 2OKKA 2HORA 1MAPA 5LHAA 2E54A 1I29A 1XI9A 1D7UA 1GC3A 3AV7A 5EAAA 1RVUA 1AHXA 3ZRPA 4Y0HA 1UU1A 4ZASA 4IYOB 3FZ6A 1TOJA 2W7FA 4AZJA 4F5MA 3B46A 2OKJA 1WYTB 3B1CA 3DRDA 4WYCA 4EFFA 1O4SA 2JJGA 1GBNA 4JE5D 3FDDA 1ASLA 4XJLA 3IHJA 4AOAA 4W1VA 4CXQA 1ASGA 1AIAA 2HP1A 3FFRA 2CH2A 3DODA 1W3UA 2Z67A 3USFA 3GZDA 4TMRA 1S09A 4UQVA 5DJ9A 3EZSA 2FNUA 2DGKA 3AENA 3FVXA 3WGCA 3WZFA 2VMUA 2D7ZA 4GE9A 1ASEA 2CJHA 2AEUA 1S07A 5G2QA 1LC5A 4WB0A 5E4ZA 3R4TA 4MKKA 3FKDA 4OT8A 4ITGA 2ZY2A 3VK2A 4MGRA 4F5JA 2WB6A 3N0LA 4R5ZA 4R2NA 2VMNA 2Z9UA 1YOOA 1B8GA 1U08A 1CQ7A 1GCKA 1EQBA 1OHYA 3FTBA 1BQAA 2FYFA 4ZWMA 1O69A 3VOMA 4E1OA 2Z20A 1ARGA 1PFFA 2X5FA 3A8UX 5G0AA 2BIEA 3WKSA 5K8BA 1E5FA 2A1VA 1IX6A 2GQNA 2CANA 3BWOA 1KMJA 2CH1A 1KKJA 3QPGA 3PDBB 5FT8A 3E2ZA 3G8MA 5FT6A 2VGTA 4A0HA 3RUYA 3MKJA 4CBSA 3TFTA 2VGUA 4MQQA 1G4VA 3UE8A 2WK9A 1DKAA 4BA5A 1C4KA 1M6SA 1B4XA 1I43A 4K2IA 1BJNA 2VIAA 2OATA 2EH6A 4HVKA 3WGBA 3MAUA 3ASBA 2DGMA 4OMAA 2QMAA 1AY8A 1N31A 1KL1A 2V1PA 1Z7DA 1LC8A 3TATA 3QI6A 1BJOB 2O1BA 1YIYA 2W8UA 4E3QA 1WYUB 4WYEA 2W8WA 3I5TA 2W8JA 4CXRA 1EG5A 3JW9A 1RV3A 4OBVA 2HUFA 3LVKA 1W23A 5M4BA 4F5LA 4A0RA 2ZSLA 4NOGA 1LK9A 1G4XA 1SZSA 3H14A 5EFSA 3E2YA 4M2KA 2JISA 2JG2A 1WYVA 2VMPA 1GC2A 2ZY5A 3EIAA 5M4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BI2 A;  1O61 A;  1ZOB A;  1I48 A;  3LVL B;  4W1W A;  2VI9 A;  2PO3 A;  3H7F A;  4F5K A;  1M0P A;  3BCB A;  1FG3 A;  2GMU A;  5EIG A;  3BCA A;  4WD2 A;  1O62 A;  2AY6 A;  2BKW A;  2YKY A;  1ZOD A;  3F0H A;  1SF2 A;  3BS8 A;  4L0O A;  3FQ8 A;  2FQ6 A;  1AIC A;  2CFB A;  4A72 A;  1C0N A;  2DGL A;  4A0G A;  3RQ1 A;  1JS3 A;  1DGD A;  4Q6R A;  1KL2 A;  2RFV A;  3EZ1 A;  3JWB A;  3CQ5 A;  4WYF A;  2W8T A;  4LW2 A;  1AAW A;  1PG8 A;  2X8U A;  4PFF A;  1YIZ A;  1BW0 A;  2R5C A;  4JE5 A;  1G7W A;  4UHM A;  5IWQ A;  3ZRR A;  4W91 A;  2JJF A;  2BWP A;  1BKG A;  1VEF A;  4A6U A;  2VYC A;  2F8J A;  3NRA A;  1GEX A;  3W1J A;  1CQ8 A;  3ACZ A;  3FVS A;  3HL2 A;  1CS1 A;  1ECX A;  5M46 A;  2VMS A;  4O6Z A;  3TFU A;  1B9I A;  1D2F A;  3AEP A;  3PD6 B;  4GE7 A;  2Q7W A;  2VMZ A;  4Q75 A;  5F9S A;  1MLY A;  3RCH B;  2HUI A;  1QIT A;  3NU7 A;  4XAU A;  5J8Q A;  1FC4 A;  4LNM A;  3Q8N A;  1M7Y A;  1DFO A;  1EJI A;  4GE4 A;  4MQR A;  4OYT A;  4IX8 A;  2C44 A;  1AMR A;  2QB3 A;  4BQ0 A;  4B9B A;  1TOI A;  1JS6 A;  1AMA A;  3ZZK A;  3GZD C;  4TV7 A;  1GEW A;  1M32 A;  3FD0 A;  3E77 A;  4XJO A;  4AO4 A;  1S06 A;  5HXX A;  3GET A;  2D7Y A;  2BI1 A;  2ZC0 A;  2VMV A;  2DKB A;  2D61 A;  3A9Y A;  5I92 A;  2ZYJ A;  4XEW A;  4Y0I A;  4XJP A;  2VMT A;  4EB7 A;  3AEN B;  4WYA A;  1J04 A;  3RI6 A;  2PB0 A;  4LW4 A;  4AH3 A;  4W5K A;  4MSO A;  2W7J A;  4HF8 A;  4WB0 B;  2VMQ A;  2VLH A;  1IBJ A;  2D63 A;  3EI9 A;  1UKJ A;  4RLG A;  4OBU A;  2W7H A;  1LW5 A;  4H51 A;  4DGT A;  3JZL A;  3FDB A;  5AX8 A;  1PMO A;  1H1C A;  2YHK A;  1G7X A;  5M49 A;  3PPL A;  1GC0 A;  1AMQ A;  2OGA A;  1AKA A;  3LVM A;  2NMP A;  2EO5 A;  3FCR A;  3ZRQ A;  3A2B A;  8AAT A;  2D5Y A;  1X0M A;  1Z3Z A;  4JEW A;  3AEL A;  4OC9 A;  1AJS A;  1IUG A;  4RM1 A;  5EAV A;  1PMM A;  2OQX A;  3BCX A;  2C81 A;  3KE3 A;  4ADB A;  3P1T A;  3L8A A;  2YCP A;  4PFN A;  1W7N A;  1OXO A;  2VMR A;  2ZUK A;  1ELQ A;  4RIT A;  2EGY A;  4F4E A;  1MDZ A;  3II0 A;  2AY1 A;  3NDN A;  3E2Z B;  3UWC A;  1ORD A;  3IF2 A;  1X28 A;  1QZ9 A;  4GSA A;  1CJ0 A;  4Y0D A;  4UOY A;  2EPJ A;  1DGE A;  4A00 A;  1KMK A;  1OAT A;  2O0R A;  3JWA A;  1TOE A;  3MAF A;  1QJ5 A;  1W7L A;  3EI5 A;  2WK8 A;  2QLR A;  3DXW A;  4IXZ A;  3P6K A;  4RKC A;  4CVQ A;  4EMY A;  4A6T A;  3NUI A;  2ZSM A;  2ZY3 A;  3AEJ A;  5HDM A;  1AAM A;  4MY5 A;  3BV0 A;  4F5I A;  2AY9 A;  2JGT A;  3E2F A;  2AY5 A;  5EUN A;  4CBR A;  4LC3 A;  5DJ1 A;  4ZSY A;  5D5S A;  1C7N A;  4W8I A;  3LWS A;  2HP2 A;  1MAQ A;  3JU7 A;  4TN4 A;  3WCN A;  1GC4 A;  4DQ6 A;  5BJ3 A;  7AAT A;  2PB2 A;  3A9X A;  4WBT A;  2HOX A;  3F9T A;  3FQ7 A;  3MC6 A;  3HQT A;  2BI5 A;  2YKX A;  2WKA A;  1CZE A;  2AY2 A;  2HZP A;  4K2B A;  1OXP A;  1N2T A;  2YCN A;  4RAE A;  3FFH A;  1ART A;  4GRX A;  4WLH A;  1WYV B;  2QBT A;  4WXB A;  3HMU A;  3F6T A;  2YKV A;  5E5I A;  3PJ0 A;  5HHY A;  3WX9 A;  2FN6 A;  2YCT A;  1TAT A;  1C7G A;  3L44 A;  2Z9X A;  2D65 A;  3QBO A;  1DJ9 A;  3GZC A;  1AKC A;  5DB5 A;  5EIG B;  2JJH A;  2AY7 A;  4KXK A;  1TAS A;  2QB2 A;  3PDX A;  3BN1 A;  1XEY A;  1AHG A;  3B8X A;  1ARH A;  4J8L A;  2FM1 A;  5FT4 A;  4DBC A;  4ZWV A;  3BWN A;  1MDO A;  3VK3 A;  1CL2 A;  3NNK A;  1JG8 A;  3ZZJ A;  1SFF A;  3AEM A;  3BB8 A;  3KGW A;  1YJS A;  4WYG A;  2Z9W A;  1P3W A;  3PGY A;  4M2M A;  3OKS A;  3HBX A;  3EI7 A;  2AY8 A;  4RJ0 A;  1AY4 A;  3NYU A;  1ASA A;  3T32 A;  4A0F A;  2E7J A;  3WY7 A;  2BYL A;  2R5C B;  1LKC A;  3FZ7 A;  5BJ4 A;  3VAX A;  3E6G A;  1LC7 A;  1YAA A;  3DR7 A;  2AY4 A;  2XH1 A;  2VGZ A;  1V2F A;  1I41 A;  4LNL A;  4OTL A;  4RIZ A;  4IY7 A;  3COG A;  4AO9 A;  2OGE A;  4MKJ A;  3VK4 A;  1LS3 A;  1N8P A;  1M0O A;  1D7S A;  2VMW A;  2BIG A;  3G7Q A;  2GB3 A;  2C0R A;  1BQD A;  1FG7 A;  1B5O A;  2W7D A;  3ELP A;  4WXF A;  1AHE A;  3GWP A;  2DKJ A;  2W7M A;  5E3K A;  1QJ3 A;  4WP0 A;  3MBB A;  3WLX A;  3JTX A;  4JF1 A;  3PA9 A;  1M0N A;  1YJY A;  4XK1 A;  1BS0 A;  3ASA A;  2D64 A;  4XJM A;  2Z1Z A;  1OHV A;  1MDX A;  2VI8 A;  3NUB A;  4U1T A;  3DR4 A;  5EUE A;  3KGX A;  1ASF A;  2X5D A;  2WK7 A;  1QIS A;  1SZU A;  2BI3 A;  2W7I A;  3CQ6 A;  3PD6 A;  3LV2 A;  1IX8 A;  4F5F A;  1BJW A;  2BIA A;  2R0T A;  2ZJG A;  1ZC9 A;  3FSL A;  2HUU A;  5D95 A;  3HVY A;  2E7U A;  2HOY A;  3DU4 A;  2VIB A;  1TPL A;  3QN6 A;  4ZAH A;  2CTZ A;  3FRK A;  1IJI A;  1KKP A;  4W1X A;  2AEV A;  3FVU A;  2BWO A;  4E77 A;  1WST A;  1ELU A;  3NYS A;  5FT5 A;  2VMY A;  2DOU A;  2Z1Y A;  2HOZ A;  4IYO A;  4KAM A;  4KYO A;  4ADE A;  1IAX A;  1ASC A;  4ISY A;  3MAD A;  4IW7 A;  4R5F A;  4GDY A;  1WKH A;  2R5E A;  2V0Y A;  4IXO A;  4EU1 A;  1WYT A;  4QGR A;  4UHN A;  3LVJ A;  3AOV A;  3EUC A;  2CB1 A;  1C9C A;  3BC8 A;  2QA3 A;  3K7Y A;  1WKG A;  4WXG A;  4ITX A;  3A9Z A;  3EIB A;  3NTJ A;  4ADC A;  5C6U A;  2W7G A;  1IX7 A;  3NYT A;  3CAI A;  3N5M A;  1ARS A;  3W1I A;  3M5U A;  4F5H A;  4J5U A;  3QHX A;  1W7M A;  1AJS B;  1V72 A;  1SPA A;  3RBL A;  2DR1 A;  4GEB A;  3W1H A;  4ZDP A;  2YRI A;  3ELE A;  4ZDL A;  4R8D A;  5G09 A;  1M0Q A;  3AOW A;  4K2M A;  4M2J A;  3D6K A;  3AEO A;  3K40 A;  3K28 A;  1BJ4 A;  1TOK A;  2JJE A;  3AEJ C;  3QM2 A;  3HLM A;  1CZC A;  3MAF B;  3ATH A;  1GD9 A;  2BI9 A;  3I4J A;  4JEV A;  1IVR A;  2ZP7 A;  3B1E A;  1M4N A;  4EB5 A;  1ASD A;  3PDB A;  4Q76 A;  4FFC A;  4BA4 A;  4N0W A;  2AAT A;  2W7K A;  3DC1 A;  3MC6 C;  2CIN A;  4OCA A;  3WCO A;  5LH9 A;  2EZ2 A;  1IAY A;  4U2H A;  4JEZ A;  2VMX A;  2W8V A;  4MQP A;  3B1D A;  1OHW A;  4P3M A;  5TF5 A;  2O7C A;  2BYJ A;  2ZY4 A;  1AIB A;  1B5P A;  2Z61 A;  3UAK A;  1T3I A;  2GMS A;  4FL0 A;  1DJU A;  3CBF A;  4PVF A;  4ZLV A;  1S08 A;  2D66 A;  1B9H A;  1MLZ A;  5G4I A;  2W7L A;  1QGN A;  1QIR A;  1BJO A;  1TAR A;  1GEY A;  3LY1 A;  4N0B A;  1AHF A;  2E7I A;  4WLJ A;  1WYU A;  3ISL A;  3GSB A;  4PIW A;  1X2A A;  2YOB A;  3BWN C;  1AKB A;  1AHY A;  1X29 A;  1CL1 A;  3NU8 A;  3GR9 A;  2AY3 A;  2CST A;  4Q31 A;  1AMS A;  1J32 A;  3HDO A;  5F8V A;  1MGV A;  1DJE A;  2TPL A;  1VP4 A;  3AEM C;  3LG0 A;  5DX5 A;  1V2D A;  3PIU A;  2CY8 A;  3G0T A;  4ZM4 A;  1H0C A;  3R9A A;  4ZDO A;  4ZSW A;  1YJZ A;  3VP6 A;  1RVY A;  4IXS A;  3WKR A;  2BHX A;  2EZ1 A;  1RV4 A;  2GSA A;  3PAA A;  3RBF A;  4ADD A;  2R2N A;  4P7Y A;  1S0A A;  1SZK A;  2CJG A;  2FNI A;  4ATQ A;  3ECD A;  4RJY A;  4AZK A;  3AAT A;  4JF0 A;  4JEX A;  1E5E A;  1AJR A;  1C7O A;  3FZ8 A;  3MEB A;  1GDE A;  2X3L A;  3EI6 A;  3E9K A;  4JEY A;  1AX4 A;  3HT4 A;  3NX3 A;  3OP7 A;  3I16 A;  2C7T A;  3DZZ A;  5EQC A;  2BWN A;  4RKD A;  4UHO A;  4BMK A;  2YKU A;  5EUD A;  3CQ4 A;  4BHD A;  2VGW A;  2W7E A;  5G4J A;  1JF9 A;  3TCM A;  1LW4 A;  1AY5 A;  4LNJ A;  1ARI A;  2YRR A;  3TQX A;  2G6W A;  4I8A A;  1UU0 A;  1VJO A;  1TOG A;  3GBX A;  4A6R A;  1CQ6 A;  2Z9V A;  4WYD A;  2VMO A;  2VGS A;  3DXV A;  3N75 A;  3GJU A;  1UU2 A;  1ASB A;  1ASM A;  1SVV A;  2CJD A;  2XBN A;  3KKI A;  3EI8 A;  2VLF A;  3QGU A;  1D7V A;  1V2E A;  4ATP A;  1DTY A;  4B98 A;  9AAT A;  1YNU A;  3DYD A;  4F5G A;  2ORD A;  1D7R A;  2VGV A;  1Y4I A;  4ZM3 A;  3FQA A;  4XQ2 A;  1BT4 A;  1ASN A;  5G2P A;  4E3R A;  5JAY A;  3RCH A;  2OKK A;  2HOR A;  1MAP A;  5LHA A;  2E54 A;  1I29 A;  1XI9 A;  1D7U A;  1GC3 A;  3AV7 A;  5EAA A;  1RVU A;  1AHX A;  3ZRP A;  4Y0H A;  1UU1 A;  4ZAS A;  4IYO B;  3FZ6 A;  1TOJ A;  2W7F A;  4AZJ A;  4F5M A;  3B46 A;  2OKJ A;  1WYT B;  3B1C A;  3DRD A;  4WYC A;  4EFF A;  1O4S A;  2JJG A;  1GBN A;  4JE5 D;  3FDD A;  1ASL A;  4XJL A;  3IHJ A;  4AOA A;  4W1V A;  4CXQ A;  1ASG A;  1AIA A;  2HP1 A;  3FFR A;  2CH2 A;  3DOD A;  1W3U A;  2Z67 A;  3USF A;  3GZD A;  4TMR A;  1S09 A;  4UQV A;  5DJ9 A;  3EZS A;  2FNU A;  2DGK A;  3AEN A;  3FVX A;  3WGC A;  3WZF A;  2VMU A;  2D7Z A;  4GE9 A;  1ASE A;  2CJH A;  2AEU A;  1S07 A;  5G2Q A;  1LC5 A;  4WB0 A;  5E4Z A;  3R4T A;  4MKK A;  3FKD A;  4OT8 A;  4ITG A;  2ZY2 A;  3VK2 A;  4MGR A;  4F5J A;  3N0L A;  4R5Z A;  4R2N A;  2VMN A;  2Z9U A;  1YOO A;  1B8G A;  1U08 A;  1CQ7 A;  1GCK A;  1EQB A;  1OHY A;  3FTB A;  1BQA A;  2FYF A;  4ZWM A;  1O69 A;  3VOM A;  4E1O A;  2Z20 A;  1ARG A;  1PFF A;  2X5F A;  3A8U X;  5G0A A;  2BIE A;  3WKS A;  5K8B A;  1E5F A;  1IX6 A;  2GQN A;  2CAN A;  3BWO A;  1KMJ A;  2CH1 A;  1KKJ A;  3QPG A;  3PDB B;  5FT8 A;  3E2Z A;  3G8M A;  5FT6 A;  2VGT A;  4A0H A;  3RUY A;  3MKJ A;  4CBS A;  3TFT A;  2VGU A;  4MQQ A;  1G4V A;  3UE8 A;  2WK9 A;  1DKA A;  4BA5 A;  1C4K A;  1M6S A;  1B4X A;  1I43 A;  4K2I A;  1BJN A;  2VIA A;  2OAT A;  2EH6 A;  4HVK A;  3WGB A;  3MAU A;  3ASB A;  2DGM A;  4OMA A;  2QMA A;  1AY8 A;  1N31 A;  1KL1 A;  2V1P A;  1Z7D A;  1LC8 A;  3TAT A;  3QI6 A;  1BJO B;  2O1B A;  1YIY A;  2W8U A;  4E3Q A;  1WYU B;  4WYE A;  2W8W A;  3I5T A;  2W8J A;  4CXR A;  1EG5 A;  3JW9 A;  1RV3 A;  4OBV A;  2HUF A;  3LVK A;  1W23 A;  5M4B A;  4F5L A;  4A0R A;  2ZSL A;  4NOG A;  1LK9 A;  1G4X A;  1SZS A;  3H14 A;  5EFS A;  3E2Y A;  4M2K A;  2JIS A;  2JG2 A;  1WYV A;  2VMP A;  1GC2 A;  2ZY5 A;  3EIA A;  5M4D A; 
#chains in the Genus database with same CATH topology
 2BI2 A;  1O61 A;  1ZOB A;  1I48 A;  3LVL B;  4W1W A;  2VI9 A;  2PO3 A;  3H7F A;  4F5K A;  1M0P A;  3BCB A;  1FG3 A;  2GMU A;  5EIG A;  3BCA A;  4WD2 A;  1O62 A;  2AY6 A;  2BKW A;  2YKY A;  1ZOD A;  3F0H A;  1SF2 A;  3BS8 A;  4L0O A;  3FQ8 A;  2FQ6 A;  1AIC A;  2CFB A;  4A72 A;  1C0N A;  2DGL A;  4A0G A;  3RQ1 A;  1JS3 A;  1DGD A;  4Q6R A;  1KL2 A;  2RFV A;  3EZ1 A;  3JWB A;  3CQ5 A;  4WYF A;  2W8T A;  4LW2 A;  1AAW A;  1PG8 A;  2X8U A;  4PFF A;  1YIZ A;  1BW0 A;  2R5C A;  4JE5 A;  1G7W A;  4UHM A;  5IWQ A;  3ZRR A;  4W91 A;  2JJF A;  1KAF A;  2BWP A;  1BKG A;  1VEF A;  4A6U A;  2VYC A;  2F8J A;  3NRA A;  1GEX A;  3W1J A;  1CQ8 A;  3ACZ A;  3FVS A;  3HL2 A;  1CS1 A;  1ECX A;  5M46 A;  2VMS A;  4O6Z A;  3TFU A;  1B9I A;  1D2F A;  3AEP A;  3PD6 B;  4GE7 A;  2Q7W A;  2VMZ A;  4Q75 A;  5F9S A;  1MLY A;  3RCH B;  2HUI A;  1QIT A;  3NU7 A;  4XAU A;  5J8Q A;  1FC4 A;  4LNM A;  3Q8N A;  1M7Y A;  1DFO A;  1EJI A;  4GE4 A;  4MQR A;  4OYT A;  4IX8 A;  2QSR A;  2C44 A;  1AMR A;  2QB3 A;  4BQ0 A;  4B9B A;  1TOI A;  1JS6 A;  1AMA A;  3ZZK A;  3GZD C;  4TV7 A;  1GEW A;  1M32 A;  3FD0 A;  3E77 A;  4XJO A;  4AO4 A;  1S06 A;  5HXX A;  3GET A;  2D7Y A;  2BI1 A;  2ZC0 A;  2VMV A;  2DKB A;  2D61 A;  3A9Y A;  5I92 A;  2FKI A;  2ZYJ A;  4XEW A;  4Y0I A;  4XJP A;  2VMT A;  4EB7 A;  3AEN B;  4WYA A;  1J04 A;  3RI6 A;  2PB0 A;  4LW4 A;  4AH3 A;  4W5K A;  4MSO A;  2W7J A;  4HF8 A;  4WB0 B;  2VMQ A;  2VLH A;  1IBJ A;  2D63 A;  3EI9 A;  1UKJ A;  4RLG A;  4OBU A;  2W7H A;  1LW5 A;  4H51 A;  4DGT A;  3JZL A;  3FDB A;  5AX8 A;  1PMO A;  1H1C A;  2YHK A;  1G7X A;  5M49 A;  3PPL A;  1GC0 A;  1AMQ A;  2OGA A;  1AKA A;  3LVM A;  2NMP A;  2EO5 A;  3FCR A;  3ZRQ A;  3A2B A;  8AAT A;  2D5Y A;  1X0M A;  1Z3Z A;  4JEW A;  3AEL A;  4OC9 A;  1AJS A;  1IUG A;  4RM1 A;  5EAV A;  1PMM A;  2OQX A;  3BCX A;  2C81 A;  3KE3 A;  4ADB A;  3P1T A;  3L8A A;  2YCP A;  4PFN A;  1W7N A;  1OXO A;  2VMR A;  2ZUK A;  1ELQ A;  4RIT A;  2EGY A;  4F4E A;  1MDZ A;  3II0 A;  2AY1 A;  3NDN A;  3E2Z B;  3UWC A;  1ORD A;  3IF2 A;  1X28 A;  1QZ9 A;  4GSA A;  1CJ0 A;  4Y0D A;  4UOY A;  2EPJ A;  1DGE A;  4A00 A;  1KMK A;  1OAT A;  2O0R A;  3JWA A;  1TOE A;  3MAF A;  1QJ5 A;  1W7L A;  3EI5 A;  2WK8 A;  2QLR A;  3DXW A;  4IXZ A;  3P6K A;  4RKC A;  4CVQ A;  4EMY A;  4A6T A;  3NUI A;  2ZSM A;  2ZY3 A;  3AEJ A;  5HDM A;  1AAM A;  4MY5 A;  3BV0 A;  4F5I A;  2AY9 A;  2JGT A;  3E2F A;  2AY5 A;  5EUN A;  4CBR A;  4LC3 A;  5DJ1 A;  4ZSY A;  5D5S A;  1C7N A;  4W8I A;  3LWS A;  2HP2 A;  1MAQ A;  3JU7 A;  4TN4 A;  3WCN A;  1GC4 A;  4DQ6 A;  5BJ3 A;  7AAT A;  2PB2 A;  3A9X A;  4WBT A;  2HOX A;  3F9T A;  3FQ7 A;  3MC6 A;  3HQT A;  2BI5 A;  2YKX A;  2WKA A;  1CZE A;  2AY2 A;  2HZP A;  4K2B A;  1OXP A;  1N2T A;  2YCN A;  4RAE A;  3FFH A;  1ART A;  4GRX A;  4WLH A;  1WYV B;  2QBT A;  4WXB A;  3HMU A;  3F6T A;  2YKV A;  5E5I A;  3PJ0 A;  5HHY A;  3WX9 A;  2FN6 A;  2YCT A;  1TAT A;  1C7G A;  3L44 A;  2Z9X A;  2D65 A;  3QBO A;  1DJ9 A;  3GZC A;  1AKC A;  5DB5 A;  5EIG B;  2JJH A;  2AY7 A;  4KXK A;  1TAS A;  2QB2 A;  3PDX A;  3BN1 A;  1XEY A;  1AHG A;  3B8X A;  1ARH A;  4J8L A;  2FM1 A;  5FT4 A;  4DBC A;  4ZWV A;  3BWN A;  1MDO A;  3VK3 A;  1CL2 A;  3NNK A;  1JG8 A;  3ZZJ A;  1SFF A;  3AEM A;  3BB8 A;  3KGW A;  1YJS A;  4WYG A;  2Z9W A;  1P3W A;  3PGY A;  4M2M A;  3OKS A;  3HBX A;  3EI7 A;  2AY8 A;  4RJ0 A;  1AY4 A;  3NYU A;  1ASA A;  3T32 A;  4A0F A;  2E7J A;  3WY7 A;  2BYL A;  2R5C B;  1LKC A;  3FZ7 A;  5BJ4 A;  3VAX A;  3E6G A;  1LC7 A;  1YAA A;  3DR7 A;  2AY4 A;  2XH1 A;  2VGZ A;  1V2F A;  1I41 A;  4LNL A;  4OTL A;  4RIZ A;  4IY7 A;  3COG A;  4AO9 A;  2OGE A;  4MKJ A;  3VK4 A;  1LS3 A;  1N8P A;  1M0O A;  1D7S A;  2VMW A;  2BIG A;  3G7Q A;  2GB3 A;  2C0R A;  1BQD A;  3N7N A;  1FG7 A;  1B5O A;  2W7D A;  3ELP A;  4WXF A;  1AHE A;  3GWP A;  2DKJ A;  2W7M A;  5E3K A;  1QJ3 A;  4WP0 A;  3MBB A;  3WLX A;  3JTX A;  4JF1 A;  3PA9 A;  1M0N A;  1YJY A;  4XK1 A;  1BS0 A;  3ASA A;  2D64 A;  4XJM A;  2Z1Z A;  1OHV A;  1MDX A;  2VI8 A;  3NUB A;  4U1T A;  3DR4 A;  5EUE A;  3KGX A;  1ASF A;  2X5D A;  2WK7 A;  3N4X A;  1QIS A;  1SZU A;  2BI3 A;  2W7I A;  3CQ6 A;  3PD6 A;  3LV2 A;  1IX8 A;  4F5F A;  1BJW A;  2BIA A;  2R0T A;  2ZJG A;  1ZC9 A;  3FSL A;  2HUU A;  5D95 A;  3HVY A;  2E7U A;  2HOY A;  3DU4 A;  2VIB A;  1TPL A;  3QN6 A;  4ZAH A;  2CTZ A;  3FRK A;  1IJI A;  1KKP A;  4W1X A;  2AEV A;  3FVU A;  2BWO A;  4E77 A;  1WST A;  1ELU A;  3NYS A;  5FT5 A;  2VMY A;  2DOU A;  2Z1Y A;  2HOZ A;  4IYO A;  4KAM A;  4KYO A;  4ADE A;  1IAX A;  1ASC A;  4ISY A;  3MAD A;  4IW7 A;  4R5F A;  4GDY A;  1WKH A;  2R5E A;  2V0Y A;  4IXO A;  4EU1 A;  1WYT A;  4QGR A;  4UHN A;  3LVJ A;  3AOV A;  3EUC A;  2CB1 A;  1C9C A;  3BC8 A;  2QA3 A;  3K7Y A;  1WKG A;  4WXG A;  5KTB A;  4ITX A;  3A9Z A;  2EYQ A;  3EIB A;  3NTJ A;  4ADC A;  5C6U A;  2W7G A;  1IX7 A;  3NYT A;  3CAI A;  3N5M A;  1ARS A;  3W1I A;  3M5U A;  4F5H A;  4J5U A;  3QHX A;  1W7M A;  1AJS B;  1V72 A;  1SPA A;  3RBL A;  2DR1 A;  4GEB A;  2G7J A;  3W1H A;  4ZDP A;  2YRI A;  3ELE A;  4ZDL A;  4R8D A;  5G09 A;  1M0Q A;  3AOW A;  4K2M A;  4M2J A;  3D6K A;  3AEO A;  3K40 A;  3K28 A;  4K05 A;  1BJ4 A;  1TOK A;  2JJE A;  3AEJ C;  3QM2 A;  3HLM A;  1CZC A;  3MAF B;  3ATH A;  3N4R A;  1GD9 A;  2BI9 A;  3I4J A;  4JEV A;  1IVR A;  2KFP A;  2ZP7 A;  3B1E A;  1M4N A;  4EB5 A;  1ASD A;  3PDB A;  4Q76 A;  4FFC A;  4BA4 A;  4N0W A;  2AAT A;  2W7K A;  3DC1 A;  3MC6 C;  2CIN A;  4OCA A;  3WCO A;  5LH9 A;  2EZ2 A;  1IAY A;  4U2H A;  4JEZ A;  2VMX A;  2W8V A;  4MQP A;  3B1D A;  1OHW A;  4P3M A;  5TF5 A;  2O7C A;  2BYJ A;  2ZY4 A;  1AIB A;  1B5P A;  2Z61 A;  3UAK A;  1T3I A;  2GMS A;  4FL0 A;  1DJU A;  3CBF A;  4PVF A;  3N4S A;  4ZLV A;  1S08 A;  2D66 A;  1B9H A;  1MLZ A;  5G4I A;  2W7L A;  1QGN A;  1QIR A;  1BJO A;  1TAR A;  1GEY A;  3LY1 A;  4N0B A;  1AHF A;  2E7I A;  4WLJ A;  1WYU A;  3ISL A;  3GSB A;  4PIW A;  1X2A A;  2YOB A;  3BWN C;  1AKB A;  1AHY A;  1X29 A;  1CL1 A;  3NU8 A;  3GR9 A;  2AY3 A;  2CST A;  4Q31 A;  1AMS A;  1J32 A;  3HDO A;  5F8V A;  3H9X A;  1MGV A;  1DJE A;  2TPL A;  1VP4 A;  3AEM C;  3LG0 A;  5DX5 A;  1V2D A;  3PIU A;  2CY8 A;  3G0T A;  4ZM4 A;  1H0C A;  3R9A A;  4ZDO A;  4ZSW A;  1YJZ A;  3VP6 A;  1RVY A;  4IXS A;  3WKR A;  2BHX A;  2EZ1 A;  1RV4 A;  2GSA A;  3PAA A;  3RBF A;  4ADD A;  2R2N A;  4P7Y A;  1S0A A;  1SZK A;  2CJG A;  2FNI A;  4ATQ A;  3ECD A;  4RJY A;  4AZK A;  3AAT A;  4JF0 A;  4JEX A;  1E5E A;  1AJR A;  1C7O A;  3FZ8 A;  3MEB A;  1GDE A;  2X3L A;  3EI6 A;  3E9K A;  4JEY A;  1AX4 A;  3HT4 A;  3NX3 A;  3OP7 A;  3I16 A;  2C7T A;  3DZZ A;  5EQC A;  2BWN A;  4RKD A;  4UHO A;  4BMK A;  2YKU A;  5EUD A;  3CQ4 A;  4BHD A;  2VGW A;  2W7E A;  5G4J A;  1JF9 A;  3TCM A;  1LW4 A;  1AY5 A;  4LNJ A;  1ARI A;  2YRR A;  3TQX A;  2G6W A;  4I8A A;  1UU0 A;  1VJO A;  1TOG A;  3GBX A;  4A6R A;  4H63 Q;  1CQ6 A;  2Z9V A;  4WYD A;  2VMO A;  2VGS A;  3DXV A;  3N75 A;  3GJU A;  1UU2 A;  1ASB A;  1ASM A;  1SVV A;  2CJD A;  2XBN A;  3KKI A;  3EI8 A;  2VLF A;  3QGU A;  1D7V A;  1V2E A;  4ATP A;  1DTY A;  4B98 A;  9AAT A;  1YNU A;  3DYD A;  4F5G A;  2ORD A;  1D7R A;  2VGV A;  1Y4I A;  4ZM3 A;  3FQA A;  4XQ2 A;  1BT4 A;  1ASN A;  5G2P A;  4E3R A;  5JAY A;  3RCH A;  2OKK A;  2HOR A;  1MAP A;  5LHA A;  2E54 A;  1I29 A;  1XI9 A;  1D7U A;  1GC3 A;  3AV7 A;  5EAA A;  1RVU A;  1AHX A;  3ZRP A;  4Y0H A;  1UU1 A;  4ZAS A;  4IYO B;  3FZ6 A;  1TOJ A;  2W7F A;  4AZJ A;  4F5M A;  3B46 A;  2OKJ A;  1WYT B;  3B1C A;  3DRD A;  4WYC A;  4EFF A;  1O4S A;  2JJG A;  1GBN A;  4JE5 D;  3FDD A;  1ASL A;  4XJL A;  3IHJ A;  4AOA A;  4W1V A;  4CXQ A;  1ASG A;  1AIA A;  2HP1 A;  3FFR A;  2CH2 A;  3DOD A;  1W3U A;  2Z67 A;  3USF A;  3GZD A;  4TMR A;  1S09 A;  4UQV A;  5DJ9 A;  3EZS A;  2FNU A;  2DGK A;  3AEN A;  3FVX A;  3WGC A;  3WZF A;  2VMU A;  2D7Z A;  4GE9 A;  1ASE A;  2CJH A;  2AEU A;  1S07 A;  5G2Q A;  1LC5 A;  4WB0 A;  5E4Z A;  3R4T A;  4MKK A;  3FKD A;  4OT8 A;  4ITG A;  2ZY2 A;  3VK2 A;  4MGR A;  4F5J A;  2WB6 A;  3N0L A;  4R5Z A;  4R2N A;  2VMN A;  2Z9U A;  1YOO A;  1B8G A;  1U08 A;  1CQ7 A;  1GCK A;  1EQB A;  1OHY A;  3FTB A;  1BQA A;  2FYF A;  4ZWM A;  1O69 A;  3VOM A;  4E1O A;  2Z20 A;  1ARG A;  1PFF A;  2X5F A;  3A8U X;  5G0A A;  2BIE A;  3WKS A;  5K8B A;  1E5F A;  2A1V A;  1IX6 A;  2GQN A;  2CAN A;  3BWO A;  1KMJ A;  2CH1 A;  1KKJ A;  3QPG A;  3PDB B;  5FT8 A;  3E2Z A;  3G8M A;  5FT6 A;  2VGT A;  4A0H A;  3RUY A;  3MKJ A;  4CBS A;  3TFT A;  2VGU A;  4MQQ A;  1G4V A;  3UE8 A;  2WK9 A;  1DKA A;  4BA5 A;  1C4K A;  1M6S A;  1B4X A;  1I43 A;  4K2I A;  1BJN A;  2VIA A;  2OAT A;  2EH6 A;  4HVK A;  3WGB A;  3MAU A;  3ASB A;  2DGM A;  4OMA A;  2QMA A;  1AY8 A;  1N31 A;  1KL1 A;  2V1P A;  1Z7D A;  1LC8 A;  3TAT A;  3QI6 A;  1BJO B;  2O1B A;  1YIY A;  2W8U A;  4E3Q A;  1WYU B;  4WYE A;  2W8W A;  3I5T A;  2W8J A;  4CXR A;  1EG5 A;  3JW9 A;  1RV3 A;  4OBV A;  2HUF A;  3LVK A;  1W23 A;  5M4B A;  4F5L A;  4A0R A;  2ZSL A;  4NOG A;  1LK9 A;  1G4X A;  1SZS A;  3H14 A;  5EFS A;  3E2Y A;  4M2K A;  2JIS A;  2JG2 A;  1WYV A;  2VMP A;  1GC2 A;  2ZY5 A;  3EIA A;  5M4D A; 
#chains in the Genus database with same CATH homology
 2BI2 A;  1O61 A;  1ZOB A;  1I48 A;  3LVL B;  4W1W A;  2VI9 A;  2PO3 A;  3H7F A;  4F5K A;  1M0P A;  3BCB A;  1FG3 A;  2GMU A;  5EIG A;  3BCA A;  4WD2 A;  1O62 A;  2AY6 A;  2BKW A;  2YKY A;  1ZOD A;  3F0H A;  1SF2 A;  3BS8 A;  4L0O A;  3FQ8 A;  2FQ6 A;  1AIC A;  2CFB A;  4A72 A;  1C0N A;  2DGL A;  4A0G A;  3RQ1 A;  1JS3 A;  1DGD A;  4Q6R A;  1KL2 A;  2RFV A;  3EZ1 A;  3JWB A;  3CQ5 A;  4WYF A;  2W8T A;  4LW2 A;  1AAW A;  1PG8 A;  2X8U A;  4PFF A;  1YIZ A;  1BW0 A;  2R5C A;  4JE5 A;  1G7W A;  4UHM A;  5IWQ A;  3ZRR A;  4W91 A;  2JJF A;  2BWP A;  1BKG A;  1VEF A;  4A6U A;  2VYC A;  2F8J A;  3NRA A;  1GEX A;  3W1J A;  1CQ8 A;  3ACZ A;  3FVS A;  3HL2 A;  1CS1 A;  1ECX A;  5M46 A;  2VMS A;  4O6Z A;  3TFU A;  1B9I A;  1D2F A;  3AEP A;  3PD6 B;  4GE7 A;  2Q7W A;  2VMZ A;  4Q75 A;  5F9S A;  1MLY A;  3RCH B;  2HUI A;  1QIT A;  3NU7 A;  4XAU A;  5J8Q A;  1FC4 A;  4LNM A;  3Q8N A;  1M7Y A;  1DFO A;  1EJI A;  4GE4 A;  4MQR A;  4OYT A;  4IX8 A;  2QSR A;  2C44 A;  1AMR A;  2QB3 A;  4BQ0 A;  4B9B A;  1TOI A;  1JS6 A;  1AMA A;  3ZZK A;  3GZD C;  4TV7 A;  1GEW A;  1M32 A;  3FD0 A;  3E77 A;  4XJO A;  4AO4 A;  1S06 A;  5HXX A;  3GET A;  2D7Y A;  2BI1 A;  2ZC0 A;  2VMV A;  2DKB A;  2D61 A;  3A9Y A;  5I92 A;  2FKI A;  2ZYJ A;  4XEW A;  4Y0I A;  4XJP A;  2VMT A;  4EB7 A;  3AEN B;  4WYA A;  1J04 A;  3RI6 A;  2PB0 A;  4LW4 A;  4AH3 A;  4W5K A;  4MSO A;  2W7J A;  4HF8 A;  4WB0 B;  2VMQ A;  2VLH A;  1IBJ A;  2D63 A;  3EI9 A;  1UKJ A;  4RLG A;  4OBU A;  2W7H A;  1LW5 A;  4H51 A;  4DGT A;  3JZL A;  3FDB A;  5AX8 A;  1PMO A;  1H1C A;  2YHK A;  1G7X A;  5M49 A;  3PPL A;  1GC0 A;  1AMQ A;  2OGA A;  1AKA A;  3LVM A;  2NMP A;  2EO5 A;  3FCR A;  3ZRQ A;  3A2B A;  8AAT A;  2D5Y A;  1X0M A;  1Z3Z A;  4JEW A;  3AEL A;  4OC9 A;  1AJS A;  1IUG A;  4RM1 A;  5EAV A;  1PMM A;  2OQX A;  3BCX A;  2C81 A;  3KE3 A;  4ADB A;  3P1T A;  3L8A A;  2YCP A;  4PFN A;  1W7N A;  1OXO A;  2VMR A;  2ZUK A;  1ELQ A;  4RIT A;  2EGY A;  4F4E A;  1MDZ A;  3II0 A;  2AY1 A;  3NDN A;  3E2Z B;  3UWC A;  1ORD A;  3IF2 A;  1X28 A;  1QZ9 A;  4GSA A;  1CJ0 A;  4Y0D A;  4UOY A;  2EPJ A;  1DGE A;  4A00 A;  1KMK A;  1OAT A;  2O0R A;  3JWA A;  1TOE A;  3MAF A;  1QJ5 A;  1W7L A;  3EI5 A;  2WK8 A;  2QLR A;  3DXW A;  4IXZ A;  3P6K A;  4RKC A;  4CVQ A;  4EMY A;  4A6T A;  3NUI A;  2ZSM A;  2ZY3 A;  3AEJ A;  5HDM A;  1AAM A;  4MY5 A;  3BV0 A;  4F5I A;  2AY9 A;  2JGT A;  3E2F A;  2AY5 A;  5EUN A;  4CBR A;  4LC3 A;  5DJ1 A;  4ZSY A;  5D5S A;  1C7N A;  4W8I A;  3LWS A;  2HP2 A;  1MAQ A;  3JU7 A;  4TN4 A;  3WCN A;  1GC4 A;  4DQ6 A;  5BJ3 A;  7AAT A;  2PB2 A;  3A9X A;  4WBT A;  2HOX A;  3F9T A;  3FQ7 A;  3MC6 A;  3HQT A;  2BI5 A;  2YKX A;  2WKA A;  1CZE A;  2AY2 A;  2HZP A;  4K2B A;  1OXP A;  1N2T A;  2YCN A;  4RAE A;  3FFH A;  1ART A;  4GRX A;  4WLH A;  1WYV B;  2QBT A;  4WXB A;  3HMU A;  3F6T A;  2YKV A;  5E5I A;  3PJ0 A;  5HHY A;  3WX9 A;  2FN6 A;  2YCT A;  1TAT A;  1C7G A;  3L44 A;  2Z9X A;  2D65 A;  3QBO A;  1DJ9 A;  3GZC A;  1AKC A;  5DB5 A;  5EIG B;  2JJH A;  2AY7 A;  4KXK A;  1TAS A;  2QB2 A;  3PDX A;  3BN1 A;  1XEY A;  1AHG A;  3B8X A;  1ARH A;  4J8L A;  2FM1 A;  5FT4 A;  4DBC A;  4ZWV A;  3BWN A;  1MDO A;  3VK3 A;  1CL2 A;  3NNK A;  1JG8 A;  3ZZJ A;  1SFF A;  3AEM A;  3BB8 A;  3KGW A;  1YJS A;  4WYG A;  2Z9W A;  1P3W A;  3PGY A;  4M2M A;  3OKS A;  3HBX A;  3EI7 A;  2AY8 A;  4RJ0 A;  1AY4 A;  3NYU A;  1ASA A;  3T32 A;  4A0F A;  2E7J A;  3WY7 A;  2BYL A;  2R5C B;  1LKC A;  3FZ7 A;  5BJ4 A;  3VAX A;  3E6G A;  1LC7 A;  1YAA A;  3DR7 A;  2AY4 A;  2XH1 A;  2VGZ A;  1V2F A;  1I41 A;  4LNL A;  4OTL A;  4RIZ A;  4IY7 A;  3COG A;  4AO9 A;  2OGE A;  4MKJ A;  3VK4 A;  1LS3 A;  1N8P A;  1M0O A;  1D7S A;  2VMW A;  2BIG A;  3G7Q A;  2GB3 A;  2C0R A;  1BQD A;  3N7N A;  1FG7 A;  1B5O A;  2W7D A;  3ELP A;  4WXF A;  1AHE A;  3GWP A;  2DKJ A;  2W7M A;  5E3K A;  1QJ3 A;  4WP0 A;  3MBB A;  3WLX A;  3JTX A;  4JF1 A;  3PA9 A;  1M0N A;  1YJY A;  4XK1 A;  1BS0 A;  3ASA A;  2D64 A;  4XJM A;  2Z1Z A;  1OHV A;  1MDX A;  2VI8 A;  3NUB A;  4U1T A;  3DR4 A;  5EUE A;  3KGX A;  1ASF A;  2X5D A;  2WK7 A;  3N4X A;  1QIS A;  1SZU A;  2BI3 A;  2W7I A;  3CQ6 A;  3PD6 A;  3LV2 A;  1IX8 A;  4F5F A;  1BJW A;  2BIA A;  2R0T A;  2ZJG A;  1ZC9 A;  3FSL A;  2HUU A;  5D95 A;  3HVY A;  2E7U A;  2HOY A;  3DU4 A;  2VIB A;  1TPL A;  3QN6 A;  4ZAH A;  2CTZ A;  3FRK A;  1IJI A;  1KKP A;  4W1X A;  2AEV A;  3FVU A;  2BWO A;  4E77 A;  1WST A;  1ELU A;  3NYS A;  5FT5 A;  2VMY A;  2DOU A;  2Z1Y A;  2HOZ A;  4IYO A;  4KAM A;  4KYO A;  4ADE A;  1IAX A;  1ASC A;  4ISY A;  3MAD A;  4IW7 A;  4R5F A;  4GDY A;  1WKH A;  2R5E A;  2V0Y A;  4IXO A;  4EU1 A;  1WYT A;  4QGR A;  4UHN A;  3LVJ A;  3AOV A;  3EUC A;  2CB1 A;  1C9C A;  3BC8 A;  2QA3 A;  3K7Y A;  1WKG A;  4WXG A;  5KTB A;  4ITX A;  3A9Z A;  2EYQ A;  3EIB A;  3NTJ A;  4ADC A;  5C6U A;  2W7G A;  1IX7 A;  3NYT A;  3CAI A;  3N5M A;  1ARS A;  3W1I A;  3M5U A;  4F5H A;  4J5U A;  3QHX A;  1W7M A;  1AJS B;  1V72 A;  1SPA A;  3RBL A;  2DR1 A;  4GEB A;  2G7J A;  3W1H A;  4ZDP A;  2YRI A;  3ELE A;  4ZDL A;  4R8D A;  5G09 A;  1M0Q A;  3AOW A;  4K2M A;  4M2J A;  3D6K A;  3AEO A;  3K40 A;  3K28 A;  4K05 A;  1BJ4 A;  1TOK A;  2JJE A;  3AEJ C;  3QM2 A;  3HLM A;  1CZC A;  3MAF B;  3ATH A;  3N4R A;  1GD9 A;  2BI9 A;  3I4J A;  4JEV A;  1IVR A;  2KFP A;  2ZP7 A;  3B1E A;  1M4N A;  4EB5 A;  1ASD A;  3PDB A;  4Q76 A;  4FFC A;  4BA4 A;  4N0W A;  2AAT A;  2W7K A;  3DC1 A;  3MC6 C;  2CIN A;  4OCA A;  3WCO A;  5LH9 A;  2EZ2 A;  1IAY A;  4U2H A;  4JEZ A;  2VMX A;  2W8V A;  4MQP A;  3B1D A;  1OHW A;  4P3M A;  5TF5 A;  2O7C A;  2BYJ A;  2ZY4 A;  1AIB A;  1B5P A;  2Z61 A;  3UAK A;  1T3I A;  2GMS A;  4FL0 A;  1DJU A;  3CBF A;  4PVF A;  3N4S A;  4ZLV A;  1S08 A;  2D66 A;  1B9H A;  1MLZ A;  5G4I A;  2W7L A;  1QGN A;  1QIR A;  1BJO A;  1TAR A;  1GEY A;  3LY1 A;  4N0B A;  1AHF A;  2E7I A;  4WLJ A;  1WYU A;  3ISL A;  3GSB A;  4PIW A;  1X2A A;  2YOB A;  3BWN C;  1AKB A;  1AHY A;  1X29 A;  1CL1 A;  3NU8 A;  3GR9 A;  2AY3 A;  2CST A;  4Q31 A;  1AMS A;  1J32 A;  3HDO A;  5F8V A;  3H9X A;  1MGV A;  1DJE A;  2TPL A;  1VP4 A;  3AEM C;  3LG0 A;  5DX5 A;  1V2D A;  3PIU A;  2CY8 A;  3G0T A;  4ZM4 A;  1H0C A;  3R9A A;  4ZDO A;  4ZSW A;  1YJZ A;  3VP6 A;  1RVY A;  4IXS A;  3WKR A;  2BHX A;  2EZ1 A;  1RV4 A;  2GSA A;  3PAA A;  3RBF A;  4ADD A;  2R2N A;  4P7Y A;  1S0A A;  1SZK A;  2CJG A;  2FNI A;  4ATQ A;  3ECD A;  4RJY A;  4AZK A;  3AAT A;  4JF0 A;  4JEX A;  1E5E A;  1AJR A;  1C7O A;  3FZ8 A;  3MEB A;  1GDE A;  2X3L A;  3EI6 A;  3E9K A;  4JEY A;  1AX4 A;  3HT4 A;  3NX3 A;  3OP7 A;  3I16 A;  2C7T A;  3DZZ A;  5EQC A;  2BWN A;  4RKD A;  4UHO A;  4BMK A;  2YKU A;  5EUD A;  3CQ4 A;  4BHD A;  2VGW A;  2W7E A;  5G4J A;  1JF9 A;  3TCM A;  1LW4 A;  1AY5 A;  4LNJ A;  1ARI A;  2YRR A;  3TQX A;  2G6W A;  4I8A A;  1UU0 A;  1VJO A;  1TOG A;  3GBX A;  4A6R A;  4H63 Q;  1CQ6 A;  2Z9V A;  4WYD A;  2VMO A;  2VGS A;  3DXV A;  3N75 A;  3GJU A;  1UU2 A;  1ASB A;  1ASM A;  1SVV A;  2CJD A;  2XBN A;  3KKI A;  3EI8 A;  2VLF A;  3QGU A;  1D7V A;  1V2E A;  4ATP A;  1DTY A;  4B98 A;  9AAT A;  1YNU A;  3DYD A;  4F5G A;  2ORD A;  1D7R A;  2VGV A;  1Y4I A;  4ZM3 A;  3FQA A;  4XQ2 A;  1BT4 A;  1ASN A;  5G2P A;  4E3R A;  5JAY A;  3RCH A;  2OKK A;  2HOR A;  1MAP A;  5LHA A;  2E54 A;  1I29 A;  1XI9 A;  1D7U A;  1GC3 A;  3AV7 A;  5EAA A;  1RVU A;  1AHX A;  3ZRP A;  4Y0H A;  1UU1 A;  4ZAS A;  4IYO B;  3FZ6 A;  1TOJ A;  2W7F A;  4AZJ A;  4F5M A;  3B46 A;  2OKJ A;  1WYT B;  3B1C A;  3DRD A;  4WYC A;  4EFF A;  1O4S A;  2JJG A;  1GBN A;  4JE5 D;  3FDD A;  1ASL A;  4XJL A;  3IHJ A;  4AOA A;  4W1V A;  4CXQ A;  1ASG A;  1AIA A;  2HP1 A;  3FFR A;  2CH2 A;  3DOD A;  1W3U A;  2Z67 A;  3USF A;  3GZD A;  4TMR A;  1S09 A;  4UQV A;  5DJ9 A;  3EZS A;  2FNU A;  2DGK A;  3AEN A;  3FVX A;  3WGC A;  3WZF A;  2VMU A;  2D7Z A;  4GE9 A;  1ASE A;  2CJH A;  2AEU A;  1S07 A;  5G2Q A;  1LC5 A;  4WB0 A;  5E4Z A;  3R4T A;  4MKK A;  3FKD A;  4OT8 A;  4ITG A;  2ZY2 A;  3VK2 A;  4MGR A;  4F5J A;  2WB6 A;  3N0L A;  4R5Z A;  4R2N A;  2VMN A;  2Z9U A;  1YOO A;  1B8G A;  1U08 A;  1CQ7 A;  1GCK A;  1EQB A;  1OHY A;  3FTB A;  1BQA A;  2FYF A;  4ZWM A;  1O69 A;  3VOM A;  4E1O A;  2Z20 A;  1ARG A;  1PFF A;  2X5F A;  3A8U X;  5G0A A;  2BIE A;  3WKS A;  5K8B A;  1E5F A;  2A1V A;  1IX6 A;  2GQN A;  2CAN A;  3BWO A;  1KMJ A;  2CH1 A;  1KKJ A;  3QPG A;  3PDB B;  5FT8 A;  3E2Z A;  3G8M A;  5FT6 A;  2VGT A;  4A0H A;  3RUY A;  3MKJ A;  4CBS A;  3TFT A;  2VGU A;  4MQQ A;  1G4V A;  3UE8 A;  2WK9 A;  1DKA A;  4BA5 A;  1C4K A;  1M6S A;  1B4X A;  1I43 A;  4K2I A;  1BJN A;  2VIA A;  2OAT A;  2EH6 A;  4HVK A;  3WGB A;  3MAU A;  3ASB A;  2DGM A;  4OMA A;  2QMA A;  1AY8 A;  1N31 A;  1KL1 A;  2V1P A;  1Z7D A;  1LC8 A;  3TAT A;  3QI6 A;  1BJO B;  2O1B A;  1YIY A;  2W8U A;  4E3Q A;  1WYU B;  4WYE A;  2W8W A;  3I5T A;  2W8J A;  4CXR A;  1EG5 A;  3JW9 A;  1RV3 A;  4OBV A;  2HUF A;  3LVK A;  1W23 A;  5M4B A;  4F5L A;  4A0R A;  2ZSL A;  4NOG A;  1LK9 A;  1G4X A;  1SZS A;  3H14 A;  5EFS A;  3E2Y A;  4M2K A;  2JIS A;  2JG2 A;  1WYV A;  2VMP A;  1GC2 A;  2ZY5 A;  3EIA A;  5M4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...