1BL4A

Fkbp mutant f36v complexed with remodeled synthetic ligand
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506 BINDING PROTEIN)
publication title Redesigning an FKBP-ligand interface to generate chemical dimerizers with novel specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 27
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1bl4A00
1FKGA 2Y78A 4LAYA 1A7XA 5HT1A 2ZQTA 1Q6UA 2KFWA 1NMVA 2F2DA 2UZ5A 3O5KA 4NNRA 1Q6HA 2MNTA 2M1IA 1EQ3A 3UI4A 3KZ7A 1FJDA 1JNSA 2KE0A 1PINA 2ZR4A 1TCOC 3KABA 1J4HA 3KADA 3O5JA 2VN1A 4QT3A 4JFLA 3UQBA 3O5LA 3RGCA 4DRQA 3ODKA 2LKNA 3IHZA 5HUAA 2IF4A 3I6CA 5BXJA 1D7HA 4LAWA 2XPBA 2ZQVA 2DG4A 3H9RB 4GGQA 2PV2A 2XP8A 3O5DA 1FD9A 4O2TA 4ODNA 4R0XA 4W9OA 1J6YA 4ODRA 1ROTA 3KAIA 3OOBA 4TNSA 3MDYB 2D9FA 2PBCA 3KAFA 4ODQA 4ODKA 3TCZA 1QPFA 1FKBA 3O5QA 5HTGA 1PBKA 4IQ2A 1C9HA 1U79A 2LGOA 4U85A 1BL4A 3O5MA 5J6EA 3KCEA 1FKJA 2RUCA 3NTPA 1R9HA 2PPPA 2RUQA 4C02B 4ODMA 3O5IA 1KT0A 3JYMA 2MF9A 1B6CA 3VAWA 4U86A 1J4RA 1QZ2A 5HKGA 2PPNA 5B8IC 3CGNA 3JXVA 4J4OA 3UF8A 2M08A 5DITA 1Q1CA 3NI6A 1FAPA 1F8AB 4DT4A 4DRPA 5GPGA 2ZQUA 2PPOA 4JFIA 2RQSA 2PV1A 1EYMA 3O5GA 1D7JA 4J4NA 4N19A 1FKFA 4ODPA 4FAPA 2LJ4A 2XP4A 1JNTA 2XP7A 2ZQSA 2MLXA 3B7XA 4ODLA 4LAVA 3CGMA 2OFNA 4TX0A 5HW6A 5DIVA 1FKKA 1FKSA 4ODOA 2JZVA 4DROA 1YATA 2K8IA 4W9PA 3UI5A 2XP9A 1NSGA 3FAPA 1N1AA 3NRKA 1FKDA 2XP3A 1W26A 2MPHA 2XPAA 4TW8A 4G50A 1F40A 1P5QA 2N87A 4MGVA 1ROUA 4TW7A 3O5OA 1HXVA 4DZ3A 3UQIA 3JYJA 1NMWA 4JFMA 2DG3A 4JFJA 1D6OA 3O5PA 2FKEA 4DIPA 3RFWA 2XP5A 4TYOA 2ZR5A 1Q6IA 2LPVA 3IKGA 1M5YA 1T11A 2F21A 3TDBA 1FKIA 2L2SA 3WH0A 5D75A 3KAHA 3O5RA 1ZK6A 4DRIA 5HW8A 2F4EA 1L1PA 3KACA 3GPKA 1FKRA 2VCDA 2XP6A 3O5EA 3TC5A 4JFKA 4W9QA 2RSEA 4DRMA 4ITZA 4QIBA 4DZ2A 1FKTA 3KAGA 3IKDA 1YW5A 3EY6A 4MSPA 5HWCA 1FKLA 3O5FA 4LAXA 4DH0A 4DRHA 2FAPA 2KI3A 2KO7A 2MLZA 1KT1A 4BF8A 3UI6A 5HW7A 4QT2A 4GIVA 4DRJA 4IPXA 1J4IA 2KGJA 2M2AA 1BKFA 3PRDA 1Y0OA 1D7IA 1JVWA 3IK8A 1ZCNA 2Q5AA 4DRKA 4DRNA 2MLYA 4G2PA 5I98A 4IQCA 1QPLA 1FKHA 2ITKA 2DG9A 2KR7A 2RUDA 3LUOA 2PV3A 3PA7A 5DIUA 5HWBA 4TW6A 4JYSA 2ZR6A 3UQAA 4U84A 3PRBA 2RURA 4FN2A 2AWGA
chains in the Genus database with same CATH superfamily
3AROA 4LAYA 1NMVA 3ALFA 2UZ5A 3CHFA 1FJDA 2M1IA 2QF8A 3ARZA 4LGXA 1J4HA 3ARTA 2VN1A 4WIWA 1RD6A 4JFLA 3O5LA 2G41A 3RGCA 2IF4A 3I6CA 1D7HA 4Z2KA 5DF0A 4ZPVR 3H9RB 4DRPA 4O2TA 4W9OA 1J6YA 4ODRA 3KAFA 1X6LA 3TCZA 1FKBA 2LGOA 1VF8A 1FKJA 2FDMA 1E6ZA 2ETNA 3BXWA 3VAWA 1QZ2A 4W5UA 1GOIA 2A3BA 4DT4A 4MNLA 2PV1A 1EYMA 3O5GA 4P8WA 3B7XA 2ZQSA 3ARQA 4LAVA 4WKFA 4ODOA 2JZVA 1HKJA 1ZB5A 1N1AA 4ZS6A 2F23A 1HJVA 3GTYX 2PN0A 3OA5A 4DZ3A 3O5PA 1OGBA 4P8VA 4TYOA 3IKGA 3RMEA 3KAHA 3O5RA 3ARXA 3GPKA 3WIJA 2VCDA 4UDMA 3TC5A 4W9QA 4DZ2A 1ITXA 3IKDA 1FKLA 1WB0A 4XAKA 2MLZA 4DRJA 1J4IA 2KGJA 1HKMA 1Y0OA 3G6LA 2MLYA 4IQCA 1QPLA 2KR7A 1WAWA 3PRBA 2RURA 2WM0A 1FKGA 2Y78A 1A7XA 1LG1A 4MNKA 4NNRA 3KZ7A 1LJYA 2KE0A 4IT4A 3RM4A 2ZR4A 1NWTA 3KADA 3O5JA 1LL6A 3B9EA 3UQBA 3FY1A 4DRQA 3ODKA 4DWSA 5BXJA 4LAWA 1HKIA 4GGQA 2B31A 1FD9A 4R0XA 3KAIA 3OOBA 3WKZA 4TNSA 2YBTA 2PBCA 3CZ8A 5HTGA 1PBKA 2WK2A 1ZBKA 3WQVA 3KCEA 4ODMA 3JYMA 3G6MA 5HKGA 4U86A 1W1PA 4MNJA 3WD0A 2M08A 2EULA 3NI6A 1WNOA 3B9AA 3BMBA 3AS0A 2DSZA 1D7JA 4J4NA 2LJ4A 2XP4A 2XP7A 2DPEA 3CGMA 1GRJA 1W1YA 2OFNA 4KQZA 5HW6A 3ARVA 4DROA 1E9LA 2A3EA 3FAPA 2WLYA 3NRKA 1W26A 2XPAA 2A3AA 1UR9A 4TW8A 4G50A 3RM8A 1P5QA 3RM9A 3O5OA 1E6PA 1HXVA 1LG2A 1XRVA 3JYJA 4JFMA 1NWUA 2FKEA 2DSWA 3RFWA 4WKAA 2XP5A 4Z2IA 1Q6IA 1M5YA 2O9OA 4WKHA 1FKIA 2L2SA 4HBOA 2DSVA 1IX5A 3QOKA 1L1PA 3WD4A 1FKRA 3O5EA 4DRMA 1OWQA 3ARUA 1W9PA 5HWCA 1ZU8A 3ARYA 4DH0A 2KI3A 1EHNA 4QZVB 4IPXA 2M2AA 3FXYA 3PRDA 1D7IA 2Q5AA 4DRKA 4DRNA 4G2PA 2DG9A 4WJXA 1W1VA 3CHDA 2ZR6A 4JYSA 1E44A 5HBFA 4DWSC 4Q22A 1Q6UA 2F2DA 3O5KA 2MNTA 5DO2A 3ARSA 3CHCA 1JNSA 1E6RA 1TCOC 3KABA 3B9DA 4HBEA 4Z2HA 1GPFA 2ESCA 4WK9A 3IHZA 5HUAA 2ZQVA 2DG4A 4ODNA 2DT1A 2PV2A 2XP8A 3O5DA 4P8XA 3MDYB 1XHGA 4DWSB 1W1TA 4ODQA 1QPFA 3O5QA 4IQ2A 1U79A 4L72B 3O5MA 3AQUA 1O6IA 4C02B 3B8SA 2DT0A 1B6CA 4HARA 1J4RA 5DEZA 1TFVA 1NWSA 1EIBA 4S3JA 2B5UB 5DITA 3WD1A 1FAPA 1FFQA 1LL7A 5GPGA 2ZQUA 2PPOA 4MPKA 5JH8A 3AS2A 4ODLA 1UR8A 4TX0A 1FKKA 1YATA 1HJWA 3WD3A 1NSGA 1GUVA 4URIA 2MPHA 2DT3A 1F40A 2N87A 4MGVA 1ROUA 1HJXA 4IT6A 1SR0A 3UQIA 4DIPA 4Z2GA 2LPVA 1T11A 2F21A 2O92A 3WH0A 5D75A 5GPRA 3CH9A 4Q7NA 1ZK6A 4ML4A 2F4EA 3KACA 1E6NA 2XP6A 1JCHB 1SYTA 4QIBA 3EY6A 1ZBWA 4Z2JA 4LAXA 1KT1A 2WLZA 4QT2A 4MNMA 4NZCA 3IK8A 2RUDA 5DIUA 2PV3A 3PA7A 3WD2A 5HWBA 4U84A 4FN2A 1OGGA 2AWGA 5HT1A 3ALGA 2ZQTA 2KFWA 1Q6HA 1EQ3A 3UI4A 2A3CA 1NH6A 3WL1A 1PINA 3W4RA 4QT3A 4ZPTR 2LKNA 2DSUA 2XPBA 2OLHA 1ROTA 2D9FA 3CHEA 4ODKA 4AY1A 1C9HA 4U85A 1BL4A 1H0IA 4P8UA 5J6EA 2RUCA 3NTPA 4MAVA 1D2KA 1LQ0A 1JNDA 1R9HA 4ZPWR 1FFRA 1KFWA 2PPPA 2RUQA 2IUZA 3O5IA 1KT0A 2PI6A 2MF9A 2PPNA 3WL0A 3CGNA 3JXVA 2YBUA 5B8IC 4L3NA 4J4OA 3UF8A 1CTNA 1Q1CA 1ZL1A 1F8AB 1X6NA 1W9UA 4JFIA 2RQSA 4N19A 1JNEA 3EIPA 4KR0B 2AOSA 1FKFA 4ODPA 4FAPA 1JNTA 2MLXA 3PRAA 5DIVA 1FKSA 2K8IA 4W9PA 4R5EA 3UI5A 2XP9A 4Z2LA 2DT2A 4NSBA 1FKDA 2XP3A 3ARWA 4PTMA 1H0GA 4TW7A 1NMWA 2DG3A 4JFJA 1D6OA 3PR9A 2P4VA 2ZR5A 3TDBA 1NWRA 4DRIA 4MTVA 5HW8A 5GQBA 3GU0A 4S3KA 4JFKA 2RSEA 2G8ZA 4ITZA 3ARRA 1FKTA 4MSPA 1YW5A 1EDQA 3AS1A 3O5FA 4DRHA 2FAPA 2KO7A 4BF8A 3UI6A 1LL4A 5HW7A 1K9TA 4GIVA 4DWSD 1BKFA 1JVWA 1ZCNA 1HKKA 5I98A 1W9VA 1FKHA 2ITKA 3ARPA 1E15A 3LUOA 3AS3A 3WQWA 1ZBVA 4TW6A 3UQAA 3KAGA 1ZBCA
chains in the Genus database with same CATH topology
3AROA 4LAYA 1NMVA 3ALFA 2UZ5A 3CHFA 1FJDA 2M1IA 2QF8A 3ARZA 4LGXA 1J4HA 3ARTA 2VN1A 4WIWA 1RD6A 4JFLA 3O5LA 2G41A 3RGCA 2IF4A 3I6CA 1D7HA 4Z2KA 5DF0A 4ZPVR 3H9RB 4DRPA 4O2TA 4W9OA 1J6YA 4ODRA 3KAFA 1X6LA 3TCZA 1FKBA 2LGOA 1VF8A 1FKJA 2FDMA 1E6ZA 3BXWA 3VAWA 1QZ2A 4W5UA 1GOIA 2A3BA 4DT4A 4MNLA 2PV1A 1EYMA 3O5GA 4P8WA 3B7XA 2ZQSA 3ARQA 4LAVA 4WKFA 4ODOA 2JZVA 1HKJA 1ZB5A 1N1AA 4ZS6A 1HJVA 3OA5A 4DZ3A 3O5PA 1OGBA 4P8VA 4TYOA 3IKGA 3RMEA 3KAHA 3O5RA 3ARXA 3GPKA 3WIJA 2VCDA 3TC5A 4W9QA 4DZ2A 1ITXA 3IKDA 1FKLA 1WB0A 4XAKA 2MLZA 4DRJA 1J4IA 2KGJA 1HKMA 1Y0OA 3G6LA 2MLYA 4IQCA 1QPLA 2KR7A 1WAWA 3PRBA 2RURA 2WM0A 1FKGA 2Y78A 1A7XA 1LG1A 4MNKA 4NNRA 3KZ7A 1LJYA 2KE0A 4IT4A 3RM4A 2ZR4A 1NWTA 3KADA 3O5JA 1LL6A 3B9EA 3UQBA 3FY1A 4DRQA 3ODKA 4DWSA 5BXJA 4LAWA 1HKIA 4GGQA 2B31A 1FD9A 4R0XA 3KAIA 3OOBA 3WKZA 4TNSA 2YBTA 2PBCA 3CZ8A 5HTGA 1PBKA 2WK2A 1ZBKA 3WQVA 3KCEA 4ODMA 3JYMA 3G6MA 5HKGA 4U86A 1W1PA 4MNJA 3WD0A 2M08A 3NI6A 1WNOA 3B9AA 3AS0A 2DSZA 1D7JA 4J4NA 2LJ4A 2XP4A 2XP7A 2DPEA 3CGMA 1W1YA 2OFNA 4KQZA 5HW6A 3ARVA 4DROA 1E9LA 2A3EA 3FAPA 2WLYA 3NRKA 1W26A 2XPAA 2A3AA 1UR9A 4TW8A 4G50A 3RM8A 1P5QA 3RM9A 3O5OA 1E6PA 1HXVA 1LG2A 1XRVA 3JYJA 4JFMA 1NWUA 2FKEA 2DSWA 3RFWA 4WKAA 2XP5A 4Z2IA 1Q6IA 1M5YA 2O9OA 4WKHA 1FKIA 2L2SA 4HBOA 2DSVA 1IX5A 3QOKA 1L1PA 3WD4A 1FKRA 3O5EA 4DRMA 1OWQA 3ARUA 1W9PA 5HWCA 1ZU8A 3ARYA 4DH0A 2KI3A 1EHNA 4QZVB 4IPXA 2M2AA 3FXYA 3PRDA 1D7IA 2Q5AA 4DRKA 4DRNA 4G2PA 2DG9A 4WJXA 1W1VA 3CHDA 2ZR6A 4JYSA 5HBFA 4DWSC 4Q22A 1Q6UA 2F2DA 3O5KA 2MNTA 5DO2A 3ARSA 3CHCA 1JNSA 1E6RA 1TCOC 3KABA 3B9DA 4HBEA 4Z2HA 1GPFA 2ESCA 4WK9A 3IHZA 5HUAA 2ZQVA 2DG4A 4ODNA 2DT1A 2PV2A 2XP8A 3O5DA 4P8XA 3MDYB 1XHGA 4DWSB 1W1TA 4ODQA 1QPFA 3O5QA 4IQ2A 1U79A 4L72B 3O5MA 3AQUA 1O6IA 4C02B 3B8SA 2DT0A 1B6CA 4HARA 1J4RA 5DEZA 1TFVA 1NWSA 1EIBA 4S3JA 5DITA 3WD1A 1FAPA 1FFQA 1LL7A 5GPGA 2ZQUA 2PPOA 4MPKA 5JH8A 3AS2A 4ODLA 1UR8A 4TX0A 1FKKA 1YATA 1HJWA 3WD3A 1NSGA 1GUVA 4URIA 2MPHA 2DT3A 1F40A 2N87A 4MGVA 1ROUA 1HJXA 4IT6A 1SR0A 3UQIA 4DIPA 4Z2GA 2LPVA 1T11A 2F21A 2O92A 3WH0A 5D75A 5GPRA 3CH9A 4Q7NA 1ZK6A 4ML4A 2F4EA 3KACA 1E6NA 2XP6A 1SYTA 4QIBA 3EY6A 1ZBWA 4Z2JA 4LAXA 1KT1A 2WLZA 4QT2A 4MNMA 4NZCA 3IK8A 2RUDA 5DIUA 2PV3A 3PA7A 3WD2A 5HWBA 4U84A 4FN2A 1OGGA 2AWGA 5HT1A 3ALGA 2ZQTA 2KFWA 1Q6HA 1EQ3A 3UI4A 2A3CA 1NH6A 3WL1A 1PINA 3W4RA 4QT3A 4ZPTR 2LKNA 2DSUA 2XPBA 2OLHA 1ROTA 2D9FA 3CHEA 4ODKA 4AY1A 1C9HA 4U85A 1BL4A 1H0IA 4P8UA 5J6EA 2RUCA 3NTPA 4MAVA 1D2KA 1LQ0A 1JNDA 1R9HA 4ZPWR 1FFRA 1KFWA 2PPPA 2RUQA 2IUZA 3O5IA 1KT0A 2PI6A 2MF9A 2PPNA 3WL0A 3CGNA 3JXVA 2YBUA 5B8IC 4L3NA 4J4OA 3UF8A 1CTNA 1Q1CA 1ZL1A 1F8AB 1X6NA 1W9UA 4JFIA 2RQSA 4N19A 1JNEA 4KR0B 2AOSA 1FKFA 4ODPA 4FAPA 1JNTA 2MLXA 3PRAA 5DIVA 1FKSA 2K8IA 4W9PA 4R5EA 3UI5A 2XP9A 4Z2LA 2DT2A 4NSBA 1FKDA 2XP3A 3ARWA 4PTMA 1H0GA 4TW7A 1NMWA 2DG3A 4JFJA 1D6OA 3PR9A 2ZR5A 3TDBA 1NWRA 4DRIA 4MTVA 5HW8A 5GQBA 4S3KA 4JFKA 2RSEA 2G8ZA 4ITZA 3ARRA 1FKTA 4MSPA 1YW5A 1EDQA 3AS1A 3O5FA 4DRHA 2FAPA 2KO7A 4BF8A 3UI6A 1LL4A 5HW7A 1K9TA 4GIVA 4DWSD 1BKFA 1JVWA 1ZCNA 1HKKA 5I98A 1W9VA 1FKHA 2ITKA 3ARPA 1E15A 3LUOA 3AS3A 3WQWA 1ZBVA 4TW6A 3UQAA 3KAGA 1ZBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKG A;  2Y78 A;  4LAY A;  1A7X A;  5HT1 A;  2ZQT A;  1Q6U A;  2KFW A;  1NMV A;  2F2D A;  2UZ5 A;  3O5K A;  4NNR A;  1Q6H A;  2MNT A;  2M1I A;  1EQ3 A;  3UI4 A;  3KZ7 A;  1FJD A;  1JNS A;  2KE0 A;  1PIN A;  2ZR4 A;  1TCO C;  3KAB A;  1J4H A;  3KAD A;  3O5J A;  2VN1 A;  4QT3 A;  4JFL A;  3UQB A;  3O5L A;  3RGC A;  4DRQ A;  3ODK A;  2LKN A;  3IHZ A;  5HUA A;  2IF4 A;  3I6C A;  5BXJ A;  1D7H A;  4LAW A;  2XPB A;  2ZQV A;  2DG4 A;  3H9R B;  4GGQ A;  2PV2 A;  2XP8 A;  3O5D A;  1FD9 A;  4O2T A;  4ODN A;  4R0X A;  4W9O A;  1J6Y A;  4ODR A;  1ROT A;  3KAI A;  3OOB A;  4TNS A;  3MDY B;  2D9F A;  2PBC A;  3KAF A;  4ODQ A;  4ODK A;  3TCZ A;  1QPF A;  1FKB A;  3O5Q A;  5HTG A;  1PBK A;  4IQ2 A;  1C9H A;  1U79 A;  2LGO A;  4U85 A;  1BL4 A;  3O5M A;  5J6E A;  3KCE A;  1FKJ A;  2RUC A;  3NTP A;  1R9H A;  2PPP A;  2RUQ A;  4C02 B;  4ODM A;  3O5I A;  1KT0 A;  3JYM A;  2MF9 A;  1B6C A;  3VAW A;  4U86 A;  1J4R A;  1QZ2 A;  5HKG A;  2PPN A;  5B8I C;  3CGN A;  3JXV A;  4J4O A;  3UF8 A;  2M08 A;  5DIT A;  1Q1C A;  3NI6 A;  1FAP A;  1F8A B;  4DT4 A;  4DRP A;  5GPG A;  2ZQU A;  2PPO A;  4JFI A;  2RQS A;  2PV1 A;  1EYM A;  3O5G A;  1D7J A;  4J4N A;  4N19 A;  1FKF A;  4ODP A;  4FAP A;  2LJ4 A;  2XP4 A;  1JNT A;  2XP7 A;  2ZQS A;  2MLX A;  3B7X A;  4ODL A;  4LAV A;  3CGM A;  2OFN A;  4TX0 A;  5HW6 A;  5DIV A;  1FKK A;  1FKS A;  4ODO A;  2JZV A;  4DRO A;  1YAT A;  2K8I A;  4W9P A;  3UI5 A;  2XP9 A;  1NSG A;  3FAP A;  1N1A A;  3NRK A;  1FKD A;  2XP3 A;  1W26 A;  2MPH A;  2XPA A;  4TW8 A;  4G50 A;  1F40 A;  1P5Q A;  2N87 A;  4MGV A;  1ROU A;  4TW7 A;  3O5O A;  1HXV A;  4DZ3 A;  3UQI A;  3JYJ A;  1NMW A;  4JFM A;  2DG3 A;  4JFJ A;  1D6O A;  3O5P A;  2FKE A;  4DIP A;  3RFW A;  2XP5 A;  4TYO A;  2ZR5 A;  1Q6I A;  2LPV A;  3IKG A;  1M5Y A;  1T11 A;  2F21 A;  3TDB A;  1FKI A;  2L2S A;  3WH0 A;  5D75 A;  3KAH A;  3O5R A;  1ZK6 A;  4DRI A;  5HW8 A;  2F4E A;  1L1P A;  3KAC A;  3GPK A;  1FKR A;  2VCD A;  2XP6 A;  3O5E A;  3TC5 A;  4JFK A;  4W9Q A;  2RSE A;  4DRM A;  4ITZ A;  4QIB A;  4DZ2 A;  1FKT A;  3KAG A;  3IKD A;  1YW5 A;  3EY6 A;  4MSP A;  5HWC A;  1FKL A;  3O5F A;  4LAX A;  4DH0 A;  4DRH A;  2FAP A;  2KI3 A;  2KO7 A;  2MLZ A;  1KT1 A;  4BF8 A;  3UI6 A;  5HW7 A;  4QT2 A;  4GIV A;  4DRJ A;  4IPX A;  1J4I A;  2KGJ A;  2M2A A;  1BKF A;  3PRD A;  1Y0O A;  1D7I A;  1JVW A;  3IK8 A;  1ZCN A;  2Q5A A;  4DRK A;  4DRN A;  2MLY A;  4G2P A;  5I98 A;  4IQC A;  1QPL A;  1FKH A;  2ITK A;  2DG9 A;  2KR7 A;  2RUD A;  3LUO A;  2PV3 A;  3PA7 A;  5DIU A;  5HWB A;  4TW6 A;  4JYS A;  2ZR6 A;  3UQA A;  4U84 A;  3PRB A;  2RUR A;  4FN2 A;  2AWG A; 
#chains in the Genus database with same CATH topology
 3ARO A;  4LAY A;  1NMV A;  3ALF A;  2UZ5 A;  3CHF A;  1FJD A;  2M1I A;  2QF8 A;  3ARZ A;  4LGX A;  1J4H A;  3ART A;  2VN1 A;  4WIW A;  1RD6 A;  4JFL A;  3O5L A;  2G41 A;  3RGC A;  2IF4 A;  3I6C A;  1D7H A;  4Z2K A;  5DF0 A;  4ZPV R;  3H9R B;  4DRP A;  4O2T A;  4W9O A;  1J6Y A;  4ODR A;  3KAF A;  1X6L A;  3TCZ A;  1FKB A;  2LGO A;  1VF8 A;  1FKJ A;  2FDM A;  1E6Z A;  2ETN A;  3BXW A;  3VAW A;  1QZ2 A;  4W5U A;  1GOI A;  2A3B A;  4DT4 A;  4MNL A;  2PV1 A;  1EYM A;  3O5G A;  4P8W A;  3B7X A;  2ZQS A;  3ARQ A;  4LAV A;  4WKF A;  4ODO A;  2JZV A;  1HKJ A;  1ZB5 A;  1N1A A;  4ZS6 A;  2F23 A;  1HJV A;  3GTY X;  2PN0 A;  3OA5 A;  4DZ3 A;  3O5P A;  1OGB A;  4P8V A;  4TYO A;  3IKG A;  3RME A;  3KAH A;  3O5R A;  3ARX A;  3GPK A;  3WIJ A;  2VCD A;  4UDM A;  3TC5 A;  4W9Q A;  4DZ2 A;  1ITX A;  3IKD A;  1FKL A;  1WB0 A;  4XAK A;  2MLZ A;  4DRJ A;  1J4I A;  2KGJ A;  1HKM A;  1Y0O A;  3G6L A;  2MLY A;  4IQC A;  1QPL A;  2KR7 A;  1WAW A;  3PRB A;  2RUR A;  2WM0 A;  1FKG A;  2Y78 A;  1A7X A;  1LG1 A;  4MNK A;  4NNR A;  3KZ7 A;  1LJY A;  2KE0 A;  4IT4 A;  3RM4 A;  2ZR4 A;  1NWT A;  3KAD A;  3O5J A;  1LL6 A;  3B9E A;  3UQB A;  3FY1 A;  4DRQ A;  3ODK A;  4DWS A;  5BXJ A;  4LAW A;  1HKI A;  4GGQ A;  2B31 A;  1FD9 A;  4R0X A;  3KAI A;  3OOB A;  3WKZ A;  4TNS A;  2YBT A;  2PBC A;  3CZ8 A;  5HTG A;  1PBK A;  2WK2 A;  1ZBK A;  3WQV A;  3KCE A;  4ODM A;  3JYM A;  3G6M A;  5HKG A;  4U86 A;  1W1P A;  4MNJ A;  3WD0 A;  2M08 A;  2EUL A;  3NI6 A;  1WNO A;  3B9A A;  3BMB A;  3AS0 A;  2DSZ A;  1D7J A;  4J4N A;  2LJ4 A;  2XP4 A;  2XP7 A;  2DPE A;  3CGM A;  1GRJ A;  1W1Y A;  2OFN A;  4KQZ A;  5HW6 A;  3ARV A;  4DRO A;  1E9L A;  2A3E A;  3FAP A;  2WLY A;  3NRK A;  1W26 A;  2XPA A;  2A3A A;  1UR9 A;  4TW8 A;  4G50 A;  3RM8 A;  1P5Q A;  3RM9 A;  3O5O A;  1E6P A;  1HXV A;  1LG2 A;  1XRV A;  3JYJ A;  4JFM A;  1NWU A;  2FKE A;  2DSW A;  3RFW A;  4WKA A;  2XP5 A;  4Z2I A;  1Q6I A;  1M5Y A;  2O9O A;  4WKH A;  1FKI A;  2L2S A;  4HBO A;  2DSV A;  1IX5 A;  3QOK A;  1L1P A;  3WD4 A;  1FKR A;  3O5E A;  4DRM A;  1OWQ A;  3ARU A;  1W9P A;  5HWC A;  1ZU8 A;  3ARY A;  4DH0 A;  2KI3 A;  1EHN A;  4QZV B;  4IPX A;  2M2A A;  3FXY A;  3PRD A;  1D7I A;  2Q5A A;  4DRK A;  4DRN A;  4G2P A;  2DG9 A;  4WJX A;  1W1V A;  3CHD A;  2ZR6 A;  4JYS A;  1E44 A;  5HBF A;  4DWS C;  4Q22 A;  1Q6U A;  2F2D A;  3O5K A;  2MNT A;  5DO2 A;  3ARS A;  3CHC A;  1JNS A;  1E6R A;  1TCO C;  3KAB A;  3B9D A;  4HBE A;  4Z2H A;  1GPF A;  2ESC A;  4WK9 A;  3IHZ A;  5HUA A;  2ZQV A;  2DG4 A;  4ODN A;  2DT1 A;  2PV2 A;  2XP8 A;  3O5D A;  4P8X A;  3MDY B;  1XHG A;  4DWS B;  1W1T A;  4ODQ A;  1QPF A;  3O5Q A;  4IQ2 A;  1U79 A;  4L72 B;  3O5M A;  3AQU A;  1O6I A;  4C02 B;  3B8S A;  2DT0 A;  1B6C A;  4HAR A;  1J4R A;  5DEZ A;  1TFV A;  1NWS A;  1EIB A;  4S3J A;  2B5U B;  5DIT A;  3WD1 A;  1FAP A;  1FFQ A;  1LL7 A;  5GPG A;  2ZQU A;  2PPO A;  4MPK A;  5JH8 A;  3AS2 A;  4ODL A;  1UR8 A;  4TX0 A;  1FKK A;  1YAT A;  1HJW A;  3WD3 A;  1NSG A;  1GUV A;  4URI A;  2MPH A;  2DT3 A;  1F40 A;  2N87 A;  4MGV A;  1ROU A;  1HJX A;  4IT6 A;  1SR0 A;  3UQI A;  4DIP A;  4Z2G A;  2LPV A;  1T11 A;  2F21 A;  2O92 A;  3WH0 A;  5D75 A;  5GPR A;  3CH9 A;  4Q7N A;  1ZK6 A;  4ML4 A;  2F4E A;  3KAC A;  1E6N A;  2XP6 A;  1JCH B;  1SYT A;  4QIB A;  3EY6 A;  1ZBW A;  4Z2J A;  4LAX A;  1KT1 A;  2WLZ A;  4QT2 A;  4MNM A;  4NZC A;  3IK8 A;  2RUD A;  5DIU A;  2PV3 A;  3PA7 A;  3WD2 A;  5HWB A;  4U84 A;  4FN2 A;  1OGG A;  2AWG A;  5HT1 A;  3ALG A;  2ZQT A;  2KFW A;  1Q6H A;  1EQ3 A;  3UI4 A;  2A3C A;  1NH6 A;  3WL1 A;  1PIN A;  3W4R A;  4QT3 A;  4ZPT R;  2LKN A;  2DSU A;  2XPB A;  2OLH A;  1ROT A;  2D9F A;  3CHE A;  4ODK A;  4AY1 A;  1C9H A;  4U85 A;  1BL4 A;  1H0I A;  4P8U A;  5J6E A;  2RUC A;  3NTP A;  4MAV A;  1D2K A;  1LQ0 A;  1JND A;  1R9H A;  4ZPW R;  1FFR A;  1KFW A;  2PPP A;  2RUQ A;  2IUZ A;  3O5I A;  1KT0 A;  2PI6 A;  2MF9 A;  2PPN A;  3WL0 A;  3CGN A;  3JXV A;  2YBU A;  5B8I C;  4L3N A;  4J4O A;  3UF8 A;  1CTN A;  1Q1C A;  1ZL1 A;  1F8A B;  1X6N A;  1W9U A;  4JFI A;  2RQS A;  4N19 A;  1JNE A;  3EIP A;  4KR0 B;  2AOS A;  1FKF A;  4ODP A;  4FAP A;  1JNT A;  2MLX A;  3PRA A;  5DIV A;  1FKS A;  2K8I A;  4W9P A;  4R5E A;  3UI5 A;  2XP9 A;  4Z2L A;  2DT2 A;  4NSB A;  1FKD A;  2XP3 A;  3ARW A;  4PTM A;  1H0G A;  4TW7 A;  1NMW A;  2DG3 A;  4JFJ A;  1D6O A;  3PR9 A;  2P4V A;  2ZR5 A;  3TDB A;  1NWR A;  4DRI A;  4MTV A;  5HW8 A;  5GQB A;  3GU0 A;  4S3K A;  4JFK A;  2RSE A;  2G8Z A;  4ITZ A;  3ARR A;  1FKT A;  4MSP A;  1YW5 A;  1EDQ A;  3AS1 A;  3O5F A;  4DRH A;  2FAP A;  2KO7 A;  4BF8 A;  3UI6 A;  1LL4 A;  5HW7 A;  1K9T A;  4GIV A;  4DWS D;  1BKF A;  1JVW A;  1ZCN A;  1HKK A;  5I98 A;  1W9V A;  1FKH A;  2ITK A;  3ARP A;  1E15 A;  3LUO A;  3AS3 A;  3WQW A;  1ZBV A;  4TW6 A;  3UQA A;  3KAG A;  1ZBC A; 
#chains in the Genus database with same CATH homology
 3ARO A;  4LAY A;  1NMV A;  3ALF A;  2UZ5 A;  3CHF A;  1FJD A;  2M1I A;  2QF8 A;  3ARZ A;  4LGX A;  1J4H A;  3ART A;  2VN1 A;  4WIW A;  1RD6 A;  4JFL A;  3O5L A;  2G41 A;  3RGC A;  2IF4 A;  3I6C A;  1D7H A;  4Z2K A;  5DF0 A;  4ZPV R;  3H9R B;  4DRP A;  4O2T A;  4W9O A;  1J6Y A;  4ODR A;  3KAF A;  1X6L A;  3TCZ A;  1FKB A;  2LGO A;  1VF8 A;  1FKJ A;  2FDM A;  1E6Z A;  3BXW A;  3VAW A;  1QZ2 A;  4W5U A;  1GOI A;  2A3B A;  4DT4 A;  4MNL A;  2PV1 A;  1EYM A;  3O5G A;  4P8W A;  3B7X A;  2ZQS A;  3ARQ A;  4LAV A;  4WKF A;  4ODO A;  2JZV A;  1HKJ A;  1ZB5 A;  1N1A A;  4ZS6 A;  1HJV A;  3OA5 A;  4DZ3 A;  3O5P A;  1OGB A;  4P8V A;  4TYO A;  3IKG A;  3RME A;  3KAH A;  3O5R A;  3ARX A;  3GPK A;  3WIJ A;  2VCD A;  3TC5 A;  4W9Q A;  4DZ2 A;  1ITX A;  3IKD A;  1FKL A;  1WB0 A;  4XAK A;  2MLZ A;  4DRJ A;  1J4I A;  2KGJ A;  1HKM A;  1Y0O A;  3G6L A;  2MLY A;  4IQC A;  1QPL A;  2KR7 A;  1WAW A;  3PRB A;  2RUR A;  2WM0 A;  1FKG A;  2Y78 A;  1A7X A;  1LG1 A;  4MNK A;  4NNR A;  3KZ7 A;  1LJY A;  2KE0 A;  4IT4 A;  3RM4 A;  2ZR4 A;  1NWT A;  3KAD A;  3O5J A;  1LL6 A;  3B9E A;  3UQB A;  3FY1 A;  4DRQ A;  3ODK A;  4DWS A;  5BXJ A;  4LAW A;  1HKI A;  4GGQ A;  2B31 A;  1FD9 A;  4R0X A;  3KAI A;  3OOB A;  3WKZ A;  4TNS A;  2YBT A;  2PBC A;  3CZ8 A;  5HTG A;  1PBK A;  2WK2 A;  1ZBK A;  3WQV A;  3KCE A;  4ODM A;  3JYM A;  3G6M A;  5HKG A;  4U86 A;  1W1P A;  4MNJ A;  3WD0 A;  2M08 A;  3NI6 A;  1WNO A;  3B9A A;  3AS0 A;  2DSZ A;  1D7J A;  4J4N A;  2LJ4 A;  2XP4 A;  2XP7 A;  2DPE A;  3CGM A;  1W1Y A;  2OFN A;  4KQZ A;  5HW6 A;  3ARV A;  4DRO A;  1E9L A;  2A3E A;  3FAP A;  2WLY A;  3NRK A;  1W26 A;  2XPA A;  2A3A A;  1UR9 A;  4TW8 A;  4G50 A;  3RM8 A;  1P5Q A;  3RM9 A;  3O5O A;  1E6P A;  1HXV A;  1LG2 A;  1XRV A;  3JYJ A;  4JFM A;  1NWU A;  2FKE A;  2DSW A;  3RFW A;  4WKA A;  2XP5 A;  4Z2I A;  1Q6I A;  1M5Y A;  2O9O A;  4WKH A;  1FKI A;  2L2S A;  4HBO A;  2DSV A;  1IX5 A;  3QOK A;  1L1P A;  3WD4 A;  1FKR A;  3O5E A;  4DRM A;  1OWQ A;  3ARU A;  1W9P A;  5HWC A;  1ZU8 A;  3ARY A;  4DH0 A;  2KI3 A;  1EHN A;  4QZV B;  4IPX A;  2M2A A;  3FXY A;  3PRD A;  1D7I A;  2Q5A A;  4DRK A;  4DRN A;  4G2P A;  2DG9 A;  4WJX A;  1W1V A;  3CHD A;  2ZR6 A;  4JYS A;  5HBF A;  4DWS C;  4Q22 A;  1Q6U A;  2F2D A;  3O5K A;  2MNT A;  5DO2 A;  3ARS A;  3CHC A;  1JNS A;  1E6R A;  1TCO C;  3KAB A;  3B9D A;  4HBE A;  4Z2H A;  1GPF A;  2ESC A;  4WK9 A;  3IHZ A;  5HUA A;  2ZQV A;  2DG4 A;  4ODN A;  2DT1 A;  2PV2 A;  2XP8 A;  3O5D A;  4P8X A;  3MDY B;  1XHG A;  4DWS B;  1W1T A;  4ODQ A;  1QPF A;  3O5Q A;  4IQ2 A;  1U79 A;  4L72 B;  3O5M A;  3AQU A;  1O6I A;  4C02 B;  3B8S A;  2DT0 A;  1B6C A;  4HAR A;  1J4R A;  5DEZ A;  1TFV A;  1NWS A;  1EIB A;  4S3J A;  5DIT A;  3WD1 A;  1FAP A;  1FFQ A;  1LL7 A;  5GPG A;  2ZQU A;  2PPO A;  4MPK A;  5JH8 A;  3AS2 A;  4ODL A;  1UR8 A;  4TX0 A;  1FKK A;  1YAT A;  1HJW A;  3WD3 A;  1NSG A;  1GUV A;  4URI A;  2MPH A;  2DT3 A;  1F40 A;  2N87 A;  4MGV A;  1ROU A;  1HJX A;  4IT6 A;  1SR0 A;  3UQI A;  4DIP A;  4Z2G A;  2LPV A;  1T11 A;  2F21 A;  2O92 A;  3WH0 A;  5D75 A;  5GPR A;  3CH9 A;  4Q7N A;  1ZK6 A;  4ML4 A;  2F4E A;  3KAC A;  1E6N A;  2XP6 A;  1SYT A;  4QIB A;  3EY6 A;  1ZBW A;  4Z2J A;  4LAX A;  1KT1 A;  2WLZ A;  4QT2 A;  4MNM A;  4NZC A;  3IK8 A;  2RUD A;  5DIU A;  2PV3 A;  3PA7 A;  3WD2 A;  5HWB A;  4U84 A;  4FN2 A;  1OGG A;  2AWG A;  5HT1 A;  3ALG A;  2ZQT A;  2KFW A;  1Q6H A;  1EQ3 A;  3UI4 A;  2A3C A;  1NH6 A;  3WL1 A;  1PIN A;  3W4R A;  4QT3 A;  4ZPT R;  2LKN A;  2DSU A;  2XPB A;  2OLH A;  1ROT A;  2D9F A;  3CHE A;  4ODK A;  4AY1 A;  1C9H A;  4U85 A;  1BL4 A;  1H0I A;  4P8U A;  5J6E A;  2RUC A;  3NTP A;  4MAV A;  1D2K A;  1LQ0 A;  1JND A;  1R9H A;  4ZPW R;  1FFR A;  1KFW A;  2PPP A;  2RUQ A;  2IUZ A;  3O5I A;  1KT0 A;  2PI6 A;  2MF9 A;  2PPN A;  3WL0 A;  3CGN A;  3JXV A;  2YBU A;  5B8I C;  4L3N A;  4J4O A;  3UF8 A;  1CTN A;  1Q1C A;  1ZL1 A;  1F8A B;  1X6N A;  1W9U A;  4JFI A;  2RQS A;  4N19 A;  1JNE A;  4KR0 B;  2AOS A;  1FKF A;  4ODP A;  4FAP A;  1JNT A;  2MLX A;  3PRA A;  5DIV A;  1FKS A;  2K8I A;  4W9P A;  4R5E A;  3UI5 A;  2XP9 A;  4Z2L A;  2DT2 A;  4NSB A;  1FKD A;  2XP3 A;  3ARW A;  4PTM A;  1H0G A;  4TW7 A;  1NMW A;  2DG3 A;  4JFJ A;  1D6O A;  3PR9 A;  2ZR5 A;  3TDB A;  1NWR A;  4DRI A;  4MTV A;  5HW8 A;  5GQB A;  4S3K A;  4JFK A;  2RSE A;  2G8Z A;  4ITZ A;  3ARR A;  1FKT A;  4MSP A;  1YW5 A;  1EDQ A;  3AS1 A;  3O5F A;  4DRH A;  2FAP A;  2KO7 A;  4BF8 A;  3UI6 A;  1LL4 A;  5HW7 A;  1K9T A;  4GIV A;  4DWS D;  1BKF A;  1JVW A;  1ZCN A;  1HKK A;  5I98 A;  1W9V A;  1FKH A;  2ITK A;  3ARP A;  1E15 A;  3LUO A;  3AS3 A;  3WQW A;  1ZBV A;  4TW6 A;  3UQA A;  3KAG A;  1ZBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...