1BL4A

Fkbp mutant f36v complexed with remodeled synthetic ligand
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redesigning an FKBP-ligand interface to generate chemical dimerizers with novel specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROTEIN (FK506 BINDING PROTEIN)
total genus 27
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1bl4A00
3O5KA 2F4EA 1W26A 2KE0A 1D7IA 2M08A 4W9QA 3TC5A 1YATA 3TDBA 1JVWA 4ODQA 1J4RA 3O5FA 4JFKA 4DROA 3UQAA 1F40A 4U86A 4DRIA 1FKIA 1ROTA 2OFNA 5J6EA 4JFMA 1PINA 2LJ4A 3CGMA 3PA7A 2L2SA 3O5JA 3MDYB 3O5OA 2DG9A 4W9OA 2PPPA 3UI5A 4BF8A 4ODKA 1FKHA 1FKBA 2FKEA 4JFJA 1BL4A 2LKNA 3UF8A 4DIPA 4DRPA 1J4HA 2XPBA 3KADA 3UQBA 2LPVA 4U84A 2ZQUA 2IF4A 2MLZA 3KAHA 1FKSA 2Y78A 2KGJA 2LGOA 3KAIA 1Q1CA 2N87A 4IQ2A 4MGVA 3NRKA 4ODMA 1M5YA 3VAWA 5HT1A 3O5DA 2MF9A 3NI6A 2ZQSA 2KR7A 1R9HA 2PV1A 4ITZA 2DG3A 1FKGA 2D9FA 2MPHA 3FAPA 3IHZA 1Y0OA 3KABA 4DH0A 4ODRA 4DRHA 2ZQTA 1TCOC 5HW6A 1ROUA 3IK8A 4FAPA 4C02B 5GPGA 4JYSA 3KZ7A 4JFLA 3UI4A 5BXJA 3I6CA 3OOBA 2RURA 1BKFA 4JFIA 4DRMA 2XP6A 1EQ3A 2ZQVA 1FKLA 4GIVA 4DRKA 1JNSA 1A7XA 2FAPA 1D7JA 2RSEA 2XP4A 4J4NA 4TX0A 4W9PA 3UQIA 1KT0A 2XP5A 4FN2A 2F21A 4TNSA 2ZR4A 1QZ2A 3O5RA 5HKGA 3LUOA 3O5IA 5B8IC 1N1AA 1NSGA 1P5QA 2PPNA 1EYMA 4O2TA 5HW7A 2RUQA 5HW8A 1ZCNA 2AWGA 2K8IA 3GPKA 3JYMA 4LAYA 4IQCA 4DT4A 5HTGA 3KAFA 1J6YA 4MSPA 2KO7A 1T11A 3O5GA 5HWCA 2XP9A 4QIBA 1FKKA 4NNRA 2VCDA 4ODLA 1PBKA 4J4OA 3B7XA 3KCEA 2M2AA 4LAWA 5DITA 1FKJA 1D6OA 2MLYA 2PV2A 2RUCA 4TW7A 2M1IA 4TW8A 2DG4A 5HUAA 5DIVA 1FKRA 1FKFA 1YW5A 2ITKA 4G50A 3O5MA 3RGCA 4DZ2A 5I98A 1QPLA 1U79A 1Q6IA 2XP3A 1JNTA 3CGNA 4R0XA 2MNTA 3EY6A 2PBCA 2ZR6A 4DRNA 2F2DA 2UZ5A 2RQSA 3IKDA 3KAGA 1KT1A 2Q5AA 3O5EA 5HWBA 2VN1A 1B6CA 2JZVA 2XP7A 4LAVA 4ODPA 1ZK6A 2MLXA 2PV3A 2XPAA 3JYJA 4ODOA 3O5PA 5D75A 5DIUA 4U85A 4DRJA 2XP8A 4GGQA 1FAPA 3NTPA 1FJDA 2KFWA 1NMVA 1FD9A 4IPXA 4QT3A 3ODKA 1J4IA 4QT2A 1L1PA 1F8AB 1QPFA 2ZR5A 3WH0A 3UI6A 4TYOA 1Q6HA 1Q6UA 3PRBA 4LAXA 3O5LA 4TW6A 1FKTA 2RUDA 4G2PA 4N19A 1HXVA 3KACA 3H9RB 4ODNA 3JXVA 2PPOA 1FKDA 1NMWA 3PRDA 4DZ3A 3RFWA 1C9HA 2KI3A 1D7HA 3IKGA 3O5QA 4DRQA 3TCZA
chains in the Genus database with same CATH superfamily
2P4VA 2F4EA 1D7IA 5JH8A 3TDBA 1JVWA 1F40A 4JFKA 3O5FA 4XAKA 4U86A 1PINA 2LJ4A 3CGMA 4KR0B 1W1PA 3O5JA 1W9PA 4ODKA 1GOIA 1XHGA 4MNJA 2WLYA 3WL0A 3KADA 4MAVA 1NWUA 2IF4A 2MLZA 1FKSA 1D2KA 5HT1A 3VAWA 3QOKA 1Q1CA 2QF8A 2WM0A 4ODMA 2ZQSA 4ITZA 4WJXA 4UDMA 2MPHA 1ITXA 3IHZA 1Y0OA 1JCHB 2ZQTA 3ARZA 4Z2HA 4FAPA 1KFWA 3ARTA 3ARXA 3KZ7A 4JFLA 5DO2A 3I6CA 3OOBA 1LQ0A 1FKLA 1JNSA 1A7XA 1ZBCA 3UQIA 1KT0A 1UR9A 2XP5A 3B9AA 1QZ2A 1W9VA 5HKGA 4LGXA 3PR9A 1N1AA 1NSGA 1EYMA 1W9UA 3CZ8A 2K8IA 3GPKA 3AS0A 1T11A 4WKFA 3AS3A 2OLHA 1O6IA 1PBKA 4Q7NA 4S3KA 4WKAA 1D6OA 3AROA 4TW7A 1E6ZA 5HUAA 1ZU8A 5DF0A 1QPLA 5DEZA 4Z2LA 1JNTA 2ZR6A 4DWSB 5HWBA 2RQSA 3IKDA 3KAGA 1KT1A 3O5EA 1B6CA 4ODPA 5I98A 2PV3A 3JYJA 2A3AA 1FAPA 1OGBA 2KFWA 4MNKA 4MNLA 1ZBWA 4QT3A 2G8ZA 1F8AB 4TYOA 2DSUA 1Q6UA 3ALFA 3AQUA 3O5LA 2RUDA 2PN0A 1HXVA 3KACA 1X6NA 2PPOA 1NMWA 3CHFA 3RFWA 1W1TA 4P8VA 3IKGA 3O5QA 3TCZA 2M08A 1W26A 2KE0A 3OA5A 4DROA 4ODQA 1J4RA 3UQAA 3CHEA 1ROTA 5J6EA 4JFMA 3PA7A 1JNEA 4QZVB 4NSBA 2FKEA 3G6LA 4ZS6A 3ARYA 4URIA 3CH9A 4WIWA 2Y78A 2KGJA 4MGVA 4S3JA 1M5YA 2MF9A 2ETNA 1EDQA 4DH0A 4ODRA 4DRHA 5HBFA 3G6MA 1ROUA 4C02B 3BMBA 3UI4A 4ZPWR 2O9OA 4DWSC 5BXJA 1HJXA 2XP6A 4GIVA 3PRAA 1D7JA 2RSEA 4W9PA 1HKMA 2F21A 1ZL1A 3GU0A 3LUOA 3FXYA 4ML4A 1P5QA 4ZPTR 1W1VA 5HW8A 3B9EA 2YBUA 4IQCA 3WKZA 2DPEA 4QIBA 1FKKA 2VCDA 3AS1A 1H0GA 5GQBA 3WL1A 3B7XA 2PI6A 1E9LA 2O92A 2MLYA 2M1IA 1LG1A 5DIVA 1FKRA 1YW5A 4G50A 3O5MA 1U79A 1Q6IA 3AS2A 4R0XA 4L72B 1GPFA 3EY6A 2F2DA 1UR8A 4Z2GA 2XP7A 4ODOA 5D75A 4DRJA 5DIUA 3NTPA 1FJDA 3ARWA 4P8WA 3WH0A 4G2PA 1LL4A 3H9RB 1FKDA 3PRDA 1WAWA 1E6NA 1E15A 1D7HA 3WIJA 1E6RA 3TC5A 4R5EA 1YATA 1RD6A 1IX5A 3W4RA 1HJWA 1FKIA 2L2SA 3MDYB 3O5OA 2DG9A 4W9OA 4W5UA 3WQVA 3UI5A 3RM8A 1BL4A 3UF8A 1NWSA 4DRPA 4HBOA 3RMEA 4Z2JA 2LPVA 4U84A 1ZBVA 3KAIA 1HJVA 4IQ2A 4MPKA 3O5DA 4PTMA 2DG3A 1FKGA 2D9FA 4DWSD 2DT1A 2DT2A 5HW6A 4NZCA 3IK8A 3WD0A 5GPGA 2B31A 2F23A 4IT4A 2ESCA 1WB0A 4JFIA 1BKFA 1HKJA 3EIPA 1GUVA 1EQ3A 2ZQVA 2XP4A 2FAPA 4J4NA 1LG2A 4TNSA 2ZR4A 3O5RA 2IUZA 3O5IA 5B8IC 1K9TA 4Q22A 2RUQA 1ZCNA 4LAYA 3B9DA 5HWCA 2XP9A 4ODLA 5GPRA 3WD1A 4J4OA 3ARRA 1ZB5A 1X6LA 2M2AA 3RM9A 2DSVA 5DITA 1NH6A 2PV2A 2RUCA 2DSZA 4TW8A 1FKFA 2ITKA 2EULA 1EHNA 3RGCA 4DZ2A 1SR0A 4MTVA 1NWRA 2PBCA 4DRNA 1E6PA 2Q5AA 4HBEA 2JZVA 2AOSA 4LAVA 3O5PA 4U85A 2XP8A 3ARVA 1FD9A 1HKIA 1SYTA 4QT2A 1L1PA 2ZR5A 3FY1A 3UI6A 2YBTA 3WD3A 3PRBA 1CTNA 1FKTA 4N19A 2DT0A 4ODNA 3JXVA 1OWQA 4DZ3A 1E44A 2KI3A 1GRJA 3O5KA 4W9QA 1HKKA 4WK9A 1XRVA 2OFNA 1LL6A 2PPPA 4BF8A 1FKHA 1FKBA 4JFJA 2LKNA 4DIPA 1J4HA 2XPBA 3ARUA 2WK2A 3UQBA 2ZQUA 1EIBA 3KAHA 1TFVA 4DRIA 2LGOA 1W1YA 2N87A 3NRKA 3WD4A 1LL7A 3NI6A 1H0IA 2KR7A 1R9HA 2PV1A 2FDMA 3FAPA 3KABA 4ZPVR 1TCOC 3WD2A 4JYSA 1FFQA 3RM4A 3B8SA 2RURA 4DRMA 3GTYX 4DRKA 4TX0A 1OGGA 4FN2A 2B5UB 3BXWA 2PPNA 1ZBKA 4O2TA 5HW7A 2AWGA 3JYMA 4DT4A 5HTGA 3KAFA 1J6YA 4MSPA 2KO7A 3O5GA 4NNRA 4P8XA 3ARQA 2DT3A 4DWSA 2DSWA 3KCEA 4LAWA 1JNDA 1FKJA 4MNMA 2DG4A 2A3EA 1FFRA 4Z2IA 3ALGA 2XP3A 4AY1A 3CGNA 2MNTA 2UZ5A 2VN1A 4WKHA 1ZK6A 2MLXA 2XPAA 2WLZA 4GGQA 3ARSA 1NMVA 2A3BA 2G41A 4IPXA 3CHCA 3ODKA 1J4IA 3ARPA 1QPFA 4IT6A 1Q6HA 4LAXA 4TW6A 1WNOA 1NWTA 4Z2KA 4KQZA 1LJYA 4HARA 3WQWA 3CHDA 2A3CA 1C9HA 4L3NA 1VF8A 4P8UA 4DRQA
chains in the Genus database with same CATH topology
2F4EA 1D7IA 5JH8A 3TDBA 1JVWA 1F40A 4JFKA 3O5FA 4XAKA 4U86A 1PINA 2LJ4A 3CGMA 4KR0B 1W1PA 3O5JA 1W9PA 4ODKA 1GOIA 1XHGA 4MNJA 2WLYA 3WL0A 3KADA 4MAVA 1NWUA 2IF4A 2MLZA 1FKSA 1D2KA 5HT1A 3VAWA 3QOKA 1Q1CA 2QF8A 2WM0A 4ODMA 2ZQSA 4ITZA 4WJXA 2MPHA 1ITXA 3IHZA 1Y0OA 2ZQTA 3ARZA 4Z2HA 4FAPA 1KFWA 3ARTA 3ARXA 3KZ7A 4JFLA 5DO2A 3I6CA 3OOBA 1LQ0A 1FKLA 1JNSA 1A7XA 1ZBCA 3UQIA 1KT0A 1UR9A 2XP5A 3B9AA 1QZ2A 1W9VA 5HKGA 4LGXA 3PR9A 1N1AA 1NSGA 1EYMA 1W9UA 3CZ8A 2K8IA 3GPKA 3AS0A 1T11A 4WKFA 3AS3A 2OLHA 1O6IA 1PBKA 4Q7NA 4S3KA 4WKAA 1D6OA 3AROA 4TW7A 1E6ZA 5HUAA 1ZU8A 5DF0A 1QPLA 5DEZA 4Z2LA 1JNTA 2ZR6A 4DWSB 5HWBA 2RQSA 3IKDA 3KAGA 1KT1A 3O5EA 1B6CA 4ODPA 5I98A 2PV3A 3JYJA 2A3AA 1FAPA 1OGBA 2KFWA 4MNKA 4MNLA 1ZBWA 4QT3A 2G8ZA 1F8AB 4TYOA 2DSUA 1Q6UA 3ALFA 3AQUA 3O5LA 2RUDA 1HXVA 3KACA 1X6NA 2PPOA 1NMWA 3CHFA 3RFWA 1W1TA 4P8VA 3IKGA 3O5QA 3TCZA 2M08A 1W26A 2KE0A 3OA5A 4DROA 4ODQA 1J4RA 3UQAA 3CHEA 1ROTA 5J6EA 4JFMA 3PA7A 1JNEA 4QZVB 4NSBA 2FKEA 3G6LA 4ZS6A 3ARYA 4URIA 3CH9A 4WIWA 2Y78A 2KGJA 4MGVA 4S3JA 1M5YA 2MF9A 1EDQA 4DH0A 4ODRA 4DRHA 5HBFA 3G6MA 1ROUA 4C02B 3UI4A 4ZPWR 2O9OA 4DWSC 5BXJA 1HJXA 2XP6A 4GIVA 3PRAA 1D7JA 2RSEA 4W9PA 1HKMA 2F21A 1ZL1A 3LUOA 3FXYA 4ML4A 1P5QA 4ZPTR 1W1VA 5HW8A 3B9EA 2YBUA 4IQCA 3WKZA 2DPEA 4QIBA 1FKKA 2VCDA 3AS1A 1H0GA 5GQBA 3WL1A 3B7XA 2PI6A 1E9LA 2O92A 2MLYA 2M1IA 1LG1A 5DIVA 1FKRA 1YW5A 4G50A 3O5MA 1U79A 1Q6IA 3AS2A 4R0XA 4L72B 1GPFA 3EY6A 2F2DA 1UR8A 4Z2GA 2XP7A 4ODOA 5D75A 4DRJA 5DIUA 3NTPA 1FJDA 3ARWA 4P8WA 3WH0A 4G2PA 1LL4A 3H9RB 1FKDA 3PRDA 1WAWA 1E6NA 1E15A 1D7HA 3WIJA 1E6RA 3TC5A 4R5EA 1YATA 1RD6A 1IX5A 3W4RA 1HJWA 1FKIA 2L2SA 3MDYB 3O5OA 2DG9A 4W9OA 4W5UA 3WQVA 3UI5A 3RM8A 1BL4A 3UF8A 1NWSA 4DRPA 4HBOA 3RMEA 4Z2JA 2LPVA 4U84A 1ZBVA 3KAIA 1HJVA 4IQ2A 4MPKA 3O5DA 4PTMA 2DG3A 1FKGA 2D9FA 4DWSD 2DT1A 2DT2A 5HW6A 4NZCA 3IK8A 3WD0A 5GPGA 2B31A 4IT4A 2ESCA 1WB0A 4JFIA 1BKFA 1HKJA 1EQ3A 1GUVA 2ZQVA 2XP4A 2FAPA 4J4NA 1LG2A 4TNSA 2ZR4A 3O5RA 2IUZA 3O5IA 5B8IC 1K9TA 4Q22A 2RUQA 1ZCNA 4LAYA 3B9DA 5HWCA 2XP9A 4ODLA 5GPRA 3WD1A 4J4OA 3ARRA 1ZB5A 1X6LA 2M2AA 3RM9A 2DSVA 5DITA 1NH6A 2PV2A 2RUCA 2DSZA 4TW8A 1FKFA 2ITKA 1EHNA 3RGCA 4DZ2A 1SR0A 4MTVA 1NWRA 2PBCA 4DRNA 1E6PA 2Q5AA 4HBEA 2JZVA 2AOSA 4LAVA 3O5PA 4U85A 2XP8A 3ARVA 1FD9A 1HKIA 1SYTA 4QT2A 1L1PA 2ZR5A 3FY1A 3UI6A 2YBTA 3WD3A 3PRBA 1CTNA 1FKTA 4N19A 2DT0A 4ODNA 3JXVA 1OWQA 4DZ3A 2KI3A 3O5KA 4W9QA 1HKKA 4WK9A 1XRVA 2OFNA 1LL6A 2PPPA 4BF8A 1FKHA 1FKBA 4JFJA 2LKNA 4DIPA 1J4HA 2XPBA 3ARUA 2WK2A 3UQBA 2ZQUA 1EIBA 3KAHA 1TFVA 4DRIA 2LGOA 1W1YA 2N87A 3NRKA 3WD4A 1LL7A 3NI6A 1H0IA 2KR7A 1R9HA 2PV1A 2FDMA 3FAPA 3KABA 4ZPVR 1TCOC 3WD2A 4JYSA 1FFQA 3RM4A 3B8SA 2RURA 4DRMA 4DRKA 4TX0A 1OGGA 4FN2A 3BXWA 2PPNA 1ZBKA 4O2TA 5HW7A 2AWGA 3JYMA 4DT4A 5HTGA 3KAFA 1J6YA 4MSPA 2KO7A 3O5GA 4NNRA 4P8XA 3ARQA 2DT3A 4DWSA 2DSWA 3KCEA 4LAWA 1JNDA 1FKJA 4MNMA 2DG4A 2A3EA 1FFRA 4Z2IA 3ALGA 2XP3A 4AY1A 3CGNA 2MNTA 2UZ5A 2VN1A 4WKHA 1ZK6A 2MLXA 2XPAA 2WLZA 4GGQA 3ARSA 1NMVA 2A3BA 2G41A 4IPXA 3CHCA 3ODKA 1J4IA 3ARPA 1QPFA 4IT6A 1Q6HA 4LAXA 4TW6A 1WNOA 1NWTA 4Z2KA 4KQZA 1LJYA 4HARA 3WQWA 3CHDA 2A3CA 1C9HA 4L3NA 1VF8A 4P8UA 4DRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5K A;  2F4E A;  1W26 A;  2KE0 A;  1D7I A;  2M08 A;  4W9Q A;  3TC5 A;  1YAT A;  3TDB A;  1JVW A;  4ODQ A;  1J4R A;  3O5F A;  4JFK A;  4DRO A;  3UQA A;  1F40 A;  4U86 A;  4DRI A;  1FKI A;  1ROT A;  2OFN A;  5J6E A;  4JFM A;  1PIN A;  2LJ4 A;  3CGM A;  3PA7 A;  2L2S A;  3O5J A;  3MDY B;  3O5O A;  2DG9 A;  4W9O A;  2PPP A;  3UI5 A;  4BF8 A;  4ODK A;  1FKH A;  1FKB A;  2FKE A;  4JFJ A;  1BL4 A;  2LKN A;  3UF8 A;  4DIP A;  4DRP A;  1J4H A;  2XPB A;  3KAD A;  3UQB A;  2LPV A;  4U84 A;  2ZQU A;  2IF4 A;  2MLZ A;  3KAH A;  1FKS A;  2Y78 A;  2KGJ A;  2LGO A;  3KAI A;  1Q1C A;  2N87 A;  4IQ2 A;  4MGV A;  3NRK A;  4ODM A;  1M5Y A;  3VAW A;  5HT1 A;  3O5D A;  2MF9 A;  3NI6 A;  2ZQS A;  2KR7 A;  1R9H A;  2PV1 A;  4ITZ A;  2DG3 A;  1FKG A;  2D9F A;  2MPH A;  3FAP A;  3IHZ A;  1Y0O A;  3KAB A;  4DH0 A;  4ODR A;  4DRH A;  2ZQT A;  1TCO C;  5HW6 A;  1ROU A;  3IK8 A;  4FAP A;  4C02 B;  5GPG A;  4JYS A;  3KZ7 A;  4JFL A;  3UI4 A;  5BXJ A;  3I6C A;  3OOB A;  2RUR A;  1BKF A;  4JFI A;  4DRM A;  2XP6 A;  1EQ3 A;  2ZQV A;  1FKL A;  4GIV A;  4DRK A;  1JNS A;  1A7X A;  2FAP A;  1D7J A;  2RSE A;  2XP4 A;  4J4N A;  4TX0 A;  4W9P A;  3UQI A;  1KT0 A;  2XP5 A;  4FN2 A;  2F21 A;  4TNS A;  2ZR4 A;  1QZ2 A;  3O5R A;  5HKG A;  3LUO A;  3O5I A;  5B8I C;  1N1A A;  1NSG A;  1P5Q A;  2PPN A;  1EYM A;  4O2T A;  5HW7 A;  2RUQ A;  5HW8 A;  1ZCN A;  2AWG A;  2K8I A;  3GPK A;  3JYM A;  4LAY A;  4IQC A;  4DT4 A;  5HTG A;  3KAF A;  1J6Y A;  4MSP A;  2KO7 A;  1T11 A;  3O5G A;  5HWC A;  2XP9 A;  4QIB A;  1FKK A;  4NNR A;  2VCD A;  4ODL A;  1PBK A;  4J4O A;  3B7X A;  3KCE A;  2M2A A;  4LAW A;  5DIT A;  1FKJ A;  1D6O A;  2MLY A;  2PV2 A;  2RUC A;  4TW7 A;  2M1I A;  4TW8 A;  2DG4 A;  5HUA A;  5DIV A;  1FKR A;  1FKF A;  1YW5 A;  2ITK A;  4G50 A;  3O5M A;  3RGC A;  4DZ2 A;  5I98 A;  1QPL A;  1U79 A;  1Q6I A;  2XP3 A;  1JNT A;  3CGN A;  4R0X A;  2MNT A;  3EY6 A;  2PBC A;  2ZR6 A;  4DRN A;  2F2D A;  2UZ5 A;  2RQS A;  3IKD A;  3KAG A;  1KT1 A;  2Q5A A;  3O5E A;  5HWB A;  2VN1 A;  1B6C A;  2JZV A;  2XP7 A;  4LAV A;  4ODP A;  1ZK6 A;  2MLX A;  2PV3 A;  2XPA A;  3JYJ A;  4ODO A;  3O5P A;  5D75 A;  5DIU A;  4U85 A;  4DRJ A;  2XP8 A;  4GGQ A;  1FAP A;  3NTP A;  1FJD A;  2KFW A;  1NMV A;  1FD9 A;  4IPX A;  4QT3 A;  3ODK A;  1J4I A;  4QT2 A;  1L1P A;  1F8A B;  1QPF A;  2ZR5 A;  3WH0 A;  3UI6 A;  4TYO A;  1Q6H A;  1Q6U A;  3PRB A;  4LAX A;  3O5L A;  4TW6 A;  1FKT A;  2RUD A;  4G2P A;  4N19 A;  1HXV A;  3KAC A;  3H9R B;  4ODN A;  3JXV A;  2PPO A;  1FKD A;  1NMW A;  3PRD A;  4DZ3 A;  3RFW A;  1C9H A;  2KI3 A;  1D7H A;  3IKG A;  3O5Q A;  4DRQ A;  3TCZ A; 
#chains in the Genus database with same CATH topology
 2P4V A;  2F4E A;  1D7I A;  5JH8 A;  3TDB A;  1JVW A;  1F40 A;  4JFK A;  3O5F A;  4XAK A;  4U86 A;  1PIN A;  2LJ4 A;  3CGM A;  4KR0 B;  1W1P A;  3O5J A;  1W9P A;  4ODK A;  1GOI A;  1XHG A;  4MNJ A;  2WLY A;  3WL0 A;  3KAD A;  4MAV A;  1NWU A;  2IF4 A;  2MLZ A;  1FKS A;  1D2K A;  5HT1 A;  3VAW A;  3QOK A;  1Q1C A;  2QF8 A;  2WM0 A;  4ODM A;  2ZQS A;  4ITZ A;  4WJX A;  4UDM A;  2MPH A;  1ITX A;  3IHZ A;  1Y0O A;  1JCH B;  2ZQT A;  3ARZ A;  4Z2H A;  4FAP A;  1KFW A;  3ART A;  3ARX A;  3KZ7 A;  4JFL A;  5DO2 A;  3I6C A;  3OOB A;  1LQ0 A;  1FKL A;  1JNS A;  1A7X A;  1ZBC A;  3UQI A;  1KT0 A;  1UR9 A;  2XP5 A;  3B9A A;  1QZ2 A;  1W9V A;  5HKG A;  4LGX A;  3PR9 A;  1N1A A;  1NSG A;  1EYM A;  1W9U A;  3CZ8 A;  2K8I A;  3GPK A;  3AS0 A;  1T11 A;  4WKF A;  3AS3 A;  2OLH A;  1O6I A;  1PBK A;  4Q7N A;  4S3K A;  4WKA A;  1D6O A;  3ARO A;  4TW7 A;  1E6Z A;  5HUA A;  1ZU8 A;  5DF0 A;  1QPL A;  5DEZ A;  4Z2L A;  1JNT A;  2ZR6 A;  4DWS B;  5HWB A;  2RQS A;  3IKD A;  3KAG A;  1KT1 A;  3O5E A;  1B6C A;  4ODP A;  5I98 A;  2PV3 A;  3JYJ A;  2A3A A;  1FAP A;  1OGB A;  2KFW A;  4MNK A;  4MNL A;  1ZBW A;  4QT3 A;  2G8Z A;  1F8A B;  4TYO A;  2DSU A;  1Q6U A;  3ALF A;  3AQU A;  3O5L A;  2RUD A;  2PN0 A;  1HXV A;  3KAC A;  1X6N A;  2PPO A;  1NMW A;  3CHF A;  3RFW A;  1W1T A;  4P8V A;  3IKG A;  3O5Q A;  3TCZ A;  2M08 A;  1W26 A;  2KE0 A;  3OA5 A;  4DRO A;  4ODQ A;  1J4R A;  3UQA A;  3CHE A;  1ROT A;  5J6E A;  4JFM A;  3PA7 A;  1JNE A;  4QZV B;  4NSB A;  2FKE A;  3G6L A;  4ZS6 A;  3ARY A;  4URI A;  3CH9 A;  4WIW A;  2Y78 A;  2KGJ A;  4MGV A;  4S3J A;  1M5Y A;  2MF9 A;  2ETN A;  1EDQ A;  4DH0 A;  4ODR A;  4DRH A;  5HBF A;  3G6M A;  1ROU A;  4C02 B;  3BMB A;  3UI4 A;  4ZPW R;  2O9O A;  4DWS C;  5BXJ A;  1HJX A;  2XP6 A;  4GIV A;  3PRA A;  1D7J A;  2RSE A;  4W9P A;  1HKM A;  2F21 A;  1ZL1 A;  3GU0 A;  3LUO A;  3FXY A;  4ML4 A;  1P5Q A;  4ZPT R;  1W1V A;  5HW8 A;  3B9E A;  2YBU A;  4IQC A;  3WKZ A;  2DPE A;  4QIB A;  1FKK A;  2VCD A;  3AS1 A;  1H0G A;  5GQB A;  3WL1 A;  3B7X A;  2PI6 A;  1E9L A;  2O92 A;  2MLY A;  2M1I A;  1LG1 A;  5DIV A;  1FKR A;  1YW5 A;  4G50 A;  3O5M A;  1U79 A;  1Q6I A;  3AS2 A;  4R0X A;  4L72 B;  1GPF A;  3EY6 A;  2F2D A;  1UR8 A;  4Z2G A;  2XP7 A;  4ODO A;  5D75 A;  4DRJ A;  5DIU A;  3NTP A;  1FJD A;  3ARW A;  4P8W A;  3WH0 A;  4G2P A;  1LL4 A;  3H9R B;  1FKD A;  3PRD A;  1WAW A;  1E6N A;  1E15 A;  1D7H A;  3WIJ A;  1E6R A;  3TC5 A;  4R5E A;  1YAT A;  1RD6 A;  1IX5 A;  3W4R A;  1HJW A;  1FKI A;  2L2S A;  3MDY B;  3O5O A;  2DG9 A;  4W9O A;  4W5U A;  3WQV A;  3UI5 A;  3RM8 A;  1BL4 A;  3UF8 A;  1NWS A;  4DRP A;  4HBO A;  3RME A;  4Z2J A;  2LPV A;  4U84 A;  1ZBV A;  3KAI A;  1HJV A;  4IQ2 A;  4MPK A;  3O5D A;  4PTM A;  2DG3 A;  1FKG A;  2D9F A;  4DWS D;  2DT1 A;  2DT2 A;  5HW6 A;  4NZC A;  3IK8 A;  3WD0 A;  5GPG A;  2B31 A;  2F23 A;  4IT4 A;  2ESC A;  1WB0 A;  4JFI A;  1BKF A;  1HKJ A;  3EIP A;  1GUV A;  1EQ3 A;  2ZQV A;  2XP4 A;  2FAP A;  4J4N A;  1LG2 A;  4TNS A;  2ZR4 A;  3O5R A;  2IUZ A;  3O5I A;  5B8I C;  1K9T A;  4Q22 A;  2RUQ A;  1ZCN A;  4LAY A;  3B9D A;  5HWC A;  2XP9 A;  4ODL A;  5GPR A;  3WD1 A;  4J4O A;  3ARR A;  1ZB5 A;  1X6L A;  2M2A A;  3RM9 A;  2DSV A;  5DIT A;  1NH6 A;  2PV2 A;  2RUC A;  2DSZ A;  4TW8 A;  1FKF A;  2ITK A;  2EUL A;  1EHN A;  3RGC A;  4DZ2 A;  1SR0 A;  4MTV A;  1NWR A;  2PBC A;  4DRN A;  1E6P A;  2Q5A A;  4HBE A;  2JZV A;  2AOS A;  4LAV A;  3O5P A;  4U85 A;  2XP8 A;  3ARV A;  1FD9 A;  1HKI A;  1SYT A;  4QT2 A;  1L1P A;  2ZR5 A;  3FY1 A;  3UI6 A;  2YBT A;  3WD3 A;  3PRB A;  1CTN A;  1FKT A;  4N19 A;  2DT0 A;  4ODN A;  3JXV A;  1OWQ A;  4DZ3 A;  1E44 A;  2KI3 A;  1GRJ A;  3O5K A;  4W9Q A;  1HKK A;  4WK9 A;  1XRV A;  2OFN A;  1LL6 A;  2PPP A;  4BF8 A;  1FKH A;  1FKB A;  4JFJ A;  2LKN A;  4DIP A;  1J4H A;  2XPB A;  3ARU A;  2WK2 A;  3UQB A;  2ZQU A;  1EIB A;  3KAH A;  1TFV A;  4DRI A;  2LGO A;  1W1Y A;  2N87 A;  3NRK A;  3WD4 A;  1LL7 A;  3NI6 A;  1H0I A;  2KR7 A;  1R9H A;  2PV1 A;  2FDM A;  3FAP A;  3KAB A;  4ZPV R;  1TCO C;  3WD2 A;  4JYS A;  1FFQ A;  3RM4 A;  3B8S A;  2RUR A;  4DRM A;  3GTY X;  4DRK A;  4TX0 A;  1OGG A;  4FN2 A;  2B5U B;  3BXW A;  2PPN A;  1ZBK A;  4O2T A;  5HW7 A;  2AWG A;  3JYM A;  4DT4 A;  5HTG A;  3KAF A;  1J6Y A;  4MSP A;  2KO7 A;  3O5G A;  4NNR A;  4P8X A;  3ARQ A;  2DT3 A;  4DWS A;  2DSW A;  3KCE A;  4LAW A;  1JND A;  1FKJ A;  4MNM A;  2DG4 A;  2A3E A;  1FFR A;  4Z2I A;  3ALG A;  2XP3 A;  4AY1 A;  3CGN A;  2MNT A;  2UZ5 A;  2VN1 A;  4WKH A;  1ZK6 A;  2MLX A;  2XPA A;  2WLZ A;  4GGQ A;  3ARS A;  1NMV A;  2A3B A;  2G41 A;  4IPX A;  3CHC A;  3ODK A;  1J4I A;  3ARP A;  1QPF A;  4IT6 A;  1Q6H A;  4LAX A;  4TW6 A;  1WNO A;  1NWT A;  4Z2K A;  4KQZ A;  1LJY A;  4HAR A;  3WQW A;  3CHD A;  2A3C A;  1C9H A;  4L3N A;  1VF8 A;  4P8U A;  4DRQ A; 
#chains in the Genus database with same CATH homology
 2F4E A;  1D7I A;  5JH8 A;  3TDB A;  1JVW A;  1F40 A;  4JFK A;  3O5F A;  4XAK A;  4U86 A;  1PIN A;  2LJ4 A;  3CGM A;  4KR0 B;  1W1P A;  3O5J A;  1W9P A;  4ODK A;  1GOI A;  1XHG A;  4MNJ A;  2WLY A;  3WL0 A;  3KAD A;  4MAV A;  1NWU A;  2IF4 A;  2MLZ A;  1FKS A;  1D2K A;  5HT1 A;  3VAW A;  3QOK A;  1Q1C A;  2QF8 A;  2WM0 A;  4ODM A;  2ZQS A;  4ITZ A;  4WJX A;  2MPH A;  1ITX A;  3IHZ A;  1Y0O A;  2ZQT A;  3ARZ A;  4Z2H A;  4FAP A;  1KFW A;  3ART A;  3ARX A;  3KZ7 A;  4JFL A;  5DO2 A;  3I6C A;  3OOB A;  1LQ0 A;  1FKL A;  1JNS A;  1A7X A;  1ZBC A;  3UQI A;  1KT0 A;  1UR9 A;  2XP5 A;  3B9A A;  1QZ2 A;  1W9V A;  5HKG A;  4LGX A;  3PR9 A;  1N1A A;  1NSG A;  1EYM A;  1W9U A;  3CZ8 A;  2K8I A;  3GPK A;  3AS0 A;  1T11 A;  4WKF A;  3AS3 A;  2OLH A;  1O6I A;  1PBK A;  4Q7N A;  4S3K A;  4WKA A;  1D6O A;  3ARO A;  4TW7 A;  1E6Z A;  5HUA A;  1ZU8 A;  5DF0 A;  1QPL A;  5DEZ A;  4Z2L A;  1JNT A;  2ZR6 A;  4DWS B;  5HWB A;  2RQS A;  3IKD A;  3KAG A;  1KT1 A;  3O5E A;  1B6C A;  4ODP A;  5I98 A;  2PV3 A;  3JYJ A;  2A3A A;  1FAP A;  1OGB A;  2KFW A;  4MNK A;  4MNL A;  1ZBW A;  4QT3 A;  2G8Z A;  1F8A B;  4TYO A;  2DSU A;  1Q6U A;  3ALF A;  3AQU A;  3O5L A;  2RUD A;  1HXV A;  3KAC A;  1X6N A;  2PPO A;  1NMW A;  3CHF A;  3RFW A;  1W1T A;  4P8V A;  3IKG A;  3O5Q A;  3TCZ A;  2M08 A;  1W26 A;  2KE0 A;  3OA5 A;  4DRO A;  4ODQ A;  1J4R A;  3UQA A;  3CHE A;  1ROT A;  5J6E A;  4JFM A;  3PA7 A;  1JNE A;  4QZV B;  4NSB A;  2FKE A;  3G6L A;  4ZS6 A;  3ARY A;  4URI A;  3CH9 A;  4WIW A;  2Y78 A;  2KGJ A;  4MGV A;  4S3J A;  1M5Y A;  2MF9 A;  1EDQ A;  4DH0 A;  4ODR A;  4DRH A;  5HBF A;  3G6M A;  1ROU A;  4C02 B;  3UI4 A;  4ZPW R;  2O9O A;  4DWS C;  5BXJ A;  1HJX A;  2XP6 A;  4GIV A;  3PRA A;  1D7J A;  2RSE A;  4W9P A;  1HKM A;  2F21 A;  1ZL1 A;  3LUO A;  3FXY A;  4ML4 A;  1P5Q A;  4ZPT R;  1W1V A;  5HW8 A;  3B9E A;  2YBU A;  4IQC A;  3WKZ A;  2DPE A;  4QIB A;  1FKK A;  2VCD A;  3AS1 A;  1H0G A;  5GQB A;  3WL1 A;  3B7X A;  2PI6 A;  1E9L A;  2O92 A;  2MLY A;  2M1I A;  1LG1 A;  5DIV A;  1FKR A;  1YW5 A;  4G50 A;  3O5M A;  1U79 A;  1Q6I A;  3AS2 A;  4R0X A;  4L72 B;  1GPF A;  3EY6 A;  2F2D A;  1UR8 A;  4Z2G A;  2XP7 A;  4ODO A;  5D75 A;  4DRJ A;  5DIU A;  3NTP A;  1FJD A;  3ARW A;  4P8W A;  3WH0 A;  4G2P A;  1LL4 A;  3H9R B;  1FKD A;  3PRD A;  1WAW A;  1E6N A;  1E15 A;  1D7H A;  3WIJ A;  1E6R A;  3TC5 A;  4R5E A;  1YAT A;  1RD6 A;  1IX5 A;  3W4R A;  1HJW A;  1FKI A;  2L2S A;  3MDY B;  3O5O A;  2DG9 A;  4W9O A;  4W5U A;  3WQV A;  3UI5 A;  3RM8 A;  1BL4 A;  3UF8 A;  1NWS A;  4DRP A;  4HBO A;  3RME A;  4Z2J A;  2LPV A;  4U84 A;  1ZBV A;  3KAI A;  1HJV A;  4IQ2 A;  4MPK A;  3O5D A;  4PTM A;  2DG3 A;  1FKG A;  2D9F A;  4DWS D;  2DT1 A;  2DT2 A;  5HW6 A;  4NZC A;  3IK8 A;  3WD0 A;  5GPG A;  2B31 A;  4IT4 A;  2ESC A;  1WB0 A;  4JFI A;  1BKF A;  1HKJ A;  1EQ3 A;  1GUV A;  2ZQV A;  2XP4 A;  2FAP A;  4J4N A;  1LG2 A;  4TNS A;  2ZR4 A;  3O5R A;  2IUZ A;  3O5I A;  5B8I C;  1K9T A;  4Q22 A;  2RUQ A;  1ZCN A;  4LAY A;  3B9D A;  5HWC A;  2XP9 A;  4ODL A;  5GPR A;  3WD1 A;  4J4O A;  3ARR A;  1ZB5 A;  1X6L A;  2M2A A;  3RM9 A;  2DSV A;  5DIT A;  1NH6 A;  2PV2 A;  2RUC A;  2DSZ A;  4TW8 A;  1FKF A;  2ITK A;  1EHN A;  3RGC A;  4DZ2 A;  1SR0 A;  4MTV A;  1NWR A;  2PBC A;  4DRN A;  1E6P A;  2Q5A A;  4HBE A;  2JZV A;  2AOS A;  4LAV A;  3O5P A;  4U85 A;  2XP8 A;  3ARV A;  1FD9 A;  1HKI A;  1SYT A;  4QT2 A;  1L1P A;  2ZR5 A;  3FY1 A;  3UI6 A;  2YBT A;  3WD3 A;  3PRB A;  1CTN A;  1FKT A;  4N19 A;  2DT0 A;  4ODN A;  3JXV A;  1OWQ A;  4DZ3 A;  2KI3 A;  3O5K A;  4W9Q A;  1HKK A;  4WK9 A;  1XRV A;  2OFN A;  1LL6 A;  2PPP A;  4BF8 A;  1FKH A;  1FKB A;  4JFJ A;  2LKN A;  4DIP A;  1J4H A;  2XPB A;  3ARU A;  2WK2 A;  3UQB A;  2ZQU A;  1EIB A;  3KAH A;  1TFV A;  4DRI A;  2LGO A;  1W1Y A;  2N87 A;  3NRK A;  3WD4 A;  1LL7 A;  3NI6 A;  1H0I A;  2KR7 A;  1R9H A;  2PV1 A;  2FDM A;  3FAP A;  3KAB A;  4ZPV R;  1TCO C;  3WD2 A;  4JYS A;  1FFQ A;  3RM4 A;  3B8S A;  2RUR A;  4DRM A;  4DRK A;  4TX0 A;  1OGG A;  4FN2 A;  3BXW A;  2PPN A;  1ZBK A;  4O2T A;  5HW7 A;  2AWG A;  3JYM A;  4DT4 A;  5HTG A;  3KAF A;  1J6Y A;  4MSP A;  2KO7 A;  3O5G A;  4NNR A;  4P8X A;  3ARQ A;  2DT3 A;  4DWS A;  2DSW A;  3KCE A;  4LAW A;  1JND A;  1FKJ A;  4MNM A;  2DG4 A;  2A3E A;  1FFR A;  4Z2I A;  3ALG A;  2XP3 A;  4AY1 A;  3CGN A;  2MNT A;  2UZ5 A;  2VN1 A;  4WKH A;  1ZK6 A;  2MLX A;  2XPA A;  2WLZ A;  4GGQ A;  3ARS A;  1NMV A;  2A3B A;  2G41 A;  4IPX A;  3CHC A;  3ODK A;  1J4I A;  3ARP A;  1QPF A;  4IT6 A;  1Q6H A;  4LAX A;  4TW6 A;  1WNO A;  1NWT A;  4Z2K A;  4KQZ A;  1LJY A;  4HAR A;  3WQW A;  3CHD A;  2A3C A;  1C9H A;  4L3N A;  1VF8 A;  4P8U A;  4DRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...