1BLRA

Nmr solution structure of human cellular retinoic acid binding protein-type ii, 22 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
137
structure length
137
Chain Sequence
b'PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR RETINOIC ACID BINDING PROTEIN-TYPE II
publication title NMR solution structure of type II human cellular retinoic acid binding protein: implications for ligand binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport
total genus 16
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 1998-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1blrA00
2CM9A 5FENA 3STMX 1OEEA 4BQUA 4AZQA 1ACDA 5LJHA 4NLJA 3O2YA 2Q39A 4GNWA 5D4AA 2A13A 4RUUA 5BVQA 1IKJA 2CBSA 1ZNKA 4IB7A 4OS0A 5D45A 4N7CA 1TXLA 4LKPA 3FLLA 3CBSA 1HMTA 4YCHA 3TGAA 1BWYA 5LKEA 3VG7A 4QGWA 4QZTA 3STKA 2L5PA 4NYRA 4YKOA 3KFFA 1X71A 2HLVA 1G74A 2FT9A 5KICA 1NGLA 4QYNA 1JJXA 4XMHA 1HN2A 4DQ4A 1SA8A 2CBRA 3BY0A 1EXSA 3S26A 5EDBA 1E06A 2FS7A 3TGBA 1IIUA 1GXAA 3U03A 1LIFA 4YGHA 1TVQA 4XMFA 1GT3A 2G7BA 2AT8X 1NP4A 4HFOA 2ANSA 1YUPA 2RCQA 4CK4A 5HZ8A 4HPAA 5EEDA 5HCCC 1X8PA 3T1DA 4MVLA 1A2DA 4ZHDA 2A2UA 3P6HA 1A18A 1DC9A 2ALLX 2W2FA 4YGGA 5HZ9A 4RUNA 1OBPA 1ZNGA 2AL0X 4GRJA 5DPQA 3ZQ3A 1GKAA 4I9RA 4ZGUA 2RQ0A 2JU8A 4AYHA 1EW3A 2L68A 2WR6A 4K19A 1FDQA 3PH6A 5F6BA 3VG6A 1KT7A 2POAA 1LNMA 1L6MA 1H91A 2NNQA 2IFBA 4IBAA 5JR8A 1VYGA 1DV9A 5KHPA 1BRPA 1R0UA 1KT5A 5F1EA 2O62A 2FR2A 2LB6A 5EZ2A 5H8TA 2G78A 3FELA 3WJGA 5HCEC 1ZNEA 4MVKA 4M6SA 1AQBA 4TLJA 4YFRA 2CZTA 5D48A 3B2HA 2OVEA 4ODDA 2Q9SA 3UEUA 1XCAA 4D6BA 3FMZA 3WJBA 1QY1A 2WEWA 1TOUA 1HMSA 1T0VA 1E5PA 2AT0X 3HWDA 5DG4A 1ML7A 2FS6A 3KQ0A 1EIIA 2JN3A 2X46A 3ZUIA 1KT4A 1QY2A 2FTBA 2AT3X 1I05A 3BRNA 3FA9A 4AZRA 1LIBA 3WXQA 1QABE 3EYCA 3BU1A 1I06A 1SXUA 4TKJA 1GX9A 3UEWA 1PEEA 5LKFA 1LIEA 4D6AA 4QYPA 1QWDA 1ZRYA 3KFHA 2W2BA 1O1UA 3WJFA 1KT6A 2FR3A 4AZNA 1UZ2X 1SXXA 3KZAA 5FAZA 4PSQA 1LFOA 5AQ6A 1X8UA 2JU3A 2L67A 3NP1A 1GX8A 1E00A 1VYFA 1AB0A 2OVAA 1BM5A 4NYQA 1OBUA 1IFBA 3WVMA 4GKCA 5HA1A 4AZMA 4NP1A 3TZSA 3PP6A 4QGXA 3DSZA 2FWVA 2E4JA 2PY1A 3PEDA 2RCTA 1KQXA 1FTPA 4OS3A 2K62A 1A57A 1LICA 2GJ5A 1KOIA 2ACPX 4A60A 3B2JA 4OS8A 2R73A 3RSWA 5HA0A 3VG3A 1BSOA 3P6CA 4QZUA 3D96A 3WJCA 3BX8A 3NQ3A 4Y0PA 1DFVA 1NP1A 3SAOA 3APUA 4YBPA 2QO4A 1AELA 5H9AA 4HPBA 4IB8A 2AMMX 3FENA 4AZPA 3NR3A 3EMMA 4IAWA 1KT3A 3FIQA 3C76X 4NLIA 1O8VA 3CMPA 4AW8A 4YH0A 4TKBA 4TNNA 3IA8A 4YGZA 1S7DA 1I04A 4ZCBA 1BEBA 2L9CA 2QO5A 3FA6A 1P6PA 1B8EA 1LPJA 1OPBA 2F73A 3OJYC 1YWBA 1CRBA 4M7MA 2HNXA 4EDEA 2AT6X 1G85A 5LJKA 3MVFA 2Q2PA 1BBPA 2QOSC 3U0DA 2BLGA 1FEMA 2RA6A 5L8OA 2WWPA 1RLBE 1UREA 3AKNA 1EIOA 2NNEA 2X45A 1RBPA 3P6GA 3KFIA 4GE1A 3AKMA 5HZ6A 2XKLA 3C77X 2KTDA 3I0AA 4WFVA 1EUOA 3U9PC 3HWEA 1B4MA 4GNYA 5D47A 1LIDA 4GH7A 5HWZA 1BLRA 3BU9A 4I9SA 2EU7X 1D3SA 1PBOA 1MDCA 3FW5A 2AT5X 1GM6A 2FLJA 4IMOA 2LKKA 2DM5A 3L4RA 4IMNA 4YCEA 2XSTA 1YWDA 3CQRA 4YDAA 4EEJA 4EXZA 2KT4B 5K06A 2OVDA 5H9LA 1S2PA 1YWAA 1AVGI 1SY1A 3FEPA 3HWFA 4AZOA 1A3YA 1IW2A 1QQSA 3HK1A 3F9DA 1HMRA 1PMPA 1YIVA 3HWGA 4XMDA 4BOEA 5LJEA 3F8AA 1GKAB 3B2LA 1U18A 2ACOA 1X8NA 3ELZA 4TJZA 3TF6A 4Y0QA 1HBQA 3APWA 5FFHA 1Z24A 1DZKA 2JU7A 1ALBA 3NQ9A 1ZNDA 4UU2A 5D8JA 1HBPA 1D2UA 1DZPA 1GGLA 4ORRA 2ASNX 4XMCA 3MBTA 3WJDA 1QFVA 3G7XA 1U17A 2CZUA 3CBCA 3FW4A 5HZ5A 3K3LA 4ZHGA 1TW4A 4ZFXA 1YWCA 3BDRA 2HZRA 5C0NA 4YFQA 1KQWA 2R56A 2WEXA 2A3FX 1QG5A 2N93A 2LBVA 3WBGA 1ERBA 4ZHHA 4ZH9A 4LZVA 3BLGA 1T8VA 3VG4A 4ES7A 1KGLA 2QM9A 1IKEA 2GC9A 4YBUA 1PM1X 1BRQA 2CM4A 3BSZE 1O1VA 3CR6A 4YDBA 3B2IA 4XMEA 3CQNA 5HBSA 1X8QA 2GTFX 2HYSA 1IFCA 4N7DA 4ZR2A 3QKGA 1JJJA 4NNTA 5HTDA 3TGCA 4ORXA 1G5WA 1I4UA 3FA8A 1KXOA 3GAQA 4TQ2A 1N0SA 2HZQA 2WUTA 5EEEA 2R74A 1CBSA 1U0XA 5F7GA 2JOZA 2P8GA 3FEKA 4LZUA 1CJ5A 2YG2A 4A1HA 5KIDA 1GT4A 3P6EA 4TKHA 3PECA 4WBKA 4YKMA 1EQDA 4YMYA 4WFUA 1EPBA 5F58A 4ARHA 5B27A 4ZHCA 1LKEA 1OEJA 1ZNHA 4I3CA 5B29A 1ERXA 1BSYA 4NNSA 2MM3A 5CE4A 2Q2MA 3FR5A 1SY3A 4O9SA 4DQ3A 4ZHFA 3NPOA 2RD7C 1XKIA 1SY2A 1FE3A 2LFOA 4OMXA 1ICMA 5IO6A 1X89A 4IAXA 2A0AA 5EPQA 3IFBA 5IO7A 1ADLA 1QFTA 5LJDA 1ICNA 4A1YA 3D95A 5HAEA 1CBIA 4ALOA 1CBRA 1BJ7A 2Q4NA 3CWKA 2MJIA 5HZQA 1FELA 2QO6A 2WSJA 1OBQA 2MO5A 1G7NA 4IB6A 1SY0A 3JSQA 3EBWA 3WJEA 1DF3A 4Y0RA 1DZMA 4IB9A 4ORUA 1TOWA 1DZJA 1E02A 5LJCA 5F6ZA 1EALA 4LKTA 1T68X 3Q6LA 1YP7A 3O19A 3PH5A 1JV4A 3FR2A 1S44A 1MVGA 5HTEA 4ZH6A 3UEXA 2G79A 3STNA 3C78X 3NX2A 1KZWA 3NADA 3RZYA 2AKQA 2FRSA 1JBHA 5IO5A 1CBQA 1FENA 3JS1A 3P6DA 4ORSA 2K23A 2OFMX 2AH7X 4A8ZA 2WQ9A 4YFPA 4EFGA 3ELXA 4MVIA 1EPAA 3PPTA 1LF7A 4OMWA 3EM0A 2W2AA 4UU3A 2OFRX 5BVTA 1OPAA 1BSQA 3BX7A 4KIIA 4XMGA 3ZUOA 3NX1A 3O22A 2HMBA 1VPRA 3B2KA 3EBKA 3FA7A 1MX7A 5L8IA 4I3BA 4HPDA 4HPCA 1JZUA 5H9NA 4Y0SA 3DTQA 4ZJ0A 1YP6A 3D97A 1GT1A 1MX8A 2A2GA 4QAEA 3VG5A 1B56A 4ALBA 5LJBA 3BS2A 2OZQA 3APVA 5EDCA 3VG2A 5LJGA 1KZXA 3P6FA 3I17A 4GETA 5BVSA 1X8OA 1B0OA 3APXA 1HQPA 3FR4A 3KFGA 4BVMA 1JYJA 1SXYA 1QY0A 4ORYA 1SXWA 4R0BA 4I3DA 2NP1A 1MUPA 2LBAA 1ZNLA 4ORWA 2WQAE 4QGVA 2NNDA 1OEKA 5L8NA 3UEVA 1JYDA 5H9KA 5HCDC 1GT5A
chains in the Genus database with same CATH superfamily
2CM9A 5FENA 5IRUA 3STMX 4MEEA 3RKGA 2MF6A 1OEEA 1VWRB 4U8UM 4BQUA 4AZQA 1ACDA 5LJHA 4NLJA 3O2YA 5FQ7E 2Q39A 4GNWA 3LV4A 5D4AA 2A13A 1IJ8A 3AEHA 4RUUA 1SRHA 2RTEB 5BVQA 1IKJA 2CBSA 1ZNKA 4IB7A 4OS0A 5D45A 4N7CA 1TXLA 1VWJB 4LKPA 3FLLA 3CBSA 1HMTA 4YCHA 3TGAA 1BWYA 3HPEA 4LQZA 5LKEA 2VDFA 4NW4A 3VG7A 4QGWA 4QZTA 1VWIB 1HXLA 2L5PA 3STKA 4NYRA 4BX7B 2A5CA 4YKOA 3KFFA 1X71A 2HLVA 2OVSA 1G74A 2FT9A 2IZDB 5KICA 1NGLA 4CPHA 4QYNA 1JJXA 4XMHA 1HN2A 4DQ4A 1VYOA 1SA8A 2CBRA 1SRJA 3BY0A 3CKFA 1SWBA 1EXSA 3S26A 5EDBA 3VU1A 1E06A 5FQ6E 2FS7A 3TGBA 1IIUA 1GXAA 3U03A 1LIFA 3E3CA 4YGHA 1TVQA 4XMFA 1GT3A 2G7BA 2RTLA 2AT8X 1NP4A 3FYFA 2ANSA 1YUPA 2RCQA 4HFOA 4CK4A 5HZ8A 4HPAA 5EEDA 5HCCC 1X8PA 1HQQA 2RTKA 3T1DA 4Z2OA 3N91A 2IZHB 4MVLA 3ZWEA 1A2DA 4KH8A 4ZHDA 2A2UA 3P6HA 2OF9A 1NBXA 1A18A 1DC9A 2ALLX 2W2FA 4YGGA 5HZ9A 4RUNA 1OBPA 1SRGA 1ZNGA 2AL0X 2JMBA 3RDUA 4GRJA 5DPQA 3ZQ3A 1Y9TA 1GKAA 4I9RA 4Z27A 4ZGUA 2RQ0A 2FHNX 1SWAA 2IZKA 1LELA 1SWSA 3RBYA 4ZGFA 1OSPO 4CDFA 1W5RA 2JU8A 2VFCA 2IZAA 4AYHA 1EW3A 4COTA 4L3RA 2L68A 2WR6A 4K19A 4INNA 1FDQA 4GUZA 1RXKA 3PH6A 5F6BA 3VG6A 1KT7A 2POAA 1LNMA 1SLFB 3VHHA 1L6MA 1SWHA 2C1SA 1H91A 1SWLA 2NNQA 2IFBA 4NV7A 4IBAA 5JR8A 1VYGA 2IZBA 4CDCA 1VWKB 3NBXX 5JD2A 4ML7B 3RDSA 5KHPA 1BRPA 1DV9A 1VWEB 1JJUA 1R0UA 1KT5A 5F1EA 2O62A 2FR2A 2LB6A 5EZ2A 5H8TA 4B55A 2G78A 3P24A 1LDQA 1NC9A 3FELA 3WJGA 1STPA 4DNEA 5HCEC 1ZNEA 4MVKA 4M6SA 4O4OA 4U8UO 1I78A 1AQBA 1K24A 4TLJA 2LA7A 3JQOA 2CZTA 4YFRA 1JMZA 5D48A 3B2HA 2OVEA 4ODDA 4Z2PA 2Q9SA 3UEUA 3NQKA 1XCAA 3HOLA 3FMZA 4O3WA 3WJBA 4D6BA 1QY1A 2BT9A 1JIWI 1TOUA 2WEWA 1HMSA 1T0VA 1E5PA 2AT0X 3HWDA 5DG4A 1ML7A 2FS6A 3KQ0A 1EIIA 3T6FA 1E2TA 2JN3A 2OL7A 2GTLM 4PJ2A 2X46A 3ZUIA 1KT4A 1BM5A 2Z4IA 1QY2A 2FTBA 3RDMA 2AT3X 4GJSA 3LTWA 1I05A 2RTIB 3BRNA 2FGSA 3FA9A 5B2AO 1MEPA 4AZRA 1LIBA 5CYBA 1SWTA 3WXQA 4BGFA 4Z2VA 1QABE 3EYCA 3LHNA 3BU1A 3SLJA 1I06A 1SXUA 2X55A 1Y9LA 4TKJA 1GX9A 3UEWA 1PEEA 4MIRA 4I95A 3ZW0A 5LKFA 1LIEA 4D6AA 4QYPA 3VPJE 1QWDA 1ZRYA 3KFHA 2W2BA 3VGWA 1O1UA 1RXJA 3WJFA 1KT6A 2FR3A 4I6SA 4BX6A 4O4SA 1UZ2X 1SXXA 3KZAA 4MVEA 5FAZA 4AZNA 4DCBA 4BCSA 4PSQA 1LFOA 5AQ6A 1X8UA 2JU3A 4I60A 2L67A 3ZW1A 4GD9A 1STSB 3NP1A 1GX8A 1E00A 1SRIA 1AB0A 1JMXA 1RAVA 1VYFA 1VWFB 2G8CO 2I5ZO 1VWQB 2OVAA 3OBLA 1WBIA 4GZVA 4ID2A 3RWXA 4NYQA 1OBUA 1IFBA 3WVMA 4GKCA 2MHDA 5HA1A 2DJGA 4AZMA 4FQBB 4NP1A 1SWCA 3TZSA 3PP6A 1NQMA 4QGXA 3ZI8A 1MOYA 3DSZA 2FWVA 3PQSA 2E4JA 2PY1A 1PBYA 3PEDA 2BS6A 2RCTA 1KQXA 4GK9A 1FTPA 4OS3A 1SRFA 4OEMA 1N7YA 2K62A 4O4UA 3WZOA 4CPFA 1GX3A 1A57A 1LICA 2GJ5A 5AJBA 1KOIA 2ACPX 1N9MA 3B2JA 1VWHB 2R73A 1MM9A 4OS8A 3RSWA 4A60A 5HA0A 1Y55X 1K3BA 3VG3A 1BSOA 2RTOB 3WYPA 2F09A 3P6CA 5CHKA 1SREA 4QZUA 4U46A 3D96A 4Z28A 3WJCA 3S5XA 3BX8A 3NQ3A 3ZW2A 4Y0PA 1DFVA 1NP1A 3SAOA 2ZAGA 4QQ1A 2OFBA 4JNJA 2CAMA 3APUA 2Z4HA 4YBPA 2QO4A 1AELA 1N9YA 5H9AA 2VFBA 4HPBA 2OYBO 4IB8A 2AVIA 2AMMX 3FENA 4AZPA 3NR3A 3EMMA 4IAWA 1KT3A 3FIQA 3C76X 1SWKA 3QQ2A 4NLIA 2RN4A 1Y0GA 2IZFB 1O8VA 3CMPA 4YVBA 4AW8A 4YH0A 4BJ8A 4TKBA 4TNNA 3IA8A 4GDAA 4YGZA 1S7DA 1I04A 2GTLO 2RTCB 1BEBA 2L9CA 4FBOA 4ZCBA 2WPUA 2QO5A 4Y5DA 4FBRA 3FA6A 2ZSCA 1P6PA 4CPEA 3U0DA 1B8EA 2OY1O 1LPJA 1OPBA 2F73A 3OJYC 1YWBA 1CRBA 4M7MA 2HNXA 3SOTA 4EDEA 2AT6X 3MG5A 1PTSA 1LCVA 2JW1A 1G85A 5LJKA 3MVFA 2Q2PA 3F6ZB 3PQUA 3S5VA 1BBPA 2QOSC 1SLEB 4KC8A 2BLGA 1FEMA 2RA6A 2YMSA 5L8OA 3AUMO 2WWPA 1RLBE 1UREA 3AKNA 1EIOA 2NNEA 5CSEA 3RDQA 2X45A 1RBPA 2UZ2A 3P6GA 4U8UN 4L1NA 3KFIA 3RE5A 4GE1A 3AKMA 1LCZA 5HZ6A 2X8TA 2XKLA 1WUBA 1SWQA 2KTDA 3C77X 4NV8A 3I0AA 3VE1A 4ON1A 4WFVA 1EUOA 3U9PC 3HWEA 1B4MA 3SZHA 1N4JA 4GNYA 3VE2A 5D47A 1LIDA 2RTJA 4GH7A 5HWZA 1BLRA 3BU9A 4I9SA 2I5VO 1VWCB 1D3SA 1PBOA 2DJFA 2EU7X 4JO6A 1MDCA 3FW5A 2AT5X 1GM6A 4CPHB 2M4LA 2FLJA 4IMOA 2LKKA 2DM5A 3L4RA 4CSBA 1N43A 4IMNA 4YCEA 2XSTA 1SWJA 1VWGB 4BX5A 1YWDA 3CQRA 4YDAA 4EEJA 4EXZA 2KT4B 5K06A 2OVDA 1W6FA 5H9LA 3OD9A 1S2PA 2QOMA 1YWAA 3FIDA 5FQ8E 1AVGI 1SY1A 3FEPA 3HWFA 2BS5A 4GGTA 4AZOA 1A3YA 1SLDB 1IW2A 1QQSA 2ZAIA 3HK1A 3F9DA 1HMRA 1PMPA 1YIVA 3HWGA 5AEOA 1I9HA 4XMDA 1Y53X 1RSTB 4BOEA 5LJEA 1SWGA 3P02A 3F8AA 5K67A 3D9WA 2RTNB 1GKAB 2Y3EA 3B2LA 2F01A 2IZEB 1U18A 1KL4A 1X8NA 2ACOA 3ELZA 4O3XB 4TJZA 3TF6A 2FKJA 4Y0QA 1HBQA 3APWA 5FFHA 4FBVA 2RTPB 2IZCB 1Z24A 1DZKA 2JU7A 1SWOA 2X34A 1ALBA 2X4MA 3NQ9A 1ZNDA 1JQPA 2C1QA 4QRLA 4UU2A 4OELA 5D8JA 3VHIA 1HBPA 1D2UA 4BX7A 1DZPA 1GGLA 4WHIA 3WZNA 2BC3A 4ORRA 2ASNX 2IZGB 4XMCA 3MBTA 2UYWA 3WJDA 1QFVA 3G7XA 1U17A 2CZUA 1MK5A 2FKGA 4IABA 4U9CA 3CBCA 3FW4A 5HZ5A 4Y59A 4QNIA 3K3LA 4ZHGA 5B11O 2OL6O 1TW4A 4ZFXA 1YWCA 3BDRA 2RTMA 2HZRA 5C0NA 4YFQA 3EW1A 1KQWA 2R56A 2WEXA 2A3FX 2RTFB 1QG5A 3SLTA 3EC5A 3FDCA 2N93A 2LBVA 3WBGA 1ERBA 4ZHHA 4ZH9A 4LZVA 1EI5A 1T8VA 3BLGA 3VG4A 4ES7A 4O3YA 1KGLA 2QM9A 1IKEA 2GC9A 4YBUA 1PM1X 1BRQA 2CM4A 2IZLB 3BSZE 1O1VA 3CR6A 4YDBA 2BHVA 3B2IA 2A8GA 3OE3A 4XMEA 3CQNA 3RDOA 1HY2A 4HWMA 1X8QA 3H3IA 5HBSA 2GTFX 1KFFA 3PK2A 2HYSA 1IFCA 4N7DA 4ZR2A 3QKGA 3WYQA 4GGZA 1JJJA 4NNTA 1VWBB 2IZJA 5HTDA 4ORXA 3TGCA 1G5WA 1I4UA 3FA8A 1KXOA 3GAQA 4TQ2A 2GTLN 1N0SA 1SWPA 1SWNA 2HZQA 4IRWA 1SWEA 2WUTA 1STRB 5EEEA 2R74A 1CBSA 1LCWA 1U0XA 2RTDB 2JOZA 5F7GA 4GDZA 5IRAA 3ZW0B 2P8GA 3S60A 3FEKA 4LZUA 3T2XA 2YG2A 3X00A 1CJ5A 3WOVA 4A1HA 5KIDA 3WZPA 4U3QA 1GT4A 3MM0A 3P6EA 3PECA 4GU8A 4TKHA 4WBKA 4YKMA 4BX6B 1EQDA 4YMYA 4WFUA 1EPBA 4OKAA 5B5FA 5F58A 4ARHA 1VWNB 2KW1A 3KVNA 5B27A 4CV7A 4O4XA 1LDOA 5K68A 4ZHCA 1LKEA 1KL3A 1OEJA 1ZNHA 4I3CA 4O3ZA 3ZW1B 3V8UA 1SLGB 5B29A 2KD2A 1ERXA 1BSYA 1SMPI 2MM3A 4NNSA 5CE4A 4GGRA 2Q2MA 3FR5A 1SY3A 2QMIA 4KT5A 1HXZA 4O9SA 3WZQA 5F2BA 4DQ3A 4ZHFA 1VWMB 2AF5A 4JHQA 2OY5O 3NPOA 2RD7C 2RTAA 1SWRA 1SY2A 1XKIA 1FE3A 1LUQA 2LFOA 4OMXA 1ICMA 3D4RA 4JGLA 5IO6A 2RTBB 1X89A 4IAXA 2A0AA 4MISA 3IFBA 2MWHA 1NDJA 5EPQA 4CPIA 3ZZVA 5IO7A 1ADLA 1QFTA 1VWOB 1RSUB 4KCAA 1ICNA 5B3MO 5LJDA 5B5GA 2RTHB 4A1YA 1FJ1E 3D95A 5HAEA 1CBIA 2BSZA 4ALOA 1CBRA 2RTQB 1BJ7A 2OF8A 2Q4NA 3CWKA 2MJIA 5HZQA 1FELA 4FGIB 2FHLA 2QO6A 2WSJA 3HTYA 3RDXA 1OBQA 2MO5A 2X32A 1G7NA 4IB6A 1SY0A 3JSQA 3SLOA 3EBWA 3WJEA 1SWFA 1NQNA 2KTSA 2A5BA 1DF3A 1UYNX 4Y0RA 1DZMA 3HOEA 4IB9A 4ORUA 1TOWA 1DZJA 3MX7A 3PDFA 1E02A 1UYOX 5BYPA 5F6ZA 5LJCA 4LKTA 1EALA 4CDDA 1T68X 3CKGA 3Q6LA 1YP7A 3O19A 3PH5A 1JV4A 3FR2A 1S44A 2RTRB 4GJVA 3RY2A 1MVGA 1Y52X 5HTEA 4ZH6A 3UEXA 3EW2A 5AJCA 2G79A 1VWPB 3STNA 4O49A 4EKVA 4C5PA 3C78X 3NX2A 3RE6A 1KZWA 3NADA 3RZYA 2AKQA 2FRSA 2X8SA 1JBHA 5IO5A 1CBQA 1VWDB 3VHMA 2X8FA 2JGSA 1FENA 3JS1A 3P6DA 2GH7A 4ORSA 4KC7A 2OY8A 5B10O 2K23A 2OFMX 3Q34A 2AH7X 4A8ZA 2WQ9A 4YFPA 4EFGA 3ELXA 4MVIA 1EPAA 3PPTA 1LF7A 4OMWA 1DF8A 3EM0A 2W2AA 4UU3A 2OFRX 4EQAC 1OPAA 5BVTA 1BSQA 3BX7A 2HKDA 1KL5A 4KIIA 3UAQA 4XMGA 3ZUOA 2QCBA 3NX1A 3O22A 2HMBA 1VPRA 3B2KA 3EBKA 1VWLB 3FA7A 1MX7A 1VWAB 5L8IA 4I3BA 4HPDA 4Z6JA 4HPCA 2OL8O 5IXGA 1SWUA 1JZUA 3SZJA 5H9NA 2Y3FA 1AVEA 3DTQA 3GE2A 4Y0SA 4ZJ0A 1YP6A 3D97A 1GT1A 1MX8A 2A2GA 4QAEA 1RXHA 3VG5A 1B56A 4ALBA 2X56A 5LJBA 2RTGB 3BS2A 2IZIA 2OZQA 2Y32A 3APVA 5EDCA 3VG2A 5LJGA 1KZXA 3P6FA 3I17A 4GETA 5BVSA 1X8OA 5L3YA 1B0OA 2C4IA 3APXA 2OFAA 1HQPA 1SWDA 3FR4A 3KFGA 1W4TA 2OY7A 4BX5B 2G5LA 4BVMA 1JYJA 1SXYA 1QY0A 4ORYA 2PI3O 1SXWA 4R0BA 4I3DA 2NP1A 1MUPA 2LBAA 1ZNLA 3T6LA 4BBOA 1AVDA 4ORWA 2WQAE 4QGVA 2NNDA 1OEKA 4CDEA 5IRWA 3T2WA 5L8NA 3UEVA 1JYDA 5H9KA 3SZIA 3RY1A 5HCDC 1GT5A
chains in the Genus database with same CATH topology
2CM9A 5FENA 3STMX 3RKGA 1OEEA 4U8UM 4BQUA 4AZQA 1ACDA 5LJHA 4NLJA 3O2YA 5FQ7E 2Q39A 4GNWA 3LV4A 5D4AA 2A13A 4RUUA 5BVQA 1IKJA 2CBSA 1ZNKA 4IB7A 4OS0A 5D45A 4N7CA 1TXLA 4LKPA 3FLLA 3CBSA 1HMTA 4YCHA 3TGAA 1BWYA 4LQZA 5LKEA 4NW4A 3VG7A 4QGWA 4QZTA 3STKA 2L5PA 4NYRA 4YKOA 3KFFA 1X71A 2HLVA 2OVSA 1G74A 2FT9A 5KICA 1NGLA 4QYNA 1JJXA 4XMHA 1HN2A 4DQ4A 1SA8A 2CBRA 3BY0A 1EXSA 3S26A 5EDBA 3VU1A 1E06A 5FQ6E 2FS7A 3TGBA 1IIUA 1GXAA 3U03A 1LIFA 3E3CA 4YGHA 1TVQA 4XMFA 1GT3A 2G7BA 2AT8X 1NP4A 3FYFA 2ANSA 1YUPA 2RCQA 4HFOA 4CK4A 5HZ8A 4HPAA 5EEDA 5HCCC 1X8PA 3T1DA 3N91A 4MVLA 3ZWEA 1A2DA 4KH8A 4ZHDA 2A2UA 3P6HA 1A18A 1DC9A 2ALLX 2W2FA 4YGGA 5HZ9A 4RUNA 1OBPA 1ZNGA 2AL0X 2JMBA 4GRJA 5DPQA 3ZQ3A 1Y9TA 1GKAA 4I9RA 4ZGUA 2RQ0A 4ZGFA 3RBYA 2JU8A 4AYHA 4COTA 1EW3A 4L3RA 2L68A 2WR6A 4K19A 4INNA 1FDQA 3PH6A 5F6BA 3VG6A 1KT7A 2POAA 1LNMA 1L6MA 1H91A 2NNQA 2IFBA 4IBAA 5JR8A 1VYGA 3NBXX 1DV9A 4ML7B 5KHPA 1BRPA 1R0UA 1KT5A 5F1EA 2O62A 2FR2A 2LB6A 5EZ2A 5H8TA 2G78A 3P24A 3FELA 3WJGA 5HCEC 1ZNEA 4MVKA 4M6SA 4O4OA 4U8UO 1AQBA 4TLJA 2LA7A 3JQOA 2CZTA 4YFRA 5D48A 3B2HA 2OVEA 4ODDA 2Q9SA 3UEUA 3NQKA 1XCAA 3HOLA 3FMZA 4O3WA 3WJBA 4D6BA 1QY1A 2BT9A 1JIWI 1TOUA 2WEWA 1HMSA 1T0VA 1E5PA 2AT0X 3HWDA 5DG4A 1ML7A 2FS6A 3KQ0A 1EIIA 2JN3A 2GTLM 4PJ2A 2X46A 3ZUIA 1KT4A 2Z4IA 1QY2A 2FTBA 2AT3X 1I05A 3BRNA 3FA9A 4AZRA 1LIBA 5CYBA 3WXQA 1QABE 3EYCA 3LHNA 3BU1A 1I06A 1SXUA 1Y9LA 4TKJA 1GX9A 3UEWA 1PEEA 4MIRA 4I95A 3ZW0A 5LKFA 1LIEA 4D6AA 4QYPA 3VPJE 1QWDA 1ZRYA 3KFHA 2W2BA 1O1UA 3WJFA 1KT6A 2FR3A 4I6SA 4O4SA 1UZ2X 1SXXA 3KZAA 4MVEA 5FAZA 4AZNA 4PSQA 1LFOA 5AQ6A 1X8UA 2JU3A 2L67A 3ZW1A 3NP1A 1GX8A 1E00A 1VYFA 1AB0A 2OVAA 3OBLA 4QNIA 1BM5A 4GZVA 4ID2A 3RWXA 4NYQA 1OBUA 1IFBA 3WVMA 4GKCA 2MHDA 5HA1A 4AZMA 4FQBB 4NP1A 3TZSA 3PP6A 4QGXA 3ZI8A 3DSZA 2FWVA 3PQSA 2E4JA 2PY1A 3PEDA 2BS6A 2RCTA 1KQXA 4GK9A 1FTPA 4OS3A 2K62A 4O4UA 1A57A 1LICA 2GJ5A 5AJBA 1KOIA 2ACPX 4A60A 3B2JA 4OS8A 2R73A 3RSWA 5HA0A 3VG3A 1BSOA 2F09A 3P6CA 4QZUA 3D96A 3WJCA 3S5XA 3BX8A 3NQ3A 3ZW2A 4Y0PA 1DFVA 1NP1A 3SAOA 2ZAGA 4QQ1A 3APUA 2Z4HA 4YBPA 2QO4A 1AELA 5H9AA 4HPBA 4IB8A 2AMMX 3FENA 4AZPA 3NR3A 3EMMA 4IAWA 1KT3A 3FIQA 3C76X 4NLIA 2RN4A 1O8VA 3CMPA 4AW8A 4YH0A 4TKBA 4TNNA 3IA8A 4YGZA 1S7DA 1I04A 2GTLO 4ZCBA 1BEBA 2L9CA 4FBOA 2QO5A 4FBRA 3FA6A 1P6PA 1B8EA 1LPJA 1OPBA 2F73A 3OJYC 1YWBA 1CRBA 4M7MA 2HNXA 3SOTA 4EDEA 2AT6X 2JW1A 1G85A 5LJKA 3MVFA 2Q2PA 3F6ZB 3PQUA 3S5VA 1BBPA 2QOSC 4KC8A 3U0DA 2BLGA 1FEMA 2RA6A 2YMSA 5L8OA 2WWPA 1RLBE 1UREA 3AKNA 1EIOA 2NNEA 2X45A 1RBPA 3P6GA 4U8UN 4L1NA 3KFIA 4GE1A 3AKMA 5HZ6A 2X8TA 2XKLA 3C77X 3VE1A 2KTDA 3I0AA 4ON1A 4WFVA 1EUOA 3U9PC 3HWEA 1B4MA 4GNYA 3VE2A 5D47A 1LIDA 4GH7A 5HWZA 1BLRA 3BU9A 4I9SA 2EU7X 1D3SA 1PBOA 1MDCA 3FW5A 2AT5X 1GM6A 2M4LA 2FLJA 4IMOA 2LKKA 2DM5A 3L4RA 4CSBA 4IMNA 4YCEA 2XSTA 1YWDA 3CQRA 4YDAA 4EEJA 4EXZA 2KT4B 5K06A 2OVDA 5H9LA 3OD9A 1S2PA 1YWAA 5FQ8E 1AVGI 1SY1A 3FEPA 3HWFA 2BS5A 4AZOA 1A3YA 1IW2A 1QQSA 2ZAIA 3HK1A 3F9DA 1HMRA 1PMPA 1YIVA 3HWGA 5AEOA 4XMDA 4BOEA 5LJEA 3P02A 3F8AA 1GKAB 3B2LA 1U18A 2ACOA 1X8NA 3ELZA 4O3XB 4TJZA 3TF6A 4Y0QA 1HBQA 3APWA 5FFHA 4FBVA 1Z24A 1DZKA 2JU7A 1ALBA 4QRLA 3NQ9A 1ZNDA 4UU2A 5D8JA 1HBPA 1D2UA 1DZPA 1GGLA 4WHIA 4ORRA 2ASNX 4XMCA 3MBTA 3WJDA 1QFVA 3G7XA 1U17A 2CZUA 4IABA 4U9CA 3CBCA 3FW4A 5HZ5A 3K3LA 4ZHGA 1TW4A 4ZFXA 1YWCA 3BDRA 2HZRA 5C0NA 4YFQA 1KQWA 2R56A 2WEXA 2A3FX 1QG5A 2N93A 2LBVA 3WBGA 1ERBA 4ZHHA 4ZH9A 4LZVA 1EI5A 1T8VA 3BLGA 3VG4A 4ES7A 4O3YA 1KGLA 2QM9A 1IKEA 2GC9A 4YBUA 1PM1X 1BRQA 2CM4A 3BSZE 1O1VA 3CR6A 4YDBA 2BHVA 3B2IA 4XMEA 3OE3A 3CQNA 4HWMA 1X8QA 3H3IA 5HBSA 2GTFX 2HYSA 1IFCA 4N7DA 4ZR2A 3QKGA 1JJJA 4NNTA 5HTDA 3TGCA 4ORXA 1G5WA 1I4UA 3FA8A 1KXOA 3GAQA 4TQ2A 2GTLN 1N0SA 2HZQA 2WUTA 5EEEA 2R74A 1CBSA 1U0XA 5F7GA 2JOZA 4GDZA 3ZW0B 2P8GA 3S60A 3FEKA 4LZUA 1CJ5A 2YG2A 3WOVA 4A1HA 5KIDA 4U3QA 1GT4A 3P6EA 4GU8A 3PECA 4TKHA 4WBKA 4YKMA 1EQDA 4YMYA 4WFUA 1EPBA 5F58A 4ARHA 2KW1A 5B27A 4CV7A 4O4XA 4ZHCA 1LKEA 1OEJA 3ZW1B 1ZNHA 4I3CA 4O3ZA 3V8UA 5B29A 2KD2A 1ERXA 1BSYA 1SMPI 2MM3A 4NNSA 5CE4A 2Q2MA 3FR5A 1SY3A 2QMIA 4KT5A 4O9SA 4DQ3A 4ZHFA 3NPOA 2RD7C 1XKIA 1SY2A 1FE3A 2LFOA 4OMXA 1ICMA 3D4RA 4JGLA 5IO6A 1X89A 4IAXA 2A0AA 4MISA 3IFBA 2MWHA 5EPQA 5IO7A 3ZZVA 1ADLA 1QFTA 4KCAA 5LJDA 1ICNA 4A1YA 3D95A 5HAEA 1CBIA 4ALOA 1CBRA 1BJ7A 2Q4NA 3CWKA 2MJIA 5HZQA 1FELA 4FGIB 2QO6A 2WSJA 3HTYA 1OBQA 2MO5A 1G7NA 4IB6A 1SY0A 3JSQA 3EBWA 3WJEA 2KTSA 1DF3A 4Y0RA 1DZMA 3HOEA 4IB9A 4ORUA 1TOWA 1DZJA 3MX7A 1E02A 5BYPA 5LJCA 5F6ZA 1EALA 4LKTA 1T68X 3Q6LA 1YP7A 3O19A 3PH5A 1JV4A 3FR2A 1S44A 1MVGA 5HTEA 4ZH6A 3UEXA 5AJCA 2G79A 3STNA 4O49A 3C78X 3NX2A 1KZWA 3NADA 3RZYA 2AKQA 2FRSA 2X8SA 1JBHA 5IO5A 1CBQA 2X8FA 1FENA 3JS1A 3P6DA 4ORSA 4KC7A 2K23A 2OFMX 2AH7X 4A8ZA 2WQ9A 4YFPA 4EFGA 3ELXA 4MVIA 1EPAA 3PPTA 1LF7A 4OMWA 3EM0A 2W2AA 4UU3A 2OFRX 4EQAC 1OPAA 5BVTA 1BSQA 3BX7A 4KIIA 3UAQA 4XMGA 3ZUOA 3NX1A 3O22A 2HMBA 1VPRA 3B2KA 3EBKA 3FA7A 1MX7A 5L8IA 4I3BA 4HPDA 4HPCA 1JZUA 5H9NA 4Y0SA 3DTQA 3GE2A 4ZJ0A 1YP6A 3D97A 1GT1A 1MX8A 2A2GA 4QAEA 3VG5A 1B56A 4ALBA 5LJBA 3BS2A 2OZQA 3APVA 5EDCA 3VG2A 5LJGA 1KZXA 3P6FA 3I17A 4GETA 5BVSA 1X8OA 1B0OA 3APXA 1HQPA 3FR4A 3KFGA 4BVMA 1JYJA 1SXYA 1QY0A 4ORYA 1SXWA 4R0BA 4I3DA 2NP1A 1MUPA 2LBAA 1ZNLA 4ORWA 2WQAE 4QGVA 2NNDA 1OEKA 5L8NA 3UEVA 1JYDA 5H9KA 5HCDC 1GT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CM9 A;  5FEN A;  3STM X;  1OEE A;  4BQU A;  4AZQ A;  1ACD A;  5LJH A;  4NLJ A;  3O2Y A;  2Q39 A;  4GNW A;  5D4A A;  2A13 A;  4RUU A;  5BVQ A;  1IKJ A;  2CBS A;  1ZNK A;  4IB7 A;  4OS0 A;  5D45 A;  4N7C A;  1TXL A;  4LKP A;  3FLL A;  3CBS A;  1HMT A;  4YCH A;  3TGA A;  1BWY A;  5LKE A;  3VG7 A;  4QGW A;  4QZT A;  3STK A;  2L5P A;  4NYR A;  4YKO A;  3KFF A;  1X71 A;  2HLV A;  1G74 A;  2FT9 A;  5KIC A;  1NGL A;  4QYN A;  1JJX A;  4XMH A;  1HN2 A;  4DQ4 A;  1SA8 A;  2CBR A;  3BY0 A;  1EXS A;  3S26 A;  5EDB A;  1E06 A;  2FS7 A;  3TGB A;  1IIU A;  1GXA A;  3U03 A;  1LIF A;  4YGH A;  1TVQ A;  4XMF A;  1GT3 A;  2G7B A;  2AT8 X;  1NP4 A;  4HFO A;  2ANS A;  1YUP A;  2RCQ A;  4CK4 A;  5HZ8 A;  4HPA A;  5EED A;  5HCC C;  1X8P A;  3T1D A;  4MVL A;  1A2D A;  4ZHD A;  2A2U A;  3P6H A;  1A18 A;  1DC9 A;  2ALL X;  2W2F A;  4YGG A;  5HZ9 A;  4RUN A;  1OBP A;  1ZNG A;  2AL0 X;  4GRJ A;  5DPQ A;  3ZQ3 A;  1GKA A;  4I9R A;  4ZGU A;  2RQ0 A;  2JU8 A;  4AYH A;  1EW3 A;  2L68 A;  2WR6 A;  4K19 A;  1FDQ A;  3PH6 A;  5F6B A;  3VG6 A;  1KT7 A;  2POA A;  1LNM A;  1L6M A;  1H91 A;  2NNQ A;  2IFB A;  4IBA A;  5JR8 A;  1VYG A;  1DV9 A;  5KHP A;  1BRP A;  1R0U A;  1KT5 A;  5F1E A;  2O62 A;  2FR2 A;  2LB6 A;  5EZ2 A;  5H8T A;  2G78 A;  3FEL A;  3WJG A;  5HCE C;  1ZNE A;  4MVK A;  4M6S A;  1AQB A;  4TLJ A;  4YFR A;  2CZT A;  5D48 A;  3B2H A;  2OVE A;  4ODD A;  2Q9S A;  3UEU A;  1XCA A;  4D6B A;  3FMZ A;  3WJB A;  1QY1 A;  2WEW A;  1TOU A;  1HMS A;  1T0V A;  1E5P A;  2AT0 X;  3HWD A;  5DG4 A;  1ML7 A;  2FS6 A;  3KQ0 A;  1EII A;  2JN3 A;  2X46 A;  3ZUI A;  1KT4 A;  1QY2 A;  2FTB A;  2AT3 X;  1I05 A;  3BRN A;  3FA9 A;  4AZR A;  1LIB A;  3WXQ A;  1QAB E;  3EYC A;  3BU1 A;  1I06 A;  1SXU A;  4TKJ A;  1GX9 A;  3UEW A;  1PEE A;  5LKF A;  1LIE A;  4D6A A;  4QYP A;  1QWD A;  1ZRY A;  3KFH A;  2W2B A;  1O1U A;  3WJF A;  1KT6 A;  2FR3 A;  4AZN A;  1UZ2 X;  1SXX A;  3KZA A;  5FAZ A;  4PSQ A;  1LFO A;  5AQ6 A;  1X8U A;  2JU3 A;  2L67 A;  3NP1 A;  1GX8 A;  1E00 A;  1VYF A;  1AB0 A;  2OVA A;  1BM5 A;  4NYQ A;  1OBU A;  1IFB A;  3WVM A;  4GKC A;  5HA1 A;  4AZM A;  4NP1 A;  3TZS A;  3PP6 A;  4QGX A;  3DSZ A;  2FWV A;  2E4J A;  2PY1 A;  3PED A;  2RCT A;  1KQX A;  1FTP A;  4OS3 A;  2K62 A;  1A57 A;  1LIC A;  2GJ5 A;  1KOI A;  2ACP X;  4A60 A;  3B2J A;  4OS8 A;  2R73 A;  3RSW A;  5HA0 A;  3VG3 A;  1BSO A;  3P6C A;  4QZU A;  3D96 A;  3WJC A;  3BX8 A;  3NQ3 A;  4Y0P A;  1DFV A;  1NP1 A;  3SAO A;  3APU A;  4YBP A;  2QO4 A;  1AEL A;  5H9A A;  4HPB A;  4IB8 A;  2AMM X;  3FEN A;  4AZP A;  3NR3 A;  3EMM A;  4IAW A;  1KT3 A;  3FIQ A;  3C76 X;  4NLI A;  1O8V A;  3CMP A;  4AW8 A;  4YH0 A;  4TKB A;  4TNN A;  3IA8 A;  4YGZ A;  1S7D A;  1I04 A;  4ZCB A;  1BEB A;  2L9C A;  2QO5 A;  3FA6 A;  1P6P A;  1B8E A;  1LPJ A;  1OPB A;  2F73 A;  3OJY C;  1YWB A;  1CRB A;  4M7M A;  2HNX A;  4EDE A;  2AT6 X;  1G85 A;  5LJK A;  3MVF A;  2Q2P A;  1BBP A;  2QOS C;  3U0D A;  2BLG A;  1FEM A;  2RA6 A;  5L8O A;  2WWP A;  1RLB E;  1URE A;  3AKN A;  1EIO A;  2NNE A;  2X45 A;  1RBP A;  3P6G A;  3KFI A;  4GE1 A;  3AKM A;  5HZ6 A;  2XKL A;  3C77 X;  2KTD A;  3I0A A;  4WFV A;  1EUO A;  3U9P C;  3HWE A;  1B4M A;  4GNY A;  5D47 A;  1LID A;  4GH7 A;  5HWZ A;  1BLR A;  3BU9 A;  4I9S A;  2EU7 X;  1D3S A;  1PBO A;  1MDC A;  3FW5 A;  2AT5 X;  1GM6 A;  2FLJ A;  4IMO A;  2LKK A;  2DM5 A;  3L4R A;  4IMN A;  4YCE A;  2XST A;  1YWD A;  3CQR A;  4YDA A;  4EEJ A;  4EXZ A;  2KT4 B;  5K06 A;  2OVD A;  5H9L A;  1S2P A;  1YWA A;  1AVG I;  1SY1 A;  3FEP A;  3HWF A;  4AZO A;  1A3Y A;  1IW2 A;  1QQS A;  3HK1 A;  3F9D A;  1HMR A;  1PMP A;  1YIV A;  3HWG A;  4XMD A;  4BOE A;  5LJE A;  3F8A A;  1GKA B;  3B2L A;  1U18 A;  2ACO A;  1X8N A;  3ELZ A;  4TJZ A;  3TF6 A;  4Y0Q A;  1HBQ A;  3APW A;  5FFH A;  1Z24 A;  1DZK A;  2JU7 A;  1ALB A;  3NQ9 A;  1ZND A;  4UU2 A;  5D8J A;  1HBP A;  1D2U A;  1DZP A;  1GGL A;  4ORR A;  2ASN X;  4XMC A;  3MBT A;  3WJD A;  1QFV A;  3G7X A;  1U17 A;  2CZU A;  3CBC A;  3FW4 A;  5HZ5 A;  3K3L A;  4ZHG A;  1TW4 A;  4ZFX A;  1YWC A;  3BDR A;  2HZR A;  5C0N A;  4YFQ A;  1KQW A;  2R56 A;  2WEX A;  2A3F X;  1QG5 A;  2N93 A;  2LBV A;  3WBG A;  1ERB A;  4ZHH A;  4ZH9 A;  4LZV A;  3BLG A;  1T8V A;  3VG4 A;  4ES7 A;  1KGL A;  2QM9 A;  1IKE A;  2GC9 A;  4YBU A;  1PM1 X;  1BRQ A;  2CM4 A;  3BSZ E;  1O1V A;  3CR6 A;  4YDB A;  3B2I A;  4XME A;  3CQN A;  5HBS A;  1X8Q A;  2GTF X;  2HYS A;  1IFC A;  4N7D A;  4ZR2 A;  3QKG A;  1JJJ A;  4NNT A;  5HTD A;  3TGC A;  4ORX A;  1G5W A;  1I4U A;  3FA8 A;  1KXO A;  3GAQ A;  4TQ2 A;  1N0S A;  2HZQ A;  2WUT A;  5EEE A;  2R74 A;  1CBS A;  1U0X A;  5F7G A;  2JOZ A;  2P8G A;  3FEK A;  4LZU A;  1CJ5 A;  2YG2 A;  4A1H A;  5KID A;  1GT4 A;  3P6E A;  4TKH A;  3PEC A;  4WBK A;  4YKM A;  1EQD A;  4YMY A;  4WFU A;  1EPB A;  5F58 A;  4ARH A;  5B27 A;  4ZHC A;  1LKE A;  1OEJ A;  1ZNH A;  4I3C A;  5B29 A;  1ERX A;  1BSY A;  4NNS A;  2MM3 A;  5CE4 A;  2Q2M A;  3FR5 A;  1SY3 A;  4O9S A;  4DQ3 A;  4ZHF A;  3NPO A;  2RD7 C;  1XKI A;  1SY2 A;  1FE3 A;  2LFO A;  4OMX A;  1ICM A;  5IO6 A;  1X89 A;  4IAX A;  2A0A A;  5EPQ A;  3IFB A;  5IO7 A;  1ADL A;  1QFT A;  5LJD A;  1ICN A;  4A1Y A;  3D95 A;  5HAE A;  1CBI A;  4ALO A;  1CBR A;  1BJ7 A;  2Q4N A;  3CWK A;  2MJI A;  5HZQ A;  1FEL A;  2QO6 A;  2WSJ A;  1OBQ A;  2MO5 A;  1G7N A;  4IB6 A;  1SY0 A;  3JSQ A;  3EBW A;  3WJE A;  1DF3 A;  4Y0R A;  1DZM A;  4IB9 A;  4ORU A;  1TOW A;  1DZJ A;  1E02 A;  5LJC A;  5F6Z A;  1EAL A;  4LKT A;  1T68 X;  3Q6L A;  1YP7 A;  3O19 A;  3PH5 A;  1JV4 A;  3FR2 A;  1S44 A;  1MVG A;  5HTE A;  4ZH6 A;  3UEX A;  2G79 A;  3STN A;  3C78 X;  3NX2 A;  1KZW A;  3NAD A;  3RZY A;  2AKQ A;  2FRS A;  1JBH A;  5IO5 A;  1CBQ A;  1FEN A;  3JS1 A;  3P6D A;  4ORS A;  2K23 A;  2OFM X;  2AH7 X;  4A8Z A;  2WQ9 A;  4YFP A;  4EFG A;  3ELX A;  4MVI A;  1EPA A;  3PPT A;  1LF7 A;  4OMW A;  3EM0 A;  2W2A A;  4UU3 A;  2OFR X;  5BVT A;  1OPA A;  1BSQ A;  3BX7 A;  4KII A;  4XMG A;  3ZUO A;  3NX1 A;  3O22 A;  2HMB A;  1VPR A;  3B2K A;  3EBK A;  3FA7 A;  1MX7 A;  5L8I A;  4I3B A;  4HPD A;  4HPC A;  1JZU A;  5H9N A;  4Y0S A;  3DTQ A;  4ZJ0 A;  1YP6 A;  3D97 A;  1GT1 A;  1MX8 A;  2A2G A;  4QAE A;  3VG5 A;  1B56 A;  4ALB A;  5LJB A;  3BS2 A;  2OZQ A;  3APV A;  5EDC A;  3VG2 A;  5LJG A;  1KZX A;  3P6F A;  3I17 A;  4GET A;  5BVS A;  1X8O A;  1B0O A;  3APX A;  1HQP A;  3FR4 A;  3KFG A;  4BVM A;  1JYJ A;  1SXY A;  1QY0 A;  4ORY A;  1SXW A;  4R0B A;  4I3D A;  2NP1 A;  1MUP A;  2LBA A;  1ZNL A;  4ORW A;  2WQA E;  4QGV A;  2NND A;  1OEK A;  5L8N A;  3UEV A;  1JYD A;  5H9K A;  5HCD C;  1GT5 A; 
#chains in the Genus database with same CATH topology
 2CM9 A;  5FEN A;  5IRU A;  3STM X;  4MEE A;  3RKG A;  2MF6 A;  1OEE A;  1VWR B;  4U8U M;  4BQU A;  4AZQ A;  1ACD A;  5LJH A;  4NLJ A;  3O2Y A;  5FQ7 E;  2Q39 A;  4GNW A;  3LV4 A;  5D4A A;  2A13 A;  1IJ8 A;  3AEH A;  4RUU A;  1SRH A;  2RTE B;  5BVQ A;  1IKJ A;  2CBS A;  1ZNK A;  4IB7 A;  4OS0 A;  5D45 A;  4N7C A;  1TXL A;  1VWJ B;  4LKP A;  3FLL A;  3CBS A;  1HMT A;  4YCH A;  3TGA A;  1BWY A;  3HPE A;  4LQZ A;  5LKE A;  2VDF A;  4NW4 A;  3VG7 A;  4QGW A;  4QZT A;  1VWI B;  1HXL A;  2L5P A;  3STK A;  4NYR A;  4BX7 B;  2A5C A;  4YKO A;  3KFF A;  1X71 A;  2HLV A;  2OVS A;  1G74 A;  2FT9 A;  2IZD B;  5KIC A;  1NGL A;  4CPH A;  4QYN A;  1JJX A;  4XMH A;  1HN2 A;  4DQ4 A;  1VYO A;  1SA8 A;  2CBR A;  1SRJ A;  3BY0 A;  3CKF A;  1SWB A;  1EXS A;  3S26 A;  5EDB A;  3VU1 A;  1E06 A;  5FQ6 E;  2FS7 A;  3TGB A;  1IIU A;  1GXA A;  3U03 A;  1LIF A;  3E3C A;  4YGH A;  1TVQ A;  4XMF A;  1GT3 A;  2G7B A;  2RTL A;  2AT8 X;  1NP4 A;  3FYF A;  2ANS A;  1YUP A;  2RCQ A;  4HFO A;  4CK4 A;  5HZ8 A;  4HPA A;  5EED A;  5HCC C;  1X8P A;  1HQQ A;  2RTK A;  3T1D A;  4Z2O A;  3N91 A;  2IZH B;  4MVL A;  3ZWE A;  1A2D A;  4KH8 A;  4ZHD A;  2A2U A;  3P6H A;  2OF9 A;  1NBX A;  1A18 A;  1DC9 A;  2ALL X;  2W2F A;  4YGG A;  5HZ9 A;  4RUN A;  1OBP A;  1SRG A;  1ZNG A;  2AL0 X;  2JMB A;  3RDU A;  4GRJ A;  5DPQ A;  3ZQ3 A;  1Y9T A;  1GKA A;  4I9R A;  4Z27 A;  4ZGU A;  2RQ0 A;  2FHN X;  1SWA A;  2IZK A;  1LEL A;  1SWS A;  3RBY A;  4ZGF A;  1OSP O;  4CDF A;  1W5R A;  2JU8 A;  2VFC A;  2IZA A;  4AYH A;  1EW3 A;  4COT A;  4L3R A;  2L68 A;  2WR6 A;  4K19 A;  4INN A;  1FDQ A;  4GUZ A;  1RXK A;  3PH6 A;  5F6B A;  3VG6 A;  1KT7 A;  2POA A;  1LNM A;  1SLF B;  3VHH A;  1L6M A;  1SWH A;  2C1S A;  1H91 A;  1SWL A;  2NNQ A;  2IFB A;  4NV7 A;  4IBA A;  5JR8 A;  1VYG A;  2IZB A;  4CDC A;  1VWK B;  3NBX X;  5JD2 A;  4ML7 B;  3RDS A;  5KHP A;  1BRP A;  1DV9 A;  1VWE B;  1JJU A;  1R0U A;  1KT5 A;  5F1E A;  2O62 A;  2FR2 A;  2LB6 A;  5EZ2 A;  5H8T A;  4B55 A;  2G78 A;  3P24 A;  1LDQ A;  1NC9 A;  3FEL A;  3WJG A;  1STP A;  4DNE A;  5HCE C;  1ZNE A;  4MVK A;  4M6S A;  4O4O A;  4U8U O;  1I78 A;  1AQB A;  1K24 A;  4TLJ A;  2LA7 A;  3JQO A;  2CZT A;  4YFR A;  1JMZ A;  5D48 A;  3B2H A;  2OVE A;  4ODD A;  4Z2P A;  2Q9S A;  3UEU A;  3NQK A;  1XCA A;  3HOL A;  3FMZ A;  4O3W A;  3WJB A;  4D6B A;  1QY1 A;  2BT9 A;  1JIW I;  1TOU A;  2WEW A;  1HMS A;  1T0V A;  1E5P A;  2AT0 X;  3HWD A;  5DG4 A;  1ML7 A;  2FS6 A;  3KQ0 A;  1EII A;  3T6F A;  1E2T A;  2JN3 A;  2OL7 A;  2GTL M;  4PJ2 A;  2X46 A;  3ZUI A;  1KT4 A;  1BM5 A;  2Z4I A;  1QY2 A;  2FTB A;  3RDM A;  2AT3 X;  4GJS A;  3LTW A;  1I05 A;  2RTI B;  3BRN A;  2FGS A;  3FA9 A;  5B2A O;  1MEP A;  4AZR A;  1LIB A;  5CYB A;  1SWT A;  3WXQ A;  4BGF A;  4Z2V A;  1QAB E;  3EYC A;  3LHN A;  3BU1 A;  3SLJ A;  1I06 A;  1SXU A;  2X55 A;  1Y9L A;  4TKJ A;  1GX9 A;  3UEW A;  1PEE A;  4MIR A;  4I95 A;  3ZW0 A;  5LKF A;  1LIE A;  4D6A A;  4QYP A;  3VPJ E;  1QWD A;  1ZRY A;  3KFH A;  2W2B A;  3VGW A;  1O1U A;  1RXJ A;  3WJF A;  1KT6 A;  2FR3 A;  4I6S A;  4BX6 A;  4O4S A;  1UZ2 X;  1SXX A;  3KZA A;  4MVE A;  5FAZ A;  4AZN A;  4DCB A;  4BCS A;  4PSQ A;  1LFO A;  5AQ6 A;  1X8U A;  2JU3 A;  4I60 A;  2L67 A;  3ZW1 A;  4GD9 A;  1STS B;  3NP1 A;  1GX8 A;  1E00 A;  1SRI A;  1AB0 A;  1JMX A;  1RAV A;  1VYF A;  1VWF B;  2G8C O;  2I5Z O;  1VWQ B;  2OVA A;  3OBL A;  1WBI A;  4GZV A;  4ID2 A;  3RWX A;  4NYQ A;  1OBU A;  1IFB A;  3WVM A;  4GKC A;  2MHD A;  5HA1 A;  2DJG A;  4AZM A;  4FQB B;  4NP1 A;  1SWC A;  3TZS A;  3PP6 A;  1NQM A;  4QGX A;  3ZI8 A;  1MOY A;  3DSZ A;  2FWV A;  3PQS A;  2E4J A;  2PY1 A;  1PBY A;  3PED A;  2BS6 A;  2RCT A;  1KQX A;  4GK9 A;  1FTP A;  4OS3 A;  1SRF A;  4OEM A;  1N7Y A;  2K62 A;  4O4U A;  3WZO A;  4CPF A;  1GX3 A;  1A57 A;  1LIC A;  2GJ5 A;  5AJB A;  1KOI A;  2ACP X;  1N9M A;  3B2J A;  1VWH B;  2R73 A;  1MM9 A;  4OS8 A;  3RSW A;  4A60 A;  5HA0 A;  1Y55 X;  1K3B A;  3VG3 A;  1BSO A;  2RTO B;  3WYP A;  2F09 A;  3P6C A;  5CHK A;  1SRE A;  4QZU A;  4U46 A;  3D96 A;  4Z28 A;  3WJC A;  3S5X A;  3BX8 A;  3NQ3 A;  3ZW2 A;  4Y0P A;  1DFV A;  1NP1 A;  3SAO A;  2ZAG A;  4QQ1 A;  2OFB A;  4JNJ A;  2CAM A;  3APU A;  2Z4H A;  4YBP A;  2QO4 A;  1AEL A;  1N9Y A;  5H9A A;  2VFB A;  4HPB A;  2OYB O;  4IB8 A;  2AVI A;  2AMM X;  3FEN A;  4AZP A;  3NR3 A;  3EMM A;  4IAW A;  1KT3 A;  3FIQ A;  3C76 X;  1SWK A;  3QQ2 A;  4NLI A;  2RN4 A;  1Y0G A;  2IZF B;  1O8V A;  3CMP A;  4YVB A;  4AW8 A;  4YH0 A;  4BJ8 A;  4TKB A;  4TNN A;  3IA8 A;  4GDA A;  4YGZ A;  1S7D A;  1I04 A;  2GTL O;  2RTC B;  1BEB A;  2L9C A;  4FBO A;  4ZCB A;  2WPU A;  2QO5 A;  4Y5D A;  4FBR A;  3FA6 A;  2ZSC A;  1P6P A;  4CPE A;  3U0D A;  1B8E A;  2OY1 O;  1LPJ A;  1OPB A;  2F73 A;  3OJY C;  1YWB A;  1CRB A;  4M7M A;  2HNX A;  3SOT A;  4EDE A;  2AT6 X;  3MG5 A;  1PTS A;  1LCV A;  2JW1 A;  1G85 A;  5LJK A;  3MVF A;  2Q2P A;  3F6Z B;  3PQU A;  3S5V A;  1BBP A;  2QOS C;  1SLE B;  4KC8 A;  2BLG A;  1FEM A;  2RA6 A;  2YMS A;  5L8O A;  3AUM O;  2WWP A;  1RLB E;  1URE A;  3AKN A;  1EIO A;  2NNE A;  5CSE A;  3RDQ A;  2X45 A;  1RBP A;  2UZ2 A;  3P6G A;  4U8U N;  4L1N A;  3KFI A;  3RE5 A;  4GE1 A;  3AKM A;  1LCZ A;  5HZ6 A;  2X8T A;  2XKL A;  1WUB A;  1SWQ A;  2KTD A;  3C77 X;  4NV8 A;  3I0A A;  3VE1 A;  4ON1 A;  4WFV A;  1EUO A;  3U9P C;  3HWE A;  1B4M A;  3SZH A;  1N4J A;  4GNY A;  3VE2 A;  5D47 A;  1LID A;  2RTJ A;  4GH7 A;  5HWZ A;  1BLR A;  3BU9 A;  4I9S A;  2I5V O;  1VWC B;  1D3S A;  1PBO A;  2DJF A;  2EU7 X;  4JO6 A;  1MDC A;  3FW5 A;  2AT5 X;  1GM6 A;  4CPH B;  2M4L A;  2FLJ A;  4IMO A;  2LKK A;  2DM5 A;  3L4R A;  4CSB A;  1N43 A;  4IMN A;  4YCE A;  2XST A;  1SWJ A;  1VWG B;  4BX5 A;  1YWD A;  3CQR A;  4YDA A;  4EEJ A;  4EXZ A;  2KT4 B;  5K06 A;  2OVD A;  1W6F A;  5H9L A;  3OD9 A;  1S2P A;  2QOM A;  1YWA A;  3FID A;  5FQ8 E;  1AVG I;  1SY1 A;  3FEP A;  3HWF A;  2BS5 A;  4GGT A;  4AZO A;  1A3Y A;  1SLD B;  1IW2 A;  1QQS A;  2ZAI A;  3HK1 A;  3F9D A;  1HMR A;  1PMP A;  1YIV A;  3HWG A;  5AEO A;  1I9H A;  4XMD A;  1Y53 X;  1RST B;  4BOE A;  5LJE A;  1SWG A;  3P02 A;  3F8A A;  5K67 A;  3D9W A;  2RTN B;  1GKA B;  2Y3E A;  3B2L A;  2F01 A;  2IZE B;  1U18 A;  1KL4 A;  1X8N A;  2ACO A;  3ELZ A;  4O3X B;  4TJZ A;  3TF6 A;  2FKJ A;  4Y0Q A;  1HBQ A;  3APW A;  5FFH A;  4FBV A;  2RTP B;  2IZC B;  1Z24 A;  1DZK A;  2JU7 A;  1SWO A;  2X34 A;  1ALB A;  2X4M A;  3NQ9 A;  1ZND A;  1JQP A;  2C1Q A;  4QRL A;  4UU2 A;  4OEL A;  5D8J A;  3VHI A;  1HBP A;  1D2U A;  4BX7 A;  1DZP A;  1GGL A;  4WHI A;  3WZN A;  2BC3 A;  4ORR A;  2ASN X;  2IZG B;  4XMC A;  3MBT A;  2UYW A;  3WJD A;  1QFV A;  3G7X A;  1U17 A;  2CZU A;  1MK5 A;  2FKG A;  4IAB A;  4U9C A;  3CBC A;  3FW4 A;  5HZ5 A;  4Y59 A;  4QNI A;  3K3L A;  4ZHG A;  5B11 O;  2OL6 O;  1TW4 A;  4ZFX A;  1YWC A;  3BDR A;  2RTM A;  2HZR A;  5C0N A;  4YFQ A;  3EW1 A;  1KQW A;  2R56 A;  2WEX A;  2A3F X;  2RTF B;  1QG5 A;  3SLT A;  3EC5 A;  3FDC A;  2N93 A;  2LBV A;  3WBG A;  1ERB A;  4ZHH A;  4ZH9 A;  4LZV A;  1EI5 A;  1T8V A;  3BLG A;  3VG4 A;  4ES7 A;  4O3Y A;  1KGL A;  2QM9 A;  1IKE A;  2GC9 A;  4YBU A;  1PM1 X;  1BRQ A;  2CM4 A;  2IZL B;  3BSZ E;  1O1V A;  3CR6 A;  4YDB A;  2BHV A;  3B2I A;  2A8G A;  3OE3 A;  4XME A;  3CQN A;  3RDO A;  1HY2 A;  4HWM A;  1X8Q A;  3H3I A;  5HBS A;  2GTF X;  1KFF A;  3PK2 A;  2HYS A;  1IFC A;  4N7D A;  4ZR2 A;  3QKG A;  3WYQ A;  4GGZ A;  1JJJ A;  4NNT A;  1VWB B;  2IZJ A;  5HTD A;  4ORX A;  3TGC A;  1G5W A;  1I4U A;  3FA8 A;  1KXO A;  3GAQ A;  4TQ2 A;  2GTL N;  1N0S A;  1SWP A;  1SWN A;  2HZQ A;  4IRW A;  1SWE A;  2WUT A;  1STR B;  5EEE A;  2R74 A;  1CBS A;  1LCW A;  1U0X A;  2RTD B;  2JOZ A;  5F7G A;  4GDZ A;  5IRA A;  3ZW0 B;  2P8G A;  3S60 A;  3FEK A;  4LZU A;  3T2X A;  2YG2 A;  3X00 A;  1CJ5 A;  3WOV A;  4A1H A;  5KID A;  3WZP A;  4U3Q A;  1GT4 A;  3MM0 A;  3P6E A;  3PEC A;  4GU8 A;  4TKH A;  4WBK A;  4YKM A;  4BX6 B;  1EQD A;  4YMY A;  4WFU A;  1EPB A;  4OKA A;  5B5F A;  5F58 A;  4ARH A;  1VWN B;  2KW1 A;  3KVN A;  5B27 A;  4CV7 A;  4O4X A;  1LDO A;  5K68 A;  4ZHC A;  1LKE A;  1KL3 A;  1OEJ A;  1ZNH A;  4I3C A;  4O3Z A;  3ZW1 B;  3V8U A;  1SLG B;  5B29 A;  2KD2 A;  1ERX A;  1BSY A;  1SMP I;  2MM3 A;  4NNS A;  5CE4 A;  4GGR A;  2Q2M A;  3FR5 A;  1SY3 A;  2QMI A;  4KT5 A;  1HXZ A;  4O9S A;  3WZQ A;  5F2B A;  4DQ3 A;  4ZHF A;  1VWM B;  2AF5 A;  4JHQ A;  2OY5 O;  3NPO A;  2RD7 C;  2RTA A;  1SWR A;  1SY2 A;  1XKI A;  1FE3 A;  1LUQ A;  2LFO A;  4OMX A;  1ICM A;  3D4R A;  4JGL A;  5IO6 A;  2RTB B;  1X89 A;  4IAX A;  2A0A A;  4MIS A;  3IFB A;  2MWH A;  1NDJ A;  5EPQ A;  4CPI A;  3ZZV A;  5IO7 A;  1ADL A;  1QFT A;  1VWO B;  1RSU B;  4KCA A;  1ICN A;  5B3M O;  5LJD A;  5B5G A;  2RTH B;  4A1Y A;  1FJ1 E;  3D95 A;  5HAE A;  1CBI A;  2BSZ A;  4ALO A;  1CBR A;  2RTQ B;  1BJ7 A;  2OF8 A;  2Q4N A;  3CWK A;  2MJI A;  5HZQ A;  1FEL A;  4FGI B;  2FHL A;  2QO6 A;  2WSJ A;  3HTY A;  3RDX A;  1OBQ A;  2MO5 A;  2X32 A;  1G7N A;  4IB6 A;  1SY0 A;  3JSQ A;  3SLO A;  3EBW A;  3WJE A;  1SWF A;  1NQN A;  2KTS A;  2A5B A;  1DF3 A;  1UYN X;  4Y0R A;  1DZM A;  3HOE A;  4IB9 A;  4ORU A;  1TOW A;  1DZJ A;  3MX7 A;  3PDF A;  1E02 A;  1UYO X;  5BYP A;  5F6Z A;  5LJC A;  4LKT A;  1EAL A;  4CDD A;  1T68 X;  3CKG A;  3Q6L A;  1YP7 A;  3O19 A;  3PH5 A;  1JV4 A;  3FR2 A;  1S44 A;  2RTR B;  4GJV A;  3RY2 A;  1MVG A;  1Y52 X;  5HTE A;  4ZH6 A;  3UEX A;  3EW2 A;  5AJC A;  2G79 A;  1VWP B;  3STN A;  4O49 A;  4EKV A;  4C5P A;  3C78 X;  3NX2 A;  3RE6 A;  1KZW A;  3NAD A;  3RZY A;  2AKQ A;  2FRS A;  2X8S A;  1JBH A;  5IO5 A;  1CBQ A;  1VWD B;  3VHM A;  2X8F A;  2JGS A;  1FEN A;  3JS1 A;  3P6D A;  2GH7 A;  4ORS A;  4KC7 A;  2OY8 A;  5B10 O;  2K23 A;  2OFM X;  3Q34 A;  2AH7 X;  4A8Z A;  2WQ9 A;  4YFP A;  4EFG A;  3ELX A;  4MVI A;  1EPA A;  3PPT A;  1LF7 A;  4OMW A;  1DF8 A;  3EM0 A;  2W2A A;  4UU3 A;  2OFR X;  4EQA C;  1OPA A;  5BVT A;  1BSQ A;  3BX7 A;  2HKD A;  1KL5 A;  4KII A;  3UAQ A;  4XMG A;  3ZUO A;  2QCB A;  3NX1 A;  3O22 A;  2HMB A;  1VPR A;  3B2K A;  3EBK A;  1VWL B;  3FA7 A;  1MX7 A;  1VWA B;  5L8I A;  4I3B A;  4HPD A;  4Z6J A;  4HPC A;  2OL8 O;  5IXG A;  1SWU A;  1JZU A;  3SZJ A;  5H9N A;  2Y3F A;  1AVE A;  3DTQ A;  3GE2 A;  4Y0S A;  4ZJ0 A;  1YP6 A;  3D97 A;  1GT1 A;  1MX8 A;  2A2G A;  4QAE A;  1RXH A;  3VG5 A;  1B56 A;  4ALB A;  2X56 A;  5LJB A;  2RTG B;  3BS2 A;  2IZI A;  2OZQ A;  2Y32 A;  3APV A;  5EDC A;  3VG2 A;  5LJG A;  1KZX A;  3P6F A;  3I17 A;  4GET A;  5BVS A;  1X8O A;  5L3Y A;  1B0O A;  2C4I A;  3APX A;  2OFA A;  1HQP A;  1SWD A;  3FR4 A;  3KFG A;  1W4T A;  2OY7 A;  4BX5 B;  2G5L A;  4BVM A;  1JYJ A;  1SXY A;  1QY0 A;  4ORY A;  2PI3 O;  1SXW A;  4R0B A;  4I3D A;  2NP1 A;  1MUP A;  2LBA A;  1ZNL A;  3T6L A;  4BBO A;  1AVD A;  4ORW A;  2WQA E;  4QGV A;  2NND A;  1OEK A;  4CDE A;  5IRW A;  3T2W A;  5L8N A;  3UEV A;  1JYD A;  5H9K A;  3SZI A;  3RY1 A;  5HCD C;  1GT5 A; 
#chains in the Genus database with same CATH homology
 2CM9 A;  5FEN A;  3STM X;  3RKG A;  1OEE A;  4U8U M;  4BQU A;  4AZQ A;  1ACD A;  5LJH A;  4NLJ A;  3O2Y A;  5FQ7 E;  2Q39 A;  4GNW A;  3LV4 A;  5D4A A;  2A13 A;  4RUU A;  5BVQ A;  1IKJ A;  2CBS A;  1ZNK A;  4IB7 A;  4OS0 A;  5D45 A;  4N7C A;  1TXL A;  4LKP A;  3FLL A;  3CBS A;  1HMT A;  4YCH A;  3TGA A;  1BWY A;  4LQZ A;  5LKE A;  4NW4 A;  3VG7 A;  4QGW A;  4QZT A;  3STK A;  2L5P A;  4NYR A;  4YKO A;  3KFF A;  1X71 A;  2HLV A;  2OVS A;  1G74 A;  2FT9 A;  5KIC A;  1NGL A;  4QYN A;  1JJX A;  4XMH A;  1HN2 A;  4DQ4 A;  1SA8 A;  2CBR A;  3BY0 A;  1EXS A;  3S26 A;  5EDB A;  3VU1 A;  1E06 A;  5FQ6 E;  2FS7 A;  3TGB A;  1IIU A;  1GXA A;  3U03 A;  1LIF A;  3E3C A;  4YGH A;  1TVQ A;  4XMF A;  1GT3 A;  2G7B A;  2AT8 X;  1NP4 A;  3FYF A;  2ANS A;  1YUP A;  2RCQ A;  4HFO A;  4CK4 A;  5HZ8 A;  4HPA A;  5EED A;  5HCC C;  1X8P A;  3T1D A;  3N91 A;  4MVL A;  3ZWE A;  1A2D A;  4KH8 A;  4ZHD A;  2A2U A;  3P6H A;  1A18 A;  1DC9 A;  2ALL X;  2W2F A;  4YGG A;  5HZ9 A;  4RUN A;  1OBP A;  1ZNG A;  2AL0 X;  2JMB A;  4GRJ A;  5DPQ A;  3ZQ3 A;  1Y9T A;  1GKA A;  4I9R A;  4ZGU A;  2RQ0 A;  4ZGF A;  3RBY A;  2JU8 A;  4AYH A;  4COT A;  1EW3 A;  4L3R A;  2L68 A;  2WR6 A;  4K19 A;  4INN A;  1FDQ A;  3PH6 A;  5F6B A;  3VG6 A;  1KT7 A;  2POA A;  1LNM A;  1L6M A;  1H91 A;  2NNQ A;  2IFB A;  4IBA A;  5JR8 A;  1VYG A;  3NBX X;  1DV9 A;  4ML7 B;  5KHP A;  1BRP A;  1R0U A;  1KT5 A;  5F1E A;  2O62 A;  2FR2 A;  2LB6 A;  5EZ2 A;  5H8T A;  2G78 A;  3P24 A;  3FEL A;  3WJG A;  5HCE C;  1ZNE A;  4MVK A;  4M6S A;  4O4O A;  4U8U O;  1AQB A;  4TLJ A;  2LA7 A;  3JQO A;  2CZT A;  4YFR A;  5D48 A;  3B2H A;  2OVE A;  4ODD A;  2Q9S A;  3UEU A;  3NQK A;  1XCA A;  3HOL A;  3FMZ A;  4O3W A;  3WJB A;  4D6B A;  1QY1 A;  2BT9 A;  1JIW I;  1TOU A;  2WEW A;  1HMS A;  1T0V A;  1E5P A;  2AT0 X;  3HWD A;  5DG4 A;  1ML7 A;  2FS6 A;  3KQ0 A;  1EII A;  2JN3 A;  2GTL M;  4PJ2 A;  2X46 A;  3ZUI A;  1KT4 A;  2Z4I A;  1QY2 A;  2FTB A;  2AT3 X;  1I05 A;  3BRN A;  3FA9 A;  4AZR A;  1LIB A;  5CYB A;  3WXQ A;  1QAB E;  3EYC A;  3LHN A;  3BU1 A;  1I06 A;  1SXU A;  1Y9L A;  4TKJ A;  1GX9 A;  3UEW A;  1PEE A;  4MIR A;  4I95 A;  3ZW0 A;  5LKF A;  1LIE A;  4D6A A;  4QYP A;  3VPJ E;  1QWD A;  1ZRY A;  3KFH A;  2W2B A;  1O1U A;  3WJF A;  1KT6 A;  2FR3 A;  4I6S A;  4O4S A;  1UZ2 X;  1SXX A;  3KZA A;  4MVE A;  5FAZ A;  4AZN A;  4PSQ A;  1LFO A;  5AQ6 A;  1X8U A;  2JU3 A;  2L67 A;  3ZW1 A;  3NP1 A;  1GX8 A;  1E00 A;  1VYF A;  1AB0 A;  2OVA A;  3OBL A;  4QNI A;  1BM5 A;  4GZV A;  4ID2 A;  3RWX A;  4NYQ A;  1OBU A;  1IFB A;  3WVM A;  4GKC A;  2MHD A;  5HA1 A;  4AZM A;  4FQB B;  4NP1 A;  3TZS A;  3PP6 A;  4QGX A;  3ZI8 A;  3DSZ A;  2FWV A;  3PQS A;  2E4J A;  2PY1 A;  3PED A;  2BS6 A;  2RCT A;  1KQX A;  4GK9 A;  1FTP A;  4OS3 A;  2K62 A;  4O4U A;  1A57 A;  1LIC A;  2GJ5 A;  5AJB A;  1KOI A;  2ACP X;  4A60 A;  3B2J A;  4OS8 A;  2R73 A;  3RSW A;  5HA0 A;  3VG3 A;  1BSO A;  2F09 A;  3P6C A;  4QZU A;  3D96 A;  3WJC A;  3S5X A;  3BX8 A;  3NQ3 A;  3ZW2 A;  4Y0P A;  1DFV A;  1NP1 A;  3SAO A;  2ZAG A;  4QQ1 A;  3APU A;  2Z4H A;  4YBP A;  2QO4 A;  1AEL A;  5H9A A;  4HPB A;  4IB8 A;  2AMM X;  3FEN A;  4AZP A;  3NR3 A;  3EMM A;  4IAW A;  1KT3 A;  3FIQ A;  3C76 X;  4NLI A;  2RN4 A;  1O8V A;  3CMP A;  4AW8 A;  4YH0 A;  4TKB A;  4TNN A;  3IA8 A;  4YGZ A;  1S7D A;  1I04 A;  2GTL O;  4ZCB A;  1BEB A;  2L9C A;  4FBO A;  2QO5 A;  4FBR A;  3FA6 A;  1P6P A;  1B8E A;  1LPJ A;  1OPB A;  2F73 A;  3OJY C;  1YWB A;  1CRB A;  4M7M A;  2HNX A;  3SOT A;  4EDE A;  2AT6 X;  2JW1 A;  1G85 A;  5LJK A;  3MVF A;  2Q2P A;  3F6Z B;  3PQU A;  3S5V A;  1BBP A;  2QOS C;  4KC8 A;  3U0D A;  2BLG A;  1FEM A;  2RA6 A;  2YMS A;  5L8O A;  2WWP A;  1RLB E;  1URE A;  3AKN A;  1EIO A;  2NNE A;  2X45 A;  1RBP A;  3P6G A;  4U8U N;  4L1N A;  3KFI A;  4GE1 A;  3AKM A;  5HZ6 A;  2X8T A;  2XKL A;  3C77 X;  3VE1 A;  2KTD A;  3I0A A;  4ON1 A;  4WFV A;  1EUO A;  3U9P C;  3HWE A;  1B4M A;  4GNY A;  3VE2 A;  5D47 A;  1LID A;  4GH7 A;  5HWZ A;  1BLR A;  3BU9 A;  4I9S A;  2EU7 X;  1D3S A;  1PBO A;  1MDC A;  3FW5 A;  2AT5 X;  1GM6 A;  2M4L A;  2FLJ A;  4IMO A;  2LKK A;  2DM5 A;  3L4R A;  4CSB A;  4IMN A;  4YCE A;  2XST A;  1YWD A;  3CQR A;  4YDA A;  4EEJ A;  4EXZ A;  2KT4 B;  5K06 A;  2OVD A;  5H9L A;  3OD9 A;  1S2P A;  1YWA A;  5FQ8 E;  1AVG I;  1SY1 A;  3FEP A;  3HWF A;  2BS5 A;  4AZO A;  1A3Y A;  1IW2 A;  1QQS A;  2ZAI A;  3HK1 A;  3F9D A;  1HMR A;  1PMP A;  1YIV A;  3HWG A;  5AEO A;  4XMD A;  4BOE A;  5LJE A;  3P02 A;  3F8A A;  1GKA B;  3B2L A;  1U18 A;  2ACO A;  1X8N A;  3ELZ A;  4O3X B;  4TJZ A;  3TF6 A;  4Y0Q A;  1HBQ A;  3APW A;  5FFH A;  4FBV A;  1Z24 A;  1DZK A;  2JU7 A;  1ALB A;  4QRL A;  3NQ9 A;  1ZND A;  4UU2 A;  5D8J A;  1HBP A;  1D2U A;  1DZP A;  1GGL A;  4WHI A;  4ORR A;  2ASN X;  4XMC A;  3MBT A;  3WJD A;  1QFV A;  3G7X A;  1U17 A;  2CZU A;  4IAB A;  4U9C A;  3CBC A;  3FW4 A;  5HZ5 A;  3K3L A;  4ZHG A;  1TW4 A;  4ZFX A;  1YWC A;  3BDR A;  2HZR A;  5C0N A;  4YFQ A;  1KQW A;  2R56 A;  2WEX A;  2A3F X;  1QG5 A;  2N93 A;  2LBV A;  3WBG A;  1ERB A;  4ZHH A;  4ZH9 A;  4LZV A;  1EI5 A;  1T8V A;  3BLG A;  3VG4 A;  4ES7 A;  4O3Y A;  1KGL A;  2QM9 A;  1IKE A;  2GC9 A;  4YBU A;  1PM1 X;  1BRQ A;  2CM4 A;  3BSZ E;  1O1V A;  3CR6 A;  4YDB A;  2BHV A;  3B2I A;  4XME A;  3OE3 A;  3CQN A;  4HWM A;  1X8Q A;  3H3I A;  5HBS A;  2GTF X;  2HYS A;  1IFC A;  4N7D A;  4ZR2 A;  3QKG A;  1JJJ A;  4NNT A;  5HTD A;  3TGC A;  4ORX A;  1G5W A;  1I4U A;  3FA8 A;  1KXO A;  3GAQ A;  4TQ2 A;  2GTL N;  1N0S A;  2HZQ A;  2WUT A;  5EEE A;  2R74 A;  1CBS A;  1U0X A;  5F7G A;  2JOZ A;  4GDZ A;  3ZW0 B;  2P8G A;  3S60 A;  3FEK A;  4LZU A;  1CJ5 A;  2YG2 A;  3WOV A;  4A1H A;  5KID A;  4U3Q A;  1GT4 A;  3P6E A;  4GU8 A;  3PEC A;  4TKH A;  4WBK A;  4YKM A;  1EQD A;  4YMY A;  4WFU A;  1EPB A;  5F58 A;  4ARH A;  2KW1 A;  5B27 A;  4CV7 A;  4O4X A;  4ZHC A;  1LKE A;  1OEJ A;  3ZW1 B;  1ZNH A;  4I3C A;  4O3Z A;  3V8U A;  5B29 A;  2KD2 A;  1ERX A;  1BSY A;  1SMP I;  2MM3 A;  4NNS A;  5CE4 A;  2Q2M A;  3FR5 A;  1SY3 A;  2QMI A;  4KT5 A;  4O9S A;  4DQ3 A;  4ZHF A;  3NPO A;  2RD7 C;  1XKI A;  1SY2 A;  1FE3 A;  2LFO A;  4OMX A;  1ICM A;  3D4R A;  4JGL A;  5IO6 A;  1X89 A;  4IAX A;  2A0A A;  4MIS A;  3IFB A;  2MWH A;  5EPQ A;  5IO7 A;  3ZZV A;  1ADL A;  1QFT A;  4KCA A;  5LJD A;  1ICN A;  4A1Y A;  3D95 A;  5HAE A;  1CBI A;  4ALO A;  1CBR A;  1BJ7 A;  2Q4N A;  3CWK A;  2MJI A;  5HZQ A;  1FEL A;  4FGI B;  2QO6 A;  2WSJ A;  3HTY A;  1OBQ A;  2MO5 A;  1G7N A;  4IB6 A;  1SY0 A;  3JSQ A;  3EBW A;  3WJE A;  2KTS A;  1DF3 A;  4Y0R A;  1DZM A;  3HOE A;  4IB9 A;  4ORU A;  1TOW A;  1DZJ A;  3MX7 A;  1E02 A;  5BYP A;  5LJC A;  5F6Z A;  1EAL A;  4LKT A;  1T68 X;  3Q6L A;  1YP7 A;  3O19 A;  3PH5 A;  1JV4 A;  3FR2 A;  1S44 A;  1MVG A;  5HTE A;  4ZH6 A;  3UEX A;  5AJC A;  2G79 A;  3STN A;  4O49 A;  3C78 X;  3NX2 A;  1KZW A;  3NAD A;  3RZY A;  2AKQ A;  2FRS A;  2X8S A;  1JBH A;  5IO5 A;  1CBQ A;  2X8F A;  1FEN A;  3JS1 A;  3P6D A;  4ORS A;  4KC7 A;  2K23 A;  2OFM X;  2AH7 X;  4A8Z A;  2WQ9 A;  4YFP A;  4EFG A;  3ELX A;  4MVI A;  1EPA A;  3PPT A;  1LF7 A;  4OMW A;  3EM0 A;  2W2A A;  4UU3 A;  2OFR X;  4EQA C;  1OPA A;  5BVT A;  1BSQ A;  3BX7 A;  4KII A;  3UAQ A;  4XMG A;  3ZUO A;  3NX1 A;  3O22 A;  2HMB A;  1VPR A;  3B2K A;  3EBK A;  3FA7 A;  1MX7 A;  5L8I A;  4I3B A;  4HPD A;  4HPC A;  1JZU A;  5H9N A;  4Y0S A;  3DTQ A;  3GE2 A;  4ZJ0 A;  1YP6 A;  3D97 A;  1GT1 A;  1MX8 A;  2A2G A;  4QAE A;  3VG5 A;  1B56 A;  4ALB A;  5LJB A;  3BS2 A;  2OZQ A;  3APV A;  5EDC A;  3VG2 A;  5LJG A;  1KZX A;  3P6F A;  3I17 A;  4GET A;  5BVS A;  1X8O A;  1B0O A;  3APX A;  1HQP A;  3FR4 A;  3KFG A;  4BVM A;  1JYJ A;  1SXY A;  1QY0 A;  4ORY A;  1SXW A;  4R0B A;  4I3D A;  2NP1 A;  1MUP A;  2LBA A;  1ZNL A;  4ORW A;  2WQA E;  4QGV A;  2NND A;  1OEK A;  5L8N A;  3UEV A;  1JYD A;  5H9K A;  5HCD C;  1GT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...