1BLXB

P19ink4d/cdk6 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
160
Chain Sequence
VCVGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPAVALELLKQGASPNVQDASGTSPVHDAARTGFLDTLKVLVEHGADVNALDSTGSLPIHLAIREGHSSVVSFLAPESDLHHRDASGLTPLELARQRGAQNLMDILQGHMMIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 6
publication title Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (inhibitor protein/kinase)
total genus 51
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1998-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1blxB00
1BD8A 4HRMB 5AQ7A 4DX7D 5BXUA 2JABA 4BESA 2P2CP 3TWSA 4U8YD 5JA4D 3IXEA 4U8VD 5ENTD 3SO8A 4BETA 5KBAA 5EYLA 2ETAA 1S70B 5ENRD 4O60A 4YDWA 5D66A 4J7WA 2BKGA 3C5RA 5EN5D 3W9FA 3AJIA 2RFMA 5EILA 5EYPF 3HRAA 3EU9A 1YYHA 1WG0A 4O1OA 4LNUD 5ENOD 5JMND 3TWUA 3D9HA 3J5QB 5AARA 2Y1LE 5BXOA 2F8YA 3V79K 1TR4A 1UOHA 1N0QA 1MYOA 2NYJA 5HKPA 4BSZB 2MYOA 4F6RD 4DRXE 1AWCB 4GMRA 3NBNB 2DVWA 5EIDA 4G8LA 2V4HC 5AN8A 1BU9A 1N11A 2XZTG 2BKKB 2QC9A 1AP7A 2ETBA 2ZGGA 5ENSD 3NOCD 4HB5A 2B0OE 3V2XA 3UXGA 1BI7B 3W9GA 1MX6A 4K5CA 2FO1E 2ZGDA 1A5EA 3B7BA 5FINA 4Z68A 5ENPD 2Y0BG 2XZDG 1BI8B 1K3ZD 2HE0A 1K1AA 4TUMA 4HI9A 5AQBA 5AQ9A 1YCSB 3Q9NC 1IKND 1MX2A 5KWDA 4UUCA 4CZ2D 3NOGD 2DZNA 3UTMA 4LSZE 4C48B 3UI2A 3LJNA 4B93B 2KBXA 3ZNGA 5CEDB 4DUIA 4HBDA 4HQDA 2QYJA 4OAVB 1D9SA 1YMPA 1NFIE 3AAAC 1IHBA 2XEEA 1DCQA 5ENQD 4DX1A 4BERA 2L6BA 3Q9UC 4QFVA 5ITZF 1K1BA 3TWQA 4A63B 4ATZD 2XEHA 1MJ0A 3TWWA 2DZOA 3V30A 3J5PA 4GPMA 3TWTA 4NIKA 1DC2A 3ZUVB 4YDYA 4HRLA 4OAUC 5CBOA 1MX4A 3JUEA 4J8YA 2F37A 3F6QA 2F8XK 2PNNA 4ZFHA 4DX5D 3KEAA 3T8KA 1SW6A 3ZKJA 4HNAD 4DX6D 4BEPA 4RLYA 4LG6A 4U96D 1N0RA 2RFAA 5CEAA 3EHRA 1G3NB 1SVXA 2A5EA 4N5QA 5CECB 3JXJA 5CBNA 3B95A 1QYMA 5KNHD 5AQAA 4CYMD 4K5AB 3TWRA 5KNGA 4JB8P 2KXPC 1OT8A 4HRNA 3DEOA 5CERB 5AAOA 3TWVA 3V31A 5FIOA 5HS0A 5HRYA 3TWXA 2XENA 5EIBE 4ZHBA 1BLXB 3ZU7B 4U95D 3T9KA 3HG0D 2ETCA 1OY3D 2VGEA 3V2OA 4G8KA 4F1PA 1WDYA 2AJAA 3DEPA 4HLLA 3EHQA 1IXVA 2DWZA 4DX2A 4K5BA 2J8SD 2V5QC 4HI8A 3JXIA 4O1PA 4QQIA
chains in the Genus database with same CATH superfamily
1RZ4A 4X8QA 4F7AA 5JA4D 3R9AB 3OXLA 4U8VD 2VTBA 1FPPA 3FTSA 4BTAA 4C9BB 1N4QA 1U2VG 5EILA 1MHQA 1ELKA 5B1BE 3MKQA 1VDYA 1SA5A 3MA5A 2Y4TA 4GMRA 3ZYQA 5LCWC 4L2YA 2ETBA 4CDRA 3C3OA 1EDUA 3V2XA 3UIPC 3W9GA 2FO1E 3B7BA 2PZIA 2HE0A 4ACLA 4GU5A 2RKKA 2HO1A 2M63A 4TUUA 4JC8A 3UI2A 3LJNA 2XPIA 4JZYA 4JPSA 4UQZA 4HBDA 5LX8A 4M7CA 4LCTA 1JCSA 2B6CA 5ENQD 3LY9A 2FI7A 4RVBA 5FQ8A 3ML8A 2PQNA 3UT4A 4ATZD 3L16A 4XI9A 1Z6TA 2XPYA 1TNZA 1UN8A 4ZFHA 2YHCA 1SW6A 3ZKJA 1N0RA 4FA6A 3APFA 4F1SA 5KJNA 3I3NA 4UWFA 2AWIA 5FJYA 5JHAA 4YDOA 3TGOA 3TWVA 3ZW3A 4IULA 2XENA 1UN9A 3U66A 3I4GA 2IJGX 2GRQB 2YQ8A 1TNBA 3ESLA 3E4BA 3NZSA 3JXIA 2VGXB 1BD8A 1TNYA 4HRMB 2JABA 4BWRA 2KM4A 4AVXA 3QNKA 3EU5A 3C5RA 4L1BA 5ENNA 4O1OA 1H2UA 3DPYA 3L54A 3EIJA 5BW8C 4HXIA 1U3CA 3SD5A 1OUVA 2GRLA 3CK9A 2XCCA 1BI7B 2GRPB 3SF4A 2BF0X 1JWGA 3PREA 2Y0BG 4TUMA 3DPDA 1O5MA 2J08A 4I17A 3MJWA 3QOUA 5ANLA 1BPOA 4HQDA 2VSYA 5G55A 1XGWA 3Q9UC 3HXBA 1K1BA 3QARA 4N3AA 2DZOA 4MLPA 5D2MC 1LF8A 3QC1A 5J90A 3KEAA 4BEPA 4RLYA 4GCOA 3S2AA 2A5EA 2Y3AA 3ZN3A 4CYMD 4CT0A 4APFA 5T4YA 1SZ9A 4LNBA 3FUKA 1H6KA 4U95D 3Q79A 2VTBB 1SA4A 2WXGA 1TN7A 3I5PA 5DBKA 4F1PA 2IOSA 3ZFWA 4R7LA 4QQIA 4OVUA 3FTUA 4Y6WA 3ABKE 3TWSA 1A17A 2GW1A 3IEGA 3OXGA 4YDWA 3U3WA 2X6JA 4WNDA 3ML9A 4LNUD 1HG2A 3IV0A 4TXQA 4GMJA 2MYOA 2AXUA 2AW6A 5LFAA 2P9KG 4HOSA 3RJVA 3E33A 3FUJA 1HX8A 3MX3A 2KBXA 3TXNA 1P5QA 4L2LA 1S64A 5CCLA 4GMLA 2EIME 4GAAA 1IYGA 4MS6A 3TWTA 4JEHA 3DBSA 5CBOA 3PEVB 5KJMA 4PS8A 2MOWA 4CDNA 1XNFA 4JEUA 1TN8A 2WXPA 3RK6A 2KXPC 2E0IA 3ZXPA 2J49A 2R59A 5AAOA 2ZIRA 4WNFA 4GCNA 4ZHBA 5BV0A 3DSUA 2CHZA 4I2WA 1UJKA 2KZTA 1OWNA 4JA7A 3FEYA 3D9JA 1OCRE 5BXUA 4G24A 4DPRA 3S7BA 2V5FA 3P1UA 2J4BA 5EN5D 2QFCA 3HRAA 3LXUX 1TR4A 2VGYA 1KPSB 5JJTA 3CIAA 3EHMA 4J8FA 3DSXA 3ASOE 1KT1A 3SZ7A 4OYSA 2WXNA 4GB9A 1IKND 1EF1C 2BUGA 1JPLA 4ACKA 3UT8A 3HXEA 2R5SA 3ZNGA 4I9EA 4DX1A 3QWPA 2ZISA 4BTBA 2IOLA 2WMOA 4J8YA 2LO6A 4NACA 2F37A 2UY1B 3CQCB 5CHEE 4APOA 2NXPA 3G2VA 4KVMA 3CVVA 2P9NG 2MHKA 2CFZA 5CBNA 4CGWA 1MZCA 2H6HA 2IEJA 2LNIA 4XKCA 4HRNA 4U0ZA 3UUXA 2V4LA 3JYSA 4XEIG 4AV7A 3PH0C 4U8HA 3UM3A 3K9IA 3PRZA 5EIBE 2IO3C 3FUDA 3CHPA 2Y4UA 3HG0D 2OVFA 3T8MA 2PM7A 3CKCA 1WDYA 2LAIA 5AJDA 2V5QC 4HOTA 2DIWA 2XRZA 3FH8A 2YHEA 4N2SA 5ENRD 4O60A 3B7TA 3IHYA 3LDZA 4PS3A 4EQFA 2I6HA 4K03A 4PS7A 3HXFA 2KC7A 5EX0A 3CVNA 5FWQA 5ARFA 3CVWA 4N3CA 2KCLA 1JCRA 4F6RD 4DRXE 3LYAA 4NQ0A 2FBNA 3QB2A 2XZTG 4B0ZA 3U9WA 3TG5A 4G25A 2ONDA 3GZ1A 3HXDA 1N52A 4ANWA 2NC9A 5AQ9A 1OWPA 3JCKC 4AP2A 5D0OD 3UTMA 1KLXA 2P9SG 1O1SA 5FTPA 3FU0A 2L6BA 1QZ2A 1E7UA 1TJCA 3FU5A 2AXVA 3ZUVB 4WNEA 3C3RA 4AM9A 5E75A 2CG2A 2R03A 3PZ2A 1G3NB 5CECB 2KZTB 1U3DA 3UKRG 4A3VA 4BSXA 1X5BA 4Q96A 3BG0B 3FTXA 2WXRA 3L82A 5ANRA 3DEPA 2P58C 3UM2A 3BQOA 4HI8A 4O1PA 1Y6IA 5AQ7A 4LNGA 3D9OA 3LJ3A 3CSFA 1OCZE 4GTSA 3HXCA 4EECA 2PQRA 4GTOA 5BPPA 3LKUA 2WM9A 3HDXA 4C0EA 1IQUA 1O1TA 4RG9A 5EDSA 2IY0C 1FT2A 3PS6A 2CHWA 1QNFA 1ZU2A 1HO8A 2ZGDA 2PM6A 5FINA 1H2TC 4I1MA 1YCSB 2XPZA 4EZKA 3PZ3A 3DSTA 2RD0A 3PZ4A 4FU3A 4XI0A 3L17A 3DWLG 4I1AA 2WPVA 3SFZA 3RRUA 3L13A 2F8XK 2R05A 4KYOB 4DX5D 5G05C 4N5QA 5KNHD 4JA9A 4JB8P 4CT4A 5C1DA 1FCHA 3FFLA 3LCAA 2LXLA 5FZQA 4JD2G 5J08A 3JQ1A 2V8SE 2MRIA 3FUIA 5BNWA 3BG1B 3EHNA 4LRZA 4DX7D 5KCMA 1HS6A 3WXXA 5JJ6A 3B7RL 5FZSA 5A23A 2XRYA 3TAXA 3ISMC 2WQHA 3D9HA 4A3TA 3ASHA 2WXLA 4ANXA 1Z5SC 1N0QA 2UWJG 1V55E 4UQYA 1L5JA 4MBGA 3KAEA 1OWLA 3NF1A 5AN8A 5AJLA 2I2OA 3FEXA 4CCAA 1N94A 4HS2A 5ENPD 3Q9NC 3G2WA 3QAQA 3CKBA 3L6AA 4UI9K 1WM5A 4JL0A 4G1TA 4TXPA 3TWQA 3O4ZA 1TEZA 1KT0A 2VQ2A 4GZCA 4HORA 4XIFA 3JXJA 3B95A 2XQ0A 4G2VA 3FTZA 3QWWA 4AY5A 5HRYA 3FTYA 4FP7A 2R17C 5FT9A 2IF4A 3CVUA 4GTRA 1TNOA 4N3BA 3V2OA 3JUIA 2WXOA 4U63A 2DWZA 3LVQE 3AU4A 2L9BA 3ASNE 3RKVA 2LUHA 4G26A 4LUNU 3CVLA 4BETA 4RSYA 1ELRA 3SQVA 2UY1A 5FZRA 2YINA 3OXFA 3VLFA 5EYPF 5ENOD 2E2EA 5AARA 2P9UG 2C0MA 5HKPA 1QQEA 4NURA 5G04J 4A1GA 3NBNB 5CMWA 3AG1E 3CLJA 3ESKA 5FQ4A 1ZBPA 3T5XA 3CVQA 4YVQC 3PUJA 1BI8B 2OOEA 5AQBA 4HI9A 3FUFA 5KWDA 1LTXA 2R2LA 3D9MA 3O48A 4LSZE 4DUIA 4E85A 3B7UX 4GZDA 4OAVB 2LSVA 3HHMA 2VSXE 1O1RA 2FF4A 3UPVA 4FLBA 2EIKE 4KXKB 3MCXA 4GTMA 2DYRE 1WY6A 3NZUA 1GW6A 4GPKA 3HVEA 3SBSA 4FJZA 1D8DA 2VSOE 3CHQA 3UKUG 2DYSE 5CEAA 3RAUA 3X2QE 3BUAA 3FU6A 4LERA 2IONA 3HYMB 2FO7A 4MKTA 3UIOC 3DXKG 3VTYA 3E32A 2X6HA 3FTVA 4Q94A 3CV0A 2ZXWE 3Q15A 2OVBA 4EZJA 4ILIA 2WB2A 3CEQA 5AYWD 3FUNA 3GYZA 3NB2A 4ATGA 3VLDA 4U07A 3LEWA 3DSVA 4J0UA 2XCBA 2BTDA 5JMND 3TL5A 3TWUA 5IY5E 2X6IA 2HYZA 5H7PA 3S7DA 2IQCA 5JHBA 2NYJA 1AWCB 5M72A 4HLEA 4G8LA 5A7DB 5G05J 1TNUA 3C72A 4BX9A 4HOQA 1MX6A 2ZU6B 1W3BA 4Z68A 3NAWA 4PUCA 3FH7A 1H2VC 1MX2A 4BFRA 3ABLE 2PL2A 4UUCA 4CZ2D 5CEDB 1NFIE 2XEEA 3FTWA 3E30A 3R7RA 3TJPA 1JUQA 1V54E 3S7JA 3CHSA 4FLHA 4HRLA 4FHJA 4OAUC 3D9KA 2X6FA 2OEWA 4LG6A 2EILE 3D9NA 3AG2E 3QKYA 2LAHA 1B89A 3GZSA 2NSZA 3AS5A 3EJNA 4GTQA 3PE3A 1TJFA 4KZ0A 3MGBA 3CQGB 3FH5A 3MYVA 1HZ4A 1OY3D 2VGEA 2H6FA 2XGMA 4CEMA 4GA1A 2H6GA 4G23A 1PAQA 3FHEA 3Q5MA 2H6IA 1ELWA 3KEZA 5KBAA 5EYLA 4K0RA 2VJ8A 3W9FA 3AJIA 4TV3A 4Y6CA 3V79K 2C0LA 3SBTB 3KSLA 4UWKA 2RG8A 2CFUA 1H6PA 2XHEA 1AP7A 2ZGGA 1YA0A 4WNGA 3UXGA 1KZOA 1NA0A 2EIJE 3ZYKA 1A5EA 2L0TB 5LP0A 2XS8A 1N4PA 4W9RA 1OXJA 5T3RA 2WXQA 2I1KA 3UQ3A 3ASDA 3HVEB 3FULA 1DNPA 4D10C 2DBAA 4KBQA 1Z3XA 3ZXSA 3AAAC 4UWLA 4I1OB 1MQSA 2XEHA 3MEKA 3TWWA 1IQRA 2P9LG 2P9PG 2A4ZA 4CDMA 1N4SA 5E76A 4H7XA 3PNLB 1E8YA 4B89A 5AQAA 3RRNB 4K5AB 3AS4A 2IFUA 1FVFA 3DEOA 4PDXA 4I43A 3TWXA 1H6OA 4GA2A 3PEUB 4WWOA 3UT7A 1LD8A 5G04C 2ETCA 2X3MA 4GYYA 2Y69E 4UWHA 3U64A 4RG6A 3LS8A 3FDHA 1DCEA 3DSSA 2IO2C 5D0QD 3ZHEB 1N4RA 4KVOA 4AJWA 2WQ7A 3FP3A 4NRHB 2V0PA 5BT1A 3ULEG 4L9PA 4F53A 2F8YA 3MV3B 3LPZA 1UOHA 4I6JA 3GZ2A 4U0SA 2WXHA 2WXJA 4HOUA 2BKKB 2QC9A 3BU8A 4A55A 5B1AE 3D9IA 4P29A 4TRQA 5EX3A 2QYUA 3ULYA 3ASFA 2JEKA 2YNQA 3DXMG 1Z3YA 4UI9C 3IBEA 5DIZA 3KS2A 4QFVA 3TG4A 2I1JA 4EBAA 4AOFA 3V30A 1DC2A 3APCA 3JUEA 3QJZA 2R02A 2ILRA 1E90A 4DX6D 3T8KA 4HNAD 3U4TA 1SVXA 5HQ8A 3P2BA 1UJJA 1HE8A 3V31A 1KZPA 4LEUA 3IKOB 3FU3A 3L22A 4YDEA 3T9KA 3Q7AA 4G8KA 3ABME 3R9MA 3CVPA 2KCVA 4AEZC 2P2CP 4GYOA 5ENTD 2F0YA 3NQPA 1S70B 3RO3A 3C98A 1NL4A 4WWNA 3CVYA 3VTXA 3FY4A 3FUHA 3FUMA 1OCCE 5ARGA 1YYHA 1WG0A 1TN6A 4ME2A 3D9PA 3LVRE 2JLBA 3ZPJA 5EIDA 1N11A 4H7YA 5AIJA 2XGOA 4K5CA 1EYHA 3I4RB 2OV8A 2KATA 2Q7FA 2FEZA 2P9IG 4IYPA 2LXMA 2L0IA 3CHOA 2I9CA 4C48B 3KD7A 1D9SA 1YMPA 3MZLB 3AG3E 1OCOE 4AY6A 3D9LA 5ITZF 2GRNB 1MJ0A 1N95A 3FWVA 4UWGA 2LSUA 2QZAA 5BUZA 5JJ7A 1FT1A 1QYMA 5G2NA 3SI5A 5T8IA 3TWRA 4JVSA 1E8WA 3ZGQA 4EHMA 3IHVA 1BLXB 1SQMA 4A1SA 4BX8A 2GRMA 3PE4A 4YNDA 4EBAG 4YVOA 2FULA 4HLLA 3ONLA 4GTPA 4TXRA 2WXKA 3UM0A 2J07A 4XZ4A 4JHKA 4N5CA 4EZLA 4ILGA 4U0UA 1HF8A 4IN3B 4FC8A 1PC2A 3ZYLA 3HIZA 3DRAA 3J5QB 1NI1A 2IU1A 2XS1A 4V3IA 3E37A 1MYOA 1NP7A 5KJLA 4BSZB 4GYWA 3ONKA 4FULA 5ENSD 3EUVA 4DI3A 1WAO1 4M3OA 1K3ZD 4B8AA 1JCQA 3NOGD 2DZNA 4WAFA 4JXTA 4GZ6A 3RSEG 3UM1A 1RW2A 4ABNA 4BT8A 4BERA 3Q7FA 4A63B 4G11A 3QDNA 4ANUA 3EDTB 4RQIA 4URKA 3EIQC 3UX4A 4AXHA 2PNNA 3APDA 1JWFA 2WVIA 3C3QA 2CG3A 3L9TA 3MKQB 2VYIA 3KSQA 3GW4A 5FQ6A 1X81A 4DJAA 1Q2ZA 3PZ1A 3T5VA 1OWMA 4BT9A 3ZU7B 3N71A 2L6JA 3PNTB 4CGVA 1INZA 3CGHA 1E7VA 3PZDA 2AJAA 4FADA 3EHQA 4XE0A 1IHGA 4DK5A 4J8EA 3IXEA 4UI9J 3PVLA 3S7FA 4I9CA 4PH4B 1ZB1A 4CRWA 3ASGA 3EU9A 3MV2B 1HH8A 3D3MA 2GRRB 5BXOA 2XGSA 2WXMA 4N39A 1N54A 5FQ7A 2J9QA 4U7EB 4J8DA 4OVVA 1BU9A 2C2LA 2B0OE 1SZAA 3R7QA 4HFGA 4KZCA 4DLOA 1UW4B 3BEEA 4KMOA 3Q47B 1Y8MA 4XKBA 3UMVA 3JQ0A 4WUYA 3ZHEA 3ZIMA 3SFYA 2QYJA 1DCQA 4KT6B 1K8KG 1LD7A 1FVHA 5CMYA 3F6QA 5LCWJ 3Q78A 3G2SA 3LY8A 5C2YA 5BV1A 4U96D 2RFAA 3CVXA 1S63A 4N2QA 3E34A 1UG3A 2HM8A 3UINC 2XEVA 4I2ZA 1N9AA 4GTVA 5CERB 3Q75A 4L7TA 3SHFA 1HU3A 3TXMA 1S0PA 4DI4A 2GGFA 1TYQG 1NZNA 1IXVA 4DX2A 2J09A 3ZEFA 4BESA 4U8YD 3FUEA 2ETAA 1NA3A 2WXFA 4Q69A 2BEDA 2Y1LE 3PUKA 3L08A 2WQ6A 4IRUA 1HXIA 4JHRA 3SFXA 3SY2A 1E96B 2DVWA 2V4HC 3OTNA 3CHMA 3Q4AB 2DCPA 2GROB 1K1AA 4DLQA 3ULQA 4ANVA 3RRMB 2HR2A 4B93B 4BY6A 1H0AA 3RU0A 3ZVVA 4GPMA 3CR3A 3G2TA 4YDYA 1MX4A 4UQXA 5B3SE 2OEVA 3B13A 2WXIA 3PDNA 3Q73A 5HI7A 1DVPA 3CK8A 3LY7A 5EKQD 4FJYA 5CCMA 2OCCE 1E8ZA 2AXZA 5FIOA 5HS0A 3G2UA 4XX5A 1HG5A 4J6IA 4MRUA 5A6CA 4F3VA 2CHXA 4GZ3A 4FHKA 3Q49B 2WMNA 4AIFA 4GZ5A 3QK0A 4GTTA 2J8SD 4EPZA 3CSTA 3WG7E 2J4DA 1E8XA 3SNXA 3RIBA 3SO8A 3CK7A 1PY1A 5D66A 4J7WA 4I6EA 2BKGA 2X6KA 2RFMA 2VGXA 1EPUA 3ZRHA 3MKRA 3AG4E 1HFAA 4E6HA 3NOCD 4HB5A 3URZA 3CHRA 2X38A 2XZDG 3AS8A 5CRUA 3RO2A 1IHBA 3B7SA 2VSNA 3SGHA 4JW1A 3J5PA 4B8CB 2KCKA 4WWPA 4NIKA 4JHJA 4O6FA 2A5UA 3QWVA 5CRVA 5LOZA 5KJKA 4HVBA 4U04A 3VLEA 5AENA 4J8SA 3EHRA 2EQXA 4GA0A 4L23A 4C0MA 5KNGA 1OT8A 4ILHB 2EINE 1D8EA 4I6GA 3ENEA 4B94A 1OWOA 2QY7A 3OAWA 1H19A 1QBQA 3DSWA 3ZYMA 4K5BA 3AU5A 2AVPA
chains in the Genus database with same CATH topology
1BD8A 4HRMB 5AQ7A 4DX7D 5BXUA 2JABA 4BESA 2P2CP 3TWSA 4U8YD 5JA4D 3IXEA 4U8VD 5ENTD 3SO8A 4BETA 5KBAA 5EYLA 2ETAA 1S70B 5ENRD 4O60A 4YDWA 5D66A 4J7WA 2BKGA 3C5RA 5EN5D 3W9FA 3AJIA 2RFMA 5EILA 5EYPF 3HRAA 3EU9A 1YYHA 1WG0A 4O1OA 4LNUD 5ENOD 5JMND 3TWUA 3D9HA 3J5QB 5AARA 2Y1LE 5BXOA 2F8YA 3V79K 1TR4A 1UOHA 1N0QA 1MYOA 2NYJA 5HKPA 4BSZB 2MYOA 4F6RD 4DRXE 1AWCB 4GMRA 3NBNB 2DVWA 5EIDA 4G8LA 2V4HC 5AN8A 1BU9A 1N11A 2XZTG 2BKKB 2QC9A 1AP7A 2ETBA 2ZGGA 5ENSD 3NOCD 4HB5A 2B0OE 3V2XA 3UXGA 1BI7B 3W9GA 1MX6A 4K5CA 2FO1E 2ZGDA 1A5EA 3B7BA 5FINA 4Z68A 5ENPD 2Y0BG 2XZDG 1BI8B 1K3ZD 2HE0A 1K1AA 4TUMA 4HI9A 5AQBA 5AQ9A 1YCSB 3Q9NC 1IKND 1MX2A 5KWDA 4UUCA 4CZ2D 3NOGD 2DZNA 3UTMA 4LSZE 4C48B 3UI2A 3LJNA 4B93B 2KBXA 3ZNGA 5CEDB 4DUIA 4HBDA 4HQDA 2QYJA 4OAVB 1D9SA 1YMPA 1NFIE 3AAAC 1IHBA 2XEEA 1DCQA 5ENQD 4DX1A 4BERA 2L6BA 3Q9UC 4QFVA 5ITZF 1K1BA 3TWQA 4A63B 4ATZD 2XEHA 1MJ0A 3TWWA 2DZOA 3V30A 3J5PA 4GPMA 3TWTA 4NIKA 1DC2A 3ZUVB 4YDYA 4HRLA 4OAUC 5CBOA 1MX4A 3JUEA 4J8YA 2F37A 3F6QA 2F8XK 2PNNA 4ZFHA 4DX5D 3KEAA 3T8KA 1SW6A 3ZKJA 4HNAD 4DX6D 4BEPA 4RLYA 4LG6A 4U96D 1N0RA 2RFAA 5CEAA 3EHRA 1G3NB 1SVXA 2A5EA 4N5QA 5CECB 3JXJA 5CBNA 3B95A 1QYMA 5KNHD 5AQAA 4CYMD 4K5AB 3TWRA 5KNGA 4JB8P 2KXPC 1OT8A 4HRNA 3DEOA 5CERB 5AAOA 3TWVA 3V31A 5FIOA 5HS0A 5HRYA 3TWXA 2XENA 5EIBE 4ZHBA 1BLXB 3ZU7B 4U95D 3T9KA 3HG0D 2ETCA 1OY3D 2VGEA 3V2OA 4G8KA 4F1PA 1WDYA 2AJAA 3DEPA 4HLLA 3EHQA 1IXVA 2DWZA 4DX2A 4K5BA 2J8SD 2V5QC 4HI8A 3JXIA 4O1PA 4QQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BD8 A;  4HRM B;  5AQ7 A;  4DX7 D;  5BXU A;  2JAB A;  4BES A;  2P2C P;  3TWS A;  4U8Y D;  5JA4 D;  3IXE A;  4U8V D;  5ENT D;  3SO8 A;  4BET A;  5KBA A;  5EYL A;  2ETA A;  1S70 B;  5ENR D;  4O60 A;  4YDW A;  5D66 A;  4J7W A;  2BKG A;  3C5R A;  5EN5 D;  3W9F A;  3AJI A;  2RFM A;  5EIL A;  5EYP F;  3HRA A;  3EU9 A;  1YYH A;  1WG0 A;  4O1O A;  4LNU D;  5ENO D;  5JMN D;  3TWU A;  3D9H A;  3J5Q B;  5AAR A;  2Y1L E;  5BXO A;  2F8Y A;  3V79 K;  1TR4 A;  1UOH A;  1N0Q A;  1MYO A;  2NYJ A;  5HKP A;  4BSZ B;  2MYO A;  4F6R D;  4DRX E;  1AWC B;  4GMR A;  3NBN B;  2DVW A;  5EID A;  4G8L A;  2V4H C;  5AN8 A;  1BU9 A;  1N11 A;  2XZT G;  2BKK B;  2QC9 A;  1AP7 A;  2ETB A;  2ZGG A;  5ENS D;  3NOC D;  4HB5 A;  2B0O E;  3V2X A;  3UXG A;  1BI7 B;  3W9G A;  1MX6 A;  4K5C A;  2FO1 E;  2ZGD A;  1A5E A;  3B7B A;  5FIN A;  4Z68 A;  5ENP D;  2Y0B G;  2XZD G;  1BI8 B;  1K3Z D;  2HE0 A;  1K1A A;  4TUM A;  4HI9 A;  5AQB A;  5AQ9 A;  1YCS B;  3Q9N C;  1IKN D;  1MX2 A;  5KWD A;  4UUC A;  4CZ2 D;  3NOG D;  2DZN A;  3UTM A;  4LSZ E;  4C48 B;  3UI2 A;  3LJN A;  4B93 B;  2KBX A;  3ZNG A;  5CED B;  4DUI A;  4HBD A;  4HQD A;  2QYJ A;  4OAV B;  1D9S A;  1YMP A;  1NFI E;  3AAA C;  1IHB A;  2XEE A;  1DCQ A;  5ENQ D;  4DX1 A;  4BER A;  2L6B A;  3Q9U C;  4QFV A;  5ITZ F;  1K1B A;  3TWQ A;  4A63 B;  4ATZ D;  2XEH A;  1MJ0 A;  3TWW A;  2DZO A;  3V30 A;  3J5P A;  4GPM A;  3TWT A;  4NIK A;  1DC2 A;  3ZUV B;  4YDY A;  4HRL A;  4OAU C;  5CBO A;  1MX4 A;  3JUE A;  4J8Y A;  2F37 A;  3F6Q A;  2F8X K;  2PNN A;  4ZFH A;  4DX5 D;  3KEA A;  3T8K A;  1SW6 A;  3ZKJ A;  4HNA D;  4DX6 D;  4BEP A;  4RLY A;  4LG6 A;  4U96 D;  1N0R A;  2RFA A;  5CEA A;  3EHR A;  1G3N B;  1SVX A;  2A5E A;  4N5Q A;  5CEC B;  3JXJ A;  5CBN A;  3B95 A;  1QYM A;  5KNH D;  5AQA A;  4CYM D;  4K5A B;  3TWR A;  5KNG A;  4JB8 P;  2KXP C;  1OT8 A;  4HRN A;  3DEO A;  5CER B;  5AAO A;  3TWV A;  3V31 A;  5FIO A;  5HS0 A;  5HRY A;  3TWX A;  2XEN A;  5EIB E;  4ZHB A;  1BLX B;  3ZU7 B;  4U95 D;  3T9K A;  3HG0 D;  2ETC A;  1OY3 D;  2VGE A;  3V2O A;  4G8K A;  4F1P A;  1WDY A;  2AJA A;  3DEP A;  4HLL A;  3EHQ A;  1IXV A;  2DWZ A;  4DX2 A;  4K5B A;  2J8S D;  2V5Q C;  4HI8 A;  3JXI A;  4O1P A;  4QQI A; 
#chains in the Genus database with same CATH topology
 1RZ4 A;  4X8Q A;  4F7A A;  5JA4 D;  3R9A B;  3OXL A;  4U8V D;  2VTB A;  1FPP A;  3FTS A;  4BTA A;  4C9B B;  1N4Q A;  1U2V G;  5EIL A;  1MHQ A;  1ELK A;  5B1B E;  3MKQ A;  1VDY A;  1SA5 A;  3MA5 A;  2Y4T A;  4GMR A;  3ZYQ A;  5LCW C;  4L2Y A;  2ETB A;  4CDR A;  3C3O A;  1EDU A;  3V2X A;  3UIP C;  3W9G A;  2FO1 E;  3B7B A;  2PZI A;  2HE0 A;  4ACL A;  4GU5 A;  2RKK A;  2HO1 A;  2M63 A;  4TUU A;  4JC8 A;  3UI2 A;  3LJN A;  2XPI A;  4JZY A;  4JPS A;  4UQZ A;  4HBD A;  5LX8 A;  4M7C A;  4LCT A;  1JCS A;  2B6C A;  5ENQ D;  3LY9 A;  2FI7 A;  4RVB A;  5FQ8 A;  3ML8 A;  2PQN A;  3UT4 A;  4ATZ D;  3L16 A;  4XI9 A;  1Z6T A;  2XPY A;  1TNZ A;  1UN8 A;  4ZFH A;  2YHC A;  1SW6 A;  3ZKJ A;  1N0R A;  4FA6 A;  3APF A;  4F1S A;  5KJN A;  3I3N A;  4UWF A;  2AWI A;  5FJY A;  5JHA A;  4YDO A;  3TGO A;  3TWV A;  3ZW3 A;  4IUL A;  2XEN A;  1UN9 A;  3U66 A;  3I4G A;  2IJG X;  2GRQ B;  2YQ8 A;  1TNB A;  3ESL A;  3E4B A;  3NZS A;  3JXI A;  2VGX B;  1BD8 A;  1TNY A;  4HRM B;  2JAB A;  4BWR A;  2KM4 A;  4AVX A;  3QNK A;  3EU5 A;  3C5R A;  4L1B A;  5ENN A;  4O1O A;  1H2U A;  3DPY A;  3L54 A;  3EIJ A;  5BW8 C;  4HXI A;  1U3C A;  3SD5 A;  1OUV A;  2GRL A;  3CK9 A;  2XCC A;  1BI7 B;  2GRP B;  3SF4 A;  2BF0 X;  1JWG A;  3PRE A;  2Y0B G;  4TUM A;  3DPD A;  1O5M A;  2J08 A;  4I17 A;  3MJW A;  3QOU A;  5ANL A;  1BPO A;  4HQD A;  2VSY A;  5G55 A;  1XGW A;  3Q9U C;  3HXB A;  1K1B A;  3QAR A;  4N3A A;  2DZO A;  4MLP A;  5D2M C;  1LF8 A;  3QC1 A;  5J90 A;  3KEA A;  4BEP A;  4RLY A;  4GCO A;  3S2A A;  2A5E A;  2Y3A A;  3ZN3 A;  4CYM D;  4CT0 A;  4APF A;  5T4Y A;  1SZ9 A;  4LNB A;  3FUK A;  1H6K A;  4U95 D;  3Q79 A;  2VTB B;  1SA4 A;  2WXG A;  1TN7 A;  3I5P A;  5DBK A;  4F1P A;  2IOS A;  3ZFW A;  4R7L A;  4QQI A;  4OVU A;  3FTU A;  4Y6W A;  3ABK E;  3TWS A;  1A17 A;  2GW1 A;  3IEG A;  3OXG A;  4YDW A;  3U3W A;  2X6J A;  4WND A;  3ML9 A;  4LNU D;  1HG2 A;  3IV0 A;  4TXQ A;  4GMJ A;  2MYO A;  2AXU A;  2AW6 A;  5LFA A;  2P9K G;  4HOS A;  3RJV A;  3E33 A;  3FUJ A;  1HX8 A;  3MX3 A;  2KBX A;  3TXN A;  1P5Q A;  4L2L A;  1S64 A;  5CCL A;  4GML A;  2EIM E;  4GAA A;  1IYG A;  4MS6 A;  3TWT A;  4JEH A;  3DBS A;  5CBO A;  3PEV B;  5KJM A;  4PS8 A;  2MOW A;  4CDN A;  1XNF A;  4JEU A;  1TN8 A;  2WXP A;  3RK6 A;  2KXP C;  2E0I A;  3ZXP A;  2J49 A;  2R59 A;  5AAO A;  2ZIR A;  4WNF A;  4GCN A;  4ZHB A;  5BV0 A;  3DSU A;  2CHZ A;  4I2W A;  1UJK A;  2KZT A;  1OWN A;  4JA7 A;  3FEY A;  3D9J A;  1OCR E;  5BXU A;  4G24 A;  4DPR A;  3S7B A;  2V5F A;  3P1U A;  2J4B A;  5EN5 D;  2QFC A;  3HRA A;  3LXU X;  1TR4 A;  2VGY A;  1KPS B;  5JJT A;  3CIA A;  3EHM A;  4J8F A;  3DSX A;  3ASO E;  1KT1 A;  3SZ7 A;  4OYS A;  2WXN A;  4GB9 A;  1IKN D;  1EF1 C;  2BUG A;  1JPL A;  4ACK A;  3UT8 A;  3HXE A;  2R5S A;  3ZNG A;  4I9E A;  4DX1 A;  3QWP A;  2ZIS A;  4BTB A;  2IOL A;  2WMO A;  4J8Y A;  2LO6 A;  4NAC A;  2F37 A;  2UY1 B;  3CQC B;  5CHE E;  4APO A;  2NXP A;  3G2V A;  4KVM A;  3CVV A;  2P9N G;  2MHK A;  2CFZ A;  5CBN A;  4CGW A;  1MZC A;  2H6H A;  2IEJ A;  2LNI A;  4XKC A;  4HRN A;  4U0Z A;  3UUX A;  2V4L A;  3JYS A;  4XEI G;  4AV7 A;  3PH0 C;  4U8H A;  3UM3 A;  3K9I A;  3PRZ A;  5EIB E;  2IO3 C;  3FUD A;  3CHP A;  2Y4U A;  3HG0 D;  2OVF A;  3T8M A;  2PM7 A;  3CKC A;  1WDY A;  2LAI A;  5AJD A;  2V5Q C;  4HOT A;  2DIW A;  2XRZ A;  3FH8 A;  2YHE A;  4N2S A;  5ENR D;  4O60 A;  3B7T A;  3IHY A;  3LDZ A;  4PS3 A;  4EQF A;  2I6H A;  4K03 A;  4PS7 A;  3HXF A;  2KC7 A;  5EX0 A;  3CVN A;  5FWQ A;  5ARF A;  3CVW A;  4N3C A;  2KCL A;  1JCR A;  4F6R D;  4DRX E;  3LYA A;  4NQ0 A;  2FBN A;  3QB2 A;  2XZT G;  4B0Z A;  3U9W A;  3TG5 A;  4G25 A;  2OND A;  3GZ1 A;  3HXD A;  1N52 A;  4ANW A;  2NC9 A;  5AQ9 A;  1OWP A;  3JCK C;  4AP2 A;  5D0O D;  3UTM A;  1KLX A;  2P9S G;  1O1S A;  5FTP A;  3FU0 A;  2L6B A;  1QZ2 A;  1E7U A;  1TJC A;  3FU5 A;  2AXV A;  3ZUV B;  4WNE A;  3C3R A;  4AM9 A;  5E75 A;  2CG2 A;  2R03 A;  3PZ2 A;  1G3N B;  5CEC B;  2KZT B;  1U3D A;  3UKR G;  4A3V A;  4BSX A;  1X5B A;  4Q96 A;  3BG0 B;  3FTX A;  2WXR A;  3L82 A;  5ANR A;  3DEP A;  2P58 C;  3UM2 A;  3BQO A;  4HI8 A;  4O1P A;  1Y6I A;  5AQ7 A;  4LNG A;  3D9O A;  3LJ3 A;  3CSF A;  1OCZ E;  4GTS A;  3HXC A;  4EEC A;  2PQR A;  4GTO A;  5BPP A;  3LKU A;  2WM9 A;  3HDX A;  4C0E A;  1IQU A;  1O1T A;  4RG9 A;  5EDS A;  2IY0 C;  1FT2 A;  3PS6 A;  2CHW A;  1QNF A;  1ZU2 A;  1HO8 A;  2ZGD A;  2PM6 A;  5FIN A;  1H2T C;  4I1M A;  1YCS B;  2XPZ A;  4EZK A;  3PZ3 A;  3DST A;  2RD0 A;  3PZ4 A;  4FU3 A;  4XI0 A;  3L17 A;  3DWL G;  4I1A A;  2WPV A;  3SFZ A;  3RRU A;  3L13 A;  2F8X K;  2R05 A;  4KYO B;  4DX5 D;  5G05 C;  4N5Q A;  5KNH D;  4JA9 A;  4JB8 P;  4CT4 A;  5C1D A;  1FCH A;  3FFL A;  3LCA A;  2LXL A;  5FZQ A;  4JD2 G;  5J08 A;  3JQ1 A;  2V8S E;  2MRI A;  3FUI A;  5BNW A;  3BG1 B;  3EHN A;  4LRZ A;  4DX7 D;  5KCM A;  1HS6 A;  3WXX A;  5JJ6 A;  3B7R L;  5FZS A;  5A23 A;  2XRY A;  3TAX A;  3ISM C;  2WQH A;  3D9H A;  4A3T A;  3ASH A;  2WXL A;  4ANX A;  1Z5S C;  1N0Q A;  2UWJ G;  1V55 E;  4UQY A;  1L5J A;  4MBG A;  3KAE A;  1OWL A;  3NF1 A;  5AN8 A;  5AJL A;  2I2O A;  3FEX A;  4CCA A;  1N94 A;  4HS2 A;  5ENP D;  3Q9N C;  3G2W A;  3QAQ A;  3CKB A;  3L6A A;  4UI9 K;  1WM5 A;  4JL0 A;  4G1T A;  4TXP A;  3TWQ A;  3O4Z A;  1TEZ A;  1KT0 A;  2VQ2 A;  4GZC A;  4HOR A;  4XIF A;  3JXJ A;  3B95 A;  2XQ0 A;  4G2V A;  3FTZ A;  3QWW A;  4AY5 A;  5HRY A;  3FTY A;  4FP7 A;  2R17 C;  5FT9 A;  2IF4 A;  3CVU A;  4GTR A;  1TNO A;  4N3B A;  3V2O A;  3JUI A;  2WXO A;  4U63 A;  2DWZ A;  3LVQ E;  3AU4 A;  2L9B A;  3ASN E;  3RKV A;  2LUH A;  4G26 A;  4LUN U;  3CVL A;  4BET A;  4RSY A;  1ELR A;  3SQV A;  2UY1 A;  5FZR A;  2YIN A;  3OXF A;  3VLF A;  5EYP F;  5ENO D;  2E2E A;  5AAR A;  2P9U G;  2C0M A;  5HKP A;  1QQE A;  4NUR A;  5G04 J;  4A1G A;  3NBN B;  5CMW A;  3AG1 E;  3CLJ A;  3ESK A;  5FQ4 A;  1ZBP A;  3T5X A;  3CVQ A;  4YVQ C;  3PUJ A;  1BI8 B;  2OOE A;  5AQB A;  4HI9 A;  3FUF A;  5KWD A;  1LTX A;  2R2L A;  3D9M A;  3O48 A;  4LSZ E;  4DUI A;  4E85 A;  3B7U X;  4GZD A;  4OAV B;  2LSV A;  3HHM A;  2VSX E;  1O1R A;  2FF4 A;  3UPV A;  4FLB A;  2EIK E;  4KXK B;  3MCX A;  4GTM A;  2DYR E;  1WY6 A;  3NZU A;  1GW6 A;  4GPK A;  3HVE A;  3SBS A;  4FJZ A;  1D8D A;  2VSO E;  3CHQ A;  3UKU G;  2DYS E;  5CEA A;  3RAU A;  3X2Q E;  3BUA A;  3FU6 A;  4LER A;  2ION A;  3HYM B;  2FO7 A;  4MKT A;  3UIO C;  3DXK G;  3VTY A;  3E32 A;  2X6H A;  3FTV A;  4Q94 A;  3CV0 A;  2ZXW E;  3Q15 A;  2OVB A;  4EZJ A;  4ILI A;  2WB2 A;  3CEQ A;  5AYW D;  3FUN A;  3GYZ A;  3NB2 A;  4ATG A;  3VLD A;  4U07 A;  3LEW A;  3DSV A;  4J0U A;  2XCB A;  2BTD A;  5JMN D;  3TL5 A;  3TWU A;  5IY5 E;  2X6I A;  2HYZ A;  5H7P A;  3S7D A;  2IQC A;  5JHB A;  2NYJ A;  1AWC B;  5M72 A;  4HLE A;  4G8L A;  5A7D B;  5G05 J;  1TNU A;  3C72 A;  4BX9 A;  4HOQ A;  1MX6 A;  2ZU6 B;  1W3B A;  4Z68 A;  3NAW A;  4PUC A;  3FH7 A;  1H2V C;  1MX2 A;  4BFR A;  3ABL E;  2PL2 A;  4UUC A;  4CZ2 D;  5CED B;  1NFI E;  2XEE A;  3FTW A;  3E30 A;  3R7R A;  3TJP A;  1JUQ A;  1V54 E;  3S7J A;  3CHS A;  4FLH A;  4HRL A;  4FHJ A;  4OAU C;  3D9K A;  2X6F A;  2OEW A;  4LG6 A;  2EIL E;  3D9N A;  3AG2 E;  3QKY A;  2LAH A;  1B89 A;  3GZS A;  2NSZ A;  3AS5 A;  3EJN A;  4GTQ A;  3PE3 A;  1TJF A;  4KZ0 A;  3MGB A;  3CQG B;  3FH5 A;  3MYV A;  1HZ4 A;  1OY3 D;  2VGE A;  2H6F A;  2XGM A;  4CEM A;  4GA1 A;  2H6G A;  4G23 A;  1PAQ A;  3FHE A;  3Q5M A;  2H6I A;  1ELW A;  3KEZ A;  5KBA A;  5EYL A;  4K0R A;  2VJ8 A;  3W9F A;  3AJI A;  4TV3 A;  4Y6C A;  3V79 K;  2C0L A;  3SBT B;  3KSL A;  4UWK A;  2RG8 A;  2CFU A;  1H6P A;  2XHE A;  1AP7 A;  2ZGG A;  1YA0 A;  4WNG A;  3UXG A;  1KZO A;  1NA0 A;  2EIJ E;  3ZYK A;  1A5E A;  2L0T B;  5LP0 A;  2XS8 A;  1N4P A;  4W9R A;  1OXJ A;  5T3R A;  2WXQ A;  2I1K A;  3UQ3 A;  3ASD A;  3HVE B;  3FUL A;  1DNP A;  4D10 C;  2DBA A;  4KBQ A;  1Z3X A;  3ZXS A;  3AAA C;  4UWL A;  4I1O B;  1MQS A;  2XEH A;  3MEK A;  3TWW A;  1IQR A;  2P9L G;  2P9P G;  2A4Z A;  4CDM A;  1N4S A;  5E76 A;  4H7X A;  3PNL B;  1E8Y A;  4B89 A;  5AQA A;  3RRN B;  4K5A B;  3AS4 A;  2IFU A;  1FVF A;  3DEO A;  4PDX A;  4I43 A;  3TWX A;  1H6O A;  4GA2 A;  3PEU B;  4WWO A;  3UT7 A;  1LD8 A;  5G04 C;  2ETC A;  2X3M A;  4GYY A;  2Y69 E;  4UWH A;  3U64 A;  4RG6 A;  3LS8 A;  3FDH A;  1DCE A;  3DSS A;  2IO2 C;  5D0Q D;  3ZHE B;  1N4R A;  4KVO A;  4AJW A;  2WQ7 A;  3FP3 A;  4NRH B;  2V0P A;  5BT1 A;  3ULE G;  4L9P A;  4F53 A;  2F8Y A;  3MV3 B;  3LPZ A;  1UOH A;  4I6J A;  3GZ2 A;  4U0S A;  2WXH A;  2WXJ A;  4HOU A;  2BKK B;  2QC9 A;  3BU8 A;  4A55 A;  5B1A E;  3D9I A;  4P29 A;  4TRQ A;  5EX3 A;  2QYU A;  3ULY A;  3ASF A;  2JEK A;  2YNQ A;  3DXM G;  1Z3Y A;  4UI9 C;  3IBE A;  5DIZ A;  3KS2 A;  4QFV A;  3TG4 A;  2I1J A;  4EBA A;  4AOF A;  3V30 A;  1DC2 A;  3APC A;  3JUE A;  3QJZ A;  2R02 A;  2ILR A;  1E90 A;  4DX6 D;  3T8K A;  4HNA D;  3U4T A;  1SVX A;  5HQ8 A;  3P2B A;  1UJJ A;  1HE8 A;  3V31 A;  1KZP A;  4LEU A;  3IKO B;  3FU3 A;  3L22 A;  4YDE A;  3T9K A;  3Q7A A;  4G8K A;  3ABM E;  3R9M A;  3CVP A;  2KCV A;  4AEZ C;  2P2C P;  4GYO A;  5ENT D;  2F0Y A;  3NQP A;  1S70 B;  3RO3 A;  3C98 A;  1NL4 A;  4WWN A;  3CVY A;  3VTX A;  3FY4 A;  3FUH A;  3FUM A;  1OCC E;  5ARG A;  1YYH A;  1WG0 A;  1TN6 A;  4ME2 A;  3D9P A;  3LVR E;  2JLB A;  3ZPJ A;  5EID A;  1N11 A;  4H7Y A;  5AIJ A;  2XGO A;  4K5C A;  1EYH A;  3I4R B;  2OV8 A;  2KAT A;  2Q7F A;  2FEZ A;  2P9I G;  4IYP A;  2LXM A;  2L0I A;  3CHO A;  2I9C A;  4C48 B;  3KD7 A;  1D9S A;  1YMP A;  3MZL B;  3AG3 E;  1OCO E;  4AY6 A;  3D9L A;  5ITZ F;  2GRN B;  1MJ0 A;  1N95 A;  3FWV A;  4UWG A;  2LSU A;  2QZA A;  5BUZ A;  5JJ7 A;  1FT1 A;  1QYM A;  5G2N A;  3SI5 A;  5T8I A;  3TWR A;  4JVS A;  1E8W A;  3ZGQ A;  4EHM A;  3IHV A;  1BLX B;  1SQM A;  4A1S A;  4BX8 A;  2GRM A;  3PE4 A;  4YND A;  4EBA G;  4YVO A;  2FUL A;  4HLL A;  3ONL A;  4GTP A;  4TXR A;  2WXK A;  3UM0 A;  2J07 A;  4XZ4 A;  4JHK A;  4N5C A;  4EZL A;  4ILG A;  4U0U A;  1HF8 A;  4IN3 B;  4FC8 A;  1PC2 A;  3ZYL A;  3HIZ A;  3DRA A;  3J5Q B;  1NI1 A;  2IU1 A;  2XS1 A;  4V3I A;  3E37 A;  1MYO A;  1NP7 A;  5KJL A;  4BSZ B;  4GYW A;  3ONK A;  4FUL A;  5ENS D;  3EUV A;  4DI3 A;  1WAO 1;  4M3O A;  1K3Z D;  4B8A A;  1JCQ A;  3NOG D;  2DZN A;  4WAF A;  4JXT A;  4GZ6 A;  3RSE G;  3UM1 A;  1RW2 A;  4ABN A;  4BT8 A;  4BER A;  3Q7F A;  4A63 B;  4G11 A;  3QDN A;  4ANU A;  3EDT B;  4RQI A;  4URK A;  3EIQ C;  3UX4 A;  4AXH A;  2PNN A;  3APD A;  1JWF A;  2WVI A;  3C3Q A;  2CG3 A;  3L9T A;  3MKQ B;  2VYI A;  3KSQ A;  3GW4 A;  5FQ6 A;  1X81 A;  4DJA A;  1Q2Z A;  3PZ1 A;  3T5V A;  1OWM A;  4BT9 A;  3ZU7 B;  3N71 A;  2L6J A;  3PNT B;  4CGV A;  1INZ A;  3CGH A;  1E7V A;  3PZD A;  2AJA A;  4FAD A;  3EHQ A;  4XE0 A;  1IHG A;  4DK5 A;  4J8E A;  3IXE A;  4UI9 J;  3PVL A;  3S7F A;  4I9C A;  4PH4 B;  1ZB1 A;  4CRW A;  3ASG A;  3EU9 A;  3MV2 B;  1HH8 A;  3D3M A;  2GRR B;  5BXO A;  2XGS A;  2WXM A;  4N39 A;  1N54 A;  5FQ7 A;  2J9Q A;  4U7E B;  4J8D A;  4OVV A;  1BU9 A;  2C2L A;  2B0O E;  1SZA A;  3R7Q A;  4HFG A;  4KZC A;  4DLO A;  1UW4 B;  3BEE A;  4KMO A;  3Q47 B;  1Y8M A;  4XKB A;  3UMV A;  3JQ0 A;  4WUY A;  3ZHE A;  3ZIM A;  3SFY A;  2QYJ A;  1DCQ A;  4KT6 B;  1K8K G;  1LD7 A;  1FVH A;  5CMY A;  3F6Q A;  5LCW J;  3Q78 A;  3G2S A;  3LY8 A;  5C2Y A;  5BV1 A;  4U96 D;  2RFA A;  3CVX A;  1S63 A;  4N2Q A;  3E34 A;  1UG3 A;  2HM8 A;  3UIN C;  2XEV A;  4I2Z A;  1N9A A;  4GTV A;  5CER B;  3Q75 A;  4L7T A;  3SHF A;  1HU3 A;  3TXM A;  1S0P A;  4DI4 A;  2GGF A;  1TYQ G;  1NZN A;  1IXV A;  4DX2 A;  2J09 A;  3ZEF A;  4BES A;  4U8Y D;  3FUE A;  2ETA A;  1NA3 A;  2WXF A;  4Q69 A;  2BED A;  2Y1L E;  3PUK A;  3L08 A;  2WQ6 A;  4IRU A;  1HXI A;  4JHR A;  3SFX A;  3SY2 A;  1E96 B;  2DVW A;  2V4H C;  3OTN A;  3CHM A;  3Q4A B;  2DCP A;  2GRO B;  1K1A A;  4DLQ A;  3ULQ A;  4ANV A;  3RRM B;  2HR2 A;  4B93 B;  4BY6 A;  1H0A A;  3RU0 A;  3ZVV A;  4GPM A;  3CR3 A;  3G2T A;  4YDY A;  1MX4 A;  4UQX A;  5B3S E;  2OEV A;  3B13 A;  2WXI A;  3PDN A;  3Q73 A;  5HI7 A;  1DVP A;  3CK8 A;  3LY7 A;  5EKQ D;  4FJY A;  5CCM A;  2OCC E;  1E8Z A;  2AXZ A;  5FIO A;  5HS0 A;  3G2U A;  4XX5 A;  1HG5 A;  4J6I A;  4MRU A;  5A6C A;  4F3V A;  2CHX A;  4GZ3 A;  4FHK A;  3Q49 B;  2WMN A;  4AIF A;  4GZ5 A;  3QK0 A;  4GTT A;  2J8S D;  4EPZ A;  3CST A;  3WG7 E;  2J4D A;  1E8X A;  3SNX A;  3RIB A;  3SO8 A;  3CK7 A;  1PY1 A;  5D66 A;  4J7W A;  4I6E A;  2BKG A;  2X6K A;  2RFM A;  2VGX A;  1EPU A;  3ZRH A;  3MKR A;  3AG4 E;  1HFA A;  4E6H A;  3NOC D;  4HB5 A;  3URZ A;  3CHR A;  2X38 A;  2XZD G;  3AS8 A;  5CRU A;  3RO2 A;  1IHB A;  3B7S A;  2VSN A;  3SGH A;  4JW1 A;  3J5P A;  4B8C B;  2KCK A;  4WWP A;  4NIK A;  4JHJ A;  4O6F A;  2A5U A;  3QWV A;  5CRV A;  5LOZ A;  5KJK A;  4HVB A;  4U04 A;  3VLE A;  5AEN A;  4J8S A;  3EHR A;  2EQX A;  4GA0 A;  4L23 A;  4C0M A;  5KNG A;  1OT8 A;  4ILH B;  2EIN E;  1D8E A;  4I6G A;  3ENE A;  4B94 A;  1OWO A;  2QY7 A;  3OAW A;  1H19 A;  1QBQ A;  3DSW A;  3ZYM A;  4K5B A;  3AU5 A;  2AVP A; 
#chains in the Genus database with same CATH homology
 1BD8 A;  4HRM B;  5AQ7 A;  4DX7 D;  5BXU A;  2JAB A;  4BES A;  2P2C P;  3TWS A;  4U8Y D;  5JA4 D;  3IXE A;  4U8V D;  5ENT D;  3SO8 A;  4BET A;  5KBA A;  5EYL A;  2ETA A;  1S70 B;  5ENR D;  4O60 A;  4YDW A;  5D66 A;  4J7W A;  2BKG A;  3C5R A;  5EN5 D;  3W9F A;  3AJI A;  2RFM A;  5EIL A;  5EYP F;  3HRA A;  3EU9 A;  1YYH A;  1WG0 A;  4O1O A;  4LNU D;  5ENO D;  5JMN D;  3TWU A;  3D9H A;  3J5Q B;  5AAR A;  2Y1L E;  5BXO A;  2F8Y A;  3V79 K;  1TR4 A;  1UOH A;  1N0Q A;  1MYO A;  2NYJ A;  5HKP A;  4BSZ B;  2MYO A;  4F6R D;  4DRX E;  1AWC B;  4GMR A;  3NBN B;  2DVW A;  5EID A;  4G8L A;  2V4H C;  5AN8 A;  1BU9 A;  1N11 A;  2XZT G;  2BKK B;  2QC9 A;  1AP7 A;  2ETB A;  2ZGG A;  5ENS D;  3NOC D;  4HB5 A;  2B0O E;  3V2X A;  3UXG A;  1BI7 B;  3W9G A;  1MX6 A;  4K5C A;  2FO1 E;  2ZGD A;  1A5E A;  3B7B A;  5FIN A;  4Z68 A;  5ENP D;  2Y0B G;  2XZD G;  1BI8 B;  1K3Z D;  2HE0 A;  1K1A A;  4TUM A;  4HI9 A;  5AQB A;  5AQ9 A;  1YCS B;  3Q9N C;  1IKN D;  1MX2 A;  5KWD A;  4UUC A;  4CZ2 D;  3NOG D;  2DZN A;  3UTM A;  4LSZ E;  4C48 B;  3UI2 A;  3LJN A;  4B93 B;  2KBX A;  3ZNG A;  5CED B;  4DUI A;  4HBD A;  4HQD A;  2QYJ A;  4OAV B;  1D9S A;  1YMP A;  1NFI E;  3AAA C;  1IHB A;  2XEE A;  1DCQ A;  5ENQ D;  4DX1 A;  4BER A;  2L6B A;  3Q9U C;  4QFV A;  5ITZ F;  1K1B A;  3TWQ A;  4A63 B;  4ATZ D;  2XEH A;  1MJ0 A;  3TWW A;  2DZO A;  3V30 A;  3J5P A;  4GPM A;  3TWT A;  4NIK A;  1DC2 A;  3ZUV B;  4YDY A;  4HRL A;  4OAU C;  5CBO A;  1MX4 A;  3JUE A;  4J8Y A;  2F37 A;  3F6Q A;  2F8X K;  2PNN A;  4ZFH A;  4DX5 D;  3KEA A;  3T8K A;  1SW6 A;  3ZKJ A;  4HNA D;  4DX6 D;  4BEP A;  4RLY A;  4LG6 A;  4U96 D;  1N0R A;  2RFA A;  5CEA A;  3EHR A;  1G3N B;  1SVX A;  2A5E A;  4N5Q A;  5CEC B;  3JXJ A;  5CBN A;  3B95 A;  1QYM A;  5KNH D;  5AQA A;  4CYM D;  4K5A B;  3TWR A;  5KNG A;  4JB8 P;  2KXP C;  1OT8 A;  4HRN A;  3DEO A;  5CER B;  5AAO A;  3TWV A;  3V31 A;  5FIO A;  5HS0 A;  5HRY A;  3TWX A;  2XEN A;  5EIB E;  4ZHB A;  1BLX B;  3ZU7 B;  4U95 D;  3T9K A;  3HG0 D;  2ETC A;  1OY3 D;  2VGE A;  3V2O A;  4G8K A;  4F1P A;  1WDY A;  2AJA A;  3DEP A;  4HLL A;  3EHQ A;  1IXV A;  2DWZ A;  4DX2 A;  4K5B A;  2J8S D;  2V5Q C;  4HI8 A;  3JXI A;  4O1P A;  4QQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...