1BM3H

Immunoglobulin opg2 fab-peptide complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
227
structure length
216
Chain Sequence
EVQLVQSGGGLVNPGRSLKLSCAASGFTFSSYGMSWVRQTPEKRLEWVAAISGGGTYIHYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYYCTRHAMDHWGQGTSVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN OPG2 FAB, CONSTANT DOMAIN
publication title Conformational change in an anti-integrin antibody: structure of OPG2 Fab bound to a beta 3 peptide.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 216
sequence length 227
ec nomenclature
pdb deposition date 1999-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bm3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bm3H01
2VXSH 3QNZB 1H0DA 2VAAA 2VR4A 3R8QA 4DGVL 5LQBL 2A77L 1X5LA 4WV1B 1ZSDB 5CHNA 1PDKA 1CXIA 4LFHG 1MIEH 3K80A 5AAWA 1FC1A 4FQXB 4HCRH 4X8JA 2VLJE 5DVNA 4QRRA 1H5BB 1OP9A 1AI1H 5D2LB 2XWBA 5DZLA 1ERNA 4KHXL 3M17B 1HCFX 5FYLL 4JM2A 1IFHH 4NJ9L 5D6CA 3QNYB 4UU9B 5T1KA 3RX7A 2R29H 4YNYB 4PB0H 1Y18A 2C9AA 2EDRA 4HULB 5J57B 5FO7B 5F7NC 4XAKD 3PQYE 5CJ5A 2B8OT 2E9BA 2UY7A 4ZAKD 5CSGA 2I07A 1U8KB 3OF6D 5F7EH 2VH5L 3PWNB 1TVDA 4PJBB 3WXWH 3DETD 4S1DD 5ERWB 3HN3A 4HX1B 3K46A 4R9HA 3WHE0 1XF1A 3HE6B 1RIUL 5GRJL 1FL3B 4LARL 2VWEE 3RUGF 1T7YA 5FXCH 4X5XA 4QEGA 2ORBL 1MWAA 1FORH 3LY6A 4GS7B 5DT1H 3X13A 2CJUL 1P4LB 4OD2B 3C2AL 2CQVA 5E4EB 4U6VL 3ZDZF 2ZUYA 3UDWA 4JDZA 4XXCC 1T04A 1FO0A 1CZ8L 1JNHB 3RHWF 5DEGB 1CFSA 1MFEH 3IRZA 1IMHC 2XIDA 4X6FB 4W68A 4DQOH 5KS9A 1I3RA 4LLDA 5F88B 5LAXB 1AQKH 3SKMB 1UADC 2CO6B 4RZCB 4KK9C 1RU9H 4W81A 5GHWL 5FHAL 2Q8AL 5C0DA 4OLUL 3VFUB 4Q6YA 4OGXH 4OGAD 5LBSH 3WD5L 1T0MA 1NJ9A 2ADJB 1X5IA 4J3SA 2YD6A 3EDJA 4LPYA 4Z78A 3DUSA 4NKMB 3CMOH 4Z7QE 1XF5A 4H88L 4MMZC 2ICWB 5D1XA 5E8DH 5EC2A 5FUCE 3ZYOA 1WJ3A 3NCEB 1FL6B 4TVSa 2EIZB 2VKWA 3IKCA 2OR9H 1OAUL 4ZAKB 3EYUH 3DURB 2IH1B 4I2XB 1HEZB 4XPGL 1ZK9A 1PVHA 2R56L 4LCUB 5E2TH 1E27A 3GSQB 25C8H 4QOKB 1QNZL 4JZOA 3P3YA 5HHPB 4YPGA 3BH9A 4ODHH 3S5LG 4P5MB 3G6JE 5T5FH 1H8NA 2AXFB 5GGVY 2DLEA 4P3DA 4XNUH 2D7PA 3QO1B 4LLMB 3W82A 1IGYA 4Z7VF 5IQ9B 4MDJA 2AJXH 2DM4A 4HGKC 5DRXA 4M61B 4EKXA 5JIKA 4A2LA 1FRGL 2VXVH 3SHSA 3C5ZB 4HSQA 4YHNA 4G5ZL 4Y2OA 1ONQB 1UZ6E 1AGEA 4KKCD 4AMKH 4FQ1H 2IFFH 4XNYH 1RZIA 4DW2L 4FFYL 1JGEB 3VXUB 1KNOB 1MRFH 3MNZB 2P42B 4EVNA 3K4AA 3G08B 3QG6B 4GG6B 4U49A 5DQDL 3AMKA 1N5YL 3NA4A 1MFBL 3BX7C 2P5WA 5F7DA 2QHLA 2XN9D 3QEHA 1I3GH 4C83A 4NZJA 3TCXA 5BMFL 4QRRE 4U0RB 3VWJB 3RWCB 3IDNB 4HDIB 1I1CA 3IFPA 5ACLA 4I4WA 1ZT7B 1K85A 4JRYA 4MS8C 4P5KB 2P5EA 4AIXA 3FQWB 1YMHA 3WNMA 1DDHB 3BEVA 4JRXA 3C60B 4NSKA 4XNQA 4RMRA 3CC5A 2A83B 2H6PA 2VSDA 4BQ6A 3D69B 4MZ3A 2CKBA 3S6CA 4N8CL 2X40A 2HTKD 4LSTL 4R7DA 4FFZH 4FQIL 1QBLL 2YA2A 1V7ML 3CFKA 3FO9B 2GFBB 1F58L 2AJSH 3ZHLA 5IR1B 5HVHC 1DSFH 1FZJA 2J3SA 4TRPH 2CMRH 5IBLD 3VW3L 3BJ91 3BHBB 2R2HB 3QJFA 4O9HH 3ZDXF 3O3AB 4ZXBC 2UUDH 3OKNA 4B0MM 1NGXB 1YPZB 4YDKH 5ESVB 3MRJA 4RFOL 5ALBL 3Q2CA 3GJEB 4MCZA 1G7PB 1MWAH 4G6AD 1J1PH 4G42A 5K9JL 3WUWG 2A38A 4I0KA 1KEML 2WUCL 1S7TA 5KS9E 1FO0H 1WZLA 5C2BL 3B9DA 3U9PL 4X83A 4XP9L 5AYUL 5DUBB 3BP5B 3PDDA 3SDYH 3NIDE 3C5JB 4OLVH 4PLOB 2E7MA 2Y9RT 5K9KA 3WNKA 3GJFA 5DQ9A 5BOZG 2P49B 4GAJL 5JXEC 4XCYB 3FQNB 3FOMB 1JGDB 1NMAL 2GJJA 3VFMB 4LSQL 3ZKMD 1D9KB 2XI9A 4HUUB 5I1LA 1IQWL 4GXUM 5I0ZA 1BGXH 5ANMA 2ITCA 1ZLVK 2HVKA 4M93C 5IFJB 3OKLA 1WGOA 4WUKL 5JPNB 1QQDA 4OF5A 5D96B 4PJFA 4TSAL 5HHXH 4M7JH 5I0DA 2MKLC 5GGSB 1FZOA 2ED9A 2X4QA 1HQRB 4NNXA 4OLWL 2ZSVA 3U1SL 3MQIA 3L5XL 1CGSH 1NH6A 2EE3A 4LSDA 4PJCF 5HPMA 3D0LB 3MRKB 1IRAY 4F15B 3MCLH 1MOEA 2OJZL 2EDQA 1OP3K 3I6KB 2BHUA 3U7WL 4EQ2A 4BSWA 2OXGA 3QIWD 3BRGC 1EK3A 2X89A 3QRGL 1SJVA 4LF3A 5C0ND 2V5YA 3IF1B 4N9GA 3L3KB 3F12A 4P3CL 4AQ1B 5T33H 1SYVA 5IW6B 5EUOA 5DHYB 1FVDB 1NBZA 5IUSA 1DBBH 1BECA 2P5WE 3SKJH 1FH5L 2WNGA 3L3IA 5DMKA 1Z3GL 4YDIL 1WT5A 2L4OA 3QDHA 4QHKI 2HFEA 1FFQA 1GIGH 2BNRD 4KGLA 2JF1A 3P4NB 4KHTL 4JRYE 4PRPD 2P5EE 5FUZL 1YY8A 3OKDB 5DHVB 3TH3T 1X4XA 4KDTA 1GRWA 1PGRB 5IFHH 4JRXE 5AZ2L 2I9TB 3MUJA 1U8HA 3KJ4C 5EOCL 3WXVH 5GIRA 1YMMD 4KZDL 1RUPL 1BBJA 1CK0L 2BCKB 4LBEB 3TPUA 3UJJL 2DYPD 1T89A 32C2B 3ROLB 2XZQH 1OM3L 2G5BB 3GMPB 4MX7B 2CKBH 2Q76B 4Y19D 3LDBC 5F71A 2J8UF 3ARDC 1Y0LA 5MP6L 1F11B 5T3ZE 1HXYA 1IGIH 43CAA 1BFVL 4M5YH 3M07A 2BSRA 2VXSL 2V9TA 2QTEA 5T3ZH 3ZKNC 3SDDC 2ZCHH 4O02L 4FXKA 4JFFB 3PXHA 4H8WC 1BZ9B 4YBQD 4CBPA 1MIEL 1R0AH 4V2CB 2FL5B 3BPNB 5BO1H 5FECA 5DTFA 5GGRA 2FSEB 1I1AB 4HW6A 4I1NB 1AI1L 3T3MF 3ULVD 2H1PL 3WHXB 1U0QA 3DXAD 1JZ5A 1TVBA 1IFHL 5DVOA 2EDDA 4ODTH 2PYFB 5C0EB 3ZO0A 5IK3A 5L9DL 2R29L 3P0VL 2X70A 4L4TA 1W0YT 3HCVB 5IIEA 3GJFH 2HTLD 2BNRB 2CLZB 1LK3H 5I8OH 1ZGLA 4P46D 1G9NH 4HGWB 5F7EL 3DUUA 3QQNA 4PRPB 4U05A 4OGYH 5F6HJ 3WXWL 3MBXH 3QXAB 5ANME 1OAYH 1C12A 2DLIA 3BVNB 2VDLL 4WI5A 3MBED 3B4NA 4HIHB 1D5ZB 4PJAF 3WL9B 1Q9KA 4PJFE 1C16B 2FATL 4LPUA 5DJ0B 3EDEA 4WW2C 5C6PB 3VMOA 1FORL 5DT1L 2DYPB 1RQ5A 4JY6B 4U2ZA 4GRWE 1AR1C 3R1GL 2B4CC 1E4XH 1MAKA 4HC1A 3DWTA 1EEYA 4GRWH 3QIBC 4R4FH 1MFEL 3VJ6B 1IAOA 2XT1B 1BJ8A 4JEGB 5GSRA 3T09A 1K8DA 3P9LA 4J3XA 5B38A 4JANB 3U82B 3BDYH 3TBTB 3LN9A 1RU9L 4F9LA 1A4JB 5GSVA 4HZLB 1EFXB 4OGXL 4TNVF 3D2UA 5ETUB 1JUFA 3LIZL 1X4YA 5SWQA 1I85A 2DQFA 2JCCA 5KSVB 3M1BA 2AABL 2DKMA 4Y16D 2GCYA 5CGYD 4M9PA 1KJVA 3CMOL 4XPHH 1OSZB 3LKSB 1KPRA 5I1EH 3QEGL 5EUOE 1NC2B 4PG2A 4NM8H 3EGSA 5HYQB 4F7MB 1C08A 5FO9A 1WCQA 1UXSA 3KAAA 4P46B 4PIRF 5DMJB 4YE4L 1V3JA 1G7HB 1IAMA 4NQTA 5F1KC 3ARTA 1VDGA 3HLAB 5E2TL 3MRCB 2FBOJ 3MBEB 4GLRI 2OZ4L 1ZT4A 25C8L 3TNNB 4UTAH 5CLWA 1X5FA 3DVGB 5H8DA 4U6XA 4AM0A 5CD3A 4MNGA 5GJTL 1HKFA 1PG7X 4GW5B 4B7IA 3OKMA 2G75B 3QWRA 4WENB 2WV3A 1AGCA 4M62H 1OTSC 3AU1B 3GMNB 1LO4H 2VXVL 2XXCB 2BERA 4XVJL 3STLB 4AMKL 5IJVB 4FQ1L 2EDWA 4I48A 1WWCA 1XCTB 4XNYL 5I2IA 4OB5H 4TN9A 3BZ4B 4YHKL 3HR5B 1T1XA 1DQML 4ISVA 2D7TH 2F5AH 1NFDF 4PJ9A 3MLYH 4YXLL 3MYJB 2ERJC 1BBDH 5C0AD 4HUVB 3GKWH 3CDFA 1P53A 3V4UL 5JW4R 2Y5TA 4R6UA 1KCRH 4DCQA 2XWTA 4D9QD 3HRZB 3MRIA 5E5MA 1TETL 4GAGL 1XGTB 4XCNA 4CMHC 4M03A 4NN6B 3W39B 3WFBH 5D7IB 1DVFC 3D6GA 3FL7A 3JTSB 4L4TE 1M7DA 3D87B 3OB8A 4OFKA 1HINH 3SDAB 4XNMA 3KYOA 4ALAH 4BQBA 2NX5D 5ICZA 3ARVA 1HHJB 4LLUA 4MGXA 2DQGL 4NQCA 4OF3A 2F74A 4YQXH 4FFZL 4DN3H 5DJ2B 4Z7WF 5GS1B 5GGQL 2AJSL 4ZUTA 3DV4A 4G3YH 3DROB 4Q9QH 3SY0A 2CMRL 3QUKB 1I9EA 1JPST 2AV7A 4QF1B 3PWJB 4YDKL 1MUJA 3VCLA 5TQ2H 5LWYH 1J1PL 4ONOA 2XG4A 5FA3B 3B6SA 1Z6JT 4XCCL 4JN2A 4P99A 4P9MH 4CADA 4HC1H 4WHTA 1VA9A 3LEXB 4RCAA 4BFGA 4JFOB 5JIPA 5KSAB 3MUGB 4G8EB 3OKOA 4KPHL 3DGCR 5F7MC 4MDIB 1FO0L 4Z7UA 3O6FD 2CIKB 4LCWE 5INDA 1Q8MA 5KJRH 2CRZA 1A6UL 2OTUB 4IRJD 3GMRB 4XZUB 1RUAL 2P8PA 3O0RH 3V6FA 3S37H 4L3EA 5DDHB 1X9QA 1BOGB 4K7FA 5LGJB 4YBHA 1J0HA 3QFJA 5C71A 4KJYB 2JCCE 3MRMA 3SE3C 4OLXL 4G9DB 1N3NA 4B7LA 3QA3B 5I1KH 1XGYH 5DD0H 1C7SA 3MRQA 5LXGH 2WWKT 3SO5A 3CFBA 4K94L 2EDOA 1X5XA 3EJJX 5J12B 1H0DB 4M1GH 4I5BA 2VAAB 5DLML 3WE6A 1AJ7H 5HHXL 2Q3AA 4GRLA 1Q9WA 4JQVA 4X9IA 5C0CA 3BESR 4FXLA 5DHXB 5CHNB 4J8RA 3B9VA 4NWTH 4O2CA 4X8JB 4QRRB 4MNGE 3QHTC 4BH8A 4XNZB 1G6RH 2XWBB 3MCLL 5EH1A 2ARJA 4M8QA 5DRNA 3DO3A 2AJYH 3OR7A 4JM2B 2ADFH 5D6CB 5T1KB 4O51A 4UT6H 4Y8DC 1WBXA 1YEFH 5EC1A 3SE8H 1J8HA 1Y18B 3NA9H 4PB9H 1JNLH 4K7PX 1DQQA 1JGVH 5KVGH 4LDEB 5IMOA 5C2UB 2I07B 1IE5A 4L3AA 4K2UH 3LRSA 3GM0A 1M71B 4FXGA 4WY7H 3JV6A 3MLUH 4YXKH 1N6UA 4PJXB 1WZMA 4Q9CA 1FHGA 1DBBL 4X5XB 3WDHA 3SKJL 1GJIA 2A1WH 5GGSY 1D5XA 4IRSD 3AVEA 4TTDD 4D9RD 1GIGL 2XKUA 4BUGA 3QDGA 3O9WC 4ENED 3FT3A 1FO0B 5ISZA 3EKCA 1CFSB 3MJGX 2O5ZH 5K9QI 4GKZA 1JHLL 5KS9B 5IFHL 1I3RB 4L8BA 4LLDB 1OD9A 4W4OC 1CGUA 1S7UA 4PS4H 5ICYA 5JOPE 4RBPH 4XWOC 5C0DB 4J3VA 4NQCE 1XF4B 1T0MB 2ZSWB 1JFQH 4OSUH 2XZQL 3V52H 3SKOA 1S7WA 2CKBL 1AIFA 1NJ9B 2AGJH 5FGBC 1TLKA 2FJHA 4PJ5D 2MQCA 3WFCH 4JFPA 4Z78B 3ABZA 4OCLC 3DUSB 1IGIL 4M5YL 4CGTA 3OKYA 5D1XB 5EC2B 1T1ZA 4GG8A 4M6OH 4YLQT 5T3ZL 3CZJA 2UUDK 4FQLH 3H3KA 1IC4H 2ZCHL 3CMGA 2P5ED 1S8DA 3IKCB 1MY7A 2H3NA 4UQ2A 4N1HB 1R0AL 3H7BA 5B3JF 4Z7UE 1E27B 4QRTA 3VXOA 3BE1L 3I3BA 4JZOB 4IEFB 3FKUS 4G7YH 5HHOD 4JVWA 2I26N 2D31A 2FYYA 4ODTL 3D18A 4P3DB 2AQ1A 1S7VA 4L3EE 2CR6A 4NNYA 3SCMC 1IGYB 3UAJC 4O2FA 3QFJE 4MDJB 1NPUA 5I8OL 1LK3L 5DRXB 3H3PH 4GXVH 4YGAB 2G60L 4HS8H 4ODBD 5GGUB 1PAMA 3ZL4H 4YHNB 4OGYL 1GL4B 3MBXL 1IAIH 1OAYL 1AGEB 1II4E 3S36L 1MVUA 4HAGA 1F4XH 1RZIB 2A73B 3AY4C 3WNNA 3BOVA 2BDNH 3EHBD 5DK0B 4EVNB 3FN0H 1OGAD 1O7SA 5FKPA 2DBJA 5C0CE 5F9JA 3SDXF 1KEGH 1Z2KA 3RVVC 1S9KC 3T2PA 1E4XL 2B39A 2P5WB 2Z8SA 5F7DB 2NXZD 3P11H 1J88A 3JV4A 4NZDA 4C83B 4EI6A 4R4FL 4TNWK 5K9OA 4P2QA 3IFPB 2IBGA 5D71H 4LHUA 1SEBA 1Z0MA 2P5EB 1FIGH 3BDYL 1YMHB 1J8HE 2VITB 4WTZA 3BEVB 4IJ3B 4JRXB 2AEWA 4KROD 4XNQB 5KG9B 4R7NA 3TNMA 3CC5B 2H6PB 4G6JH 1K6QL 2YRPA 2B0SH 4JFDA 2CKBB 5FCSH 4N0UA 1PZ5A 5BZWA 2R8SL 5ADPH 1UWGH 3RBGA 4ZODA 1CYGA 3CFKB 5DJ6A 1B0RA 5D2NC 1CR9L 5I1EL 4F33B 3UTQA 4MXQC 1FZJB 5HHME 3D85A 3QJFB 4D9LH 1BFOA 1G7IA 4Y7MA 1CL7I 3OKNB 35C8L 1A6WH 3CDGA 1JF5A 1KIQA 4MCZB 2YZ1A 3QDGE 5ISZE 4ZXBA 2VC2L 4UTAL 1JJUA 1AQDA 4K9EH 2X89D 1S7TB 3T1FA 5GJSH 5EU6A 4X6DF 3NABH 3AGVA 4W6WB 5K9KB 3GJFB 5DQ9B 4I18C 1MREL 3S98A 1OAZL 2IPTL 4BQ9A 1LO4L 1U9KA 3TVMD 3UTTA 2XY2A 4ODSL 5E94A 3E1F1 1PJ9A 1VERA 5I1LB 1XIWC 1QYGH 5JXEA 1T66D 2K9UA 5ANMB 3KXFD 2ITCB 1U6AL 3SJVE 2NY4D 2HVKB 2D7TL 3OKLB 1QQDB 3MLYL 5ADOH 1BBDL 1D5IH 4Y5VC 4PJFB 2NPLX 2FEEL 5FA4A 3NZHH 1FZOB 2W0FA 4GRWB 3B2UD 4NNXB 3L3JA 1PEZA 1Q9OA 3ORJA 4JFYA 3HMXA 5FCUH 2AK4D 5HPMB 1F3RB 3FT2A 1LO3H 3WFBL 5SWSD 1VADA 4CN6A 4JGMA 5IM7A 1BVZA 1WBZA 1ZVHA 5F8RC 2EIDA 3REVA 3MRRA 1HHKA 3TA3C 6FABH 1HINL 4ALAL 2R0ZH 3GJFK 3KR3H 1GVIA 4BSWB 2ED8A 2F53A 3FO0L 3HRPA 4LF3B 4DN3L 4N9GB 4Q9QL 5FV2A 4HT1H 3BDBA 1RULL 4M6MH 4X9HA 5ACZA 2I9LA 2QADD 1SYVB 1CFBA 1QSZA 2WBJC 3SO3C 2YD3A 5EUOB 1G7JA 3QPXH 1NBZB 5FGCE 4WUUA 4MJIA 5TQ2L 3L3IB 5DMKB 1UJTA 1OTTC 4XX1E 1JMXA 4BSJA 2PR4L 4P2QE 2HFEB 2J2ZA 5DVLA 1G0DA 5B4MC 5I73C 2EYSA 4NJAH 3QYCA 4RMWA 4MWFA 4Y5XC 3ULUF 3PL6D 5KJRL 1YY8B 4M7LT 1A02N 1R5IA 3QG7H 1VKXB 2WW8A 1IGJA 1U8HB 2ZOKA 5GZOD 1HWGB 1CWVA 5LJYH 2PYEA 5CZXD 4DGYH 3QBTB 4JFDE 4QTIH 4U1JA 4N0UE 1BBJB 4LP4A 3TPUB 3BPOB 1S78D 4G9FD 5FYJE 1WWAX 3V7AG 1MCWW 5IP4A 3UC0L 4J3TA 3I84A 4L3CB 4WI3A 5HD8D 5DD0L 5FYJH 4J3WA 2FHBA 1HXYB 43CAB 3LQZA 2W9LA 2BSRB 4QHMB 4PLJD 3NMEA 3TO4D 4M1GL 3VA2C 1REIA 1FVEA 2FWOA 3QI9D 1AJ7L 3OHXA 4NP4H 5F70A 3ARDA 2NY3B 4Z7NF 4ZD3H 3PWPA 4JHAH 3ESUF 2ZUQC 4NWTL 5FOBA 3KJ6L 3L3OA 3REWA 2VLRA 5FECB 4Z5RA 5DTFB 3MOBH 5GGRB 1WEJH 3SDDA 5EU6E 1A6VH 2H9GA 2GSGA 5JHLH 2EDTA 1F4YL 1RUMH 1TVBB 2FGWL 5JDJA 4UT6L 3CSPA 5IK3B 1YEFL 3SQOH 3SE8L 2X70B 3NA9L 4L4TB 1OF2A 3LMJH 1JNLL 1WC7A 5IIEB 5J1SC 3UTTE 1ZGLB 5KVGL 3MA7A 3K74B 1YEKH 4YHML 2GT9A 3DUUB 3RGVC 4K2UL 1VGEL 3CX5K 4JFQA 4EOWH 1C12B 3LHPH 4NQEA 3GB7A 1A3RH 3GSVA 4P23D 4YXKL 3QR2A 3VFRA 3DX6A 4R26H 4TPRH 3KLHC 2EC8A 2HG5A 1R6VA 5D2LF 4PRIA 3LPFA 3V4PH 4U1HA 5F6IB 1BVLA 2X7LB 5I30L 2A1WL 1E4JA 1IEAA 2D9QB 2YD5A 2R2CA 4XC1H 2X1WL 3MLWH 3VWKD 3OZ9L 2IAMA 5H94A 2AJVH 1S9WA 4JGJA 4X7FC 4FABH 1EEYB 5JMRA 3RL2B 4Y0GA 1IAOB 3HMXH 5BVPH 3KYKH 4OZFG 5GSRB 2LU4A 1K8DB 3P9LB 3QI9B 3AFLA 1NCNA 4OZGA 5EA0H 2QKIA 2K1MA 2V5SA 5GSVB 4JREB 2HT3D 5DURD 3QIBA 3OBAA 1CVSC 1WIUA 3MJ9A 4MVBD 3QIUC 2F53E 2ICWI 2R2EA 3PWUA 3D2UB 1QKZH 3V52L 1QO3A 2RFXA 3KWWA 2HWZH 1JUFB 2AGJL 3OPZH 2YEZA 5SWQB 2DQFB 4LHQB 4FMKA 3M1BB 4LSUH 2GCYB 2GHWB 1KXVC 1KJVB 1KPRB 3JUZA 3EGSB 4M6OL 1C08B 1LEKA 4DEPB 4WUUE 1IC4L 4MJIE 5FO9B 5DUMH 4QO1A 4Y4HC 5JMOC 2XOTA 5A1AA 4JKKA 5HI5C 4TVPL 5DJYA 2FD6H 1TJHH 4NQDA 1K2DA 1XF2A 3PNWB 1FNLA 4OI8A 1ZT4B 3VGBA 1KJ2A 4U6XB 5L2KA 4AM0B 5TGBA 4KJPC 5IBUB 5TDOA 5CD3B 4MNGB 4X4ZA 1KXTB 4P2OA 5CEYA 3VI3E 4APQC 2EKSB 2PYEE 3P73A 5ELIA 3OKMB 4JG0H 5DMGC 2BRRH 2R69H 3W0WA 1JF6A 1YEHH 4GXVL 4HS8L 2P48B 5I75B 3BD3A 4TVPD 3ZL4L 3MRLA 1IAIL 2G5RA 1JV5B 3AC0A 2MCPL 1HHHA 1F4XL 4I48B 3TWCL 5I2IB 3AREC 1BQSA 5I1IL 1QTYT 5E2WH 3SQBA 1T1XB 5EZIH 5DURB 3FN0L 4ISVB 4CVXA 3MXVH 1BQLH 5E1AA 2V7NA 4K8RC 3HZVA 4TUKL 2A6DA 3C6LD 5A16A 3TPKA 4NKQB 3ZE2E 1FBIH 1EPFA 2HH0L 4AL8L 1FJ1A 2Y5TB 5BRZA 2VLRE 2DWEA 3WJJA 3EO0A 5LG1A 3VFOA 4DCQB 3ET9F 2XWTB 5HDBE 4WCYH 3TZVD 4UT7H 2VB5A 5E5MB 4XCNB 4C4KO 2APWA 2UZXB 3DJ9A 2R0WH 5E8OA 5D71L 1WBYA 4GAYA 1JIBA 1YY9C 3TCLA 4H8WH 3F62A 4YK4B 1VEPA 3V7MA 1M7DB 4KJQC 5L2JA 3N1MC 4NHUA 3MLSH 3GMLA 3MUZ1 4XNMB 5ICZB 1LQSR 4GG6F 3FMGL 4OI9A 2PCPA 4LLUB 4NUJA 2F74B 1DVFA 4NQEE 3AB0C 4P4KC 1IC5H 4WFHE 4ZUTB 2W91A 3DV4B 5JIHA 1MRDH 3SY0B 4D3CL 4LQFH 4PRIE 5HDLA 2X4RA 2AV7B 2YWZA 1QG3A 4V1DA 1MUJB 3VCLB 3NFNA 5HGDA 4YUEH 3B6SB 2WP3T 4JN2B 3NCFB 2Z8VC 3X3GL 4XMLH 4CADB 4UOW0 4WHTB 2C1OB 3QO0A 4KRPC 4K9EL 2AK1L 3OKOB 3FO1A 4Z7UB 4MA3A 5F1OB 5GJSL 5INDB 4PY7B 2PW1A 4OZGE 4ELMA 4P2CG 4XVUD 4DUXA 3AXLA 4PLKD 1IM9D 3NABL 2AXJA 2B4CH 2P8PB 5IWLA 3DIFA 3S9DB 4RBPK 3V6FB 3CUPA 4L3EB 2FB4H 5TE6H 4K7FB 4ZS6D 3QFJB 3MJ9H 1OWRM 3MRMB 3PE9A 2R9HC 2ZP0T 4QRPA 3KVQA 5D7KD 1N3NB 4PJGA 3WCYA 3RWEA 1QYGL 3H6JA 5DFVC 4A2MA 2YMXH 3MRQB 4YR6A 2Z0BA 4F9PC 2D7NA 5HBBA 3H7LA 3VMPA 4DKEH 5ADOL 1KN2L 3LQAL 2ESVD 5I15H 3K1KC 4I5BB 1ZGLM 3V0VA 2X9XA 1Q9WB 5C0CB 5ALCH 1PG7H 4TOYH 3NZHL 1N0XL 4NQDE 4MZ2A 1VFMA 3SN6N 1JHKH 3HPJA 1A7QL 4O2CB 4KTYA 4I3RH 4ZQKA 4R0LC 1VFUA 4WU5A 2GITA 1LO3L 3EZJB 4WHCA 3RKPA 1YECL 2ARJB 1KJ2H 4M8QB 5DRNB 4OBSA 1A3LH 3OR7B 1GC1C 2NR6D 1NUDA 5D6DC 3ZTJG 4WU7A 2HT2D 3W0WE 4O51B 1WBXB 4NRZA 5EC1B 1S7RA 4X4YB 1J8HB 2R0ZL 1UT9A 2ZG3A 3KR3L 1X7QB 1DQQB 4WV1C 1WAAF 2APVA 2DLTA 2YUZA 3LAFA 4G6MH 3WMSA 1NUNB 3W2DL 5IMOB 1HYSC 5AG8A 5FM5O 1K4CB 2VLMD 1NAKL 1IM9B 1NGQH 2ARJQ 4HT1L 3LRSB 2ADIA 3JV6B 1H3PL 4Q6IB 1UB5A 2R1WB 4PRNB 2YC1A 3WDIA 1ZVYA 3QPXL 4IS6B 5FB8A 5BRZE 3VFPA 2DQEH 5JO5A 1D5XB 1CLCA 1UYWH 1YEGH 2Q6WA 3B9EA 3FT3B 4X6BA 5ISZB 1ZTXL 3BAEL 7CGTA 3LCYA 4GKZB 3U7AA 4HAFA 5I1JH 2ZNXA 4L8BB 4FG6C 3UYRH 3O9WA 5FYKD 4MB4A 1S7UB 4Q2ZA 4PJ8D 4DGYL 5ICYB 5DMIH 3EFDH 1NFIA 4QTIL 4HEME 4GS7C 5CD5D 2IC2A 2C1PA 2R2BB 5F9WB 4OCSH 3SKOB 3P4MA 1S7WB 5E4EC 1AIFB 4W4OA 5EDXA 3WLWC 5FDYA 5CMAA 4F57L 1AXTH 2FJHB 3S3PA 3BSZH 4UIMA 4JFPB 1I75A 4X0KA 3RVTC 2AEQH 4LPTA 4V1DE 5FIEA 1T1ZB 4LSVL 2XQYG 1RZ8A 4GG8B 5I74C 3LN5A 1FLTX 5FGBA 1OOAA 4NP4L 4JFHD 2VQTA 1S8DB 4P57A 4NKDA 2H3NB 2OR7A 4HUWA 4HQQL 4KY1H 1INQA 1B6DA 4JHAL 4KKBD 2EO9A 1CXKA 3H7BB 5CILH 2DQUH 2AW2A 1WV7T 3FAXA 3MOBL 1IBGL 1WEJL 1L0QA 4QRTB 4ZNEA 3VXOB 4ELME 4MAUH 2NXYD 1KPUA 2C4XA 3RI5K 1RUML 3G04A 1FNGA 1OWWA 2EECA 2D31B 5CS7A 2FYYB 3D18B 1NC4A 2RR3A 3SQOL 1S7VB 3OQ3B 4S0SD 1T80A 5F7WC 3PUCA 5FUOH 3C8HA 5IVZA 4ZAKC 1YEKL 4QRPE 2V9RA 4PJGE 4LSSL 3DETC 4S1DC 1HZHL 5TQ0L 1MVUB 4W70A 1DQLL 1A3RL 2AJUL 4PR5A 2D9CA 3T4YB 2BNQA 1ZLUH 4TPRL 1NCWH 4MQXC 3S4SG 2DD8H 3VXRA 5FKPB 1Z9OA 3RY6C 5T5NF 1J05B 3MXWH 4AEIH 3V4PL 5F9JB 1BZ7A 1F3JA 5HGAB 3BMVA 1UH4A 2Y06L 3MLWL 3AY4A 2AJVL 5ENWA 3JV4B 1J0JA 4EI6B 4FABL 5I18L 2YK1H 1DBKL 5GGRY 3IXAA 3C5ZC 5K9OB 2QEJA 4P2QB 4EN3D 4DN4L 2FX9L 3HMXL 1BEYH 4K7PH 5BVPL 2WUBH 4KK5D 4LHUB 4GAFB 1SEBB 4DZBA 5EA0L 5I16A 2CXKA 5FYJU 5HYJD 4LHJB 2AQ3A 1QA9A 1R5VA 4OGAC 4R7NB 5DGRA 1BF2A 3EJZD 3TNMB 3OGOE 5FKAA 3KDMA 4JFDB 1CD1B 4N0UB 3OPZL 4KRLB 1PZ5B 4Y4KA 1T7ZA 5BZWB 4YFDB 1YNKL 3ES6A 4TTGA 4U0RC 4LSUL 1TPXC 1B0RB 5SX5H 2IH3A 2HKHH 1WTLA 4ERSH 3UTQB 4Q97A 4XB8A 2EC9U 3D85B 1YYMH 4LLQA 2ZUTA 3VG9C 5HYSA 1G7IB 2QSCL 3F7RA 5D7LE 5DUML 4KH2A 1IAIM 3CDGB 5D2NA 1BQHA 3LKRA 2R1XA 1IZKA 1C1EH 3MROA 4JKMA 3FZUD 2R4RL 3VXNA 3WFDL 4KC3B 4Y1AE 2YD2A 3LB6D 2VAJA 2LE9A 1QHPA 4XP5H 3QQ9D 3T1FB 2I60H 1INEH 3KPRA 4R8WL 2W60B 3HNSH 4ZUSA 2NMSA 1JGUL 1ZEAL 2H2PD 2BRRL 2R69L 4UINH 5J89A 1MAJA 2MPAH 1SM3H 3NAAH 1YEHL 5FHBH 1RSFA 2CPCA 1A7NH 4EN3B 1OL0A 3UTTB 5HY9A 5J6HA 1RK1A 5E94B 4KKCC 2M26A 4EXPX 1KCVH 4UIKH 4I18A 3RVUD 1S7XA 3NIFE 4QRSA 1CQYA 5TF1H 4R97B 4OZHA 2X9WA 4I3SH 5DD5H 1B9ZA 1HSAA 3HC4H 1H3XA 4GQ9L 3TJEH 1FBIL 2WZPD 5L6YL 5FA4B 3LOWA 2WBWB 5HGBA 3CIQA 3CJJA 2W0FB 3G6DL 3L3JB 4JFYB 1Q9OB 4ZNEE 1G7MA 5ESAA 2XG5A 2R0WL 4Y5VA 5D70L 3FT2B 5I17B 3O3DA 1AY1H 1D9KC 1VADB 1NUFA 1B6UA 4H8WL 4GW1A 5IM7B 1WBZB 1JPGA 5JHDE 3FB6A 1OW0C 1KTLA 3MLSL 1HHKB 3MRRB 3REVB 2XZAH 4PJEA 4UNVA 5D96C 2B5IB 4ZDHA 2E9WA 1NGZA 2HTKC 2F53B 1PKOA 4AEEA 3UPRA 4XPFH 4E5XB 3PWPD 1IC5L 3E8UL 2CD0A 3MMEA 5FGSA 5SWZA 4M48L 3TA3A 2BNQE 1MRDL 3RKDC 5ACZB 5A40E 4LSPL 4PJDA 3VXRE 2IALA 2A2QT 4MD0A 4JDTH 1ITBB 4NC1C 8FABA 1CIDA 4R4BB 1A47A 1G7JB 5L88H 4WUUB 2B2XH 4MJIB 2Y25A 4G6AC 4QHKJ 1CDJA 3CDCA 2WBJA 4KV5E 4XMLL 1Y6KR 1ZHLA 2EYSB 5IQ7H 3F58H 1NCAH 4TQEH 1K4DA 1GZQA 4MWFB 3ARBD 1EEZA 2DTSA 1Z9SA 1E6OH 4X99A 1R5IB 3DBXA 1IGJB 1NLBL 2HFFB 2ZOKB 5DGQA 4POZD 2QQLH 3F6IA 3QUXA 2QLVB 3OR6A 4Z7QF 4U1JB 5E6IA 3MJ9L 3T1WA 1FG9C 2PO6D 3BUYB 1EVTC 3GHEH 5D5MA 5I8CA 2CH8A 1RVFL 2YD8A 3LQZB 3RU8H 5I15L 1MI5A 4RNRA 5D2NE 3OHXB 3LDBB 3OX8A 5ALCL 3ARDB 1PG7L 3GI9H 1KYOJ 4TOYL 3G6JF 4JKPH 3PWPB 3HAEG 5FOBB 1F8TH 4I13B 4J1UB 3L3OB 3REWB 4BQCA 1WFTA 2VLRB 4Z5RB 1NANH 3KPRE 3SDDB 3B43A 2H9GB 2FX8H 2GSGB 4LLAA 1JPFA 4HS3A 4WRLA 3P0GB 1UZ6F 1KBGH 3UTPE 3VXMA 4EIGB 1OLZA 1HHIA 3VDAA 1CGYA 4NWUH 2HT4D 4U1IA 3Q0HA 1T0NA 1WC7B 4H25A 3HA0A 3QIWC 1V5JA 3MA7B 1EMTL 3TC9A 2GT9B 1S7SA 5EO0A 2PN5A 3C9NA 4JFQB 5IFAH 5GS0H 3QP3A 4NQEB 3BI9X 3U0TA 3GB7B 1D6VL 3GSVB 3S5LA 4OZHE 3VFRB 1T3FA 5L2KD 2HG5B 2NY2B 1VFBA 2K3TA 4U1HB 1BVLB 4RGMC 2PETA 2DQEL 3PHOB 5AWNH 1IEAB 5GXBB 5BJTA 3DVIA 1UYWL 1YEGL 5HDQH 2IAMB 5H94B 2VXTL 4ZFFB 1S9WB 2AV1A 1GOGA 2LU7A 3UEZA 1RURH 1YC7A 2AQ2A 2K7PA 3S3JA 2LTQC 5I1JL 1JGLH 4ODUA 3UYRL 4P59H 1CIUA 5K59E 3RL1A 4J4PD 4OZGB 2X9YA 4PJEE 2QKIB 3GI8H 4NN5B 1CBVH 1CG9A 1BOYA 1OPGH 3EFDL 3QIBB 4PTTA 3ZZ1A 2Y23A 2R2EB 3PWUB 5BVJB 1B2WH 4ORGA 1ZLWH 1QO3B 3FN3A 2RFXB 3KWWB 3FO2A 5ESQB 3IFLH 5SWZE 1AXTL 4U2YA 2HLFC 3BSZL 4MA7H 4YHLH 4ZSOA 4FFVD 4PJDE 1L7TH 4MD5A 3VD5A 1AXSB 2AEQL 3O2DA 5D7JD 1LEKB 5KS9F 2XYCA 4ZO9A 3KPOA 3ULSA 3LZFL 4YBQC 2CK2A 3H9YA 4KY1L 5I1HH 2BSTA 3NIDF 1KCSH 2R39A 2DQUL 5A3ID 5JW4Q 4UILH 4NQDB 1K2DB 3PGFL 4K3EL 4WW1A 3ULVC 4IDLA 4KTDL 1KJ2B 4NBYB 5L2KB 5TGBB 5TDOB 4Y4HA 5C0BD 5DMYA 4P2OB 5CEYB 1LVEA 3I3EA 3H42L 4OCMC 3P73B 1CFTA 2NY6B 3N1GC 3THMH 2HTLC 3H9SA 2FJGB 3W0WB 3TF7C 4P46C 3A6CH 3CSGA 3CVIH 3FB5A 3G5XA 1CICD 3CFDA 3PV6A 3C8KA 1GYAA 5D5ME 2LQRA 3MRLB 5DC4B 3L3DB 1HHHB 1YDPA 3MBEC 2C5DC 2XQBH 2LABA 3UTSA 3IJHA 1JK8A 1MI5E 3IRPX 4CU8A 1NCWL 2Z8RA 4IRZH 2DD8L 2BVOA 3HUJA 4CVXB 4AEIL 3MXWL 4HWNA 5E1AB 4MXVE 2A6DB 1KT2A 1HE7A 4JO4H 5A16B 4ZFZB 3AREA 1FJ1B 5BRZB 2B1HH 2DWEB 1EV2E 3EO0B 3VFOB 3AS3A 1B4JL 2YK1L 2Y07L 3NCBB 3KPPA 3HZKA 4NFBA 1BEYL 4PPTA 5E8OB 3LRHA 2WUBL 5GGVH 3F65A 2NY5L 4C56D 4HXBH 1ZHNB 1WBYB 4LCYA 5EWIH 3P4OA 2FIKA 3VXME 5EBMA 1R3HA 5BZDA 3NBNA 3JWDC 4XBPA 2FIRT 3S96B 2UZYB 5E0QA 2H26A 3R0MA 5L2JB 4NHUB 2GW5A 4GKNB 2HFGL 4U1SA 4WNQA 3Q6FA 1XGPA 1U42A 2PCPB 4NUJB 2IJ0C 1I9IH 3MO1A 2QSTA 5F1SA 3WO4C 1DVFB 2Q7NA 4NQSB 4Y16C 5C0BB 4MJ4A 1RHFA 5LGHH 5CGYC 1KV3A 3QISA 4WTZG 2HKHL 4BZ2H 4ERSL 3K0WA 4G8IB 1CXLA 5I76A 2VDMH 3CK0H 1GGBH 2X4RB 4V1DB 1SY6L 2KH2B 4LLVA 4C4KT 5HGDB 1C1EL 2GJZB 1I7UA 1D6EA 5ICXA 3UO1L 1PLGL 1QSFA 2ZJSH 4MSWA 1H3GA 3QO0B 1U3ZA 4HPYH 1Y6NR 3U0WL 1IZJA 1U8NA 5GS1C 2I60L 1INEL 2PW1B 4RGNE 3GMQA 4HKJA 4ELMB 1VSCA 3AXLB 4MYWB 3BZFA 3JSSA 3WFHA 3O4LA 4GMSH 4CMMA 4P2RD 2IBBA 3DIFB 2MPAL 4NQVA 3CUPB 1JPTL 5C70A 1A7NL 1GGYA 3MRBB 4P9HL 5BV7L 1MHEA 4ZSOE 1E4XI 4UIKL 3RWEB 5KN5B 3VH8G 3A67L 4RX4D 4YR6B 5KVFH 2VTFA 2P47B 3AS1A 5TF1L 4MAYA 1XH3A 3EDDA 4OT1H 1K9TA 3EIFA 5DD5L 5KW9L 3V0VB 3HC4L 1E4WH 3AM8A 4HF5H 1ZS8A 1EUTA 3MRNB 4ODVH 3STZA 3FHAA 4XPAH 1QFOA 4F9PA 2GY7B 4QXWA 3HPJB 5MEOB 3SGDI 4ZQKB 1FSKC 1DBJL 3G5YA 4WU5B 4M02A 1B88A 4KWUA 2GITB 4KTEH 3HB3D 1MLBA 5TDPA 3ARPA 1H15A 4WU7B 3H9SE 3LQMA 4X6EB 5C07D 4R0LA 3BYYA 5J12C 4I0CC 4Q7DA 2ITDA 3AUVA 3NACL 3VFNA 4YDLC 2Z4QA 5E99L 4PJFF 4ZNCD 2C7UA 2X4OA 4S10A 4XPFL 5D6DA 4J3OC 4R4ND 1T0PB 4GRWF 1XZ0B 3QNZA 1NDMA 2ADIB 1ZA6A 2MQ0A 4JDTL 1UB5B 2RGSA 4X4XA 2YC1B 2FZ3B 1VENA 4PGCA 4XP1H 4JM2C 5L88L 5JA9A 1ZANH 5I19H 5FB8B 2GK0A 5DC0A 3VFPB 1U3HD 1MCOH 1ACYH 2H32A 5JO5B 5JW4M 2Y1VA 4PRAA 2Q6WB 2FLBT 3FRPG 1ZT1A 2YRLA 4NNPH 5IQ7L 3F58L 1NCAL 4TQEL 3O6FC 1G0YR 1E6OL 5TFSH 1HCVA 3RUGA 3V5KB 3BZEA 4Q2ZB 2QQLL 4G6KL 2UVEA 3LKQA 1EHNA 4OUUA 1NFIB 5HSFA 4NN7C 4FTVD 5BV7B 2C1PB 3QXDA 3NFPA 3T0ED 3GHEL 2RB8A 1I7RA 3P4MB 4WEBL 2VYRE 1A14H 2FEEI 5CMAB 4UV7H 1QVOA 4UIMB 4X0KB 2GAZA 5DD1H 1MCPH 2P44B 2XTLA 4OFIA 1DANU 4OFPA 1LE5A 1Q0XL 1RZ8B 3LN5B 5HI4D 5H35A 1P84J 2YPVH 4DOHE 4P57B 1JNHA 4HUWB 5JORA 4JKPL 1J10A 2E7LC 1AR2A 1INQB 1W0WA 1AFVH 4X6FA 2HYMA 2EICA 1PY4A 4X7DC 4XP4H 1VEMA 3E0GA 1JNNL 4WFFD 4JQIH 3NCYP 1IGMH 4Y4KD 1CFQB 2FX8L 1KPUB 4UOW1 1FNGB 1QFUH 3TFKD 3O4LE 3PWLA 4K94C 3MRHA 3FT4A 4ONFH 1KBGL 1NC4B 1U3HB 1OT1A 4NWUL 1ODAA 3QUZD 1J11A 3EDFA 4WWID 5E7BA 5E8EA 4PRHE 5DXWA 4E0RA 2Y36H 4JN1L 1P5VA 4ACPA 5IFAL 5GS0L 5GS2D 3T0XA 3OAYH 4HJJH 4PR5B 2BNQB 2OI9C 4ZYKA 1CLOH 1LDPL 3OF6A 4MQTB 2Z93A 3KPRD 4IBLT 1N4XH 1UCTA 5D1ZD 2LAGB 1BZ7B 1F3JB 3T0EB 2V2XA 4TTDC 3BKJH 5J13B 3RNQA 4ENEC 5ENWB 3R0NA 3NTCH 1RURL 1YEIH 3IU4H 3IXAB 4YIQA 3DX9A 1MHPH 5EIQA 4XT1C 1JGLL 1ITCA 4P59L 4EXKA 5CZVH 4DZBB 5I1CH 5I16B 4U7KA 3MV7D 4ZO8A 1BF8A 3MFFA 5B21A 1QA9B 3DHMA 3MRFA 4NZTH 1R5VB 2QL1A 1OTUD 5GGTA 4YJZL 5FKAB 3GEWB 3KDMB 3GUTA 4QNPF 4Y4KB 1FYTD 3IFLL 2BSED 3VA6A 2CDEA 2FR4B 3OAUH 1GC1H 1L7TL 2I5YH 2IH3B 4HIJA 2IMMA 3LV3A 5D7SH 4LLQB 4EEEA 5HYSB 1M05A 1SEQH 4KMLB 3F7YA 3GNMH 5C86A 2D0GA 1FC2D 5D2NB 1YC8A 5I1HL 1MCBA 1BQHB 3MROB 1G9EA 1KCSL 1DZBA 2ATKB 3VXNB 4UILL 2H32H 1SJEA 4JPWH 4FHBD 2CGRH 3NPSB 1UWEH 2DMKA 5CKAA 4XI5D 2XNAB 1RIVH 1HI6A 3RUGE 2JCCF 3KPRB 4EDWH 1RJYA 2DWDA 4ZUSB 3GFUA 4HUNB 3ZYZA 1J5OH 4IHOA 3THML 4PJBE 3ZDZE 2CDGA 4MB5A 2F19H 3FHQA 2BNUA 4KKLD 5HY9B 5J6HB 1RK1B 3QZWG 3EO9H 3WFZA 3BHBA 2R2HA 5DD3H 2XQBL 4I18B 3HE7D 3MV7B 4NKIL 2FBJH 3IDMA 5ILTH 3EHBC 3OJDA 1ORSA 4IRZL 1S7XB 2WMPA 1AKJD 2DMBA 4JCMA 4QRSB 4WTXA 1U95A 1CLZH 3QUML 1HSAB 3VD3A 1CD8A 1O7VA 4HKZB 4JO4L 4QGTA 4WO4D 1KPVA 4HG4K 5HGBB 1S5IL 2W0LA 2B1HL 3D39A 2CKNA 1HOCA 3QUXD 3O2WH 2L7JA 5E6ID 4DKDC 1A6ZA 5ESAB 4Y5VB 1B0GA 2IADA 3O3DB 2BVYA 3M8OH 5FV1L 4HXBL 2XN9A 3TYGL 4JFED 5EWIL 4OCYH 4GW1B 3KG5A 1RZFL 1FL5A 1P6FA 4F58H 1JPGB 1KTLB 2QQKH 4FQJH 4PJEB 3VFMA 3IAGC 4ZDHB 5I1DA 1NGZB 4ONHA 1WUNT 3LS5H 2VZ3A 4PGJA 3UPRB 4OAWA 4PJCA 1U93A 4TSBL 5JW4N 4I3GA 2ZNWA 1OW0A 2JJWA 3MMEB 4XAKE 4L8SA 3TA3B 1YYLH 3FQTA 1OB1A 5DO2D 1AHWA 2IALB 5LQBH 2VDML 3CK0L 3D5OF 5IB4A 1GGBL 3OJ2C 3S36X 3KLSA 8FABB 4CL7A 3MA9H 4S2SA 3OXRA 4BQ8A 2Q3ZA 2C3VA 2PXYD 1U36A 2J8OA 2WBJB 2MSPA 2ZJSL 1EEQA 3TBWA 4PBVC 1DTUA 1ZHLB 4OFVA 5HHVL 1K4DB 1GZQB 1WISA 1EEZB 5D93B 5T1LD 1MELA 1IAII 4X99B 2VDRH 3DBXB 1UH3A 3DECA 3MV8D 5IW1B 1MJ7H 4LAJH 4GMSL 1XGRA 5DF0A 3Q6GL 3QUXB 3OR6B 2VH5H 4ONGH 5E6IB 1ZLWK 3B83A 5GGTH 1D5BB 1OAKL 4QRUA 1WT5C 5J7CC 2BK8A 5D5MB 5LCVH 5I8CB 1RIUH 3INUH 1T66C 3UBXG 4LARH 2NY4C 5KVFL 1BX2B 3QUYD 1F45A 4OT1L 4Z7UF 3K4ZA 3QUMB 1MI5B 3O2DL 4KDTC 3T2OA 5A43C 3C2AH 4RNRB 2VISA 4HF5L 4TULL 1XCQA 2DDQL 1I7TA 2R0LL 4ODVL 4X7SH 2Z31D 4XPAL 3B2UC 5INCA 1F3DJ 1NUGA 3BPOC 2FHCA 1T89C 2J8UA 1RZ7L 2JE8A 4KU1A 1RUKL 2XWJB 2J4WH 1EZVX 4KTEL 4HFUH 2JLLA 1I3UA 1JPFB 4L5FH 4HS3B 5FHAH 2W1NA 4MA8L 4OLUH 5CIPA 2ZUQB 2GTZB 4DKAA 3CZFA 1SBSH 4O58L 32C2A 2C4FU 2PXYB 3VXMB 1HHIB 1EX0A 4U1IB 5CZKA 5E9DD 1T0NB 2CRMA 4H25B 4KK9D 5TH2A 3ALPA 1S7SB 2XY1A 4H88H 3C9NB 5IESL 4G8GA 3U0TB 3KYMA 3QFDA 2VXUL 1AGBA 3QIWA 3S35X 4FQ2H 1OAUH 3L6FA 4MLSA 1JL8A 3UCRA 3K4DA 1VFBB 4XP1L 4PY8I 5DK3A 4XPGH 1ZANL 5F8QC 1RD6A 3KHOA 4MMXC 3G9VA 3D39E 3LH2L 2FDBP 1MCOL 1ACYL 3F5WA 2H41A 5BJTB 3GMOA 2AV1B 1MLCA 1I9JH 2AP2A 3F7VA 3PL6C 3CVHL 1HKLL 4FQPA 2XN9E 2BMKA 4PJAA 5F3BA 1MRCH 4JPKH 3U4BH 4H0GA 3B8YA 1F90H 3W5NA 3RL1B 5GZOC 2LU3A 4RGNB 3UTSD 5CZXC 2ICWJ 1QSED 2GJ6D 4RISL 2EXYD 4PRPA 1N2RA 4G5ZH 5F6IC 1S78C 4XMPL 3RWFA 4H20L 1SJXA 4ORGB 4PJCE 1A14L 4FFYH 4HIHA 5HD8C 4UV7L 5D1QA 4R3SA 5DJ0A 4ZSOB 1YMMA 1HILA 4CW1B 5HPOA 4MD5B 2VDNH 5DQDH 2AAVA 5DD1L 1N5YH 5CP7B 3OKKA 4PLJC 4PBWD 4LP5A 3VFSA 3RVWD 1LK2A 2YRZA 3QI9C 4Y19A 4JR9L 4JO3H 3GSUA 2YPVL 3ARSA 3KPOB 3EZ8A 3ULSB 3GSOA 2BSTB 4RWYH 3IETA 4FS0A 4NC1E 4WVRA 5K33A 1X44A 4NUGL 4WW1B 4JQIL 1IGML 3MLXH 4W4NA 1IC7H 2EE2A 3IXTA 3X3FH 4Z95L 1KGCD 2X4SA 4Y4HB 1QFUL 1PX3A 4ONFL 2OSLA 1CFTB 5DJCA 4R2GD 4MS8D 2WSKA 3MCKB 5L7XH 3IAQA 5GS3A 4YO0A 1JNJA 1U91A 2YPKA 5KSVA 3FB5B 1I9RH 3DXAA 3G5XB 3CFDB 3PV6B 5JNYA 3C8KB 4KI5D 1F97A 2RQ8A 1OSZA 3EOBA 2VABA 4MA1B 1YDPB 2YHGA 1QSFD 1OCWH 4P23C 2ZUXA 4AQOA 3UTSB 3IJHB 1A6TA 1JK8B 1GOFA 2W65A 3DRTA 5ALBH 3BWAA 4K71C 2BVOB 3KPMB 3HUJB 1N4XL 5K9JH 1KT2B 3MBEA 2WM0A 3BKJL 3VWKC 5E95B 1BLNA 4JQXA 3AREB 5E1HB 2J8UE 1L9MA 2X4PA 3V5HA 2YD7A 4BFBD 4BA8A 3NTCL 3CVHB 3KPPB 4URTB 3HZKB 3WN5A 3U9UA 1JYXA 3RIFK 3ARXA 5C1MB 4KVNL 5FFLA 4WHYG 5I1CL 1FE8H 4BZYA 4LCYB 1JYWA 3P4OB 2FIKB 5EBMB 4F80A 2QR0A 2DM2A 1R3HB 3AU1A 2HT3C 5F89A 5BZDB 4XBPB 5CIPH 2H26B 4NZTL 1TZIA 4MAYD 3SE4A 2V7HA 2VZ1A 4GBXD 4LSQH 4U1SB 4WNQB 1JWUB 3Q6FB 1SVCP 1JPSH 3T3ME 4MLIA 4RFNB 1IQWH 3BZ4A 3MO1B 1TITA 5IMKA 4CDGC 1GC1L 3QPQD 2I5YL 3X12A 4AIZA 3MYJA 2CRYA 4HD9A 1VEOA 2YSSA 4XCFL 3KPNB 1I8MA 3RIAK 1HQ4B 5I76B 4KK8D 1SEQL 5J8OA 1BJMA 3GNML 3AB0B 4Y16A 5EN2A 4K3GA 1NBQA 4LLVB 3F8UB 5E2VH 4LRNL 4DOHB 1I7UB 1D6EB 4OCRH 2CK0H 5ACMA 4Z7WA 1QSFB 5D7IA 5HYSG 1M7IA 5DZNA 4K3JH 1U8NB 2C3HA 1RIVL 4U1LA 2BNRE 4EDWL 1ZA3A 5FO8A 3PXJA 3GMQB 4HKJB 4HV8A 4CVUA 4JKWA 4JFZL 4KI5F 3BZFB 1HHJA 4PRPE 2DM7A 3O4LB 4CMMB 4RDQG 4B5EA 4OCXH 2PF6A 2BVTA 3QRGH 4QXTA 5DA0B 2H8PA 4NQVB 4MD4A 4PP1D 1HK6A 1TVHA 1GGTA 3EYSH 1MHEB 1YMME 5DD3L 3CFCH 1QFWH 4L4JA 4UUJA 4HMCA 2FBJL 3MLVL 5ILTL 4Y19E 1FH5H 3ARGA 4MAYB 1TZGH 1XH3B 1Z3GH 3O41A 5FA3A 1ZVSA 1HNGA 5JR1H 3RDTA 2ZUUA 1ZS8B 3W9DA 1MFAH 1R3LA 4JM4H 4G8EA 3STZB 3VGEA 4MDIA 2UWEF 2X42A 3LD8B 3O2WL 1IKNA 12E8H 1OVZA 5FUZH 4M43H 3G5YB 2OMBA 2OTUA 5C0AA 3GMRA 3RJDA 3ZTNL 3M8OL 2A9NL 1LP9F 3MGAA 1MLBB 5TDPB 5J3HD 5SX4H 3BP7A 5LGJA 1GHFL 1W72L 2FO1A 3ULVE 5MENA 4R0LB 2QQKL 4RFEA 3DXAE 1OM3H 1I4FA 3VFNB 3ULVH 3ECBA 2C7UB 2X4OB 5MP6H 3JUYA 3ZKXC 4BK5A 3BD5A 4LVHC 3P30H 1YYLL 1NDMB 3OAYK 4BM7A 2NX5A 3IFOB 4Y2DD 2CIIA 1ZA6B 4O02H 3W5MA 4U3XA 1NL0L 5I8KL 4X4XB 4OD3H 4Q9RH 4ZMAT 3MA9L 4PGCB 2GK0B 2CUIA 4I9WD 4F37K 4OKVA 2KDGA 3DOSA 2H32B 3TIEA 4PRAB 4XMKL 4N90D 2H1PH 4GKOA 4RIRA 1ZT1B 1G1CA 5JPMA 1UG9A 3HHRB 1QRND 1TCRA 1JTOA 2I25N 5IB2A 2NY7H 5L9DH 4XVUC 4PLKC 3ELAT 2VDRL 1O0VA 3P0VH 3RUGB 1MJ7L 3MGTA 3UZEA 4Q6IC 4FOMA 3BZEB 1CFNA 3LKQB 3O6FA 4OUUB 2ICCA 4ONGL 4ZS6C 4Z76A 3BP6A 4UI2A 5GGTL 3QXDB 3NFPB 4IRJA 2VDLH 4TUJA 1M71A 5HVFB 1I7RB 5LCVL 3SBWA 4PJXA 4K9EC 3INUL 3MJ8A 4M6NH 1QVOB 2FATH 3CLFH 4IOFC 4FNLL 3V4VH 1T20A 3JWDH 2GAZB 3MREA 4OZFA 2Z92A 5K93A 3T4AB 1LE5B 3A6BL 2EE6A 3R1GH 4QLRA 5H35B 3WKNA 1IILE 3O3UN 4X7SL 5JORB 5DRZA 1CFVL 2ICEA 4LKCA 4HWUA 1W0WB 4I0PD 2EEDA 1QRKA 2JK5A 5D7IE 4YFLI 5F9WC 2J4WL 4Y2DB 5I74B 5CBEA 4JAMA 1Q38A 4CU7A 4HFUL 1A7OH 3MLTA 4L5FL 2E7LA 1W72B 2NR6C 3PWLB 2VIRA 2HT2C 5EORH 3MRHB 3FT4B 1SBSL 3LQAC 1XF4A 2ZSWA 4IDJH 2O26U 4GKSA 3ESVF 2JIXD 1UENA 1DBML 1MCJA 3LIZH 4NDMA 2AABH 5E8EB 4E0RB 2XA3A 2E6PA 4PP2A 3QEGH 1EHXA 3SE9H 4YDJA 1YEJL 4YEFA 4QXUL 5EB9A 3GRWA 4FQ2L 4YE4H 1MFCH 1KELH 5C8JA 2EE9A 4ZO6A 4ZYKB 1T1YA 1G1YA 2L0DA 2P1YA 2Z93B 1KJ3H 3OKEA 1B4RA 3VI4E 5IB3A 1FVCA 2V2XB 3V7AE 2OZ4H 4X7EC 3FAWA 4YFLF 3RNQB 5C0AE 3WIHA 3QAZC 1P4BL 5GJTH 4U6YA 1I9JL 4XXDA 1QBML 1R3IH 5F9DC 4YIQB 3DX9B 1MRCL 3VXSD 4IRSA 4JPKL 3U4BL 4D9QE 3RAJL 1F90L 5DEFB 3I9GH 3SDXA 1UKTA 3MFFB 4PJ8C 2HFTA 2DI8A 3BW9A 4HIXL 5GGUA 3MRFB 1FPTH 1J0KA 4HMEA 5CD5C 4XVJH 4PJ7F 3GUTB 2A73A 2E6QA 1P7QD 5KOMC 4YHKH 2CDEB 3D39D 2NX5E 5DK0A 1DQMH 1S3KH 5IHUL 4YXLH 4HIJB 2VDNL 3HPLA 3LV3B 4PJIA 4WW2F 4WWKD 5IGXH 5F6HI 4AZ8A 5C92A 3V4UH 1M05B 4JO3L 4KJWD 1RAMA 3SGKC 3F7YB 4PJ5A 5DS8A 1TPXB 1MFNA 4RWYL 2DLHA 1CT8A 1TETH 4GAGH 4KKBC 3VFVA 2E9IA 5EUKA 3QJHA 3PV7A 3U83A 1SJEB 3VG9B 4XVSL 5C08D 3JWOL 1PSKH 1LGVA 3MLXL 1A22B 1TJIH 1IC7L 3X3FL 3NVQA 3OXSB 2VITA 2YKLL 3L95A 1HI6B 2RJMA 5KG9A 1RJYB 2DWDB 2X1XR 1T2QL 1F02I 1N64L 3S7GA 1I1FA 1MCKA 4IHOB 1ADQA 5L7XL 3F6LA 1MHHB 5C9JA 2DQGH 2CDGB 5J1TC 2NW2B 5HHOA 1I9RL 4LQ1A 5GGQH 1QFPA 2BNUB 5TE7H 5CGMA 4F33A 4PJXE 3V6OA 1KFAH 5F7KC 1OT2A 4HGMA 4S1RH 1OCWL 1A7RH 2VR5A 1V8HA 3IDMB 2IPUG 2FJFA 3OJDB 1MJJA 1ORSB 1RJLA 1U95B 4OZFH 4LLYA 4XCCH 2VN7A 1KPVB 1NAML 4KPHH 3D39B 4OF7A 1A3QA 1DQJA 1HOCB 1XT5A 1NMBL 1HIML 1OGAA 4P5TD 1QACA 1A0QL 4EN3C 1A6ZB 1A6UH 4X7CC 2DJUA 1B0GB 1B3JA 1RUAH 3HR6A 2IADB 3BXNA 4KK5C 5B39B 5HDOA 3U30B 4YXHH 5A2LH 1BPVA 2XN9B 2VL5A 1FE8L 1PY9A 3IJYA 4CVWA 5IB5A 1NFKA 1FL5B 3ILPB 4R97C 3EJZC 4OLXH 4ETYA 4LRIA 2EEAA 4E41D 5I1DB 5JOFA 1CXHA 1BD2D 1KIRA 4ONHB 1JPSL 5F72S 3MC0A 3BIKA 4OAWB 4PJCB 1U93B 1DLHA 2VN4A 2NY1D 4K94H 4NM4L 1ED3A 3DGGA 1J87A 4L8SB 1N59A 2DAVA 4OLZH 3W9EA 1DBAL 3FQTB 5DLMH 1OB1B 2CDFA 1S9VA 5KANG 1AHWB 5IB4B 3GRWH 3KPTA 5C0JA 3ZKQD 5IW3A 4S2SB 3OXRB 5E2VL 5F7UA 5FM8A 2C3VB 1JVKA 3FZUC 4OCRL 2CK0L 4QCIA 2B5IC 4U1NA 3U7YH 3HNVH 3LB6C 3BDXA 3TBWB 3MV01 3MRGB 1EJ6A 1RPQA 3WIHH 2V5TA 3QQ9C 4K3JL 4D9RE 3MRDA 1YUHA 2ILLA 3CXHJ 3SDXE 1NMCB 2X44D 4G8GD 3N1FC 2KBGA 2EH8L 1XGRB 4OCXL 4OKDA 3T3PF 3V8OA 2VLLA 3AROA 3EYSL 3VDCA 4JCLA 4QRUB 2F8XC 2BY3A 3VFTA 3CFCL 1QFWL 3EYOA 3RZCD 1N6QH 4NO5A 4PJIE 1S5HA 4X9BA 2AXGA 2YA0A 3TVMA 2OMNA 1TZGL 1FCGA 4PJ5E 4JO1L 3DMMD 4E41B 1HSBA 4ELMF 5JR1L 3MACH 2VISB 1NAMB 1XCQB 1MFAL 1I7TB 1BHGA 4JM4L 5HYIA 3KXFA 3WBDA 3QXUA 2AEPL 2BOCA 5INCB 4M3JA 2NY1B 12E8L 3QDMD 3L7FA 2J8UB 4M43L 1JHLH 2D7OA 5IMMA 1VKXA 3QCTH 4WGWB 4LAQL 5D1QD 1L4IA 4PJGF 5CIPB 3CZFB 5HHOE 2AK4A 2KL6A 4HIEA 5SWSA 1ADQH 4L3CA 3ULVL 5DJ8A 5TH2B 5EZLA 4XWOD 4AY0A 1FZKA 1OSPL 1FNEA 1NGPL 2NY0D 2EYRA 3ZSTA 4PJHF 4QHMA 3P30L 2XTJD 4G8GB 3KYMB 2W0KA 3QFDB 3BKMH 1AGBB 3QIWB 2VR9A 3L6FB 2MHAA 4OD3L 2HAZA 4Q9RL 3OSKA 1QLFA 2R1YB 5CJQH 3VGAB 3BIAX 3F5WB 4X5LA 2ZG1A 1OGAE 2NZ9D 4MHHG 1J7VR 4RGOL 3BE1H 3GMOB 4AG4L 4JPIB 1MLCB 1A21A 1R3KA 3F7VB 4MNQD 2NY7L 5KVDL 2BMKB 4RGMB 4PJAB 5F3BB 3DMMB 15C8L 5CJOH 3U0PA 5BS0D 1A7PL 4MNHA 2HLAA 3ARRA 4N0FA 4POZC 3S4SA 5KAQF 2F9BT 2NY2C 2G60H 4KFZC 3PL6A 4XPTH 1N2RB 2MJWA 2LTQB 2PO6C 3RWFB 3S36H 3SCMD 2IAMC 3DO7B 5D1QB 2Q7YB 3WNLA 4M6NL 4R3SB 3EAKA 5J9PA 3CLFL 1YMMB 3V4VL 1HILB 3JWDL 1IQDA 4ODWA 1MSPA 4G9FA 3WDJA 2X7LA 1MCLA 4HXAH 3OKKB 3VFSB 4EDXA 1MCIA 1FYHB 1LK2B 4Y19B 4NYLA 3GSUB 2E9JA 2J6EA 1CVRA 4ETQA 3RX5A 4NN5C 3RP1A 3ZTJH 2HKFL 3RL2A 3GSOB 3CNKA 3IS0X 4E42A 5E7FA 5CEZD 1Z9MA 3IETB 3RVVD 2XTJB 3TO4A 2JB5H 3QI9A 1A1MA 1A7OL 2FLRT 3IXTB 2UV3A 3E6HA 2X4SB 1AE6H 1MIMH 5EU5A 5HI3D 3JVGA 3Q3GB 3DSFL 5EORL 4JHWH 3SGDH 5M7QA 1K6QH 4JFXA 2OSLB 2W0PA 4IDJL 2HT4C 4FRWA 5DJCB 3HI5L 4CVZA 2R8SH 5CBAB 4YO0B 2N1KA 1EVUA 1U91B 2YPKB 3L9RA 3OV6A 3DXAB 2VNCA 3NIFF 4XVTH 2P45B 5JNYB 5E08H 1CR9H 2ARWA 2JJTA 3EJYD 3BH8A 3EOBB 2VABB 3ZKSD 5LKNA 1MPAH 3SE9L 2BP3A 2N4IA 5DSCA 5KSBA 1V3MA 3O8XA 35C8H 5GPRA 3RWHA 5GZND 1A6TB 2VDOL 1MFCL 1KELL 1S9YB 2W65B 4UAOB 4LEOA 3DRTB 3BWAB 4P2OC 1KJ3L 1PKQA 4G80B 2V2WA 3KXFE 2NY6C 3PNWA 4P23A 1BLNB 2VC2H 3WIIH 2J12B 4NCDA 2X4PB 3V5HB 1GPOH 4BZ1H 1R3IL 1KB5A 3WN5B 2IPKB 3U9UB 1TENA 1TQBC 3PDOA 2EKSA 3BGAA 2OM5A 3EYVA 2W38A 2YN5A 3KPSD 3VWKA 2YPLD 4J4PC 3I9GL 3QDJD 5IBTH 1MREH 2AK4E 4ZTPH 1RIHH 2QR0B 1OAZH 5F89B 2IPTH 4Z7NE 5SWSE 1JCKA 1TZIB 3ARGD 1FPTL 2OX5A 4HMDA 4JGUA 5BQ7B 4ODSH 4NC2B 3S35H 5H2BA 2V7HB 1ULVA 1JV5A 3BPCA 4IIQA 3RDTD 5F9AC 1IT9L 2XZCH 5EBLA 3WJJC 1T22A 1U6AH 4FFVC 5IMKB 4M7ZB 5T3XD 1S3KL 3TYFA 4AEFA 5AEAA 3X12B 4AIZB 2JB6A 5JXAL 2YSSB 4KV5F 5IGXL 1NANI 3G5ZA 3CPLB 4OF6A 1I8MB 3Q1SL 1MCCA 1CN4A 4HK3J 5D7JC 1XIWD 2VQ1A 3WO4B 4Y16B 3BQUA 5EN2B 5MEND 5EO9A 5A3IC 1LMKA 5J0BA 3GO1H 4Z7WB 2WP3O 3LKPA 3SOBH 2WQ8A 1PSKL 1TJIL 1M7IB 3UMTA 1VHPA 3SGEH 4U1LB 1ZA3B 2OS7A 5FO8B 4HV8B 1I8IA 5F1IA 3EBAA 3FO0H 2ZUSA 4J2XA 4OCNC 4QXTB 3WSQL 4ESKA 2H8PB 3N0PB 1CICC 4MD4B 3V6ZB 5TE7L 1TVHB 3E6FA 2XKNA 1RULH 3CU7A 1KFAL 3H8NA 4LVNB 4S1RL 1HDMB 4G9FE 5CP3A 1A7RL 4UUJB 3QDJB 1ACZA 2GIYA 3RBSA 4BYHA 5A2KH 5ID1B 1PQZA 3G9AB 2HMID 3ARGB 2Y72A 3O41B 1ZVSB 2F15A 4KMTH 4U1MA 5CJ8A 1L0YA 3RDTB 2PR4H 5IWLC 3W9DB 1R3LB 2C1OA 2J6EH 1Q0YL 1J12A 1JYVA 4LU5H 1JZ2A 1U92B 2BHZA 1WFNA 5E8NA 4PY7A 3HKFA 5C0AB 4N9OB 3MGOA 1RMFH 1DUZA 4WJ5A 1CI5A 3C6LA 2VKXA 1EBPA 4YXHL 4YBLB 1EA9C 3KGRA 2VLKD 3BP7B 3TZVA 5ITFA 5MENB 1FSKB 2VZOA 4IMLA 4RFEB 3T2NL 3UC0H 2JELL 1F6LL 4CJ0A 3MODL 4M4PA 1I4FB 3Q5YA 4OZHF 1JTPA 3MLRH 5B39G 3ECBB 4BFIA 2EH7H 1AO7D 3HAEA 3T08A 2F8OA 5HHNA 5KSBE 1TFHA 4OLZL 1ORQA 2NX5B 2VZTA 2CIIB 4B50A 4HKXA 2NY5C 4YDLB 2BVUA 1PKQE 3GRWL 1P6AB 3QEQD 5MEQA 4M7LL 5F1NA 3KJ6H 4XTRC 1RUQH 1QFWM 4OKVB 1WAAA 3TIEB 3QRFM 1CLYL 1OQOA 3U7YL 1IM3B 3HNVL 4PJEF 1V05A 4RIRB 5JPMB 1UXWB 3T77A 1F4YH 2FGWH 2PUQT 4X6CF 1TCRB 3WFEH 3WIHL 5IB2B 3KLAA 1NKRA 1KB5H 5EIVA 3IAPA 5DVMA 4X4YA 1NGWA 1KENH 4F7TA 1X7QA 1M1SA 3QSKB 3MGTB 3VG0H 4D8PA 4EUPG 1BP3B 4CKVX 4PJDF 2DLFH 1CFNB 1NEZA 3O6FB 4YHMH 3PWVB 4Z76B 3BP6B 1K4CA 1VGEH 4RAVA 5CINH 1IM9A 1DANT 1TNNA 4IRJB 2X4TA 4TUJB 1MCQA 1MF2H 3R4DA 4Q6IA 3GSNA 2R1WA 4PRNA 1N6QL 3MJ8B 3FFCD 1H8OA 4NOFA 2R15A 4BKLB 1T20B 4ZOEA 4IS6A 4RMTA 5MERB 4NN7B 5IHZA 3MREB 2P8MA 3HFML 5I30H 4OZFB 2Z92B 3P0YL 1EHLL 3KLDA 3OZ9H 3MACL 5KZCD 2V17H 1AO7B 2PW2B 5DRZB 2ICEB 4LKCB 1BVKA 2JK5B 1P2CA 4P9HC 2ESVA 5BV7C 5CBEB 3HB3C 4JAMB 1QSVA 3QCTL 4WEUD 3MLTB 3V5DB 4L4VD 4OGZA 3QEQB 4S0TD 4FQCL 2VIRB 5F7LB 2R2BA 1NCBH 4GKSB 2ZWLT 1ADQL 4M5ZL 3TN0D 4GUPA 2YXMA 4NDMB 2H2SD 2XA8H 1HNFA 3BO8A 4R4NC 4PP2B 2Y7QA 1ZV5A 4YDJB 2DIJA 1LO2H 1WWWX 5B8CC 3BKML 3B5GA 4ORZC 4TVPE 1D7FA 2EIBA 5CP3H 3WIFA 4K3DH 1UEMA 5C8JB 1PBYA 1WF5A 1T1YB 3IFNH 4G6FD 1MEXL 3OKEB 4TVPH 5CJQL 1DQDH 1U3HC 5E00A 5IB3B 1FVCB 4JY4A 5D8JL 3FFCB 2OI9B 4NZUL 4U6YB 4XXDB 4YHIA 4KKAC 1UC6A 2B1AH 3QQ4A 1T7VA 1UGNA 4IRSB 5FEBA 5CJOL 2P46B 1WSST 3BISA 4WHDA 3BN3B 5KAQG 1JBJA 5CFHA 5KZCB 1H9VA 1GGCH 3SDXB 1U3JA 3BW9B 4XPTL 1JI2A 2X05A 2PNDA 5GQBA 3O45A 3T0EC 2MCPH 4H1LA 3TWCH 5J13C 5I1IH 3T4YA 1L6XA 4PJ8A 1BWWA 4L4VB 3HAEH 1G84A 2BJML 3N06B 4PV9A 1QBAA 1J05A 4KDVA 1MCHA 4HXAL 3HPLB 4NPYA 4PJIB 4TUKH 5HGAA 3VRJA 4FMFA 5HI4C 3CSBA 1A1OA 2ED7A 2HH0H 4AL8H 4OZIF 3I50H 1WAAE 4PJ5B 5DS8B 5E56A 4U1GB 1CT8B 3QWOA 3VFVB 5EUKB 5L0QB 3QJHB 3B3IA 2D2OA 2JB5L 5JDSA 5F44A 3ZYIA 4Y4KC 3SGKA 1NBYA 2L7UA 2P24A 3BT2L 1AE6L 1MIML 3L95B 3TFKC 2JJSA 4M7KL 2IANA 3TLRA 4JHWL 3R06A 3X17A 1I1FB 2KUTA 3FONA 5E24E 4L29A 3O4OC 1CD1A 3FMGH 5MHSD 3RZWA 3QUZC 4CJ1A 5C9JB 1LE9A 3VFWB 1WLHA 5HHOB 1RZJC 4NO3A 1F2XK 4XVTL 3H3BC 2X10A 5E08L 4ZUVA 1Q1JH 1YJDC 1MPAL 2PTTA 3ME0A 4L9LA 4D3CH 4JE4B 3ULUL 1Z5LA 3NPSC 4X6DB 5KVMC 2F5BH 1CE1H 4P4KD 3RIFF 2FJFB 1MJJB 5D7KE 4WFGD 4Y88A 1RJLB 3BKYH 3O6KH 5D1ZC 4LLYB 2GEEA 1IGTB 4MJ6A 3X3GH 5E6ZA 2A6IA 3JV5A 3WIIL 6CGTA 2ESVE 3VXPA 2AK1H 4D0CA 1DQJB 4Z7OE 1GPOL 4OCWH 1P7KA 4BZ1L 1OGAB 4QYOA 2W60A 2E8ZA 5GS0C 5IG7A 4UNUA 5C0FA 4N5UA 3BXNB 2D4FA 1NDGA 3ULUD 3VH8A 2VL5B 2NXZB 3IJYB 2VLJA 5IBTL 3D1MC 4NO2A 4XAWH 5IB5B 4ZTPL 3RY5A 1RIHL 3NFSH 1CF8H 3K2UH 4RAUA 4D0BA 4EN3A 1OTUC 3S35L 3LKOA 5JOFB 3CAFA 3NZ8A 2E5EA 5GRZA 3MOAH 1KIRB 3BRDA 1CCZA 2XZCL 3D3VD 5HYJA 4UDTB 3BIKB 1BIHA 2FEDD 1DLHB 4KROB 1ED3B 3DGGB 1KN2H 1N59B 1KJMA 1ZAGA 3LQAH 3W9EB 4CNIA 2CDFB 1S9VB 4GSDL 2VLME 1WIOA 4KK6C 4HS6A 5C0JB 1N0XH 2XFXA 4QRQA 1A7QH 5I1GL 3BJLA 5HGGS 4QCIB 5I17A 2X09A 1NSNH 3GO1L 4U1NB 2FO4A 3SOBL 2P4AB 1YECH 1CGVA 1DLFH 4XI5C 3MRDB 4JVUA 1U58A 1AC6A 1YUHB 1FZMA 2ATPA 3EOYG 1ZLSL 1DEEA 2XICA 3QCVL 3STBA 3W2DH 1E0OB 5DEZA 3BFOA 4E5XA 2VLLB 4KKLC 4P48A 1NAKH 5FYKE 2IBZX 2EZ0D 4WDIA 1XR9A 3FRPA 3VFTB 4H1LH 3VMNA 1H3PH 3EYOB 3SGJC 3MSPA 5FYKH 4NO5B 1S5HB 4R4BA 1NKOA 1KIPA 2AXGB 5H37G 5D93C 3TVMB 3RJQB 4FQXD 1IJ9A 5MI0B 4DFHA 4KMTL 1QLRA 1HSBB 3WLBA 3L7EB 4WO4C 4H5SA 2J6EL 3KXFB 3G5VA 3QUXC 4LASH 2NY4B 4LU5L 4WFED 2BOCB 1TTGA 4BFEA 1ZTXH 3BAEH 4XB7A 5E6IC 4JFHE 3L7FB 2C4FT 3O2VH 3WNPA 1JI1A 1RMFL 1KUMA 3IGAA 5IMMB 1M6OA 2HFFA 5DD6A 3CXDH 1I8KB 5F9OH 1JRHH 4KAQL 1Z0NA 4ZPTA 3BUYA 2AK4B 4S11A 3O11A 3OJMB 4I8DA 1Q94A 4HIEB 5SWSB 2EDKA 4PREA 3HE6D 4HLJA 4F57H 4F37F 3MLRL 5DJ8B 1SYSA 2EH7L 5EZLB 1FZKB 4XPBL 3JTTB 1A9BA 1FNEB 2W92A 3ARFA 2EYRB 1KB9K 4LSVH 4N8VA 4HKBA 1ZMYA 1U8LA 5DO2C 2Z91A 3MR9A 1L0XA 2MHAB 1GH7A 3Q48A 4M1CD 3GSXA 1EO8H 4HQQH 4DVRH 4PG9A 2OK0H 1QLFB 1N0LA 1G7QA 3RTQA 2XRAH 4J1UA 3ZDYF 2UY6A 1RUQL 2PXYC 1IBGH 3UJTL 2QADB 4YFEA 1LO0H 1DE4B 3LVEA 4X4MA 3WFEL 1R3KB 2DMCA 1KB5L 4HIIA 4AYFA 1X5ZA 1TDQA 1KENL 1R3JA 1BMGA 3U0PB 3VG0L 1FNHA 4MNHB 3O8XD 2HLAB 4N0FB 3S4SB 2DLFL 3ARBA 3WYRA 3PL6B 2XQYK 2CO7B 3K81A 3D25A 4IMKA 4LSSH 5CINL 5HYJE 1HZHH 5TQ0H 3I6GA 1MF2L 1DQLH 1PFCA 2AJUH 4F3FA 5KSUA 5J9PB 1IQDB 4ODWB 1P9MA 3QUYC 1N8ZA 3NH7L 2PO6A 4G9FB 4UMGA 3PHOA 4HWBA 4EDXB 3WS6C 2Y06H 4QOKD 4NYLB 5TDNA 1IARB 4ZFFA 4RGNC 5FYLD 1OP5K 4MQXD 3P77A 2V17L 4ETQB 2Z31C 5I18H 1IGCH 1DBKH 5J1AA 2APTA 1N7MH 3GMMA 4E42B 4DN4H 4BH7A 2FX9H 3TO4B 2HJLA 4PJBF 3V79C 1A1MB 1X5HA 2NZIA 2VERN 2VQUA 3E6HB 5EU5B 3C5ZD 3UX9B 5HVWA 2O61B 5BVJA 1QOKA 4JFXB 1NCBL 5CEXA 2ZCKH 3MYZA 4CVZB 3DVNA 3VXUD 2MTPA 1JHTA 5ESQA 1YNKH 4M00A 3L9RB 3WKMH 2LVEA 3HS0A 2XA8L 3BQUD 3LS4H 1LD9A 4OFDA 3BH8B 1AXSA 1CU4H 1LO2L 5DSCB 4LVEA 5EG6C 2QSCH 5KSBB 3O8XB 3FTGA 4K3DL 3RWHB 3VWJD 4J6RH 2VZSA 1IKFH 4LEOB 3O81A 3IFNL 2Y5EA 1DQDL 1PKQB 2R4RH 2V2WB 3WFDH 3HMWH 5K9QG 4S1QH 4J23A 4P23B 1H3TA 4OJFL 2EDBA 3C60D 4K71B 4R8WH 1KB5B 3QZWA 5IF0A 4OUOA 2VDQH 1MCWM 2B1AL 3PDOB 5L8JB 1JGUH 1ZEAH 1YZZA 4MA1C 4O00A 3EYVB 4Y4FD 4RMUA 1NCTA 4M4RA 3VWKB 5FDWB 2FJGA 5EU7C 1GGCL 3O6MH 2X5PA 1MQKH 2IFGA 2EXYC 4OQ1A 2DQTH 4JPVL 1UFUA 4EI5A 3MV9D 5L8KB 1SBBA 5B22A 1IAKA 4OFYD 5H2BB 4DZ8A 3BPCB 2OTWB 1GZPA 3CD4A 3L3DA 4HPOL 4IIQB 4E9LA 5DJAB 2NTSP 4F8QA 4J4PA 5EBLB 1T22B 2DQDL 2UYLA 2UVFA 1VGKA 3TYFB 4CN1A 4RMSA 2JB6B 4G43A 1AGDA 5ECJE 1MCEA 3G5ZB 3RVWC 3VGDA 1FCCA 3PWPE 4GQ9H 4OTXH 4ZFZA 1IEHA 3U6RA 5L6YH 2VQ1B 4UQ3A 3VD7A 3I50L 4YC2C 3N9GH 3G6DH 3VXQA 3BQUB 3OB0K 2IEPA 3MCG1 4QY8B 3QQ3A 4X4ME 5EO9B 5D70H 4ZFGH 1UQSA 2HRPL 1JZ6A 3LKPB 5D7JA 1KG0A 1ZHNA 1ZOXA 3I6LD 4RFNC 3PP4L 4UZGA 3WS3A 3QH3A 2YUXA 5IEKA 4X5WA 3BUTA 3S96A 3GBNL 4AENA 2NLJA 4R2GC 1I8IB 4GKNA 1D9KD 2DOCA 4LNRA 4NBZB 5F1IB 2HN7A 4ZOAA 4NQSA 1BM3H 1SHMA 1YQ2A 5C0BA 3ALXA 4KI5C 3E8UH 2VDPL 3E6FB 4M48H 1Q1JL 4Y4FB 2XKNB 4G8IA 5C6WH 3N1PC 4LSPH 2O93L 2ENYA 3C09C 2F5BL 1CE1L 3GSNL 1CICA 3SDCA 1PQZB 3OAZH 1ETZA 5EOTB 3BKYL 3MV9B 3O6KL 1W2KT 2GJZA 3MRPA 4HH9A 3RKDD 4HWBH 4U1MB 5GRUL 4EQ3A 2VDKL 1DN0A 4OCWL 5FGRA 1UWXK 3DX8A 5E8NB 1LDSA 2QBWA 3MGOB 1DUZB 1MHCA 4WJ5B 4UBDD 3C6LB 3RVXD 5TJWK 4HUKB 1NLBH 3UBXA 3UROR 1QR1A 4XAWL 3NFSL 1CF8L 3K2UL 3TZVB 5ITFB 1YPZF 4MAYC 3MRBA 1U8QA 2EDJA 3UTZA 1H3WM 4IMLB 4NKOA 1EBAA 4GBXC 3MOAL 4C56A 3AM8C 5KN5A 4BFIB 5IOPA 5KBNC 1RVFH 2EDLA 3HAEB 3LD8C 3QPQC 5HHNB 5J6GA 1ORQB 4LSRL 2V2TA 3X11A 4KK8C 2DJ4A 4HKXB 3MRNA 1UM6L 2H45A 3SKNA 3MOQA 1CDBA 3RQ3A 3ZKXB 5MEQB 4PV8A 5F1NB 3J7HA 4LVHB 3IDGA 5MEOA 1MJ8H 1AP2A 5L2KE 1MJUH 1NSNL 5DYOA 2LFGA 3MNVB 1VCAA 1DLFL 3T77B 1KF9B 1RZGA 3KLAB 4WI9A 4NHCL 4X6EA 4ZPVA 4QTHA 1NGWB 1TMCB 4ZO7A 1B90A 1PW3A 3N85H 5CSBA 4F7TB 3KYNA 2BY1A 2J8HA 3HZMA 3H9ZA 4D8PB 1EMTH 3GBMH 1NEZB 4PP1C 2QHRH 4F8TA 1XZ0A 4RAVB 4Q58C 2X4TB 1D6VH 5HGHB 4P2RA 4NIKB 4JFFD 3GSNB 5FYKL 1SY6A 2FZ3A 3O6LH 1FIEA 5IHZB 3NCYS 2P8MB 5F7YC 1I1AD 4HZAA 3E2HB 5E2JA 1PEWA 2VXTH 3ISWA 4RX4A 4LASL 4X98B 1RZKL 1BVKB 1P2CB 2ESVB 3O2VL 3LEVH 2ZCLH 4F2MA 5EULV 3I2CL 4OIIH 5CUSH 3V5KA 5IT2H 4WIQA 3KNBA 2KZWA 3TBVA 3CXDL 5J3HC 5TE4H 4CAGA 4OM1H 1CGWA 2YD9A 1UH2A 5F9OL 2HVJA 1JRHL 2Q86A 3WEXA 5C0BE 4KQ4L 1JWMA 2X4NB 1ZHBA 4GUPB 5IJKC 3BO8B 2SEBA 4YWGH 5C07A 3RA7H 1TQCB 2IGFH 2Y7QB 4Y2DC 4BJLA 1HN1A 2VZVA 4J7RA 1EZVY 3WIFB 2HLFD 4HHAB 3LZFH 1EO8L 4GMTL 4DVRL 2OK0L 1I7ZA 3VGHA 2IAND 2XRAL 3A0OA 5E00B 4KMQA 4JY4B 5B8CA 3PGFH 5FK9A 4K3EH 1LO0L 1FP5A 3J8F7 4KTDH 4WI7A 1CFQA 2Y6SD 3TT1H 1EFXD 4L1DA 3QCUH 2K7QA 4YHIB 1UEYA 3H42H 4HCRL 3QQ4B 1U3HA 4P0DA 2MNUA 2J88H 1WFOA 1QFWI 4JZNA 4K55A 4DVBB 1CDGA 4NZRH 4Q9BA 5FYKU 3QAZB 5GRVL 3B9KD 1IGFH 3PABB 4C56E 1NC2D 3O45B 4PB0L 3LEYH 5SV3A 4H1LB 1PX4A 2I24N 1P5UA 4PJ8B 3P9MA 1U8OA 4PV9B 3FFDA 2VO5A 4FTVA 2D4DA 3GKZA 4NPYB 3VRJB 5HYEA 3T0EA 1A1OB 4D0DA 4BELD 1DEDA 1EHAA 2VLJD 3DNKA 5SX4I 1B4JH 1IGCL 5I66A 5D72H 1C5CH 2Y07H 1N7ML 1YA5A 3O3EA 1A9EB 3QWOB 4I0PC 1GOHA 4YDVA 3B3IB 5JDSB 2NY5H 4LIQE 1NBYB 2P24B 4Z6AT 3VGFA 5BOPA 2A6JA 2IANB 4LIQH 2DF3A 3PQYD 3R06B 4DQOL 3VRLE 3FONB 4LCWA 4L29B 2HFGH 1XF3A 1AQKL 2O5XH 2ZCKL 1LE9B 5HXMA 3WKML 2FR4A 2NXYB 4NO3B 3LS4L 1UJ3C 5C9KA 4P2RE 5LBSL 4ZUVB 3BPLB 1CU4L 5DRWA 1KSRA 2PTTB 5T1MA 4L9LB 1KTKE 3QUZA 1Z5LB 3CCHA 1SY6H 4Y89A 3HI1A 4J6RL 1IKFL 3B9KB 1A5FH 3BMWA 3WNOA 5E8DL 5EU3A </