1BM3H

Immunoglobulin opg2 fab-peptide complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
227
structure length
216
Chain Sequence
EVQLVQSGGGLVNPGRSLKLSCAASGFTFSSYGMSWVRQTPEKRLEWVAAISGGGTYIHYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYYCTRHAMDHWGQGTSVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational change in an anti-integrin antibody: structure of OPG2 Fab bound to a beta 3 peptide.
pubmed doi rcsb
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN OPG2 FAB, CONSTANT DOMAIN
total genus 45
structure length 216
sequence length 227
ec nomenclature
pdb deposition date 1999-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bm3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bm3H01
1RK1A 4PGDB 5D6CB 5HVFB 4U3CA 1Q94B 4POZD 5F6HJ 4DZ8B 3MRHA 3O6MH 5MI0C 1AQDA 1I8MA 5FB8B 3PQYA 4KVCL 2JJSA 4OCSH 3BN9D 2FJFB 4JFDE 3TO2B 1RFDH 1FZOA 3NIDE 4NQVA 2J3SA 2Z0BA 4QXUH 3L3OA 5ESVA 5DFVD 4XMLH 3G5XA 5C92A 2K9UA 3LH2L 1CL7H 3P0VH 3QUXD 4GW4A 4TNWK 1XH3B 3WJLC 1N7MH 3DRTA 5EULV 2P8PB 5MHSD 1RPQA 3F7VB 1F3JB 4X4XB 2DBLH 4HKBA 5CIPH 1OAKL 4RGND 5C6PB 1S7RA 4P59H 3UTZB 4EUPG 3VRLE 1KULA 4CVWA 4YDJB 2X4OB 4JO1L 3IFPA 4JFPA 1JNNH 3SY0B 4LSVH 4Z5RB 3MYJB 5D6DA 4YHPA 4J1UB 1GOFA 1S9WB 4G5ZH 1MJJB 2PTTB 3M07A 5MI0B 5CEZD 5D7IE 2HWZH 4RGNE 2MQ0A 1RUMH 1SYVA 4XNZC 5DJDB 5C0RH 3MNZA 3BESR 3HUJB 4BFIA 3TV3H 3W0WB 5D2NA 4XVJL 1N7ML 3IFLH 3PP4L 1LK3L 5BW7C 1AXIB 3QUKA 3DGGA 3OKMB 5DJ8B 1IQDA 1TIUA 3FONA 2YPLD 2CDFB 4LAQL 4F9LA 5GZOC 4QNPF 1OAKH 1M4KA 2IQAA 2FX9L 1NSNL 1J10A 2DQIH 3BJLA 5FO8A 3G9AB 3QISA 3HA0A 3U4EA 4I13B 1A6PA 2E27L 4ZUUA 5T1MA 2K3TA 4J1UA 5FECB 1K4CB 1F90L 1EEQA 2YD4A 1MJJA 2HLAA 5D70L 3FQTB 2E27H 5IWLA 3MQIA 5T1LA 2V5YA 1YMMB 4PRPD 1RD6A 3VRLF 1AHWA 1FSKC 3T4AA 5ITFA 4PRNB 3L5JA 3DSNA 1BFVH 4YPGB 4N1HB 2DQEL 5F3HB 5F93C 2CK2A 1T22A 2GTZB 4XX1G 2EDFA 2Q8BL 1T21B 3FB7A 1EJ6A 3X13A 3TEUA 1Z6JT 2OS7A 1QHPA 5CINL 5MHSE 4IMKA 4UILL 4NBXB 4K9EC 1RZGA 3MXWH 4HF5L 5F7YC 5ACZB 5JDSA 4RRPG 4WFHE 3ILQC 3QEUA 1EEYA 3VWKB 3IVKA 2H45A 1OTSC 1KACB 1OAZH 4EN3A 5BV7L 1EGJL 4PJIB 1YNKH 1T03L 2EH8H 3B2UC 3JWNC 5IFAH 5EOTB 5TE7H 2CRIA 4WO4B 1F11B 3VGDA 3NIGF 4AIZA 2AGJL 4L3EA 3ZTNH 1RHHA 4R26H 3L5WA 1JWUA 3PIQA 1TMCB 3SDXF 5JPMB 3OXRB 1UJTA 4PRAB 3PL6C 1GVIA 4UDTB 1OLZA 4LHQB 4OCYL 4WEBH 3O45A 3VFPA 3P0GB 2E6PA 4I48A 3NACL 4QHUB 4Y1AE 5J1TC 4N5EC 4PGJA 1MI5A 1U8OA 5JLZB 2OTUB 3HUJF 3MXWL 5J1SC 4ZXBB 2R2HB 1BD2B 3KPPB 4UOW0 4XNUH 3WNNA 4Z76A 4OLYL 2CK0L 1E4JA 1OW0C 3B6SA 1JZ6A 4Y4FC 3CFCH 2Y6SC 2JCCE 5EO9B 3GJFA 2AJUH 5DVOA 3VFGH 1AGDB 2OBGA 5IHUH 3IJHB 4GBXC 5IG7A 2XQYG 4JFQA 3MJ7A 1KIQB 2HVKA 3PDDA 2VLRA 4GUPA 4B0MM 2D0FA 1KG0A 2ZUUA 2DAVA 3PGCB 3FB8B 2Y7QB 5E6IA 4X8XA 2X5PA 3ZDZE 1KJMA 3GMNA 2ZOKB 2DLFL 5JOEA 3BMWA 3I6KB 3OAUH 4LQ1A 4LVNB 2A6KB 1YQ2A 5C07D 3WDHA 2HJKB 3BDXA 4RFNC 1I9RL 1M7DB 1VFUA 3PWJB 3IU4H 1HHJA 2DLFH 4DTGL 5DMGD 3DX6B 1AH1A 4AT6A 4Y4FB 4MZ3A 4U1KA 4ENEC 3P3YA 2R2CA 5MERA 1S7VA 3RBGA 3RWJB 1AXTL 4TNWF 4HJ0C 4JKWA 1BD2D 3SBWA 3O0RL 3Q6FB 2EE2A 4QLRA 3LQAL 1DANT 4F33A 1R3IH 2W9LA 4PRNA 3DXAE 1ZLUH 3LN5A 1WCQA 1HZHL 3T0AA 2D03L 4IIQC 1I3GH 2AK1H 2FB4H 1WEJH 3UBXA 3BX7C 4YIQB 4J3VA 4K3EL 2R1YB 3VFUB 1BIIB 2ZNWA 3OKEA 1ODAA 5FK9A 1OTTD 3QO1B 1RJLA 2XKUA 2EH7H 3JZ7A 3SE9H 4DVBA 3S37X 2NTFA 5KVGH 1XF4B 4QHMA 3TIEA 1CDUA 5C0EB 2D7TH 2BDNL 5FFLA 3EOYG 2ZNXA 3DROB 4MD5B 2IWGA 4ODSL 4U0RB 2E9WA 2Z31B 3ARBD 3SKUD 4G6JH 3VFRA 4KJYA 5EIIA 1VSCA 4D9QE 2YHGA 4I9WE 4JQIL 4HJ0D 1QRNE 1OAXL 2R8SH 5EDXA 3KLHC 1QP1A 3AB0B 4MA7H 3EGSA 2FD6L 1WK0A 4O2EA 4I3GA 4X4ME 3VD4A 2OK0L 4QWWC 3UTQA 5FUOL 3EO0A 3ARGA 4P5MA 4JR9L 3Q6FA 1KENH 1I3GL 3QO0A 4MA7L 3S35L 5GQBA 2IH1A 1ZV5A 1FH5H 4AM0B 3BRGC 4XXCC 1DBML 4OF0A 1UEMA 5I6XC 4I9WD 4O2CA 4XNQB 4APQC 1G7JA 2EDTA 2OYPA 1MHCA 2BSTB 3DMMD 4PRBB 1GAFH 1EXUA 4DQOH 2YC1A 1MFDL 1KXVC 4YHZL 3HUJA 1KPUB 3U6RB 3L7FA 4C83B 3TPUA 4ZO7A 5E8EA 4JQXA 3ULUF 1PQZA 3MREA 4MQTB 2DTSA 4G3YL 2VLKB 3RPIB 1FO0H 2UUDH 2XWTA 4H26B 5IBLD 3VH8A 3HAEH 4M1GL 1GPOL 2BNRA 1F4YL 2GFBA 3MJ8A 5EU7E 1HXYA 2EO1A 5T1KD 3C60C 2B4CL 5ESAB 1LHZA 4NFDA 3QUXA 3EHBD 4M1GH 4JFOB 1YEHL 5J7CC 1OPGH 4P2RD 5CCKL 4U1LB 3DV6A 4I18C 3FO9B 4EUPH 4A2MA 3O9WB 4JG1L 4XMPH 3CH1B 1MCQA 4JFFE 2F58L 3KJ4B 4KRNA 4D8PB 3MNVB 1OD7A 1YUHB 1MIEL 4Y4FA 2R4SL 2P47B 5HPOA 1RJYA 2BXYA 3PHQB 4KK8C 3L3OB 3CXDL 4AMKL 2NY1B 1X4ZA 4WENB 3EUUA 2A83A 1MIEH 4RGMB 3O4LB 1RHHB 2BRRL 4BA8A 1IL1A 4XPFL 1FL3B 1UACH 1T20B 1YEDB 3B5TA 1CDCA 4QHLA 4UV7H 1BPVA 1N64L 2YSSB 3FO0L 2HRLA 4Y2DB 2H8PA 4J3OC 1NDMB 4YZFF 3Q6GL 1Q72L 2ZSWB 2ADGB 2GI7A 5MP6L 5JQ6H 1PSKH 1Z9OA 4PYHA 3LKPB 4U6VH 2QTEA 3TN0A 2OZ4L 2EH8L 3FO2B 4MCZB 2P49B 3QAZC 2IMNA 1Q72H 4UT7H 4QRUA 1FSKB 1ED3A 4KUCD 4U6VL 3OB8A 1UZ6E 1JPFB 1XR9B 5E6ZA 5EZIL 2J6EL 5FYJU 3TVMD 1MRFL 4XWGL 1EDQA 4CVZA 5F7DA 1OB1B 3CIQA 3KPRE 3SDAB 5HHXL 1KCSL 3T65A 2LV4A 2YUZA 3BPNB 1LO0H 2OL3A 4ZUSA 3ARBA 4RMSA 3CFDA 3JUZA 4F58H 2JE8A 4OT1H 5AZ2H 4M1DL 4IRJC 2FX7L 2UVEA 1S3KL 1ZHNA 3RY6A 2HTKC 4ZUWB 1JYNA 5CZVL 4V1DB 3SDYL 3UJTL 5KVFL 2IH1B 2Y25A 2VDKH 2DJ4A 4BSWA 2WQ8A 4RMUA 5GRXG 3H9SA 3QXTA 3UCRA 3NFPB 1S3KH 1KPRB 3SE4C 4Y16A 1OAYH 2Y36H 3B83A 5HYJE 2J5LB 1FLRH 4WFEE 4G8GD 4PJHE 4OZFA 3QNZB 1IC7L 5IG7B 2F5AH 3QNYA 2MPAL 4IS6B 3N1GC 1KCUH 3W11D 4WWKA 4J7RA 1NJ9A 4WUKL 1S9VB 3W39B 3MRFB 1BFSA 2VAAA 1GYAA 1DQTA 2QR0B 1R3LB 1FLRL 2W60B 2YN5A 4ZS6D 4L8DB 2WAHA 3FT3B 3B9EA 2EDWA 4MXQD 4YDKH 1YPZE 3RWCB 4P46A 4HEME 4PJCB 4LMQE 3W82A 4HFUL 2KBGA 2JIXB 3QUXC 5KN5B 5FYKU 3SDYH 3UJTH 3TNMB 1PYWA 5D1ZC 3GSVB 1ZS8A 1QFHA 1EPFA 2VABB 2VLJE 1IT9H 1DZBA 3JXAA 1CQYA 1L0XA 1X5KA 1ZANL 2AI0H 3UTSD 4GAGL 4F8QA 3X3FH 5D2LF 4LVNC 3RWHA 1CXIA 1IAKB 2ILLA 1MCDA 3BD5A 4NC1E 1J88A 3OQ3B 5EWIL 3UDWA 3ZTJG 1TVBA 2FBOJ 1GOGA 3VWJC 1XF3B 1ZLSH 5C70A 5F96H 3OB0H 4JY5L 2N4IA 3N85L 5F89A 2A77H 2EXWC 2LAGB 3FL7A 4GKSB 5C07A 4XP4L 2Y06L 4JB9H 5IVOA 3CPLA 3HE6A 4H20L 4KQ4L 4E41B 3WUWG 1SJHB 2KQNA 2W38A 2ZUQC 3TZVC 1FL5B 2XZAL 5IJVB 3FQNA 3WJLA 4BFGA 3IXAA 2FSEB 5GGVH 1J1XL 1FL6A 5D6CA 3NAAL 5DJZA 2Y7QA 3VXRD 2HT3C 5EN2A 5J12C 2EE9A 3DUHA 4CMMB 2ATKB 1HHHB 4N8CL 5JO5B 1B4RA 1G7JB 2N1KA 2BERA 3QG6A 4N5UA 1PY4A 4NO0A 5EORH 5LGHH 3QJHA 5BZWA 4Z9KB 1CFNA 3HR6A 1ZT7A 3ULUE 4AT6B 2X1QA 4YXLH 4HWEL 5F44A 1FNGA 3VXRE 2VIRA 4Z7UE 2IALA 5DK0B 3HAEB 3MX0A 4ZPTB 4NNYA 4XPHL 1F4WL 3HS0B 4QOKE 3V4PH 4ONHB 4NQDE 3R06B 4LCWA 4WI4A 1R24A 4MB3A 3RZCC 4WTZA 3JV6A 1HIML 4KK6D 2F8OA 5IJKA 1DVFB 1F4WH 4Z7WF 1MJ8H 3P0YL 1FL6B 2DWEA 4P5TA 3FOMA 2DTML 4E41A 4HZLA 1ETZB 1VB9A 5TDNB 3SHSA 3CFIC 2AXJA 4XB8A 3U79A 4Z7QF 3ULSB 1CLOL 5GRZA 1KC5H 1DE4A 1JF1B 5CLWA 1BM3H 3HB3D 2H2SC 3ULVL 1F4XH 2IAMC 1UKQA 2W9EH 4HJGB 3IAPA 4KMTH 3IDUA 5EZLA 4X7SH 1BM3L 3DSFH 1XF5B 4LPYA 1FDLH 1N5AA 3U30C 5L8LB 3GI8H 4YXLL 3K74B 1K8DA 1D9KB 4IOIA 3MJ9L 1KCLA 1JHLL 4HS3A 3HNSH 3G6JE 4QRPA 2BP3A 3ROOA 1H3WM 3DMMB 3EGSB 1EEZB 3H9HA 3VXNB 4Z7UB 3B2UD 3ZDYF 3RGVA 1IGFL 2P7TB 4OIAA 4IJ3B 4OFVA 3EYOB 2V6HA 2F5BH 1OD9A 1XR8A 5BW7A 1EAPA 2QQNH 4R3SB 5B39A 2Q76B 2H2PD 4Z0XB 1F58L 3F8UB 4MJ5B 4BSJA 5IQ9A 3V7MA 2VDMH 2QQNL 3IRPX 5INCB 5I19H 2VH5H 3HAEG 5IFHL 1QLEL 3C6SB 4KXZI 4Y1AD 3CLFL 2XWJA 3C60B 1QR4A 3FT4A 4HKXA 3HNVL 3VFNB 5IMLB 1Q94A 4GG8B 3VW3H 15C8L 4HWBL 3ZKNC 2YA2A 4UNVA 1OP5H 3EYFB 1QG3A 2HVKB 1OTSD 4W4OC 4X6DA 1RZKH 1FGVH 2JJTC 3TM6A 4LASL 1EJOL 4P2RA 3DARA 3SDDA 1Z0MA 2O5ZH 1PQZB 1R3KB 5KZCB 1CGTA 4WDIB 2Y1VA 4L9LB 1GC1H 5DEGA 4PD4J 4W70A 5FO7A 2EDNA 4IJ3C 4NZDA 1FGNH 4HAGA 4QCIA 3ZT6A 4CJ0A 4PJHF 3H42H 4NHCL 4R3SA 4PREB 5F7WC 4A6YH 5GRWA 1J0ZA 2WZPD 4WHTA 2K7PA 3C08H 3EYUH 5DDHB 3LMJH 4KHXH 2VITB 2Z8SA 5D7JD 2VDPH 1EGJA 5A3ID 5LWYL 1P7KA 43CAB 3ZYIA 4Y4FD 3G6DL 1FQ9C 3TFKD 2DQTL 3UPRA 4IOFD 4UB0L 1T7XA 4OZHE 1NMCC 1FVCB 4ZFGH 3E6FA 2CKBA 3OR6B 3BIKB 3GSNH 1QLFB 3V0VA 2EEDA 3F12A 3CDGB 4PRHB 4AIXA 1S7SB 4YFLF 5D7IA 5DD1H 3BKML 3ILPA 4LCYA 1KNOB 4F80A 4AL8L 2R29H 4X4YB 3TVMB 2ED8A 1MPAH 3DO3A 3ZMRA 1NAMH 3KPTA 3O4LE 1YMME 4HX1B 5CP7B 4AG4H 4F9PA 1QNZL 1I3RB 1M71A 5JQHC 1RUKH 4BQ6A 2GJ6E 2XRAH 2CJUL 2OCFD 2EC9T 2R2BB 1D5ZA 4WW1A 3HPJA 1Y6KR 2OXHA 4C59B 4OAWA 4Z8FH 1J5OH 1ACYL 1HKFA 1FYHB 2YUVA 4MHHG 3H9HB 4EIGB 2ADJB 1JZ4A 3S4SA 4UTAL 1CFVH 2X4SB 4KPHL 1H8NA 1DR9A 1TLKA 3DECA 1R5VA 4FMKA 5SWZD 1BFTA 1I3UA 5BO1H 1NC4B 4MLSA 1CFVL 1A7BA 3GSNL 3G9VA 1DUZB 3B2VH 4HG4K 3O3AB 4YX2L 1CT8A 1KCRH 4ZTPH 4L3CB 3HE6C 2HTLD 3PWJA 2QHRL 4U33A 5C09D 4MGXA 2ATKA 3RL2A 2K7QA 5DUML 1EMTH 2PYEB 1S7TA 2AXFA 2I5YH 4Q6IB 4GKOA 4P2OB 5F72S 2VZVA 1BVZA 2LVEA 3MV9E 3H3PH 1KIRA 3ORJA 4AG4L 1XGRB 5MEPA 1RUQL 2NR6D 5CZKA 1G6RA 5GGSY 4WWKB 3WLBA 4YHOL 3PJSB 5GGUA 4P2RB 3CU1A 4HCRL 3HAEA 4D9LL 3MNZB 1A1NA 3G5ZA 3L3HB 4ONHA 5BRZD 4U1SA 2XFXB 3NFPA 3MGTA 2HRPL 2ZJSH 5HYJA 4RAHA 5KJRL 4Z76B 1YJDC 3U46A 4OM1L 2GITB 3B9DA 2YMXL 5JLZA 3W5NA 4DAGH 3UTTE 4NQED 3L7EB 4D9QD 4KJYB 4MS8C 1MRCH 3NIGE 1G6RB 3SQBA 5HGHB 2JCCB 4ZFOA 5IVXF 3HG1A 3T3PF 5D7IF 3NZ8B 3L95B 4P2OA 5EU3B 5JW4N 4NZTL 3GHBL 3HR5A 4NZUH 2OL3L 1G1CA 3JWOH 3ZL4L 2HMIC 4R7DB 4I3SL 1UWGL 1RZ8A 1XZ0B 5SWSD 4NBYB 2NX5B 4WFFE 4EXPX 4Y4HC 4LRIC 1OSPH 3GUTA 1G7PA 2ARJB 4MD4A 1N0XH 1RK1B 1T1YB 4PGDA 2O5XH 1OF2B 1NDMA 1Z9SA 1X5FA 5L2KE 2YZ1A 3MRKB 3MRHB 3LEVL 2NNAB 2RIKA 2APVA 5F88B 3S88L 2W9EL 2AJSH 1I7ZB 4GRMA 3SY0A 4LRNL 3FO1B 4CMHB 4NQCE 4EDXA 4M62L 1W0WB 1T0MA 2AEPL 1U58A 2DLIA 2I9LA 4G9DA 2E9JA 2AJSL 3WFHB 4Y4KC 4AEEA 3SDCB 4XTRD 5IEHA 1UADC 4N0UB 4M62H 4S1RH 4M7KH 5EIVA 4LK4A 1A1OB 1IMHC 2PETA 1WAAE 3ARBB 3DWTA 1XCTB 2DYPD 4PJHB 3DV6B 2FR4B 5FXCH 4D0CB 2YPVL 1PKOA 2VB5A 3BWAA 5E0QA 3UZVB 5KVDL 4YAQB 5AYUH 2I9TB 1NDGB 1JPGB 3O8XD 4U6TA 4NDMA 4M6MH 5FO8B 5D93C 1BREA 1IC4L 2YZ8A 1GZPB 4ZUUB 5T1MB 1MHEA 3RVTC 5JMRA 2ZUVA 25C8L 3ULSA 4ZD3H 3V4VL 2FHFA 2BY3A 2NY1C 5HHQA 3O2WL 3LY6A 1I1FB 3MLTA 3O6ML 4K71B 1NPUA 4EN3D 5D8JH 3O6LL 1NFDB 3HZYB 2DICA 2A38A 3BKJL 3TNNA 4BFEA 5I1KL 1UVQA 2OJZL 5HHNB 2JKXA 4Y2DC 5D8JL 1HDMA 4R7NA 4U6YB 5DVNA 5C7XL 1MWAL 3DIFA 5IVZA 1U8KA 4M93B 4M43L 5SX4I 4WJ5A 3TBVB 3A6OA 5FGCE 2F8VA 5GGTL 5D1QA 3HE7D 3OR7B 4X6FB 1AR1D 1MWAH 1XR9A 1BEYH 1S9KC 2QHLA 5IB3A 4GG6E 1F2XK 4JO1H 4M00A 5IF0B 3GSXB 2RCSH 1CCZA 3SGDI 4FABH 4NPYA 4LSVL 2WIMA 3IDNB 4M48L 2HVJA 4OFKA 3MA7A 1EBAA 1QSEA 3KDMA 2DDQL 3NCBB 4H8WC 5EOTA 2VC2L 4FABL 5DRNB 1J0HA 4PJBF 3L6FA 5D7KE 3BRFA 3IJSB 4ZTOH 2EZ0C 2VLJD 3AROA 3LH2H 3P0VL 3TBWB 4MNHA 4RFEB 5F71A 2R4RL 4X9BA 5FKPA 3LEYH 3V5HA 5J0BA 5CLTA 1U36A 5FK9B 4PP2A 3MRDB 2XOTA 5TFSH 3VFUA 3TWCL 2R4RH 4NNXB 1XR8B 4Q6YA 3ULUC 5E1AA 4P48A 4G43A 4IM8A 2C3VA 5KANG 3W81A 1YEKH 1TTUA 3I50H 2ERJB 4W6WB 3VGEA 5I71C 3H7LA 1JNNL 3IDYC 4JY6B 4H1LA 3D2UA 3JV5A 2NLJB 4N0FA 4EBQL 4JFDB 3OGOE 1Z5LA 1WWBX 3MRLA 5ISZD 4G5ZL 4NO2B 1X4XA 3PUCA 2W07A 3QIBD 3VE0A 3FTGA 1IKNA 5JIKA 3MOAL 5FYJD 4D0DA 2FIKA 1NUFA 5JIPA 3VI4F 3LRSB 2C1OB 2JIXA 3EOAB 1MCPH 2E7CA 2ED7A 4XPBH 2BSRA 2CO6B 2VXUL 4FQQB 4HQQH 5TQ0H 4C4KO 1EFXA 3B5GA 5GISH 3SDCD 4I0PB 2MCG1 4TRPH 1JZ5A 5ERWB 5AG9A 2IQAB 2D2OA 2XTJE 3W2DH 5DFTA 5CINH 4HS6B 4O51A 5D96B 1ZLWH 5GS0C 5GZNC 4DCQB 5KSBA 4P23C 1L7IL 4O2FB 2V2TB 3PQYD 3UJJL 5DHVA 4LHUD 5CD5C 1VFMA 4LGRB 1A9EB 5ILTL 2YK1L 1NUDA 1L7IH 4FTVE 1EUTA 2XY2A 4KI5C 5TDOB 1S78C 1TPXB 2FGWL 1MHEB 3GK8L 4XVTL 2F53A 4OD3L 3TBSB 1T7ZA 1NKRA 3QEHB 1EGJH 1S9XA 5HDLA 3U36B 5BOZG 3RJQB 3CGTA 3LRSA 4TOYL 3IETA 3AAZA 3DLQR 3GK8H 5GSVA 4HC1H 4UIMA 1IJ9A 4EDWL 4HD9A 4HIHA 3U4BL 5JTWA 1RZ7H 2QQLL 5E2WH 1FCCA 2PUQT 4MX7A 5T1KB 2X41A 4X0KA 3TGXA 2QSQA 5K9OA 5C0BE 3WEXA 3UZEA 5J12B 1CF8H 1MF2H 4L8CA 3WS3B 1CGXA 1AY1H 1G9NL 4XHQA 1F6AA 1A6ZB 1IRAY 3ZE2F 3WFZA 5I15L 4BH8B 4GMTH 3HZMB 3RAJL 5DJ6A 3SE8H 4RMTA 3HE7A 2AKRA 2P48B 3QEGL 1G9MC 1VACA 3CFCL 2AERT 4QO1A 3WMSA 3GGWB 2AGJH 4HKXB 1A9BA 1FN4A 1G7PB 2PYFA 3RUGF 4XMKH 1L6ZA 1OVZA 1ROWA 1EHLL 4G42A 2IADA 3MJ6A 1WLHA 1G9ML 3BJ91 1WVZA 2HKHL 1NAKH 2DQCL 2P5ED 3BPCB 4HDIB 4UDUB 4G43B 5T1KA 4BK4A 4X6BA 3RWEA 4QKXB 1A6UL 4KZDH 2X9YA 3IKCB 2HG5A 5DT1L 3SDAA 35C8H 3OWEA 4IRSA 2F54E 3IDJA 4KZDL 4D0DB 1D3CA 4ENED 5BV7H 5SWSA 1XF5A 4GRLA 2VAJA 3FTGB 5I1DB 3CLEL 1NCCH 4X80L 1PBYA 5F1NB 3TESA 1NCBL 4HK3N 5H2BB 4JFFB 1D5XB 3NCFB 2X4OA 3QIBA 5AYUL 3CLEH 1P6AB 4TTGA 3WHE1 3HZKB 1P2CA 4YBQC 4DGIL 4R97C 2JIXD 2V2TA 4LCIH 4NKMA 4JRWA 4GOSA 1JP5A 5C0CA 1U3HA 2UVFA 5C9KA 2EDOA 3IXAB 5GGQH 4PJDB 4XH2B 4LCIL 4JFZH 5D1QC 1EEYB 3VWKA 1IQWL 3TC9A 2CD0A 5AAMA 1JPTH 4MQ7B 3UPCA 5HXMA 1G6RL 3MLVH 2VERN 3FAWA 3O0RH 1HYRC 1H3GA 2E6JA 2GAZB 3QHTC 4OZFG 3GSQB 4XP1L 5C09E 1ZKAA 3L3IA 3LZFL 1R3IL 5F9WB 5C7XH 1NCCL 1M6OB 5ACLA 3HRPA 5E8NA 4UUJB 3RVWC 5TF0A 5DK2A 1TZGH 1A3RH 2DJSA 3O2DL 3RDTC 2P5WA 1VADB 2RFXB 2D7QA 1P7HL 3LV3B 5D9SA 1FORL 5EO1B 3QDJE 2APXA 1KTRL 1FH5L 2ZSWA 2FL5A 1CWVA 3GSVA 3S97C 2R69L 4PJFE 3U83A 4L8BB 1UM6L 3QJFA 5IW3A 3V6FA 2YUWA 2R69H 2XKNB 1NMBH 1XIWA 2F54D 4H25A 4UT6H 3V5KA 4CUCA 1P6FA 2Y5TB 5KOVC 1D5BB 2IPTL 3FN0L 2XA8L 3NOIA 1G7QA 3TO4C 3CFJA 4YXHH 5CJ5A 2BC4B 3SE3A 1P4BH 4M5YH 4M6OH 2VSDA 1KG0B 3U9PL 1JI2A 1FFRA 3B9AA 4GAYA 3P73A 3P40A 1RZJC 3QULB 3DUSA 3E8UL 4OLEA 5K9QI 1C5CL 1Z0NA 2B20A 3IDXL 4A2LA 4G8IA 2W0PA 2D03H 5KVMC 5FO9B 4P59L 4PJ5A 5I18H 2NY5C 2CXGA 4OLZH 3T0EB 1EUUA 1I1AB 2GCYA 5MENB 1SMOA 3ESVF 2CKBL 1U8KB 2WK2A 1NKOA 2Y07H 2PXYA 4DKDC 2WV3A 4Z78A 3X11B 1GAFL 3CVHB 3CX2A 1DQDH 1KN2L 2MOVA 1L9NA 1A3LH 2VXQH 5F1KC 1YMMD 4PRPB 5EUOA 3QUYB 1NMBL 4RWYL 1QRND 1JNLH 3KHQA 1RURH 5E8EB 2BVOA 5I16A 2CIIB 1E6JL 3T1FA 2NXZB 4UDTA 1U93B 3PWNA 1IGMH 5C2BH 3O9WD 4X83A 4MD0A 5L2KB 5IB1B 2IPUK 4P4KA 4ODTH 3ZKXB 1QSED 1UB5A 2DLTA 3U9PH 4FQJH 3ZE0E 3ZHDA 2XQYK 2HFFB 4B41A 1QR1A 4WGWB 2VN4A 1OGAE 5DJ2B 5INDA 3WFEL 4FNLH 2CLVA 2GCYB 4MYWB 4JO3L 2DJUA 1T1YA 4G8IB 2FJGA 3DOSA 3RIAK 2Y07L 1DL7L 3JSSA 5DMYA 5IHBA 3MV11 1N59B 1VPOL 2IBBA 4XPTL 5D70H 2UZIL 3DBXB 5DMIH 4WFFD 5JW4Q 4B7IA 3MA9L 4U49A 4MQXD 5HGBB 1UCBL 1MNUH 5I1GH 1PG7W 1C16A 5EU6A 1GGCH 1WWAX 3STLA 4NUJB 1AXSB 1HXMA 3BYTA 2NXZC 1LO2L 2VR9A 1KXTB 3CC5A 1HHGA 4YHZH 2E9BA 2J1KA 5J6HB 1TPXC 3MLUH 3EDFA 2H1PL 3CX5K 1YQVH 4MNQA 2FJHB 3DMMA 1N64H 4LGPB 3X3GL 3QXAB 2P46B 4LSSH 3Q6GH 3GB7B 5C0FA 3LPGA 4JZOA 1GGYA 3SE8L 3BIKA 3OR6A 4GS7B 1AIFA 4KRPB 4APQA 4LSSL 3IT8D 3CXHK 3ZKXC 1YN7B 1DN2A 3CVHL 5GJSL 2VLKA 1I1AD 1TITA 4JHBA 3R8BB 1OPGL 4CVXB 1NGWA 3S34H 3LN5B 2D3VA 4PJGA 4I5BA 3CVHH 3MREB 4OZHA 2Q87A 1KPUA 3WKNA 4M8QA 2VZSA 5D5MA 1U8MB 2ZCLH 4HKJB 1MRDL 2VLRD 4GRLB 5I8EA 5TF1H 4ZPVB 4HXBH 3IGAB 1WAAF 1M71B 4YBLC 3VGAB 3Q1SL 1HDMB 1XIWD 5CMAA 5FKAB 1NAKL 2YPKB 1QTYT 1N4XL 3QXDA 4D0BB 3CJJA 4LVHB 3MRRA 5HJ3A 1UM4L 3WHXB 1AGFA 3RWCA 3QIUB 4JPVH 4U1LA 3MLRL 5I1LB 1QBLL 2VN7A 4JFDD 3RVUC 4DKEL 5ABDE 3QUXB 4FP8L 1LNUA 3QIWD 5C09B 4UMGA 4Z78B 3EOBA 1NGPL 3PXHA 4IDJL 1CL7I 1U8PA 3BKYH 4V2BA 1PEWA 3F58L 3RZWA 3PGFL 4LLDB 4LLWB 4PGBB 4HWZA 4PJ8C 3MJ7B 1ZGLB 4JFFA 3NIFE 4J4PC 4YDVA 1UXSA 1X5IA 1XGPA 1ZLUK 4Z0BH 2NXYC 3MRDA 4JCLA 4RIRB 4GW5B 2YS4A 2L7JA 2A73A 5C07B 2PCPA 5FOBA 5EG6C 1HK6A 1A1MB 3ZTJH 3BP7A 5C08B 4RGNC 3OAUL 4OCMC 5D1ZD 2VZTA 3OJVC 5GHWL 4LLQA 3QXDB 5A2LH 5CSZB 4HBCH 1EAPB 2Y72A 2VE6A 3MYJA 4XGZA 2BXZA 3SGKC 3QXWA 2I24N 2WP3T 4HBCL 4QRUB 4OV5A 2RBLA 1ZHBA 2HKFL 2OP4L 4ZS7L 4F3FA 3F7PC 4QRPB 4JR9H 4OLWL 1BJ1J 4I3RH 1J8HB 1IC7H 2XN9E 3K0WA 4P2QA 1D5ZB 3NVQA 4RA0C 1DBMH 4WJ5B 1SJEA 4HH8A 4H20H 1PW3A 1KIPA 3D85D 5FOBB 3JTSB 1MCOL 5AZEH 4GRLD 3IDMA 4K8RC 4NZRH 3QWRA 4PJGF 4YDKL 2NTFB 4EOWL 1E6OL 4Z77B 1AI1H 4UOW1 4KK6C 2X44D 4Y5VA 4ZAKB 1ZTXH 4JKPL 5L0QC 5E7FA 1FJ1B 1JZ2A 3QNYB 3MRMA 3FOMB 5D71H 4X9IA 3UAJC 2NY6B 4TUJB 3ZDZF 2DQFB 3W39A 1D5MA 2WM0A 4JDTH 4JDZA 4I4WB 1I8LC 2C26A 2LAAA 4JFQB 5EOCJ 1Q38A 1T5XB 2APBA 5E9DD 5IV2B 3GBMH 5L2JB 2UYLB 1T89A 5DQJA 5C0IB 3S5LA 1ACZA 4F15C 1DBJH 1S78D 5D7KD 1I85A 3D0VB 1HQ4A 1K9TA 5CD5D 5GSVB 2EXYD 1R3JA 3QDGB 3QI9D 4WU7A 2OR9H 2XZQL 1D9KC 1U41A 4UQ3A 1MLBB 4H88H 1CG9B 1DDHB 4EJ1C 5L9DH 1K85A 1M7DA 4JG1H 3RNKA 5I1HH 2V5MA 4ZSOE 1GCFA 4AH2A 4GQPH 3RVVC 4M8VA 2G2RA 2ZCKH 4PJXF 4OCLC 1BBJA 4Z77A 4QRRB 3PF2A 1LK2B 2WLZA 4DQOL 3BQUC 2IQ9H 1V5JA 4CRPA 2HLFC 1IE5A 3TO2A 5E8DL 1ZEAL 4S10A 1K8DB 2NZ9D 1A9BB 3KPRB 3C9NB 1N8ZB 3HCVB 4RMWA 1MFAL 4AIZB 3VXSD 3NA9H 1KFAL 5HY9A 4QHKI 3V52L 3L5HA 4XP9H 1YNLH 4P99A 5GGRY 4LVOB 3VFNA 3VXTB 2BNQB 4NO5B 5EFIB 4PS4L 3CSGA 1GIGH 3FOLB 3NCJL 2OSLB 1OM3L 3V52H 4L4JA 3T3MF 2OM5A 1BJ1H 3FMGL 3IFPB 1DL7H 5I6XB 5FF6A 2YXMA 4CMMA 1U8OB 3GKWH 4JO2H 1OM3H 3RWEB 5DJZB 1EZVX 1HWGB 4GT7A 5CSZA 3P0YH 2XXMB 5FCUL 5ESQB 1MFCL 1ZSDB 5B38G 4LNRB 2YRLA 4NUJA 2NY0C 4IDLA 4LCWB 5H37G 4P4RB 4TVPD 1FYTD 3QWOB 1U58B 2XTLA 1Z3GH 1GGTA 5IBUG 3C2SA 4WNQB 4PV9B 3HNTH 3PGDA 5E1HB 5AUMB 2WUBL 1MFEH 3MBEB 5JOPD 2B2XH 4P5TD 3SKJH 1HCFX 3EAKA 1QSEB 3O2VH 4XP9L 3I3EA 4N0CD 3OAZK 1XGTB 5LWYH 5EOCH 1T2QH 2WBJB 2GSIA 2WWMD 2B0SL 3H9SD 4NDMB 2F5AL 1S9YA 2IGFL 3FFCD 1OT2A 4FZ8L 2C3HA 1UT9A 3H42L 4KAQH 1J0IA 1KJ2L 1LD9A 3EFFA 5F7FA 4BZ2H 4ODWB 1S7UA 5SWZE 1A7QH 5JR1H 3REWA 3RIFF 4WUUD 3LKSB 2NW2B 5SWZB 1K5NA 4MQ7A 5HYQB 3T65B 2O61B 4BZ2L 2IANA 2DL2A 3TYGL 1CLZL 1IAOA 2XQBH 1A0QH 3BT2L 4XPAH 2C1OA 4ERSL 1KCSH 1FBIL 5EU5A 4MJ6B 1UM4H 4HMCA 1I8IB 3C2AL 2MSPA 1OB1A 5B8CC 1QEWB 5K59E 3CLFH 4PJIE 5ID1A 3C6LA 4J2XA 1EBPA 1HHKA 1I8KB 1RZIA 3V9FA 5DRXB 4LU5H 5E5MA 3QHFH 4N0UE 1JK8A 1IZJA 1OTTC 4CL7A 1UQSA 2ORBL 4NKIH 4BQ9A 2X40A 1FV1A 3BUTA 3VD3A 5IMLA 2Z92B 2Z35B 1B4JH 4NN5C 5JNYA 2L0DA 3DXAB 2MCPL 1Q9OA 1QUNA 1PEZA 4O02L 3GSRA 4QXGH 1IC1A 4KHTL 4LSQH 5CEZH 4ZTPL 1C5DA 4QTIL 4ELME 3QAZB 2IFFL 5DUMH 3ILQD 4ISVA 4MCYA 4QXGL 3S35X 1QO3B 4XVSH 1GJIA 5E6YA 2HJFA 4P2OC 2X89D 5DRNA 2ZOLA 1P7QA 4P2QB 3V8OA 1F02I 2D31A 3NTCH 4MNQE 1I9EA 3QIWA 1MREH 4MX7B 2A9NL 1KYOK 5DEZA 1OHQA 3HZVB 4G9FB 1GGIH 2OSLA 4XT1C 3TT1L 1IEBB 3FO2A 1W0WA 3BZEB 5E4EC 2EDLA 3D6GA 5BZDB 4MB5A 4XI5D 4TSAH 2NXYB 1GGIL 5IFJA 1IM9B 3VRIB 4J3UA 1TVDA 4CADB 4PV8A 5IW6B 1WBYA 1G84A 3LEXB 2C4FT 3BDYL 4XBEL 3RP1A 3FHAA 2C3WA 3DURB 5DK3A 4AQ1B 2IFFH 3BKMH 1RJCA 4D3CL 4F2MB 3PJSA 2BOBA 2KZWA 4L29B 4XVSL 1F3RB 1NEZG 3F7YA 4PIRF 5EC1A 4YK4C 1C5DB 1OLLA 4XVUD 5TDPB 3MBED 4OZIA 3PWNB 5GS0L 1PG7X 3OJ2C 1NGQH 1JL8A 4ZFOB 4Y5YA 2G75B 5ERWA 1QLFA 1Y18B 4YDVB 5FIEA 5LGKA 2HFGH 5LKNA 3KXFE 3ISWA 3TA3C 4PRBA 5CBAB 1NGQL 3O41B 4OFYA 4PJAE 1ZLVH 4KPHH 3G5VB 1FIEA 1KCVH 2DMKA 2PYEE 1LEGA 4FMFA 4PJGE 1N59A 4GKZB 1H5BB 1NUNB 4EEEA 4R4FL 4NP4H 3SJVD 1WQVT 3U7AA 4DAGL 1I7TB 1QQDA 2DWDA 4R2GC 4JFEA 2HT2D 4K94L 1CGVA 4NRZB 4XZUA 3IDJB 1B0GA 1I7UB 5DJ0A 2BVUA 2MWCA 4X5XA 4H5SA 4AK1A 3P4OB 5SWZA 1TZIA 4Y4KB 4GAFB 3D5OF 2QQKH 1G7MA 2CDFA 2KDGA 4HMDA 4M6NH 4NZTH 4JQXC 4N0UA 1X5XA 3SJVE 1NLBL 3QRFM 2BNQD 5TDPA 1BWMA 5DURB 2YPLB 3ARGD 5J9PA 2EE6A 2Q3AA 4JY4B 4LCUB 2ADGA 1YEGH 1RVFH 4DUWA 4LSUL 5FB8A 3HN3A 3S37L 4GRWB 1IKFH 3QUMB 3GSRB 1KT2B 3F62A 1UWXH 3UYOD 3C5ZC 3DUUA 2WUCH 4MJIA 3DXAA 4APQB 1TCRB 3EHBC 2A9MH 3CK0L 4PUBL 4JPWL 4YXKL 2EIEA 5TE4L 1N8ZA 1NEZB 3A67H 5GGTA 3CFBA 4KJWD 5DD5L 3O4LA 1KFAH 1IC4H 1QFOA 4Y5YC 1Z9LA 5DJ6B 4M7LH 4HW6A 4XAWL 1CGSH 2EDKA 1JWSA 5L6YL 3VFSA 2O5ZL 1LO4H 3WXVH 3OKLA 4HWBA 6CGTA 1IEHA 5TPWL 3PWVA 5HYJD 1GC1L 3P77B 4KROB 1NANH 4KK8D 4PJXB 2VLMD 3T4YA 3WHE0 2E5EA 5E6ID 1J12A 4NKOA 1MVFA 2DI7A 5SV4A 3CVIH 4PYGA 4NRYB 1AKJD 3EDJA 4BM7A 4NQEA 5C0AB 2F5BL 5F3BA 4J3WA 1YNTA 3GJFH 4HIEA 2EICA 4M43H 2EDDA 5EC2B 3EZJB 3VFMB 3QJFB 4WCYH 2BY0A 1MFBH 4M9PA 2RHEA 2OTWA 3HI1A 3QNZA 4GRWF 2A1WL 4KVNL 4URTB 4EI5D 1NUGA 4YIQA 1RZ8B 1XZ0A 4K3JL 2DQJL 4YBHA 1JCKA 5D7JA 1LO4L 4JANB 4ZFGL 3LCYA 1T2QL 1ORSA 1NGXB 2ZG3A 4NSKA 4HS6A 4O51B 1TFHA 3BHBB 4WIQA 3TN0D 4LASH 3QEQB 1XF1A 1QEWA 1R3HB 2ICWI 4G8GB 4HV8B 3F7QA 4OGAC 5IGXH 3TBVA 4N0YL 3MACL 4X98B 1G7LA 3BIAX 1WUNT 3ME0A 3NN8A 5ETUB 3QFJB 2Q6WB 3I9GH 4N9OB 1IBGL 1BD2A 1CT8B 5HI4C 1UWEH 5IK3B 1ZA3B 3CVHA 3GIZL 4HKZB 1BIHA 3P9LA 5TJWK 4R4BB 1YEKL 4PJ5B 5E2UH 3B9KC 4WV1C 3WSQH 4QRSA 3QP3A 2I27N 4Z8FL 3MYZA 4PJAB 4O2EB 1KJ3L 4L1HA 1EIBA 4XBPA 1U9KA 3GNML 3UMTA 5EO0A 1MCSA 3NH7L 4L4VB 4WI3A 5DTFA 1NBZB 3BZFB 5DHYB 4FTVD 1WV7T 3L3IB 2IPKB 2IFGA 4IRSD 1TTGA 1FN4B 1JZ7A 3P4NB 3GSOB 1WWWX 1WFTA 4XPBL 1RIVH 4YHLH 3MRQB 5F9JB 4JY4A 4EN3B 5ACZA 5C6TH 4OKVA 3H3KA 4BH8A 1QBMH 2AXGB 2HJKA 2VZUA 4MJ5A 4F37K 1CICD 1F8TL 4Y2DD 1T04A 2RAMA 3TYFB 2QEJA 2IAND 3RWIA 5D5MF 4ZODA 4L9LC 1DSFL 2VDOL 1Q1JL 2FEEI 3VCLA 1VDGA 3RJDA 4KC3B 4YPJA 1MCRA 3IXTB 5KVEH 1KJVA 3PV6A 2F9BT 5EUKA 1DP0A 1QSFD 4HWZB 5EBMA 3PL6A 3QWQB 4Z7WE 5DHVH 4E42A 3GNMH 3CCHA 1TNMA 1R6VA 1WC7A 4XRCA 1AE6L 3OKKB 4RAVB 4WO4A 1A7OH 4AYFA 2ADIB 2VR4A 1NFDF 4Q9BA 3VFVB 5KS9F 4U6HA 1FO0A 1H3XA 4IRSC 4KUCF 4KUZL 2RR3A 4KRMB 3D39A 3BEWA 4EDWH 5K59F 2EXYC 2VWEE 4ONFH 3BMVA 1A8JH 3KPPA 1QSFE 3VXSE 3QQ9C 3LEYL 4KRPD 5IQ7H 2E7HA 3BW9A 4OZHF 5GZOD 3O4OC 4D3CH 1NSNH 3HB3C 3W0WA 2V7HB 3MV8E 4Y88A 1YN6A 3KS0H 5GGRB 4JDVA 4X6DF 4I5BB 5HHOD 1TVHA 1KIQA 5F3HA 4CN4A 4JANA 3RKDD 3INUH 3LKQB 4KZEL 3LN9A 5DJXA 5I0ZA 2Y5EA 3OMZA 2QSVA 3GMLA 3LIZH 3GGWA 3RTQD 3BEWB 1D9KD 2N7BA 2I9TA 2HFTA 3C8DA 4MZ2A 2V9TA 4AM0A 4PJHA 4OIIL 2E8YA 1HOCA 1B3JA 1IAII 3O6FB 3U82B 2AK4E 4QRRD 1BECA 3UTZA 4RQQB 4JDZB 1BAFL 1ITCA 1D5IH 4JY6A 3WHXA 1T2JA 1A6ZA 5JXEA 4NKDB 2Q86B 2HKHH 4KTDL 5BV7B 5EZJB 4Y8AA 1RULH 3TV3L 1DFBL 3RNQA 5AD0A 4LQFL 1YN6B 1D5IL 1BAFH 1T1WB 1ZVHA 2X4TA 2EYSA 3KR3H 3OAZH 3WYRA 4BFBD 1TJHH 1QKZH 1QO3A 2F74B 3DI3B 5ILTH 2BY1A 5E99H 3KPOA 4NO0D 1YYLL 1QLRA 1YNKL 4WI7A 3VFSB 4PGEA 3ALPA 1SEBB 4LPCA 1T89C 3JWOL 4OGYH 3O6FD 4JVUA 3NCMA 3OKEB 2BRQA 3OF6D 4M6ML 4JRXE 1IKFL 3QDGD 3QI9B 3BO8B 1YECH 3RGHA 3TH3T 1YYML 2DQCH 3PP3K 3TBTA 2IMMA 3QXAA 5D7JC 2H3NA 4NFCA 3Q2CA 1RZ7L 5DD5H 1VEOA 3CUPB 3QUYD 2F53E 4X7CC 1TXKA 4K7PL 1A4JA 4RAUB 3RX8A 1GGBL 4DN3L 4KKCD 1DFBH 3SKNB 1MF2L 5HDOA 2WWKT 1BQHG 3HMXH 1CBVL 3PWVB 4YEFA 2VJXA 4RFNB 4X5WA 3TJEL 1IILE 4JN2B 4Q7DA 4ZPTA 4FXLA 4PJCA 3ZKSD 3GHEH 2DB8A 1NCAL 4WW2A 2YPKA 3BGAA 2M26A 5CHNA 5DEGB 3NFNB 3CVIL 2R2EA 3IGAA 2D7MA 4OGYL 2XFXA 5BOPA 3MRPA 1R3HA 4G8GA 4HV8A 2EDXA 2P5EE 4IRZL 3RI5K 2Z92A 3QDAA 2ZCHL 4Z7VF 3K8KA 3W0WE 4JG0H 3PDOA 4OI7A 2CUHA 4TUJA 3AFLA 5D7SH 1E0OB 2V7HA 1KF9B 4PLJC 2NY0B 4F57H 3OG4B 5LQBL 2VITA 4JDVB 5I1JH 4ZTOL 4OCYH 4YBQD 4OSUH 4DTGH 1BX2A 5T5NF 1LP9A 4X4ZA 1ADQL 5ESVB 3N1QC 4OCRL 3DXAD 2Z31C 1VA9A 5F7KC 2EE3A 1AXTH 1IGIL 4ODXB 1G7LB 3UTTD 1V7NH 3CMGA 1BIIA 3OX8B 2J88L 4OCRH 3V7AE 2DQHH 2WBJC 3GSWB 3N9GL 3D0LB 1CD1A 1WTGT 3KPSD 1RZJL 2ICWJ 3UTSA 4NQCA 3O45B 4HDIA 2ZKHH 1MEXH 4F8TA 2AK1L 4JGJA 5D93B 1F00I 4GRMB 4K3EH 1BBDL 5HD8C 3BZEA 1T0MB 1AIFB 5GRYA 4HULB 2VE6B 1YN7A 2ESVE 5ICZB 2XWJB 3C60A 4PLKD 5E2TL 3ULVF 3V6BR 2GTWA 3SDXB 2DDQH 3MGAA 4QHLB 4E5XB 3VG0H 4UT9L 2XA8H 3A6CH 2DQGH 1SY6H 3J8F7 4YWGH 1KLGA 1XF4A 6FABL 1WIUA 3DO7A 2A0LC 1J05A 4JRYB 3ARDD 2FCBA 2UZYB 1CZ8L 5EU4A 3T0VA 4JFFD 4M4RA 3FB8A 4FFWC 3UJJH 2Z35A 3ZHKA 2OK0H 5JW4M 1QSVA 5D1XC 3MV9B 2WANA 3AS3A 1KV3A 4EIZC 4LKCA 4QY8A 2CLRA 1FZJA 2VLLA 5HYSA 4G6MH 1GZPA 3LQAH 2X4NB 2YXFA 2CKBH 1AGDA 2A6DA 2DMBA 2X1WL 5EPMA 5B21A 4YGVB 2BMKA 3GMOA 4JO3H 4NRZA 5D1ZA 5E8NB 3STBA 3ET9F 1HQRB 4FG6D 1QQDB 2DWDB 4HT1L 5DR5H 3QHZH 1P7QB 4MS8D 1JNLL 3KYKH 5L88L 1T5XA 5IV2A 1E6JH 3IFNL 2J4WL 2XXCB 4UT9H 3MLXH 4D0BA 1RHFA 4JN2A 2AEQH 2MHAA 1UVQB 2HFEA 2W65B 5J6GA 1BF2A 4ODTL 4ZFZB 3ARDC 5J4MA 2HT2C 1BZ7A 5KS9E 4YXHL 2DL9A 2YC1B 1MWAA 4YQXH 2VXTL 3DO7B 4JRYE 1SM3L 4B50A 1P4BL 3KPLA 3I2CL 5ALBH 3ZZ1A 2GSIB 1W8NA 2W0FB 3WL9A 1SYVB 4L4TA 1ZWIA 4NN7B 3K1DA 4XXDB 1SVZA 3I2CH 5ALBL 1NAMA 5I18L 2KPNA 2I07A 3LEXA 4GG8A 1HILA 3T8XA 2V9RA 5EPMB 2HP4A 4YO0A 5EOQL 5DC9B 4KWUA 1EHNA 4I8DA 3ECBB 1LO5A 1F90H 1S7XA 5FYLE 1WBXA 3DVGB 1DQDL 3KPOB 3C5ZA 4HC1L 1AJ7L 1CFBA 4KQ3H 2NW2A 4OIIH 4MDJA 1ZS8B 1GOHA 3IJYA 4X7TB 4NQCB 4LSRL 3R0NA 1NFDE 1FFOA 2G75A 3J7HA 1KEML 1OT1A 1W0YT 4KY1H 4WEBL 4XP6H 3S5LG 3T4YB 3WEXB 5T3XL 4NC0B 3CSYB 3QUZB 1CLYL 3HMXA 5HHOB 2VXSL 4JKLA 4JGUA 4EI5C 1MOEA 2DM4A 4ODVH 2H3NB 3PQYB 1AO7B 4Y4KD 1WSST 5ICZA 5F89B 4FP8H 4MJ2A 4ONGL 1YYLH 2A74B 3MBXL 4XPGH 4AJ0A 5E6IC 4ODVL 4I0PD 5DO2C 2CXKA 3MO1B 1J87A 3CFEA 5KTEL 2WNGA 1P69B 4KI5F 2W1NA 2ZG2A 4OCXL 3EO9H 1AFVH 1HINH 2EO9A 5C2UB 3RI5F 1W8OA 1M6OA 2P8LB 5JORB 1HSAA 3EO9L 4NZJA 3HC0B 1WICA 4OJFL 4X8JA 2F58H 1J1PH 4RNRB 3TA3A 1CFQB 3NPZB 3DIFB 4YHYC 5HI5C 1FPTL 2G60H 1HHJB 4X7TA 4JHWH 5T3ZD 1JRHL 2LTQB 4LKXA 2HTKD 5E5UB 5E7BA 3BP7B 5KVFH 5HDQL 5GRUL 3KPQB 4P3CL 5D7IB 1G6RH 2FZ3A 2G60L 1I1FA 5FYKD 5FEBA 4JHAH 5HDQH 5D1ZB 4N9GB 3MCKB 3KPNA 3FB5B 4HGKC 2CO7B 4HH9B 4H1LG 3PG2A 2BNRB 1IZKA 3FQXA 2ZSVA 1YY9C 2AJUL 3R4DA 3WD5H 2ENSA 1DBAL 1NMAL 2GYSA 3WNKA 1A47A 3I02B 5JHLL 4F9PC 4RMQA 4OZIB 1UJ3A 4DEPC 1SEBA 5LCVH 5JHLH 4PTTA 1YEFH 2P4AB 4UOJA 4S1QL 3TIEB 3OGCA 4Q6IC 3WN5B 4Z95L 2VDRL 3MRBB 1D6EA 3I3DA 4QOKD 3E6HB 5LCVL 4XHJD 3RQ3A 4HWNA 3MLRH 2EXWD 1VFOA 2CR3A 5CEZE 1FZKA 4ODUA 1QVOB 43C9B 5I1IH 2R8SL 2X4RB 4O5LL 2ED9A 1U3JA 5ENWA 3VE0B 4I0KA 3H9YA 4M5ZH 4L3EE 3EO0B 4Q74A 4YPGA 5DFVC 1S7XB 3CCHB 1KB5B 4XRCB 3ROOB 5JHDD 1ZLSL 3QA3B 1EK3A 3LKPA 3RZCB 4IOIB 1PG7H 1SVCP 1T5WB 3GSNA 4FQXB 4U1KB 2A6JA 4WUKH 2FECL 5IM7B 3JV4A 2PR4L 3Q3GA 3ARED 4DEPB 4DFHA 2NMSA 4OM0L 4TUKH 4NGHH 3QUMA 1D6EB 3QFJA 2Q6WA 4ZG1A 2IBZY 4MJIE 3QEUB 4DOHB 2CLZB 2F19H 2XPGA 3NZ8A 2NTSP 4FQCH 4PJBE 3AGVA 3AVEA 2E6QA 1I1YA 5HYEA 4PJEA 5D2NB 4JEGB 2F8XC 1BJ8A 1FVEB 4LLYA 4C55A 1Y6NR 5D5ME 2DIAA 5IHZB 2XI9A 4I18B 2G9HB 4LBEB 3AXLB 5SX4H 3WFEH 4AY0A 4BQ8A 4GAGH 1HH9A 1FYTE 1LQSR 3Q5TA 3OHXA 1ZHKB 3E8UH 2D0HA 3S3JA 4ZNEE 1MCNA 1OSZB 4HIEB 3S7GA 4O4YH 3O41A 4W6YB 4Z7OE 2A77L 4K7FB 3CFKB 3SDCC 3REWB 5DR5L 5HYQA 5L88H 3AU1B 1HYSC 1AI1L 4QCIB 3VU2A 1JHKH 1NC2A 3OZ9L 4PJEB 1AQKL 2AEQL 5DA0B 4XC1H 3SDCA 4S1SL 3TBYB 1RURL 5MEPB 4P46C 3PGCA 3MLUL 3MFFB 3RU8H 1ORSB 1DN0A 1DLHB 1C08A 1YEEH 2EIDA 2CUIA 4GKSA 4GUPB 5FKPB 2XWBB 2M1KA 2VXTH 4E5XA 2QQQA 4FN0A 4I77H 1KENL 2BOCA 3O11A 4DZ8A 2ZUSA 4ELKA 1IGJA 4P3DA 5DMJB 3EOBB 2GW5A 2VUOA 1Q9LA 1A22B 4CKVX 4PJIA 5J13C 4JJHA 1IEBA 3RWHB 4ALAL 5IW1B 3S6CA 3D2UB 5EOQH 3U7YL 1ZSDA 1AO7A 3ZE0F 4MVBD 4WW1B 2IGFH 1YEHH 3IFOB 3MV8D 4HUWA 3HG1B 3QNXA 4BQBA 5CCKH 2QADD 3ZE2E 3O6KH 4BZ1H 1E27B 4LHUA 4YUEL 4Q9QH 1U95A 4FQPA 3AM8C 3IJYB 2V7NB 2DTMH 4FXKA 4F37F 2COQA 3B3IA 3DBXA 4U3XA 4LSTL 2HJLA 4WHYG 2IF7A 4XCCL 4YUEH 3QUYC 4NNYB 4HGMA 4HUVA 1CGYA 4N0CC 1G9EA 1CLYH 3CZFB 1A5FH 5DRWA 4PJXE 1Q9WA 5C07E 1A4KA 4F7TB 5DHYA 1W0VA 1NGPH 4CU6A 3VXUB 2F54B 5DMGC 3SO3C 3BKCH 4G6KH 1QFWH 1TZHA 4H0HB 3F58H 5CEYA 3WNLA 4NQTA 3C9NA 1Q0XL 4OI9A 3RGVD 1JIBA 5E08H 4F3FB 3MJ9A 1LK2A 1NQBA 4JZJA 4LFHG 1A14H 4LLUA 5FHAH 4X9HA 1X5JA 5T5FH 4KK5D 1CD0A 5DHXB 5C3TA 5E8PA 3TFKC 4L5FL 4QRTA 4PJBA 4UT7L 2R4SH 4FQ1H 4Q6IA 4YFEA 1YJDL 4NT6A 4OJFH 5IMOB 1U92A 5K93A 1NC4D 2VLJA 4ONOA 4YHNB 5TH2A 5D1QD 1PAMA 4HXBL 1IVLA 2R0ZL 1HNFA 2FO4A 1TJIL 5HHXH 1VGEL 4XNQA 5IT2L 2VMFA 4QRQB 2R0LL 5FGBC 4OQTH 4RMVA 5JA9A 5BVPL 5GRUH 5CMAB 1FO0B 5T3ZL 4F7CB 5JHDB 2FHBA 3RPKA 3O2VL 2Z91A 4KV5F 1P5VA 1AD9A 2CMRL 4DKEH 3OSKA 4HWBH 1KTDA 1IGCL 2HKFH 1NCDL 2OP4H 4ZS7H 3EYQD 4JHAL 2QSCL 2UYLA 1LWRA 2C7UB 2UWEA 4KI1A 1A14L 5MEOA 4BYHA 3V0AC 1BVLA 4XCFL 3FT4B 2A0LD 4MXWH 2FO1A 3KWWB 2Y6SD 3GMMB 5C0BA 5JDSB 5A40E 3U0PA 3FN9A 4I0PA 4XCFH 2BVEA 1ZLWK 3QIUC 1ZMYA 4KMQA 1PX4A 1CDYA 3HC3H 4PLKC 3QDMA 4NKOB 3GSNB 4FZEH 3QCTH 1S9VA 5ISZA 2AK4B 4Y0GA 1MJUH 1J1XH 4UDUA 3WS6A 3CH1A 5IM7A 4JE4B 2B39A 1A6WL 1RZFH 1A6AA 1V05A 4WRLA 4FFWD 1F97A 1MHPH 4X8JB 5IFJB 3O3BB 2ENYA 5IB2A 3FO9A 5BO1L 5M94B 2X4NA 1RZFL 2DQTH 3S4SB 3ARUA 3REVB 5SWQB 3C6LB 5SWSE 3K4AA 3D3VE 4QGTA 3CD4A 4YHKH 3VCLB 5DJYA 3TNMA 2WMPA 1EMTL 5AAWA 2CDEA 1IAOB 3OG6B 2Q8AH 3ALWA 3G5ZB 3L3HA 2EYTA 2Z8WC 5F1IB 1A7PL 4G9FE 4HPOL 4OGXH 1U8LB 2R29L 4WHCA 2DWEB 4P5TB 3WIIL 3SE3C 4NCC2 3SN6N 2SEBA 2PW2A 4X7EC 1E4XL 3NFSH 4PJCF 2VLRB 3ULVC 1TNNA 3QPQC 3CFKA 4WY7L 3PABB 3THML 1D7FA 5DQ9B 3ES6B 1XGUB 5A1AA 3LQAC 3TT1H 3ULVH 1B0GB 3V4UL 1LO5B 1CICA 2OTPA 1WAAA 4FHBD 1ZHLB 1ZA6A 4MMXC 4U1SB 3ZYJA 1HILB 5I30H 3JWDL 2BFVL 4OLUL 5EWIH 3UP1A 1YMHB 2YBRA 4V1DA 4BH7A 2VXVH 5AG8A 2OL3B 3PP3H 4OZ4A 4TNVK 5CHNB 4ZUSB 2Q8AL 4M6NL 2FO4B 3MLSH 1QSEE 3TLRA 5DQJB 3EBAA 1K4DB 4HPOH 3WXVL 3LSOB 1FIGL 4KQ4H 1PLGL 2X6MA 3RTQB 3RX7A 3V4PL 1FNEA 2XNAB 2FH8A 1P84J 4DCQA 3F7RA 5C0EA 5FCSH 3ULVE 1QRNA 5FYLD 4PRIE 4HK3J 4F2MA 5BRZA 4HXAH 1JN6B 3E3QC 5EC1B 4JREB 5ICXB 1K2DB 1V3KA 4HCRH 5F1SA 1O0VA 1GHFL 4NQDB 4RDQG 4C56D 4P4KD 4WCYL 5L0QB 1KJ2A 2YEZA 3L5XL 1MCIA 3MO1A 1IEAA 4X6CA 1MIMH 2HVJB 1JGDA 1EO5A 2PTVA 3MLYH 4OFYD 4AENA 2DQJH 3QA3A 1RUPL 1PZ5B 5CSBA 3DUSB 4N8VB 1NGYB 2EEAA 3U1SL 1YC8A 3DJ9A 3OKNB 5I73B 3U48A 1ETZA 2IH3B 2X1XR 2NW3A 1BOGA 4XBGA 3MODH 4UAOB 5J06A 3M1BA 4K55A 3CZJA 3ZDXE 2F15A 5ISZB 1J8KA 3RTQA 4L8CB 1U3HD 2X4QB 2EDEA 2EZ0D 3KNBA 4NN7C 3EJZC 1MFBL 4BZ1L 4Q9QL 4B5EA 3VRJB 4L4TE 4LDEB 4TVPH 2LU4A 3K8MA 1L0YA 1YEGL 5BXFB 5JW3L 3C08L 1MSPA 3FRUA 1HQ4B 5CBEB 1ZGLA 2WBWB 4PJFA 4LU5L 2W91A 1LEIB 5D72H 3D48R 2RFXA 4XX1E 1YDPA 1MCCA 3GRWH 5J11B 3C6LD 2WBJA 2WIIA 5EU6D 2FDBP 3CU7A 1C08B 1MFNA 5E9DE 1U91A 5IVXB 2BVTA 3HRZB 1A9EA 1J8HD 3KLSA 1IGFH 3IDIB 3C6SA 3OPZL 5EUOE 5H8DA 4LSQL 2Q20A 4JJ5A 3L3JA 1AR2A 4HKZA 1JTOA 1OAUH 1WITA 1MAKA 4BFIB 3UJIH 4TSCL 1KJ2H 4PR5B 3MPCA 3VDCA 1MCBA 4AL8H 2Z93B 1F8TH 4S1DC 3LKSA 5DK0A 4K8RD 1FNSL 2GIYA 1SJXA 2FH6A 2EDHA 4BKLA 4D9RD 2BSED 2VDLL 1A0QL 3S36X 1HQRA 4Z6AT 4GMSH 3MV8A 2X89A 2AAVA 3T0EA 5D2LB 2AEIT 4DVRL 2DLHA 2P8LA 3W5MA 2HT3D 4KI5D 4LF3B 4TSAL 3P73B 5GS1C 1UM5H 1U8JB 3LN4B 2ORBH 1A7RH 4YAQA 3TYFA 2VDNL 4WHYH 1XMWA 2B8OT 2XZCH 3U4AA 4CW1B 3MFGB 1VACB 2FJFA 1T20A 3RA7H 5J89A 3WNOA 2IBGA 4KTEH 3KWWA 2AXHA 1AQDB 3FB6A 1I8MB 4QF1A 3MC0A 4QRRE 4J6RL 1V8HA 4OI8A 2YD5A 4WTXA 1WF5A 4JZNA 4YDIL 1OOAA 1X44A 4MDJB 1PZ5A 5F1OB 4PJ5D 2YD7A 3RKDC 3CDYA 1H15A 1MJUL 2P43B 4OF5A 4TPRH 5DK2B 2PXYD 2E8ZA 3NH7H 4Y5XB 1CLCA 2HT4D 3SOBH 5I75B 3O3UN 4GXUM 5GS1B 4JZJC 4QRQA 3X12B 1FFNA 1YA5A 3KPSA 3MCLH 3MOBH 2HA1A 2VDQH 3MRBA 5L2JA 3ARFA 2OJEB 4EI6B 3CFDB 5HYFA 1ZA3A 5ITBL 3PABA 2QL1A 4PJDE 1LE9B 5IROC 1TQCC 4FRWA 4UV4H 1OCWL 2VKWA 1G7HA 3TBYA 1N2RB 2LQRA 2NY5L 3V6OC 4J3SA 3TNNB 1EAJA 1QNZH 5DLML 2X4TB 4EI5B 1R3KA 1V3MA 4H8WL 5F7UA 1BVLB 1UA6H 1PFCA 3WIIH 5JHDE 5KOMC 1ACYH 2LU3A 3BVNA 2WQRA 4NIKB 2HFEB 3HZKA 1RVFL 3WE6B 1JK8B 1HYSD 3EOTH 4JM2B 1JWMB 5IB3B 3O3AA 12E8H 4RWHA 1NFIB 3QQ3A 3IAGC 1ONQB 3GBNL 2HLAB 4LNVA 1EFXD 3MRGA 4KDTA 1X5AA 4FQ2H 5H94A 4EVNA 1WC7B 4XAKE 2QKIB 4KDWA 3F6LA 3MLPA 2HRPH 3GBNH 2NLJA 3TIDA 2AEPH 1CXLA 3PV6B 5FKAA 4BK5A 1Z5LB 4LNRA 4RRPA 3K2UH 2NY6C 5GIRA 3WUWA 1QFUH 4HUXB 1O7SA 4MJ4A 2AV7A 2XG5A 3MLSL 3H3PL 2V5RA 3F7VA 4OZHB 5LXGH 1I75A 1MH5B 2EYRA 5HGGS 4U1NB 5FDWB 4HKJA 5ADPL 2F53D 4NNXA 4ZOCA 3BW9B 3VXMD 5A2IH 5IWLC 1EFXB 4MCZA 4U1MA 3C8KA 1JV5A 4Q0XH 4HIJA 3C5SB 4WI5A 3GHBH 5IROA 1BWWA 4AEFA 2BVYA 2ZP0T 1GHFH 2JJVA 3BFOA 5D9SB 5FUZL 5K9JH 3L5XH 2E3VA 2ZCHH 3REVA 3VXSA 5CWSA 4XBPB 5LGJA 4PGBA 1DQMH 4DN3H 4G6FD 2CDGB 2BJMH 3Q48A 5H35A 3ZHLA 4QXWA 1VGKA 5F7LB 5GRJH 4F57L 1QFUL 4LARL 3QUKB 3L9RA 3ULUH 5FDWA 4LFHD 5JZ7D 3RRQA 43C9A 4XNUL 4WWID 1B0RA 2ZUTA 4JRXB 2MHAB 1FE8H 4M7ZC 2Q86A 2OL3H 2VRAA 5I17A 2AXGA 3CMOL 2MJWA 3R8QA 2A73B 3MRQA 4WU5B 2X70A 3ZYOA 1ZAGA 3UBXG 2DMCA 3WSQL 4PJDA 3IU3B 5DZLA 5DVKA 4X6EB 3LEVH 5JNYB 3PHSA 1UB6A 1OQXA 1YECL 4K3GA 4PLJD 1P9MA 4AQOA 1B9ZA 2VL5A 4J23A 4WUUE 4M48H 5T1LD 1JN6A 5ICXA 1F3DJ 4JFYB 1QA9A 2ZSVB 3FT2A 3IJHA 1A3QA 4HLJA 5AWNL 1LDPH 3GRWL 2YSSA 3GM0A 4KJQD 3HC4L 3NGBC 5CGMA 2BNUA 3OX8A 4OIBA 1FYTA 4X99A 4ZSOA 5JXEC 2W92A 5I17B 4HUVB 3IDYB 3SGEI 2V17H 3SGEH 3FQUB 3MUGA 4CAGA 5HJ3B 2GITA 4UTBH 3QWRD 4OFDA 5CD3A 3TWCH 4EKXA 3KVQA 3TO4D 2X4UA 3D18B 1QPXA 4HUNB 5HHQB 2X1PA 3MBEC 4X80H 1UKSA 3ARVA 1IM9A 4P2QD 2BNQE 3AY4C 4RAUA 3QG6B 2Y23A 4KKAC 4M7JL 3BISA 1IM3A 1PX3A 3NA4A 2UY7A 1S7WB 3BGFB 3LAFA 1OGAD 2R2BA 4RGOL 5HVWA 3CFJB 2AJYL 3DVNB 5FUCE 3PWPB 5KSBE 4K07A 4ETYA 5A16A 4KKLC 1MUJA 5CP3H 2AJYH 3QCUH 3BXNB 3KYAA 3O6LH 4YHIA 3IFNH 2R23B 3FQUA 3T0BA 5BRZE 2JK5A 1CZ8H 5IQ9B 1OP5K 3LD8B 5F9JA 4RA3A 4ZSOB 5KSVB 1T0NB 3ZKQD 1Y0LA 1ZK9A 4NCDA 1KN4L 4ZYKA 3PHQA 4RZCB 3NGBB 4XCNB 2WBJD 2NZIA 2AV1B 4DWHA 2NY3B 2E9IA 1WT5C 4NPYB 4U1GB 5FGRA 3QNXB 3MA7B 2DQUL 3B9KB 5ITFB 2IALB 2D4DA 4FQIH 4JKMA 3WNPA 4TUOA 1BQLL 1ZHBB 3D1MC 5HD8D 3D9AH 1X9QA 3H3BC 4JVWA 2CKNA 1FLTX 3AAZB 3IETB 3FQRA 3V6ZB 1NAMB 1N5AB 3HG1D 1A3LL 2VC2H 3GSQA 3QDMB 3GSWA 3ARGB 1C12A 4U2YA 2YD2A 1EHAA 5I8OH 3BVNB 1BFVL 3IFLL 3PP4H 2MQ3A 3A6CL 3WJJA 3O9WC 3WE6A 2Q8BH 4QWWD 2VXUH 3M45A 3VI4E 4FFZL 3KYMB 4DGVL 3EFDL 5L7XL 3E2HC 1O5DT 4KY1L 4XP6L 5TQ2H 5T3XE 5GS3A 3I85A 2RQ8A 3SGJC 2FEDD 3TVMC 3FZUC 5IEKA 1NLDL 4LAJH 5HVHC 1FO0L 3VXUD 1G9NC 1R0AL 5C0GA 3BOVA 1QYGL 4JFYA 3VWKC 5C8JB 3FZUD 4PGCB 2EIBA 3QEGH 1KEGH 3KPRD 4JZJB 2FIKB 1BHGA 3GMRA 5L8JB 5ICYA 4EZMA 4UINL 1PVHA 4XVTH 1WBZB 3IVKB 2VQTA 2GK0A 4LMQI 2XN9A 1II4E 3U2SB 4G9FA 1MQKH 2Q76A 1TTFA 5HGDB 3ARFD 4NWUL 4P4KC 4LRIA 4TRPL 1FZJB 1H15B 4JFED 3CXDH 3VFTB 1WISA 2YRZA 3KNBB 3U4BH 2GEEA 3MV9A 5SX5H 1J1PL 2PW2B 5D96C 3TA3B 5HVGB 3T2NH 2DQEH 4G6AC 3IFOA 5GIRB 3WUWB 4RISL 5T5NG 3WLWD 5JPMA 4LAQH 3L1OL 2P42B 1U42A 3WFHA 4FQJL 3VXSB 5LGJB 3QPXL 1BVKA 1AGEB 4G6AD 3VMOA 4P3CH 3HHRB 2X7LA 5ID0A 1I7RB 4PJ8A 4XI5C 5DO2D 1TJHL 4EI6A 2BNQA 2C1PB 2NYYC 3D87B 4PY8J 3FCTA 2H9GA 3T77A 3FOLA 1RJZA 5C0CE 3IJSA 5KS9A 1TETH 4JM2C 5DJCB 1NCWL 1H5BC 4K9EL 3RKPA 2QBWA 1H3UA 4L4TD 3QIWC 4PGEB 3UYRH 5BRZB 2DLGA 5I8CA 3EJJX 1K2DA 4K9EH 1U8NA 2UWEE 2VISA 1RZGB 2XY1A 2AABL 3SPVA 5KG9B 3PWUA 3VXQB 5T3XD 4J8RB 3ZKMC 3V79C 4NQXA 1N6UA 4K3DL 3C5JB 4K7PY 5IK3A 3SO5A 4UILH 2NY3D 4KJPC 3P9LB 1YPZB 1YQVL 4GKNB 1QFWM 2DBJA 5GS2D 5DSCB 4FQQA 3DVGA 1NCNA 1N6QH 2KZ1B 3ZT5A 5F7DB 4S1DD 3BKYL 5J1AB 5I66A 1YY9D 3QG7L 3RY4A 1P7QD 1T1ZB 4O5LH 3SBWC 3PIQB 5E94B 5E4EB 4JFPB 3H7BB 5E4IA 1TJGL 3C6LC 5HYSB 1ERNA 3QJHB 4ZNCD 1T7WA 1HZHH 3IF1A 3UYRL 4PRIB 2FRGP 4FQHA 4JFEE 4MA8L 1YY8B 3MOQA 3W9DB 3CFEB 1PG7L 1KTKE 5JIHA 1KPRA 1LO3L 4RDQF 3QQ4B 1CDJA 3AMKA 4Z95H 4LEOB 2FNBA 3T1WA 5TF1L 4XNYL 5I1DA 3QI9C 2AJZB 3FRUB 4JM2F 4TUKL 2EH7L 4GKNA 1BQSA 1R24B 1S7TB 2AXFB 5ALCH 1JPST 4OKDA 5TGBA 3VWJB 6FABH 1A1OA 35C8L 1J9CT 3LKNB 5FGSA 5F7EH 2FYYA 3NPSC 3BPLB 3S4SG 4M03A 3OXSA 4ZPVA 1PGRB 4JQIH 3VGBA 4OQ1A 1KB5H 2J88H 1WEJL 5EU6E 3WCYA 4EDXB 1HSAB 4G6ML 3PGFH 3BQUD 1RZJH 2G9HA 1J8HE 2XN9B 3CSBA 2V5SA 4WI6A 5JIIA 1L7TL 1MEXL 3TN0B 2YN3A 3L3DA 5BS0E 2APFA 3FQTA 3LVEA 2AK4A 5F8QC 3U0TA 5KVGL 2GAZA 4DZBB 3I6LE 4TN9A 1K4CA 4NC1C 4LCCB 2AV1A 2KUTA 4XNYH 1DBBH 3KYKL 2FB4L 1M7IB 1IAIL 3MBEA 1YEFL 3BH9B 3Q5YA 2XZAH 3I6GA 1H3PL 4DKFL 3I3BA 4WNQA 3NZHL 1JPTL 4R2GB 3IU4L 1AR1C 1NANI 4KV5E 3N1FC 5EBWA 1CS6A 1IAIH 1UJ3B 5JOFB 3SQOH 5BS0D 1F5WA 3GEWB 3I6LD 1XGPB 4UT6L 2BDNH 3RGVB 4PJ8D 3RU8L 3QCVH 4K3HA 3V6OA 1KB9K 5J13B 3EYVA 5EO1A 2NY0D 4WV1B 4ZOEA 4MAUL 4MAYC 5C0BD 3BEVB 5IP4A 1JHTB 2C9AA 5IUSA 2DBLL 1U8PB 2DYPB 3VH8G 1KCKA 3BN9C 1G0YR 1P5UA 1SY6A 2DQUH 1F6FB 5HDBE 4UQ2A 4YR6B 1U2CA 1FG9C 2JJTA 3D0VA 3DV4B 1BZQK 3IDXH 3SCMD 1KT2A 4NO0B 5I73C 4XB7A 3TO4A 3LKQA 5DQ9A 4XPTH 2WWMC 1BJMA 1U92B 4MLIA 1UFUA 2V2XB 4ODWA 2VQ1A 3QQNA 1DLHA 2OQJB 2JLLA 4W6XB 2BC4A 4Y5YB 4I48B 3D25A 3MLZH 4ODSH 5HHMD 4HGWA 1FYTB 4X99B 3MLXL 5I8KH 3LD8C 2B4CC 4GXVL 2WIIB 3PL6D 5DURD 1T4KA 5FYLL 2P44B 4FQHB 3LSOA 1LEIA 3VMPA 3DETD 4X5LA 1YDPB 3QI9A 1SM3H 2X1OA 1MHHA 5DVMA 4JFEB 3NCJH 1A4KB 1WZMA 1XF3A 3HNSL 1YEDA 1QD0A 2AKRB 1U3ZA 4GO6B 3GKWL 1CK0L 1QLRB 5FDYA 2XT1B 4YHML 1CE6A 1DQLH 5EBMB 3VXRB 5DMKA 2VXQL 2B5IB 1VKXB 3MGOB 2NY6D 4HUMB 5IHZA 1CGWA 1WGOA 4NRXA 4P3WA 3OXSB 1B0RB 2C3VB 3W0WD 4G8FB 2D31B 4X4XA 1AKJA 3K2MC 2R1WA 3BZ4A 1H3TA 4GXVH 2DIBA 5MEQA 5E03A 1CE1L 3BIBX 3MZTA 5IJVA 1MNUL 3MUY1 1KNOA 4X7FC 5DA4A 4Z7UA 3GJEA 3D85B 5T1DL 3OKNA 3QZWG 3T2NL 4DUXA 5HVHB 3FQWB 1AGCA 3VW3L 2FJGB 1F11A 4P9HH 1FNLA 1IKNC 4L8SB 1FP5A 3IDGA 4NN6B 4XAKD 4Z7WA 1WBYB 2DKUA 4HS8L 1UACL 1OY3B 5DTFB 2QR0A 4PJEF 5DI8A 2IPKA 2DRUA 2DLEA 4KDTC 4ONGH 4UV7L 2D0GA 5C1MB 1NMAH 4KGJA 2AJXH 5C0GB 1MRFH 4ACPA 5TE7L 4MVBC 5DJ8A 1ZOXA 5A3IC 4Y16B 3B4NA 3MFFA 4MNGE 3PWLB 5I66B 3S8WA 4P2QE 4ZFZA 4P57A 3VA2C 5KN5A 4MNGB 1R5IB 2ITCA 3F7YB 4X0KB 5K9OB 1FHGA 4A6YL 2ZCLL 4YFDB 8CGTA 1MRDH 2R0LH 1CFTA 3C2AH 5IVNA 3L3JB 5FO7B 1K8IB 1JRHH 4PRPE 2DD8L 3X14A 5MENA 4WO4C 5HHPB 4G9FD 4NM4H 3OF6A 4Q9RH 4YH6A 1I7TA 1BZ9B 3FO0H 1E4WL 2I07B 3ETBF 3UTQB 1JPSH 3MRLB 2M8XA 1ZANH 4LPTA 1FVEA 1BGXH 5CJOL 3UBXI 3H0TA 1G7IB 3QIWB 2ICWA 3FB5A 5DD1L 5L2KA 1GXEA 2ICCA 1Q9KB 32C2A 3QIUD 1A7QL 4IHOA 1JTPA 1JJUA 2BSSA 4XP4H 2JK5B 1HWHB 3QCTL 3V6FB 1T7VA 4DK3A 4R96B 2D7NA 4JPVL 4CW1A 2R0ZH 3KYOB 3LHPH 3QFJD 5EU7C 3AS1A 4JHZA 4OQTL 4NM4L 4OD2B 3KHOA 3L7EA 4CU8A 4KKNA 4W81A 4NQEE 3G5YA 3GMOB 4S2SA 4LLUB 1JRHI 2Y36L 3K4DA 1RUAL 2IADB 5GJTL 1J0JA 1HN1A 4AZ8A 3QULA 4BELD 4PRID 3MRJB 3CH8A 4LLVA 4N1CA 5F96L 1A6TB 3P4LA 1QVOA 1UZ8B 3VXUE 1B4JL 2NNAA 1CYGA 2X4RA 3UPAA 5ANME 4Y5VC 4R97B 4OZFH 2DIJA 2VUYA 5IVZB 4U1MB 1S7QB 1F13A 4JZOB 3C09B 4Z0BL 4A6YB 1T83C 4ZDHB 2BOCB 1AGCB 3U9UA 3WN5C 1K3IA 3GO1H 5CILH 4NQSA 1HI6A 5CGTA 1JF1A 5HHVH 5IEKB 1JHKL 1IC5L 1RJYB 2IAMB 4HFUH 4NQCD 2ZCKL 4POUB 1U95B 3O3DB 2EYSB 3T1FB 4NKDA 3W9DA 1Q9OB 4XNMA 2VLME 3PWPA 5B3JE 4WVRA 4MA1C 4X5XB 1T21A 4M02A 4PJFF 4NHUB 4Q2ZA 1S7WA 3TH4T 2HTLC 3UPRB 2ZJSL 2EKSA 4BH7B 4DFIA 4PFEA 1ZVSA 1MFAH 1S5HB 4HWEH 4U7SA 4I3RL 5HYIA 1SYSA 4NO5A 3MGTB 2FEDC 3JV0A 4Y19D 1H5BA 4GH7B 4C56B 1CD1B 4U6HB 1OWRM 3GDBA 4LIQL 4JM2A 2DYPA 4KXZH 5IKCA 3S9DB 4LLMA 3ARZA 5F6IB 4C56E 3WKML 2J8UE 5F9OL 1CDBA 1JHLH 3DRQA 2Y06H 4JB9L 1IGYB 5C0DB 3L3KB 2WLYA 4ZQKA 4HIIA 5DQDH 4WFED 3Q0HA 4I4WA 4DOHE 3ZL4H 1U8QB 5DGQA 5DRZB 3QZWA 3V5KB 4OGAD 3QUMH 4GRWH 1EEZA 1QA9B 1E4XH 3ARWA 3RVXD 1OGTB 3OXRA 1AQKH 3EYFA 3BDBA 2G5BB 3L5WB 3ZDYE 5DJCA 1DVFD 3I6GB 5FYLH 1P1ZA 3SKMB 4UQ3B 5EIQA 3LS5L 1KC5L 4ELMA 3GSOA 1XGTA 4R4FH 3ARRA 3S3PA 5FYKL 3P9MA 1R5VB 3O11B 5BZDA 2BFVH 4HIJB 2M2DA 4OLUH 2R2EB 4JCMA 4GSDH 4OCWL 4U0QB 3NA9L 5FO9A 1ZLVK 5D72L 5TPWH 5DGRA 3S96B 4W4OA 3GJEB 5BQ7B 4WWKD 3MRCA 4X7SL 2ESVA 4K8RH 4XGZB 2DQDH 4OCWH 1DEDA 1ZT4A 2EC8A 3JVGC 4ALAH 5B8CA 1QPPA 4CDHA 1U8QA 2ITDA 2OI9B 3BUYB 4KAQL 3C5JA 4PJ7B 4FQ1L 5D1XA 3WLWC 3WJJC 1T1WA 1JGEA 5HGAB 1T80A 2DS4A 4P46B 5CSGA 1MQ8A 3RVXC 4WTWA 3FT3A 1I7UA 3DI2B 5DJ0B 4XC3H 4MJID 3T2OA 4CDGC 5CJXA 1LP9B 1ZEAH 1W72A 3JTSA 3KG5A 3MZGB 3U2SA 1FNSH 5IB4A 2APWA 4YHIB 5DD6B 3GMMA 4ZAKD 5C0BB 4LSTH 4XCCH 1KELH 4Y19E 4NKMB 3OHXB 1GC1C 5IVXA 3DSFL 3F12B 5INDB 1MFEL 1IGCH 4PRIA 3A67L 3B5HA 4V2CB 4PS4H 4ZD3L 2B2XL 3GI8L 1DE4B 5CJXC 1KELL 2XKSA 4QNPE 1FV1B 1DEEA 1L6XA 1RUPH 3OPZH 5F9AC 3BKCL 4G6KL 4PRHE 5L6YH 1FNFA 1K6QH 3DX9B 4O9HH 3L7FB 4LVOC 4C83A 1FGVL 2AJXL 1S7VB 2IAMA 3BRDA 1JMXA 3FFDB 2DN7A 4JFHE 3UTTA 3I9GL 3WDIA 4BKLB 2V2XA 4LP5A 1NEUA 4WW2B 3LKNA 2BVPA 1AD0B 5IB5B 4NT6B 1FAIH 4XWGH 1BQHB 4KHXL 2ERJC 1DDHA 3PWPD 3CXHJ 1BEYL 1NFDA 3VI3E 1CN4A 1KJ3H 2NY7L 3BN3B 3FQRB 5DFWH 1CU4H 4TQEL 3QSKB 4P23D 3SPVB 5KG9A 2GJJA 1LD9B 2LVCA 4M7LT 5F7NC 5I71B 3RZCA 1J11A 1Q0YH 1CICC 4QT5A 4KVNH 2A9NH 3OB0K 4R8WH 5FA4A 1NCUA 2VLLB 5LG1A 3VXPB 1FAKT 3CAFA 2D9QB 2CMRH 3A6BH 3NCEB 5FM4A 2GK2A 4L3EB 3HPJB 1G0XA 2YKLL 5GS2H 2JB6A 2Z31A 1ZE3C 5EIIB 5C0AE 4UB0H 4YX2H 4QF1B 1XGRA 5EBWB 3VRJA 2QJDA 3ARDA 1FFPA 3QH3B 4MDIA 3RHWK 1OAUL 2HN7A 4O02H 4J6RH 4P23B 1OCWH 2GSGA 4FFVD 1MUJB 2YRPA 1CLZH 4NQUA 2E7LA 1QOKA 3ARXA 3WXWH 2R23A 2ZZUT 3TBWA 3LKRB 4HHAA 4I0PC 2GKIA 3NIFF 1LE5B 4RNRA 1CIUA 4TQEH 2NY2C 3SJVA 4PG2C 1UQSB 1A4JB 1WZLA 4WY7H 3THMH 5BVJA 1KOAA 2C4XA 1E28B 2XRAL 3ESUF 3G6DH 3G5YB 1UENA 3BP4A 3ECBA 1MHPL 4LCWE 5HGDA 3EYSH 5T1LB 1T6VN 3QRGL 3RWFA 1S5IL 2YKLH 5GJTH 3QQ3B 4HJGA 4WI8A 1IGTA 2NZ9C 4HZAA 5A2FA 4QRSB 4FQ2L 1XH3A 3BGMB 4JRXD 3Q5OA 5IESL 3W2DL 3QIUA 1DUYA 1F2QA 1U8IA 4R7NB 4U6YA 1T1XB 3VA6A 1RI8A 4R7DA 1FFPB 1UA6L 2NCMA 4GQ9H 1HHGB 4TSBL 5KSBB 1KPVA 3P4NA 5EBLB 1MREL 4NZUL 4LLWA 4LLDA 4QGYA 5C86A 4OB5L 4OZFB 3QUZD 1OWWA 1RV6X 4Y1AA 2VL4A 1HCVA 1JYWA 1XEDA 1JYXA 5IOPA 2VIRB 3W11C 1S9WA 4LDOB 3FJTA 4OFPA 3HMWL 2VSCA 4OUUB 4P46D 1I1RA 1ZVSB 3GJFB 3RWFB 4MJ6A 3GMRB 1PKQB 2ADFL 2F53B 2VDQL 4PGCA 3B43A 3PL6B 1XAUA 3U1SH 5KJRH 2P5EA 4JAMB 1G9NH 4K94H 1H0DB 2I5YL 4LKXB 3KLDA 1MI5B 1QKZL 2R1XA 2R1WB 3BZ4B 4LSPL 3WBDA 2J7LA 1T04B 2I9LB 1MLCB 4P5TC 3H9SE 3MMEA 5CP3A 5IEHB 4HSQA 1DTUA 1N2RA 5KSVA 5EZOL 4G80A 3QIBC 4A6YA 2XPGB 4WTZG 2D7PA 8FABA 3U9UB 2OR7A 5CWSB 5CZXC 4YO0B 3UZQA 4YE4L 1CLOH 1FC2D 2Q7YB 5F6IC 1I9JH 3WIHL 4JLRB 1SJEB 2JB6B 2GTWB 2YEZB 4QTHA 4K71C 1F4XL 3VFVA 5BMFL 1VADA 1AGEA 1VHPA 3U7WH 3CK0H 3ULUL 4YDJA 1T4KB 4LCUA 3VFOB 1I85C 2VYRE 1F3JA 4IOFC 5J56B 1EXUB 2CRMA 1CVRA 1H0DA 2R0KL 3GRWA 4F9LC 4F7PA 3DPBA 1A1MA 3DX6A 3MUZ1 4EQ3A 5ISZE 3O6FA 5E99L 3N1PC 1JGLL 4OGZA 3RTQC 4UIKL 4WI2A 4IRZH 3MV7D 5E2UL 4EUPA 5FYJE 4J3XA 4QTHB 3BH8B 4FTVA 3MV9D 4OLXH 3V5DB 3T0XA 5KSUA 5F6HI 3AREB 4DVRH 5IMKB 1JFQH 5C8JA 5IIEB 3NPSB 3C8KB 5KVDH 1NL0L 4KKAD 4L4VA 1D5XA 3QIBB 5F9WC 2A6IB 5DRXA 1IM3B 4ZNEA 1YEJH 5E94A 3DVIA 4Y4HB 5K9KA 2H32A 4F7CA