1BMLC

Complex of the catalytic domain of human plasmin and streptokinase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
361
structure length
318
Chain Sequence
b'SVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQAKSVDVEYTVQFTPLNPDDDTKLLKTLAIGDTITSQELLAQAQSILNKTHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASMIN
publication title Crystal structure of the catalytic domain of human plasmin complexed with streptokinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 67
structure length 318
sequence length 361
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.150 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bmlC03
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bmlC02
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bmlC01
1L4ZB 1QQRA 1C4PA 1L4DB 1BMLC
chains in the Genus database with same CATH superfamily
4XZ4A 4E71A 1HXYD 1L5PA 3SU8X 4N58A 1I4PA 3ZNHB 3U7DA 2ZZPB 4MJSB 1KLUD 1XT9B 1JWAD 4LK0M 4OHJA 1C1YB 3R7RA 3NJTA 4W9HA 3WAMA 3SHQA 1DOIA 1D3ZA 2L83A 3AV8A 2V3SA 3VUXA 4OZAA 5BYRA 2WXMA 2H89B 4HPMB 4RH6A 1H4RA 3HRDD 2N4FA 2MP2A 3GP7A 4GOCA 4CHKA 1YQBA 3PT2B 2N9PC 1P98A 3QCAA 4PYUA 3PHWB 2V4LA 4OVZA 3RCZA 2LUMA 4ITKA 2AQ2B 1TT5B 5E6PA 2ZPNA 3A1QA 4PS8A 1V49A 4XGAB 2MRPA 2PW9A 3O65B 4F1SA 3VDZA 1QKZA 4EE2A 3VQIA 2QJLA 4M0WB 4FA6A 2CR5A 1KFYB 2IGDA 3RNBC 1QLBB 2REXA 4MGIE 1EF5A 2BGFA 2QEJC 3A9KA 2DAFA 2K8CA 1HE8A 3ZVVA 2BPSA 1FM0D 1TBEA 4HDOA 2MX2A 3QX1A 3ZIMA 4DHJB 4M8MA 2QDFA 5EDSA 3R7QA 1L4ZB 2PTLA 2MSED 3Q3MC 4FJVB 1WI0A 2VH1A 4FHKA 2W82A 2JXTA 4HKQA 5C23A 4IM0A 1RWSA 1N62A 2FE8A 3HHMA 4P1CC 2VH2A 3IAM1 4AP4C 4LNIA 1ZXHA 3PV1A 4LNFA 4XC2A 3ZDTA 1PFDA 3BY4B 4LTUA 3OWEB 1HEZE 5D3IB 1E0ZA 1K51A 1WJUA 2YEPF 1I35A 2KT7A 3ML9A 2WXQA 2I38A 3MHZA 2JRHA 4MM3A 2INPE 2WNMA 4NY0A 3DBHI 3P2BA 1QOFA 4BKTA 3JW0X 4DWFA 1J0GA 4A3OA 2AX5A 2GBMA 5JHBA 3NVYA 4E3CA 3EUB2 1NDDA 2VRRB 3QWZB 5DPTA 5FR6A 2K3UA 1YOVB 1CQVA 1GG3A 2C5LC 4KKIA 3DOWA 4YTMB 4CQNA 3R2IA 1IBXB 1E9MA 1FRDA 5EE1A 2Q5WD 5L83A 4GDKA 4ZYNA 3QJZA 2Y5PA 1WZ0A 4ARIA 2NCNA 3MJWA 1VLBA 2LZ6A 1SJED 4FLHA 1IYFA 2BF8B 4ANVA 1V86A 1E6EB 1YJ1A 2WXLA 2DENB 3AE8B 5BYQA 1F2RC 2YLMA 2PVGC 4GB9A 4C00A 1J7CA 1BUIC 2DZIA 2DAJA 1K52A 1YX5B 2G3QB 2FCNA 2KLCA 4K3BA 2N7JA 3VR9B 5AZHA 1R4NB 3WAOA 3MC8A 3LB8C 3ZUNA 3AE9B 2R61A 2ZW1A 1VD2A 3W5UB 3WAPA 4XX5A 2BYTA 3Q2AC 4B9KA 4E74A 5BMIA 2CS4A 2GBRA 3N1ZC 2KJ6A 5D94A 1TS4A 2LXAA 2PMVA 2JY6A 3Q3JA 1PDXA 3PZ7A 4KVGB 2MBHA 1WJNA 2MH7A 2K8BA 3PHXB 2LJ5A 3Q6BA 1N60A 2EMTA 3BK1A 2K5PA 3WIMA 2JZ3B 1YJIA 2KDMA 3ZJTA 2L0TA 1FCLA 3PRPB 3SD5A 2KTRB 1F0ZA 4LJPB 1TKEA 3H1UA 2WXFA 3Q3OC 1N61A 2KAJA 3AEAB 2AQ3B 3U52E 4K3CA 3Q14C 3PZ8A 1UD7A 1Q1OA 4JE3B 4HJKA 3NZSA 3A33B 3SFDB 2KQ7A 3DVGY 3IXSA 4YTPB 3TEZA 2C7HA 3E9SA 1OFFA 1WGDA 4KSLC 1N5XA 4BVUC 2LHEA 3M62B 1QOAA 4NJ7A 4M01A 1CK1A 2KFKA 5H8YE 4US8A 1SSNA 5TSSA 3MHSD 1XQQA 1OQQA 3ZNID 2GRIA 2KWDA 3MP9A 3HVDA 1T0SC 2O2VB 4B95A 4ARCA 1TZOA 3AU4A 2R2OA 4FULA 2KQ4X 4D2KA 2BTEA 1YN5A 2NBWB 1QF6A 3RNCC 3CWIA 1EWYC 1L7YA 1V1PB 1WRDB 4GN1A 3OAWA 3T8MA 2WU2B 2WDTB 3RZFA 2D10A 1H8CA 2EKEC 2K6QA 3AULA 1FPYA 3PLVA 3P4SB 3PZDA 2K8HA 5C1ZA 4XWWA 2DLBA 3P4PB 1WMHB 2KWUB 5JHAA 2KVZA 1TY0A 2IGHA 5D6JB 4RGTA 1C4CA 3C19A 1SE9A 2XBBC 1D4BA 3BIID 2N1WA 4R3DA 1Q5WB 2FUG1 5HKHA 4DHZE 1TGZB 1WFYA 3ZQ4A 3W1SA 1EUVB 2V3PA 1WGYA 2MW5A 5E6NA 2Z59B 1C9FA 1ISNA 3EA6A 2XK5B 2JWZA 3ZLZA 3OG5A 3WALA 2ON8A 2W3RA 1TZ1A 3MJ5A 2LASA 1I7HA 4FXCA 4A9AA 1WGHA 3L0WB 4G50A 2V0GA 4YSZB 1P9DU 5FKAC 2C7NB 1UGJA 4JPSA 1WE7A 4HPPA 1SXTA 2RPVA 4LNOA 2W54A 3H7PB 2ASQA 1C4AA 1AARA 2IO2B 2D07B 2HJ8A 1ENFA 3KLSX 1F9JA 1NEKB 1HZ5A 5GXGB 1NI2A 2NBVB 3EGRA 4N59A 2JUOA 3AU5A 3QARA 2ICIA 3DPDA 3AE3B 3UQBA 2G1EA 4K1RB 2BW2A 2H88B 5IO9A 3ZXRA 4ZOHC 5D7GA 4EZJA 2DNFA 4QAYA 4IM2A 1AWDA 3SFEB 4RM8A 2KDEB 4RFBA 3PO0A 4HROA 5G5GA 4K81A 3BINA 3GZNB 1YMHE 2WXIA 3TEXA 1Z5SB 4H2AA 4WJQA 3DWGC 4GIVA 3NY5A 3UGBB 1I4GA 3TIXA 2OOBB 4YXDB 4LNNA 4EEWA 2M4NA 4LNKA 2RDBC 3AE1B 1PQSA 2B3AA 1V80A 4WWPA 3ZRFA 1OGWA 1IP9A 4NQKE 1ZUD2 1WY8A 4N6EB 4ICUA 2O2VA 3H8HA 4MACA 4C7YA 5J17A 1VZ7A 1PGXA 2PIAA 5D2MB 1BT0A 3V61A 2DYMA 1FXTB 2Y5CA 4DXGA 4DXAB 4OZBA 2G9HD 1WX8A 1TJEA 1P7EA 2KMAA 1D5MC 3ETRA 4FN2A 2N7DA 1V97A 2HD5B 4OVVA 2IY0B 5C3JB 1WM3A 3DBLB 4HK2A 1WMHA 3KVFB 1HTQA 2MBEA 3B1LX 2LRWA 1ZOYB 3VH4B 4NQLB 3JYUA 2QSDA 3APCA 1DYQA 1TS2A 4XE0A 2G4DB 4DQOC 4TSSA 3DVNV 2CHWA 2QC8A 3KWVA 4FBJB 5BMHA 3NS1A 3AE7B 3RUIB 3ZTCA 3HVZA 1XEEA 2N9LA 3EECA 2D3CA 2KDIA 5E6JA 4OVUA 1L0YB 1ZPSA 3ZDMC 2NPTA 2BBCA 2KWCA 2IBIB 2UWQA 3AEEB 5CHWA 1V1OA 3DDCB 2QMTA 5KHOA 1JQ4A 2BWFA 3NVVA 2JYTA 1ROEA 2V4IB 4XWTA 4O1NA 4DDGD 1MG8A 4ACFA 3UI3A 2IO1B 1A5RA 2FIDA 1D5XC 1L4DB 1M4VA 2RMMA 3N32A 1V81A 1E8ZA 4IWQA 3ZGZA 2JPHA 3RNGC 1QQRA 1YNTE 3KW5B 1FNWA 4II3B 3CSFA 4HRSA 4LDTD 4S0RA 2MHJA 3AB5A 3NZUA 3TJPA 2LVPA 3NZ3A 4I6LB 4PS7A 1E10A 1N6ZA 1XXGA 2M0XA 4C4VB 4WJNA 4US9A 4JL9A 3VTUA 1FFVA 4JWSC 2GMIC 1IGCA 1D6EC 2V1YA 1E5WA 2J0JA 4FJZA 2INDC 1J8CA 1GPXA 2K9XA 2UYZB 3FAHA 4GDLB 4GMVA 1WYGA 1XCQL 3EC8A 1RRBA 1U4AA 3NVZA 2DZKA 5I4DA 2BVCA 1ET9A 1FNVA 1SB3C 2Y3AA 2JSVX 4IW0A 2K25A 2EMSA 2NR2A 1SEBD 4K7SA 3U8ZA 2E6XA 2JZZA 1XO3A 1C79A 1F77A 4Q2JA 1LQBA 1UUPA 1C4PA 3SR6A 4BAXA 5TR5A 2RDHA 1C77A 4WWOA 4KV2A 2PVOD 5LNK1 4M02A 4GU2A 4NAWA 4W9IA 4K7UA 1ZDXA 2FAZA 3UINB 4ZYSA 1T0YA 4L23A 4HVBA 1EM7A 1PGBA 3I57A 3TBLD 4AOFA 1VZ6A 2KANA 3KUZA 1UWMA 2LGSA 2JVCA 2YVCA 3L08A 4IM3A 5AUKA 3PTFC 2BYFA 4ASWC 2N9EB 3CSTA 2N7EA 3HK0A 3R66C 3DHHC 3DBHB 4MJSA 1LFDA 4ZHOA 1GAQB 2IO3B 2LGYA 2KACA 4MT5A 1WSPA 2L00B 2LWPA 4A90A 4IDIA 1WXVA 3U2SC 2OEDA 3URYA 3ABVB 4ICVA 1MFWA 4G11A 1WJ4A 2D11A 5IOIA 3V6CB 1UBQA 3W2DA 2WYQA 5CHVC 1R4NI 2J52A 3RI7C 3U30A 3Q3NC 4A8XC 4HEA1 2EKIA 2LI5A 2WXGA 4AJYB 3KH0A 1WGRA 1QT9A 1ZDVA 4J6IA 2GBNA 2L52A 1C3TA 2INCC 5H92C 3R3MA 3RNFC 3SDLC 1JCKB 2FCSA 2NBUA 4JX1C 1WXAA 3ZNZB 5EE3A 4ZRKA 2MBQA 4M0WA 3K9PB 4TV3A 2QIEB 4N9F4 4C7ZA 3A4SC 1K53A 5BO4B 2GB1A 3LXFA 4JWUC 5C2TB 1S1QB 2J42A 3NHEB 4REZA 3N30A 3B0AA 3IT6B 2L3ZA 3FILB 3RD2A 3E56A 1JWSD 1Q10A 3A9JB 1MJDA 1WJ6A 3KYDD 4CO7A 1MG4A 1OTRB 5G2NA 1K50A 3MFGA 2M0AA 1TYGB 2JRIB 2WQYB 2KJHB 3V60A 1XD3B 3D32A 1EWCA 4AWJA 2KC1A 2N9XA 2BQQA 3L54A 3WA0A 1SE3A 2PLPA 1GOZA 2EELA 1WX7A 1OQRA 3VH3B 1PYWD 2WX0A 2GI9A 1FNUA 1NI3A 3B2GA 4G3XB 5J2RA 4IWPA 2ZW0A 2MJEA 2ACZB 5D3DA 4IG7B 4M8NA 2LEKA 1Z2MA 1JWUD 4AS1A 3B9JA 2LXCA 1T0RC 1FEHA 1D5ZC 4BKSA 3NOBA 3HIZA 3UIOB 1XLQA 3AM9A 3JVZX 5CHFA 2PE9A 3VRAB 5LXIB 4JIOU 3L17A 4NZLB 3AXCA 1YX6B 2N0SB 4L2YA 4ANUA 3GOEA 3QIJA 4A6QA 1JRUA 2DHZA 2HDEA 5BMGA 2SAKA 2IO0B 2WXNA 2WWZA 2KN4A 4XYCA 4KIKB 3V3XA 2M1MA 2G45B 2ZPYA 3J9CA 2KWVB 1P1AA 4C56C 3DHIC 1IBXA 1TY2A 3AEDB 3AE4B 1E8WA 1YN4A 2RR9A 5IKCM 2AL6A 1KLGD 2B76B 2NTSA 4NAMA 4RM9A 3P4QB 2MEKA 4LLGM 4M00A 5E6OA 4KGSA 2FBWB 3DBRB 4BBNC 3TEWA 4HPLB 2DZMA 2BS2B 3FC4A 2O6VB 1EO6A 3GB1A 3I5JC 3RFZB 3JSVB 4DDID 3AE2B 3R8BA 1SIFA 1EU4A 1BXTA 1RFAA 3NRZA 1OEYJ 2WHIA 2FUHB 5LXHA 5IN7A 4RGOS 2Y5BB 1FCCC 2ZCCA 2A4ZA 4MGZE 1C78A 2J4XA 5CTRC 2LVQA 2K39A 3IFWB 2JT4B 2WXJA 2QHOA 3N3KB 3IBEA 3X23A 3L16A 5BYSA 2GBKA 2RGFA 1L2NA 2DX5B 3BK2A 3V05A 3MTNB 4NNJB 1VJKA 1PUTA 3QAQA 2RPQA 1E90A 5HG2A 1E8YA 3VFKA 2NTTA 3IG3A 4HCPB 1YD8U 3L10B 2N9KA 3NVWA 4W9LA 3W5VB 1SBBB 3IT4B 2IGGA 2M17A 2PPHA 2R2QA 2KD0A 2MP2B 2BYVE 4RGNA 2QCZA 3AECB 4YT0B 2KHWB 3A9JA 1GB1A 2L8JA 5IP4D 2LUEA 2VZKD 2KTRA 1C76A 3A1QB 1SE4A 2N1VA 2CJOA 1CZPA 3U4EG 4W9DA 5IAAC 1XCTL 1WXMA 3PGEA 4JLCA 3APFA 3A9KB 4LDTB 4JGHB 2AWTA 4WH4A 5JZEB 1P0RA 1WR6E 1V5TA 1UF0A 1NBFC 4KZ0A 2CU3A 4A3PA 5HI1A 5HHDG 1ESFA 1ZE3D 4P1BC 2KX0A 2MBOA 2UU7A 2KK8A 5DPSA 2IPKD 3HM6X 3QC8B 1YIWA 2ONQA 1KJTA 4YWGG 1NYRA 3W9CB 4B0EA 4GXBA 3B08A 4FADA 2L1AA 5AUIA 3SEBA 2M8SA 1AW7A 2HE7A 2QILA 1F2RI 1JW9D 4IC7B 4P6VF 2G4SA 4ZRIA 2JZPA 3M3JA 2D5GA 3ZTDA 2KVRA 2KJRA 1TKGA 1ACCA 1SF0A 3CF6E 2JF5A 3TMPB 4TQ1A 2A5UA 2KYWA 4DXFA 1V1PA 3DHGC 2BKFA 2JX5A 1XLPA 4II2B 1RM6C 1DGJA 2X38A 2O6VD 1MPEA 4ANXA 3VTVA 4HDQA 4X57B 1L6VA 1EU3A 2MJDA 4AQ7A 3KUDB 3DVNU 1JWBD 3EFUA 3ML8A 4FHJA 2C60A 4KKJA 1WR1A 3V6EB 3ZYYX 2HTHA 4A20A 3OLMD 3H9DA 3DQVA 5G5HA 1FIQA 3ZJVA 3N9YC 3VUWA 1OEYA 1VRAB 4P7IA 1E7VA 2E3TA 3KYCD 1R4MB 4P16A 1ZP0B 3Q8BA 1RYJA 3TCAA 2PEAA 3T3OA 1B9RA 1GNUA 2JWUA 4KZCA 3N1YC 4GDKB 2J0KA 3UF8A 3AMZA 4CYEA 3RMKC 3RT3B 2XK5A 3RPFC 1T0QC 1GUAB 3TEYA 1J7AA 2Z0EB 1KLVA 1UWXA 1L0XB 2MLBA 4RMAA 2J53A 3QK0A 2INNE 1GC6A 2AL3A 2CU1A 2KFJA 1ET6A 4GLSC 2HTME 4DK5A 3H7PA 1EF1A 1JRPA 2GBJA 2ZNVC 3KUCB 4GSWA 3PPAA 3LJ3A 3KWLA 4ZRPA 4AJWA 3IHPC 3M63B 5DPRA 2D3AA 3AEBB 2I1KA 1Q0WB 4BFRA 4S17A 3TUOA 2LRUA 1E7PB 1B1ZA 5FK9C 4BZAA 1N63A 4W9KA 3Q69A 4EFOA 1WWTA 3OJ4B 4OW0A 2DYOA 3DBSA 2I1JA 4BOZB 3C0RB 3VVWB 1UGMA 3NG0A 4J3OD 4HXDA 2ZEQA 4LJOB 1DOXA 4KGTA 2M19A 1DOYA 1J7BA 1TKYA 3GS2A 2NS5A 2KQSA 3NS8A 3TL5A 3ZNGC 3BWUD 2CHZA 3VHTC 3DVGX 4YSYB 3UQAA 5G55A 1Y8RC 2KMMA 2WXKA 1L0VB 2RD0A 2KO3A 2WXRA 1X1MA 2JYEA 2RSUA 2LHDA 1TTNA 2BT6A 1WGKA 1FXAA 1WGGA 4WAAA 4RGMA 3I3TB 1CJEA 4IUMB 4W9JA 2BS3B 1VDVA 3C8YA 1FD6A 1T6BX 2WDRB 2KXJA 3OJ3A 3QQ8B 1PGAA 1AN8A 1V6EA 2KFKB 3RZWC 1KH0A 3WCQA 2XEWA 4WAFA 2MA9B 3DCGA 4F7ZA 4IOIE 2AQ1B 3LDZE 4BKGA 1P7FA 1NVID 3ALBA 1GC7A 1QOGA 1SIJA 3Q8AA 2DZJA 1WX9A 1J19A 3PRMB 4MELA 3PS6A 4HLEA 1L6UA 1ZXIA 3EHVA 1V8CA 5JH5C 1IPGA 1AYFA 4NPNA 4W9GA 1LGRA 3P63A 3PREA 3I9V1 2L05A 3HUIA 2WU5B 2BB6A 1KF6B 2ZCBA 3IVFA 2LGDA 2OJRA 4GGQA 4I6PA 1UELA 1A70A 4RF1A 2X8XX 4IWOA 3N20C 2OHFA 4RNAA 2K22A 3ZJUA 2C9WB 2IJ0A 1JWMD 2WXOA 2NMQA 2C7MB 4DBGA 1V5OA 2PJHA 1I4XA 1GB4A 2KOXA 3VAWA 2AYOB 2LD9A 1SE2A 2OJWA 2RDGA 2DBYA 1R7SA 1MHXA 4TQ0A 3AE6B 4MSQB 1K8RB 1ZGUB 2BB5A 3RNAC 2LMCA 1G6JA 2BYEA 1YQ4B 4PYZA 1N5WA 4MDKE 3H7SA 4KGRA 4L1BA 2XNAC 2ZVOA 4RCOA 3L13A 1NENB 2D2QA 1GJZA 1WXQA 3RYTA 2LGIA 3APDA 4WJOA 3AN1A 1M94A 1I4HA 2JQRB 4DHJD 3AE5B 4MH0E 4KSKC 2KC2A 3N1XC 2M56B 1BMLC 3A4RA 1T3QA 3ENEA 4C4VA 3BYYB 5T8IA 4XDCA 3AI5A 3H6NA 2YEPB 3VRBB 4WWNA 1FFUA 5J18A 1WIAA 1XLOA 2BWES 2VZKB 1WZ3A 4B6WA 3V62A 1E8XA 1JROA 1XLNA 3ZKJC 3UIPB 4GDLA 4HWIB 1WE6A 2K0PA 2WS3B 4OZCA 4JQWC 1LM8B 3BVZA 2WDQB 1QZEA 2ZJDA 4WJPA 4B0MA 1F52A 4HKZE 1RAXA 3T3NA 1MHHE 2PE6B 3VUYA 5DCNA 2L0FA 3PRZA 1YN3A 1WF9A 1JALA 4BKSD 1P3QU 5HFYA 4C80A 4UDUC 3I63C 3M95A 5CX3A 4ZRQA 1NYQA 1WM2A 3BVMA 2FNJB 5AZGA 5L95C 3GE3C 4YSXB 2ZVNA 3T9LA 2FCMA 4KDLB 4WWMA 3BZDB 2WXHA 3LYYA 3X0WA 1ZKHA 1WXSA 1TS5A 1HA5A 3RN9C 2BS4B 1LO5D 1ZW7A 1FRRA 2WLBA 3DBRI 2LFIA 2W55A 3EFCA 1Y56A 5MPOA 1STEA 1V9JA 4TKNA 2KDFB 3ZRCA 2I2YA 2WXPA 5LLIA 3MC9A 2DYBA 3VR8B 2L76A 4ZDVA 1JMLA 1WH3A 3P42A 1FXIA 1HZ6A 1VZ8A 3QA8A 3K9OB 4W9FA 2KLGA 3ZO5B 5IA7A 4G0NB 2HJ1A 3AEGB 2LVOA 3ONSA 3Q8FA 1VR9A 2ZNVB 4EZKA 4URKA 3S2AA 1I4QA 1XF5L 1LXDA 1YQ3B 2CJNA 2IZVB 5JXVA 3P1MA 3CMMB 2CKHB 1IGDA 1RLFA 2KN5A 1WYWB 4WQOB 4WURA 2TSSA 2FCQA 2BKRB 4MGYE 1QOBA 1FO4A 3ZXVA 1MVKA 1HQRD 2JXXA 5FR3A 2LGXA 4FJYA 4A55A 1FMAD 4WIPA 2KKCA 3ZW3A 2KZRA 4MH8A 2D3GA 3PVLA 1KOTA 4LCDE 4KX6B 2NPTB 4XDDA 4USAA 4EUTA 2D3BA 2XN9C 3MC0B 3FILA 2WX1A 2NVUI 2PKOA 2W3SA 3B2FA 4MSMB 2K6DB 4PS3A 4EZLA 1QILA 4ZRJA 5EE9A 2WDVB 2MCNB 1TIFA 1TS3A 4TMAB 2DWQA 4MGKE 3Q8CA 3R2TA 3RNEC 2IYDB 4W9CA 2SEBD 5DPWA 3IAS1 1VCBA 3W1SC 4ANWA 1KRHA 4DHZB 1UBIA 3GZNI 4YTNB 2K1FA 1I4RA 4HCNB 1KTKA 4BOSC 1CMXB 3PLUA 2MBBB 4ZHPA 1T5XD 5EE0A 2IDYA 2JU6X 1UZXB 2AEHA 4YL8A 1F1HA 3PSEB 1RFKA 3VTWA 3KQ4A 1HTOA 1YJJA 4PK1A 1WRIA 2GOWA 4F8CB 3U7ZA 2KNBA 4EOYA 2FIFA 3BVGA 1E7UA 3AH7A 5KHQA 3AEFB 1OQYA 4WQMA 1I42A 2WP9B 4PT5A 2V9HA 1SJHD 5AEKB 1IUEA 3Q8EA 4KIKA 2GLSA 2V3NA 4TUUA 2KDBA 3DWMA 2J7QB 4K7WA 2MWSB 3Q3FA 3BYTB 3WANA 3ECIA 2L32A 2LJIA 4HJGE 1UH6A 4KDIC 2CHXA 3P4RB 3DBLI 4MEMA 4IKGA 2Z0DB 3RULA 2MQJA 1MI0A 3O13A 3HM3A 4MM3B 4EKUA 2KX3A 4NJCA 2KMCA 2Z8LA 1KM7A 1S3SG 1V2YA 2MJ3A 2O6VA 3FKYA 4I6NB 4W9EA 5AZFA 3VXWA 1R4MI 4NAWB 2W9NA 4NJ6A 3JSVA 2KTFA 3GE8C 2WGSA 2L7RA 5GMVA 3NUHB 3W1YA 3CIRB 4RF0A 3TSSA 4AUQC 2IY1B 3L4PA 2J0MA 3QHTA 4BBNF 1SGHA 1UNSA
chains in the Genus database with same CATH topology
2W3RA 1EWCA 3C8YA 1FD6A 1T6BX 2WDRB 3MJ5A 1HXYD 1L5PA 4N58A 1SE3A 1PGAA 2PLPA 1I7HA 1GOZA 4FXCA 2EELA 1I4PA 4A9AA 1AN8A 1OQRA 1PYWD 2GI9A 1FNUA 1KH0A 1NI3A 3B2GA 3WCQA 2V0GA 4YSZB 1KLUD 5FKAC 4WAFA 2ZW0A 2MJEA 1UGJA 1JWAD 4LK0M 2ACZB 4JPSA 4OHJA 1SXTA 5D3DA 2LEKA 2RPVA 2W54A 4IOIE 1JWUD 1C4AA 4AS1A 3B9JA 2AQ1B 1FEHA 1P7FA 1D5ZC 1NVID 1DOIA 1QOGA 1SIJA 2L83A 3AV8A 3Q8AA 1ENFA 3KLSX 1NEKB 1HZ5A 1XLQA 3AM9A 4OZAA 5GXGB 5BYRA 3VRAB 2WXMA 2H89B 1L6UA 4RH6A 1ZXIA 3HRDD 4NZLB 3EGRA 1V8CA 4N59A 2N0SB 4L2YA 3GP7A 1AYFA 2ICIA 3AE3B 4A6QA 2G1EA 3P63A 2HDEA 5BMGA 2BW2A 2SAKA 2H88B 3I9V1 4OVZA 3HUIA 4ZOHC 2WU5B 2WXNA 2BB6A 1KF6B 2KN4A 5D7GA 2LUMA 3V3XA 4ITKA 1AWDA 2AQ2B 1A70A 4RF1A 3SFEB 2OHFA 4RFBA 4RNAA 3PO0A 4HROA 3J9CA 5G5GA 2K22A 3ZJUA 2PW9A 4C56C 2IJ0A 1IBXA 1QKZA 1TY2A 1JWMD 4EE2A 3AEDB 3AE4B 1YMHE 2WXIA 3TEXA 3VQIA 1YN4A 2WXOA 4H2AA 2QJLA 2NMQA 3DWGC 1KLGD 2B76B 1I4XA 1I4GA 1GB4A 1KFYB 2IGDA 1QLBB 2NTSA 4NAMA 4YXDB 3P4QB 2MEKA 2QEJC 4LLGM 4KGSA 2FBWB 1SE2A 1FM0D 3AE1B 2RDGA 3TEWA 2DBYA 1R7SA 1MHXA 4TQ0A 1ZUD2 3AE6B 2BS2B 3FC4A 2BB5A 4N6EB 2LMCA 3GB1A 1YQ4B 3RFZB 1N5WA 3H8HA 4MACA 4KGRA 1L4ZB 4C7YA 4L1BA 2XNAC 1VZ7A 2PTLA 1PGXA 2PIAA 3AE2B 3R8BA 4RCOA 1EU4A 1BXTA 2DYMA 3NRZA 1NENB 2W82A 2Y5CA 4RGOS 4DXGA 1FCCC 1WXQA 2LGIA 4OZBA 1C78A 2J4XA 2JXTA 4HKQA 3AN1A 2G9HD 2WXJA 1RWSA 1TJEA 1I4HA 1P7EA 2JQRB 1N62A 3AE5B 2FE8A 1D5MC 3ETRA 5BYSA 3IAM1 1V97A 3BK2A 2M56B 1BMLC 1T3QA 3V05A 1ZXHA 5C3JB 1VJKA 1PUTA 3BYYB 4XDCA 5T8IA 1PFDA 2YEPB 3VRBB 1FFUA 5HG2A 4LTUA 1XLOA 2NTTA 2VZKB 1HEZE 3OWEB 1ZOYB 3NVWA 2N9KA 1JROA 2QSDA 1XLNA 1DYQA 5D3IB 1SBBB 3IT4B 3W5VB 1TS2A 1E0ZA 4XE0A 1K51A 2K0PA 2YEPF 4DQOC 2IGGA 2WS3B 2WXQA 2I38A 4OZCA 4TSSA 3MHZA 3KWVA 3BVZA 2WDQB 2INPE 2WNMA 4RGNA 5BMHA 3AECB 4B0MA 1QOFA 4YT0B 3NS1A 2AX5A 4HKZE 3AE7B 3T3NA 3HVZA 1XEEA 1MHHE 2N9LA 1GB1A 3NVYA 2VZKD 3EUB2 1YN3A 1C76A 5E6JA 1JALA 2K3UA 1CQVA 1L0YB 5HFYA 4C80A 1SE4A 1ZPSA 4UDUC 4KKIA 4YTMB 4CQNA 3R2IA 1IBXB 2BBCA 2CJOA 1CZPA 1E9MA 4ZRQA 1FRDA 1NYQA 5EE1A 3AEEB 2Q5WD 3BVMA 3U4EG 1V1OA 2Y5PA 2QMTA 1XCTL 4ARIA 1JQ4A 4YSXB 3NVVA 1VLBA 4WWMA 3BZDB 1SJED 2WXHA 2JYTA 3LYYA 1ROEA 2V4IB 4WH4A 4XWTA 4O1NA 1TS5A 3UI3A 1E6EB 1HA5A 2BS4B 2CU3A 1LO5D 5HI1A 2WXLA 5HHDG 1D5XC 1L4DB 1M4VA 2RMMA 3AE8B 5BYQA 1FRRA 2WLBA 1ESFA 1ZE3D 1F2RC 2LFIA 2W55A 5MPOA 1Y56A 2PVGC 3ZGZA 2IPKD 1STEA 1J7CA 1BUIC 1QQRA 2ONQA 1YNTE 1K52A 4YWGG 2I2YA 1NYRA 3W9CB 4B0EA 2WXPA 1FNWA 4HRSA 3VR8B 2N7JA 2L1AA 1JMLA 5AUIA 3AB5A 3SEBA 1AW7A 3VR9B 3P42A 1FXIA 3NZ3A 2QILA 1HZ6A 1F2RI 1VZ8A 1JW9D 3LB8C 1E10A 4P6VF 3AE9B 1XXGA 2R61A 2ZW1A 3W5UB 2JZPA 3AEGB 3Q8FA 2D5GA 1TKGA 1ACCA 1VR9A 4US9A 1SF0A 2BYTA 1FFVA 4JWSC 1I4QA 4TQ1A 1XF5L 1IGCA 4DXFA 1V1PA 1D6EC 1YQ3B 2CJNA 2JX5A 5JXVA 1XLPA 5BMIA 3P1MA 1RM6C 1GPXA 1IGDA 1DGJA 2K9XA 2X38A 3FAHA 1MPEA 1TS4A 4GDLB 2PMVA 1WYGA 1XCQL 1PDXA 3PZ7A 4WURA 1L6VA 2TSSA 1EU3A 2MJDA 3NVZA 4AQ7A 2MH7A 1JWBD 1N60A 4KKJA 3BK1A 2K5PA 5I4DA 3ZYYX 1QOBA 1FO4A 1MVKA 1ET9A 1FNVA 1SB3C 1YJIA 2Y3AA 5G5HA 1HQRD 1FIQA 2JSVX 3ZJVA 3N9YC 5FR3A 2KDMA 4A55A 3ZJTA 1FMAD 1FCLA 1VRAB 4WIPA 1SEBD 2E3TA 1F0ZA 4MH8A 1TKEA 2E6XA 4P16A 1ZP0B 2WXFA 3Q8BA 1RYJA 1XO3A 1C79A 1N61A 2KAJA 3AEAB 1F77A 4KX6B 4Q2JA 2AQ3B 4XDDA 3T3OA 1B9RA 4USAA 3U52E 1UUPA 1C4PA 3SR6A 2JWUA 2XN9C 2RDHA 3MC0B 1C77A 3FILA 3PZ8A 2PVOD 5LNK1 4JE3B 4GDKB 2PKOA 2W3SA 1ZDXA 3AMZA 3SFDB 4ZYSA 3B2FA 3IXSA 4L23A 4YTPB 1EM7A 1PGBA 3I57A 1QILA 3TEZA 5EE9A 2WDVB 3E9SA 3RPFC 1VZ6A 1OFFA 1TS3A 3TEYA 4TMAB 1UWMA 1J7AA 1N5XA 2DWQA 2LHEA 1QOAA 1UWXA 3Q8CA 3R2TA 5AUKA 1L0XB 2SEBD 3IAS1 1KRHA 2J53A 1CK1A 2INNE 4YTNB 1I4RA 1KTKA 5H8YE 4US8A 4ZHPA 1SSNA 1ET6A 1GAQB 4ZHOA 2KACA 4MT5A 1WSPA 2HTME 4GLSC 1T5XD 5TSSA 4A90A 5EE0A 1OQQA 2IDYA 4IDIA 2JU6X 2GRIA 2KWDA 1RFKA 1JRPA 3MP9A 3HVDA 3U2SC 2OEDA 3KQ4A 1TZOA 3ABVB 3URYA 4ARCA 1YJJA 1WRIA 2KQ4X 4D2KA 2BTEA 3KWLA 4ZRPA 1YN5A 3U7ZA 3W2DA 3BVGA 2J52A 3AEBB 3AH7A 1QF6A 4A8XC 4HEA1 2EKIA 3CWIA 1EWYC 3AEFB 4WQMA 3TUOA 1V1PB 2WP9B 2WXGA 1E7PB 1QT9A 1B1ZA 4PT5A 1ZDVA 1SJHD 5FK9C 1IUEA 1N63A 2L52A 2WU2B 3Q8EA 2V3NA 3Q69A 1WWTA 5H92C 3DWMA 1JCKB 4OW0A 2DYOA 3P4SB 3BYTB 4XWWA 2DLBA 3P4PB 2L32A 4JX1C 4J3OD 5EE3A 2LJIA 1TY0A 4HJGE 1DOXA 2IGHA 4KGTA 2M19A 4M0WA 4RGTA 1C4CA 1DOYA 1J7BA 3P4RB 1TKYA 1D4BA 3GS2A 2QIEB 3BIID 4IKGA 4C7ZA 4R3DA 1K53A 2FUG1 2GB1A 3LXFA 1MI0A 4JWUC 5C2TB 2J42A 3BWUD 4REZA 3O13A 3ZQ4A 3W1SA 4MM3B 4NJCA 3IT6B 4YSYB 2V3PA 2KMMA 2WXKA 2Z8LA 3FILB 2MJ3A 1L0VB 3E56A 1JWSD 1Q10A 4NAWB 2WXRA 2JYEA 2LHDA 2BT6A 1C9FA 1K50A 1WGKA 1FXAA 3MFGA 2M0AA 1TYGB 3EA6A 3NUHB 3CIRB 4RF0A 3TSSA 2WQYB 4RGMA 3L4PA 1CJEA 2BS3B 1UNSA 2ON8A 1VDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4Z B;  1QQR A;  1C4P A;  1L4D B;  1BML C; 
#chains in the Genus database with same CATH topology
 4XZ4 A;  4E71 A;  1HXY D;  1L5P A;  3SU8 X;  4N58 A;  1I4P A;  3ZNH B;  3U7D A;  2ZZP B;  4MJS B;  1KLU D;  1XT9 B;  1JWA D;  4LK0 M;  4OHJ A;  1C1Y B;  3R7R A;  3NJT A;  4W9H A;  3WAM A;  3SHQ A;  1DOI A;  1D3Z A;  2L83 A;  3AV8 A;  2V3S A;  3VUX A;  4OZA A;  5BYR A;  2WXM A;  2H89 B;  4HPM B;  4RH6 A;  1H4R A;  3HRD D;  2N4F A;  2MP2 A;  3GP7 A;  4GOC A;  4CHK A;  1YQB A;  3PT2 B;  2N9P C;  1P98 A;  3QCA A;  4PYU A;  3PHW B;  2V4L A;  4OVZ A;  3RCZ A;  2LUM A;  4ITK A;  2AQ2 B;  1TT5 B;  5E6P A;  2ZPN A;  3A1Q A;  4PS8 A;  1V49 A;  4XGA B;  2MRP A;  2PW9 A;  3O65 B;  4F1S A;  3VDZ A;  1QKZ A;  4EE2 A;  3VQI A;  2QJL A;  4M0W B;  4FA6 A;  2CR5 A;  1KFY B;  2IGD A;  3RNB C;  1QLB B;  2REX A;  4MGI E;  1EF5 A;  2BGF A;  2QEJ C;  3A9K A;  2DAF A;  2K8C A;  1HE8 A;  3ZVV A;  2BPS A;  1FM0 D;  1TBE A;  4HDO A;  2MX2 A;  3QX1 A;  3ZIM A;  4DHJ B;  4M8M A;  2QDF A;  5EDS A;  3R7Q A;  1L4Z B;  2PTL A;  2MSE D;  3Q3M C;  4FJV B;  1WI0 A;  2VH1 A;  4FHK A;  2W82 A;  2JXT A;  4HKQ A;  5C23 A;  4IM0 A;  1RWS A;  1N62 A;  2FE8 A;  3HHM A;  4P1C C;  2VH2 A;  3IAM 1;  4AP4 C;  4LNI A;  1ZXH A;  3PV1 A;  4LNF A;  4XC2 A;  3ZDT A;  1PFD A;  3BY4 B;  4LTU A;  3OWE B;  1HEZ E;  5D3I B;  1E0Z A;  1K51 A;  1WJU A;  2YEP F;  1I35 A;  2KT7 A;  3ML9 A;  2WXQ A;  2I38 A;  3MHZ A;  2JRH A;  4MM3 A;  2INP E;  2WNM A;  4NY0 A;  3DBH I;  3P2B A;  1QOF A;  4BKT A;  3JW0 X;  4DWF A;  1J0G A;  4A3O A;  2AX5 A;  2GBM A;  5JHB A;  3NVY A;  4E3C A;  3EUB 2;  1NDD A;  2VRR B;  3QWZ B;  5DPT A;  5FR6 A;  2K3U A;  1YOV B;  1CQV A;  1GG3 A;  2C5L C;  4KKI A;  3DOW A;  4YTM B;  4CQN A;  3R2I A;  1IBX B;  1E9M A;  1FRD A;  5EE1 A;  2Q5W D;  5L83 A;  4GDK A;  4ZYN A;  3QJZ A;  2Y5P A;  1WZ0 A;  4ARI A;  2NCN A;  3MJW A;  1VLB A;  2LZ6 A;  1SJE D;  4FLH A;  1IYF A;  2BF8 B;  4ANV A;  1V86 A;  1E6E B;  1YJ1 A;  2WXL A;  2DEN B;  3AE8 B;  5BYQ A;  1F2R C;  2YLM A;  2PVG C;  4GB9 A;  4C00 A;  1J7C A;  1BUI C;  2DZI A;  2DAJ A;  1K52 A;  1YX5 B;  2G3Q B;  2FCN A;  2KLC A;  4K3B A;  2N7J A;  3VR9 B;  5AZH A;  1R4N B;  3WAO A;  3MC8 A;  3LB8 C;  3ZUN A;  3AE9 B;  2R61 A;  2ZW1 A;  1VD2 A;  3W5U B;  3WAP A;  4XX5 A;  2BYT A;  3Q2A C;  4B9K A;  4E74 A;  5BMI A;  2CS4 A;  2GBR A;  3N1Z C;  2KJ6 A;  5D94 A;  1TS4 A;  2LXA A;  2PMV A;  2JY6 A;  3Q3J A;  1PDX A;  3PZ7 A;  4KVG B;  2MBH A;  1WJN A;  2MH7 A;  2K8B A;  3PHX B;  2LJ5 A;  3Q6B A;  1N60 A;  2EMT A;  3BK1 A;  2K5P A;  3WIM A;  2JZ3 B;  1YJI A;  2KDM A;  3ZJT A;  2L0T A;  1FCL A;  3PRP B;  3SD5 A;  2KTR B;  1F0Z A;  4LJP B;  1TKE A;  3H1U A;  2WXF A;  3Q3O C;  1N61 A;  2KAJ A;  3AEA B;  2AQ3 B;  3U52 E;  4K3C A;  3Q14 C;  3PZ8 A;  1UD7 A;  1Q1O A;  4JE3 B;  4HJK A;  3NZS A;  3A33 B;  3SFD B;  2KQ7 A;  3DVG Y;  3IXS A;  4YTP B;  3TEZ A;  2C7H A;  3E9S A;  1OFF A;  1WGD A;  4KSL C;  1N5X A;  4BVU C;  2LHE A;  3M62 B;  1QOA A;  4NJ7 A;  4M01 A;  1CK1 A;  2KFK A;  5H8Y E;  4US8 A;  1SSN A;  5TSS A;  3MHS D;  1XQQ A;  1OQQ A;  3ZNI D;  2GRI A;  2KWD A;  3MP9 A;  3HVD A;  1T0S C;  2O2V B;  4B95 A;  4ARC A;  1TZO A;  3AU4 A;  2R2O A;  4FUL A;  2KQ4 X;  4D2K A;  2BTE A;  1YN5 A;  2NBW B;  1QF6 A;  3RNC C;  3CWI A;  1EWY C;  1L7Y A;  1V1P B;  1WRD B;  4GN1 A;  3OAW A;  3T8M A;  2WU2 B;  2WDT B;  3RZF A;  2D10 A;  1H8C A;  2EKE C;  2K6Q A;  3AUL A;  1FPY A;  3PLV A;  3P4S B;  3PZD A;  2K8H A;  5C1Z A;  4XWW A;  2DLB A;  3P4P B;  1WMH B;  2KWU B;  5JHA A;  2KVZ A;  1TY0 A;  2IGH A;  5D6J B;  4RGT A;  1C4C A;  3C19 A;  1SE9 A;  2XBB C;  1D4B A;  3BII D;  2N1W A;  4R3D A;  1Q5W B;  2FUG 1;  5HKH A;  4DHZ E;  1TGZ B;  1WFY A;  3ZQ4 A;  3W1S A;  1EUV B;  2V3P A;  1WGY A;  2MW5 A;  5E6N A;  2Z59 B;  1C9F A;  1ISN A;  3EA6 A;  2XK5 B;  2JWZ A;  3ZLZ A;  3OG5 A;  3WAL A;  2ON8 A;  2W3R A;  1TZ1 A;  3MJ5 A;  2LAS A;  1I7H A;  4FXC A;  4A9A A;  1WGH A;  3L0W B;  4G50 A;  2V0G A;  4YSZ B;  1P9D U;  5FKA C;  2C7N B;  1UGJ A;  4JPS A;  1WE7 A;  4HPP A;  1SXT A;  2RPV A;  4LNO A;  2W54 A;  3H7P B;  2ASQ A;  1C4A A;  1AAR A;  2IO2 B;  2D07 B;  2HJ8 A;  1ENF A;  3KLS X;  1F9J A;  1NEK B;  1HZ5 A;  5GXG B;  1NI2 A;  2NBV B;  3EGR A;  4N59 A;  2JUO A;  3AU5 A;  3QAR A;  2ICI A;  3DPD A;  3AE3 B;  3UQB A;  2G1E A;  4K1R B;  2BW2 A;  2H88 B;  5IO9 A;  3ZXR A;  4ZOH C;  5D7G A;  4EZJ A;  2DNF A;  4QAY A;  4IM2 A;  1AWD A;  3SFE B;  4RM8 A;  2KDE B;  4RFB A;  3PO0 A;  4HRO A;  5G5G A;  4K81 A;  3BIN A;  3GZN B;  1YMH E;  2WXI A;  3TEX A;  1Z5S B;  4H2A A;  4WJQ A;  3DWG C;  4GIV A;  3NY5 A;  3UGB B;  1I4G A;  3TIX A;  2OOB B;  4YXD B;  4LNN A;  4EEW A;  2M4N A;  4LNK A;  2RDB C;  3AE1 B;  1PQS A;  2B3A A;  1V80 A;  4WWP A;  3ZRF A;  1OGW A;  1IP9 A;  4NQK E;  1ZUD 2;  1WY8 A;  4N6E B;  4ICU A;  2O2V A;  3H8H A;  4MAC A;  4C7Y A;  5J17 A;  1VZ7 A;  1PGX A;  2PIA A;  5D2M B;  1BT0 A;  3V61 A;  2DYM A;  1FXT B;  2Y5C A;  4DXG A;  4DXA B;  4OZB A;  2G9H D;  1WX8 A;  1TJE A;  1P7E A;  2KMA A;  1D5M C;  3ETR A;  4FN2 A;  2N7D A;  1V97 A;  2HD5 B;  4OVV A;  2IY0 B;  5C3J B;  1WM3 A;  3DBL B;  4HK2 A;  1WMH A;  3KVF B;  1HTQ A;  2MBE A;  3B1L X;  2LRW A;  1ZOY B;  3VH4 B;  4NQL B;  3JYU A;  2QSD A;  3APC A;  1DYQ A;  1TS2 A;  4XE0 A;  2G4D B;  4DQO C;  4TSS A;  3DVN V;  2CHW A;  2QC8 A;  3KWV A;  4FBJ B;  5BMH A;  3NS1 A;  3AE7 B;  3RUI B;  3ZTC A;  3HVZ A;  1XEE A;  2N9L A;  3EEC A;  2D3C A;  2KDI A;  5E6J A;  4OVU A;  1L0Y B;  1ZPS A;  3ZDM C;  2NPT A;  2BBC A;  2KWC A;  2IBI B;  2UWQ A;  3AEE B;  5CHW A;  1V1O A;  3DDC B;  2QMT A;  5KHO A;  1JQ4 A;  2BWF A;  3NVV A;  2JYT A;  1ROE A;  2V4I B;  4XWT A;  4O1N A;  4DDG D;  1MG8 A;  4ACF A;  3UI3 A;  2IO1 B;  1A5R A;  2FID A;  1D5X C;  1L4D B;  1M4V A;  2RMM A;  3N32 A;  1V81 A;  1E8Z A;  4IWQ A;  3ZGZ A;  2JPH A;  3RNG C;  1QQR A;  1YNT E;  3KW5 B;  1FNW A;  4II3 B;  3CSF A;  4HRS A;  4LDT D;  4S0R A;  2MHJ A;  3AB5 A;  3NZU A;  3TJP A;  2LVP A;  3NZ3 A;  4I6L B;  4PS7 A;  1E10 A;  1N6Z A;  1XXG A;  2M0X A;  4C4V B;  4WJN A;  4US9 A;  4JL9 A;  3VTU A;  1FFV A;  4JWS C;  2GMI C;  1IGC A;  1D6E C;  2V1Y A;  1E5W A;  2J0J A;  4FJZ A;  2IND C;  1J8C A;  1GPX A;  2K9X A;  2UYZ B;  3FAH A;  4GDL B;  4GMV A;  1WYG A;  1XCQ L;  3EC8 A;  1RRB A;  1U4A A;  3NVZ A;  2DZK A;  5I4D A;  2BVC A;  1ET9 A;  1FNV A;  1SB3 C;  2Y3A A;  2JSV X;  4IW0 A;  2K25 A;  2EMS A;  2NR2 A;  1SEB D;  4K7S A;  3U8Z A;  2E6X A;  2JZZ A;  1XO3 A;  1C79 A;  1F77 A;  4Q2J A;  1LQB A;  1UUP A;  1C4P A;  3SR6 A;  4BAX A;  5TR5 A;  2RDH A;  1C77 A;  4WWO A;  4KV2 A;  2PVO D;  5LNK 1;  4M02 A;  4GU2 A;  4NAW A;  4W9I A;  4K7U A;  1ZDX A;  2FAZ A;  3UIN B;  4ZYS A;  1T0Y A;  4L23 A;  4HVB A;  1EM7 A;  1PGB A;  3I57 A;  3TBL D;  4AOF A;  1VZ6 A;  2KAN A;  3KUZ A;  1UWM A;  2LGS A;  2JVC A;  2YVC A;  3L08 A;  4IM3 A;  5AUK A;  3PTF C;  2BYF A;  4ASW C;  2N9E B;  3CST A;  2N7E A;  3HK0 A;  3R66 C;  3DHH C;  3DBH B;  4MJS A;  1LFD A;  4ZHO A;  1GAQ B;  2IO3 B;  2LGY A;  2KAC A;  4MT5 A;  1WSP A;  2L00 B;  2LWP A;  4A90 A;  4IDI A;  1WXV A;  3U2S C;  2OED A;  3URY A;  3ABV B;  4ICV A;  1MFW A;  4G11 A;  1WJ4 A;  2D11 A;  5IOI A;  3V6C B;  1UBQ A;  3W2D A;  2WYQ A;  5CHV C;  1R4N I;  2J52 A;  3RI7 C;  3U30 A;  3Q3N C;  4A8X C;  4HEA 1;  2EKI A;  2LI5 A;  2WXG A;  4AJY B;  3KH0 A;  1WGR A;  1QT9 A;  1ZDV A;  4J6I A;  2GBN A;  2L52 A;  1C3T A;  2INC C;  5H92 C;  3R3M A;  3RNF C;  3SDL C;  1JCK B;  2FCS A;  2NBU A;  4JX1 C;  1WXA A;  3ZNZ B;  5EE3 A;  4ZRK A;  2MBQ A;  4M0W A;  3K9P B;  4TV3 A;  2QIE B;  4N9F 4;  4C7Z A;  3A4S C;  1K53 A;  5BO4 B;  2GB1 A;  3LXF A;  4JWU C;  5C2T B;  1S1Q B;  2J42 A;  3NHE B;  4REZ A;  3N30 A;  3B0A A;  3IT6 B;  2L3Z A;  3FIL B;  3RD2 A;  3E56 A;  1JWS D;  1Q10 A;  3A9J B;  1MJD A;  1WJ6 A;  3KYD D;  4CO7 A;  1MG4 A;  1OTR B;  5G2N A;  1K50 A;  3MFG A;  2M0A A;  1TYG B;  2JRI B;  2WQY B;  2KJH B;  3V60 A;  1XD3 B;  3D32 A;  1EWC A;  4AWJ A;  2KC1 A;  2N9X A;  2BQQ A;  3L54 A;  3WA0 A;  1SE3 A;  2PLP A;  1GOZ A;  2EEL A;  1WX7 A;  1OQR A;  3VH3 B;  1PYW D;  2WX0 A;  2GI9 A;  1FNU A;  1NI3 A;  3B2G A;  4G3X B;  5J2R A;  4IWP A;  2ZW0 A;  2MJE A;  2ACZ B;  5D3D A;  4IG7 B;  4M8N A;  2LEK A;  1Z2M A;  1JWU D;  4AS1 A;  3B9J A;  2LXC A;  1T0R C;  1FEH A;  1D5Z C;  4BKS A;  3NOB A;  3HIZ A;  3UIO B;  1XLQ A;  3AM9 A;  3JVZ X;  5CHF A;  2PE9 A;  3VRA B;  5LXI B;  4JIO U;  3L17 A;  4NZL B;  3AXC A;  1YX6 B;  2N0S B;  4L2Y A;  4ANU A;  3GOE A;  3QIJ A;  4A6Q A;  1JRU A;  2DHZ A;  2HDE A;  5BMG A;  2SAK A;  2IO0 B;  2WXN A;  2WWZ A;  2KN4 A;  4XYC A;  4KIK B;  3V3X A;  2M1M A;  2G45 B;  2ZPY A;  3J9C A;  2KWV B;  1P1A A;  4C56 C;  3DHI C;  1IBX A;  1TY2 A;  3AED B;  3AE4 B;  1E8W A;  1YN4 A;  2RR9 A;  5IKC M;  2AL6 A;  1KLG D;  2B76 B;  2NTS A;  4NAM A;  4RM9 A;  3P4Q B;  2MEK A;  4LLG M;  4M00 A;  5E6O A;  4KGS A;  2FBW B;  3DBR B;  4BBN C;  3TEW A;  4HPL B;  2DZM A;  2BS2 B;  3FC4 A;  2O6V B;  1EO6 A;  3GB1 A;  3I5J C;  3RFZ B;  3JSV B;  4DDI D;  3AE2 B;  3R8B A;  1SIF A;  1EU4 A;  1BXT A;  1RFA A;  3NRZ A;  1OEY J;  2WHI A;  2FUH B;  5LXH A;  5IN7 A;  4RGO S;  2Y5B B;  1FCC C;  2ZCC A;  2A4Z A;  4MGZ E;  1C78 A;  2J4X A;  5CTR C;  2LVQ A;  2K39 A;  3IFW B;  2JT4 B;  2WXJ A;  2QHO A;  3N3K B;  3IBE A;  3X23 A;  3L16 A;  5BYS A;  2GBK A;  2RGF A;  1L2N A;  2DX5 B;  3BK2 A;  3V05 A;  3MTN B;  4NNJ B;  1VJK A;  1PUT A;  3QAQ A;  2RPQ A;  1E90 A;  5HG2 A;  1E8Y A;  3VFK A;  2NTT A;  3IG3 A;  4HCP B;  1YD8 U;  3L10 B;  2N9K A;  3NVW A;  4W9L A;  3W5V B;  1SBB B;  3IT4 B;  2IGG A;  2M17 A;  2PPH A;  2R2Q A;  2KD0 A;  2MP2 B;  2BYV E;  4RGN A;  2QCZ A;  3AEC B;  4YT0 B;  2KHW B;  3A9J A;  1GB1 A;  2L8J A;  5IP4 D;  2LUE A;  2VZK D;  2KTR A;  1C76 A;  3A1Q B;  1SE4 A;  2N1V A;  2CJO A;  1CZP A;  3U4E G;  4W9D A;  5IAA C;  1XCT L;  1WXM A;  3PGE A;  4JLC A;  3APF A;  3A9K B;  4LDT B;  4JGH B;  2AWT A;  4WH4 A;  5JZE B;  1P0R A;  1WR6 E;  1V5T A;  1UF0 A;  1NBF C;  4KZ0 A;  2CU3 A;  4A3P A;  5HI1 A;  5HHD G;  1ESF A;  1ZE3 D;  4P1B C;  2KX0 A;  2MBO A;  2UU7 A;  2KK8 A;  5DPS A;  2IPK D;  3HM6 X;  3QC8 B;  1YIW A;  2ONQ A;  1KJT A;  4YWG G;  1NYR A;  3W9C B;  4B0E A;  4GXB A;  3B08 A;  4FAD A;  2L1A A;  5AUI A;  3SEB A;  2M8S A;  1AW7 A;  2HE7 A;  2QIL A;  1F2R I;  1JW9 D;  4IC7 B;  4P6V F;  2G4S A;  4ZRI A;  2JZP A;  3M3J A;  2D5G A;  3ZTD A;  2KVR A;  2KJR A;  1TKG A;  1ACC A;  1SF0 A;  3CF6 E;  2JF5 A;  3TMP B;  4TQ1 A;  2A5U A;  2KYW A;  4DXF A;  1V1P A;  3DHG C;  2BKF A;  2JX5 A;  1XLP A;  4II2 B;  1RM6 C;  1DGJ A;  2X38 A;  2O6V D;  1MPE A;  4ANX A;  3VTV A;  4HDQ A;  4X57 B;  1L6V A;  1EU3 A;  2MJD A;  4AQ7 A;  3KUD B;  3DVN U;  1JWB D;  3EFU A;  3ML8 A;  4FHJ A;  2C60 A;  4KKJ A;  1WR1 A;  3V6E B;  3ZYY X;  2HTH A;  4A20 A;  3OLM D;  3H9D A;  3DQV A;  5G5H A;  1FIQ A;  3ZJV A;  3N9Y C;  3VUW A;  1OEY A;  1VRA B;  4P7I A;  1E7V A;  2E3T A;  3KYC D;  1R4M B;  4P16 A;  1ZP0 B;  3Q8B A;  1RYJ A;  3TCA A;  2PEA A;  3T3O A;  1B9R A;  1GNU A;  2JWU A;  4KZC A;  3N1Y C;  4GDK B;  2J0K A;  3UF8 A;  3AMZ A;  4CYE A;  3RMK C;  3RT3 B;  2XK5 A;  3RPF C;  1T0Q C;  1GUA B;  3TEY A;  1J7A A;  2Z0E B;  1KLV A;  1UWX A;  1L0X B;  2MLB A;  4RMA A;  2J53 A;  3QK0 A;  2INN E;  1GC6 A;  2AL3 A;  2CU1 A;  2KFJ A;  1ET6 A;  4GLS C;  2HTM E;  4DK5 A;  3H7P A;  1EF1 A;  1JRP A;  2GBJ A;  2ZNV C;  3KUC B;  4GSW A;  3PPA A;  3LJ3 A;  3KWL A;  4ZRP A;  4AJW A;  3IHP C;  3M63 B;  5DPR A;  2D3A A;  3AEB B;  2I1K A;  1Q0W B;  4BFR A;  4S17 A;  3TUO A;  2LRU A;  1E7P B;  1B1Z A;  5FK9 C;  4BZA A;  1N63 A;  4W9K A;  3Q69 A;  4EFO A;  1WWT A;  3OJ4 B;  4OW0 A;  2DYO A;  3DBS A;  2I1J A;  4BOZ B;  3C0R B;  3VVW B;  1UGM A;  3NG0 A;  4J3O D;  4HXD A;  2ZEQ A;  4LJO B;  1DOX A;  4KGT A;  2M19 A;  1DOY A;  1J7B A;  1TKY A;  3GS2 A;  2NS5 A;  2KQS A;  3NS8 A;  3TL5 A;  3ZNG C;  3BWU D;  2CHZ A;  3VHT C;  3DVG X;  4YSY B;  3UQA A;  5G55 A;  1Y8R C;  2KMM A;  2WXK A;  1L0V B;  2RD0 A;  2KO3 A;  2WXR A;  1X1M A;  2JYE A;  2RSU A;  2LHD A;  1TTN A;  2BT6 A;  1WGK A;  1FXA A;  1WGG A;  4WAA A;  4RGM A;  3I3T B;  1CJE A;  4IUM B;  4W9J A;  2BS3 B;  1VDV A;  3C8Y A;  1FD6 A;  1T6B X;  2WDR B;  2KXJ A;  3OJ3 A;  3QQ8 B;  1PGA A;  1AN8 A;  1V6E A;  2KFK B;  3RZW C;  1KH0 A;  3WCQ A;  2XEW A;  4WAF A;  2MA9 B;  3DCG A;  4F7Z A;  4IOI E;  2AQ1 B;  3LDZ E;  4BKG A;  1P7F A;  1NVI D;  3ALB A;  1GC7 A;  1QOG A;  1SIJ A;  3Q8A A;  2DZJ A;  1WX9 A;  1J19 A;  3PRM B;  4MEL A;  3PS6 A;  4HLE A;  1L6U A;  1ZXI A;  3EHV A;  1V8C A;  5JH5 C;  1IPG A;  1AYF A;  4NPN A;  4W9G A;  1LGR A;  3P63 A;  3PRE A;  3I9V 1;  2L05 A;  3HUI A;  2WU5 B;  2BB6 A;  1KF6 B;  2ZCB A;  3IVF A;  2LGD A;  2OJR A;  4GGQ A;  4I6P A;  1UEL A;  1A70 A;  4RF1 A;  2X8X X;  4IWO A;  3N20 C;  2OHF A;  4RNA A;  2K22 A;  3ZJU A;  2C9W B;  2IJ0 A;  1JWM D;  2WXO A;  2NMQ A;  2C7M B;  4DBG A;  1V5O A;  2PJH A;  1I4X A;  1GB4 A;  2KOX A;  3VAW A;  2AYO B;  2LD9 A;  1SE2 A;  2OJW A;  2RDG A;  2DBY A;  1R7S A;  1MHX A;  4TQ0 A;  3AE6 B;  4MSQ B;  1K8R B;  1ZGU B;  2BB5 A;  3RNA C;  2LMC A;  1G6J A;  2BYE A;  1YQ4 B;  4PYZ A;  1N5W A;  4MDK E;  3H7S A;  4KGR A;  4L1B A;  2XNA C;  2ZVO A;  4RCO A;  3L13 A;  1NEN B;  2D2Q A;  1GJZ A;  1WXQ A;  3RYT A;  2LGI A;  3APD A;  4WJO A;  3AN1 A;  1M94 A;  1I4H A;  2JQR B;  4DHJ D;  3AE5 B;  4MH0 E;  4KSK C;  2KC2 A;  3N1X C;  2M56 B;  1BML C;  3A4R A;  1T3Q A;  3ENE A;  4C4V A;  3BYY B;  5T8I A;  4XDC A;  3AI5 A;  3H6N A;  2YEP B;  3VRB B;  4WWN A;  1FFU A;  5J18 A;  1WIA A;  1XLO A;  2BWE S;  2VZK B;  1WZ3 A;  4B6W A;  3V62 A;  1E8X A;  1JRO A;  1XLN A;  3ZKJ C;  3UIP B;  4GDL A;  4HWI B;  1WE6 A;  2K0P A;  2WS3 B;  4OZC A;  4JQW C;  1LM8 B;  3BVZ A;  2WDQ B;  1QZE A;  2ZJD A;  4WJP A;  4B0M A;  1F52 A;  4HKZ E;  1RAX A;  3T3N A;  1MHH E;  2PE6 B;  3VUY A;  5DCN A;  2L0F A;  3PRZ A;  1YN3 A;  1WF9 A;  1JAL A;  4BKS D;  1P3Q U;  5HFY A;  4C80 A;  4UDU C;  3I63 C;  3M95 A;  5CX3 A;  4ZRQ A;  1NYQ A;  1WM2 A;  3BVM A;  2FNJ B;  5AZG A;  5L95 C;  3GE3 C;  4YSX B;  2ZVN A;  3T9L A;  2FCM A;  4KDL B;  4WWM A;  3BZD B;  2WXH A;  3LYY A;  3X0W A;  1ZKH A;  1WXS A;  1TS5 A;  1HA5 A;  3RN9 C;  2BS4 B;  1LO5 D;  1ZW7 A;  1FRR A;  2WLB A;  3DBR I;  2LFI A;  2W55 A;  3EFC A;  1Y56 A;  5MPO A;  1STE A;  1V9J A;  4TKN A;  2KDF B;  3ZRC A;  2I2Y A;  2WXP A;  5LLI A;  3MC9 A;  2DYB A;  3VR8 B;  2L76 A;  4ZDV A;  1JML A;  1WH3 A;  3P42 A;  1FXI A;  1HZ6 A;  1VZ8 A;  3QA8 A;  3K9O B;  4W9F A;  2KLG A;  3ZO5 B;  5IA7 A;  4G0N B;  2HJ1 A;  3AEG B;  2LVO A;  3ONS A;  3Q8F A;  1VR9 A;  2ZNV B;  4EZK A;  4URK A;  3S2A A;  1I4Q A;  1XF5 L;  1LXD A;  1YQ3 B;  2CJN A;  2IZV B;  5JXV A;  3P1M A;  3CMM B;  2CKH B;  1IGD A;  1RLF A;  2KN5 A;  1WYW B;  4WQO B;  4WUR A;  2TSS A;  2FCQ A;  2BKR B;  4MGY E;  1QOB A;  1FO4 A;  3ZXV A;  1MVK A;  1HQR D;  2JXX A;  5FR3 A;  2LGX A;  4FJY A;  4A55 A;  1FMA D;  4WIP A;  2KKC A;  3ZW3 A;  2KZR A;  4MH8 A;  2D3G A;  3PVL A;  1KOT A;  4LCD E;  4KX6 B;  2NPT B;  4XDD A;  4USA A;  4EUT A;  2D3B A;  2XN9 C;  3MC0 B;  3FIL A;  2WX1 A;  2NVU I;  2PKO A;  2W3S A;  3B2F A;  4MSM B;  2K6D B;  4PS3 A;  4EZL A;  1QIL A;  4ZRJ A;  5EE9 A;  2WDV B;  2MCN B;  1TIF A;  1TS3 A;  4TMA B;  2DWQ A;  4MGK E;  3Q8C A;  3R2T A;  3RNE C;  2IYD B;  4W9C A;  2SEB D;  5DPW A;  3IAS 1;  1VCB A;  3W1S C;  4ANW A;  1KRH A;  4DHZ B;  1UBI A;  3GZN I;  4YTN B;  2K1F A;  1I4R A;  4HCN B;  1KTK A;  4BOS C;  1CMX B;  3PLU A;  2MBB B;  4ZHP A;  1T5X D;  5EE0 A;  2IDY A;  2JU6 X;  1UZX B;  2AEH A;  4YL8 A;  1F1H A;  3PSE B;  1RFK A;  3VTW A;  3KQ4 A;  1HTO A;  1YJJ A;  4PK1 A;  1WRI A;  2GOW A;  4F8C B;  3U7Z A;  2KNB A;  4EOY A;  2FIF A;  3BVG A;  1E7U A;  3AH7 A;  5KHQ A;  3AEF B;  1OQY A;  4WQM A;  1I42 A;  2WP9 B;  4PT5 A;  2V9H A;  1SJH D;  5AEK B;  1IUE A;  3Q8E A;  4KIK A;  2GLS A;  2V3N A;  4TUU A;  2KDB A;  3DWM A;  2J7Q B;  4K7W A;  2MWS B;  3Q3F A;  3BYT B;  3WAN A;  3ECI A;  2L32 A;  2LJI A;  4HJG E;  1UH6 A;  4KDI C;  2CHX A;  3P4R B;  3DBL I;  4MEM A;  4IKG A;  2Z0D B;  3RUL A;  2MQJ A;  1MI0 A;  3O13 A;  3HM3 A;  4MM3 B;  4EKU A;  2KX3 A;  4NJC A;  2KMC A;  2Z8L A;  1KM7 A;  1S3S G;  1V2Y A;  2MJ3 A;  2O6V A;  3FKY A;  4I6N B;  4W9E A;  5AZF A;  3VXW A;  1R4M I;  4NAW B;  2W9N A;  4NJ6 A;  3JSV A;  2KTF A;  3GE8 C;  2WGS A;  2L7R A;  5GMV A;  3NUH B;  3W1Y A;  3CIR B;  4RF0 A;  3TSS A;  4AUQ C;  2IY1 B;  3L4P A;  2J0M A;  3QHT A;  4BBN F;  1SGH A;  1UNS A; 
#chains in the Genus database with same CATH homology
 2W3R A;  1EWC A;  3C8Y A;  1FD6 A;  1T6B X;  2WDR B;  3MJ5 A;  1HXY D;  1L5P A;  4N58 A;  1SE3 A;  1PGA A;  2PLP A;  1I7H A;  1GOZ A;  4FXC A;  2EEL A;  1I4P A;  4A9A A;  1AN8 A;  1OQR A;  1PYW D;  2GI9 A;  1FNU A;  1KH0 A;  1NI3 A;  3B2G A;  3WCQ A;  2V0G A;  4YSZ B;  1KLU D;  5FKA C;  4WAF A;  2ZW0 A;  2MJE A;  1UGJ A;  1JWA D;  4LK0 M;  2ACZ B;  4JPS A;  4OHJ A;  1SXT A;  5D3D A;  2LEK A;  2RPV A;  2W54 A;  4IOI E;  1JWU D;  1C4A A;  4AS1 A;  3B9J A;  2AQ1 B;  1FEH A;  1P7F A;  1D5Z C;  1NVI D;  1DOI A;  1QOG A;  1SIJ A;  2L83 A;  3AV8 A;  3Q8A A;  1ENF A;  3KLS X;  1NEK B;  1HZ5 A;  1XLQ A;  3AM9 A;  4OZA A;  5GXG B;  5BYR A;  3VRA B;  2WXM A;  2H89 B;  1L6U A;  4RH6 A;  1ZXI A;  3HRD D;  4NZL B;  3EGR A;  1V8C A;  4N59 A;  2N0S B;  4L2Y A;  3GP7 A;  1AYF A;  2ICI A;  3AE3 B;  4A6Q A;  2G1E A;  3P63 A;  2HDE A;  5BMG A;  2BW2 A;  2SAK A;  2H88 B;  3I9V 1;  4OVZ A;  3HUI A;  4ZOH C;  2WU5 B;  2WXN A;  2BB6 A;  1KF6 B;  2KN4 A;  5D7G A;  2LUM A;  3V3X A;  4ITK A;  1AWD A;  2AQ2 B;  1A70 A;  4RF1 A;  3SFE B;  2OHF A;  4RFB A;  4RNA A;  3PO0 A;  4HRO A;  3J9C A;  5G5G A;  2K22 A;  3ZJU A;  2PW9 A;  4C56 C;  2IJ0 A;  1IBX A;  1QKZ A;  1TY2 A;  1JWM D;  4EE2 A;  3AED B;  3AE4 B;  1YMH E;  2WXI A;  3TEX A;  3VQI A;  1YN4 A;  2WXO A;  4H2A A;  2QJL A;  2NMQ A;  3DWG C;  1KLG D;  2B76 B;  1I4X A;  1I4G A;  1GB4 A;  1KFY B;  2IGD A;  1QLB B;  2NTS A;  4NAM A;  4YXD B;  3P4Q B;  2MEK A;  2QEJ C;  4LLG M;  4KGS A;  2FBW B;  1SE2 A;  1FM0 D;  3AE1 B;  2RDG A;  3TEW A;  2DBY A;  1R7S A;  1MHX A;  4TQ0 A;  1ZUD 2;  3AE6 B;  2BS2 B;  3FC4 A;  2BB5 A;  4N6E B;  2LMC A;  3GB1 A;  1YQ4 B;  3RFZ B;  1N5W A;  3H8H A;  4MAC A;  4KGR A;  1L4Z B;  4C7Y A;  4L1B A;  2XNA C;  1VZ7 A;  2PTL A;  1PGX A;  2PIA A;  3AE2 B;  3R8B A;  4RCO A;  1EU4 A;  1BXT A;  2DYM A;  3NRZ A;  1NEN B;  2W82 A;  2Y5C A;  4RGO S;  4DXG A;  1FCC C;  1WXQ A;  2LGI A;  4OZB A;  1C78 A;  2J4X A;  2JXT A;  4HKQ A;  3AN1 A;  2G9H D;  2WXJ A;  1RWS A;  1TJE A;  1I4H A;  1P7E A;  2JQR B;  1N62 A;  3AE5 B;  2FE8 A;  1D5M C;  3ETR A;  5BYS A;  3IAM 1;  1V97 A;  3BK2 A;  2M56 B;  1BML C;  1T3Q A;  3V05 A;  1ZXH A;  5C3J B;  1VJK A;  1PUT A;  3BYY B;  4XDC A;  5T8I A;  1PFD A;  2YEP B;  3VRB B;  1FFU A;  5HG2 A;  4LTU A;  1XLO A;  2NTT A;  2VZK B;  1HEZ E;  3OWE B;  1ZOY B;  3NVW A;  2N9K A;  1JRO A;  2QSD A;  1XLN A;  1DYQ A;  5D3I B;  1SBB B;  3IT4 B;  3W5V B;  1TS2 A;  1E0Z A;  4XE0 A;  1K51 A;  2K0P A;  2YEP F;  4DQO C;  2IGG A;  2WS3 B;  2WXQ A;  2I38 A;  4OZC A;  4TSS A;  3MHZ A;  3KWV A;  3BVZ A;  2WDQ B;  2INP E;  2WNM A;  4RGN A;  5BMH A;  3AEC B;  4B0M A;  1QOF A;  4YT0 B;  3NS1 A;  2AX5 A;  4HKZ E;  3AE7 B;  3T3N A;  3HVZ A;  1XEE A;  1MHH E;  2N9L A;  1GB1 A;  3NVY A;  2VZK D;  3EUB 2;  1YN3 A;  1C76 A;  5E6J A;  1JAL A;  2K3U A;  1CQV A;  1L0Y B;  5HFY A;  4C80 A;  1SE4 A;  1ZPS A;  4UDU C;  4KKI A;  4YTM B;  4CQN A;  3R2I A;  1IBX B;  2BBC A;  2CJO A;  1CZP A;  1E9M A;  4ZRQ A;  1FRD A;  1NYQ A;  5EE1 A;  3AEE B;  2Q5W D;  3BVM A;  3U4E G;  1V1O A;  2Y5P A;  2QMT A;  1XCT L;  4ARI A;  1JQ4 A;  4YSX B;  3NVV A;  1VLB A;  4WWM A;  3BZD B;  1SJE D;  2WXH A;  2JYT A;  3LYY A;  1ROE A;  2V4I B;  4WH4 A;  4XWT A;  4O1N A;  1TS5 A;  3UI3 A;  1E6E B;  1HA5 A;  2BS4 B;  2CU3 A;  1LO5 D;  5HI1 A;  2WXL A;  5HHD G;  1D5X C;  1L4D B;  1M4V A;  2RMM A;  3AE8 B;  5BYQ A;  1FRR A;  2WLB A;  1ESF A;  1ZE3 D;  1F2R C;  2LFI A;  2W55 A;  5MPO A;  1Y56 A;  2PVG C;  3ZGZ A;  2IPK D;  1STE A;  1J7C A;  1BUI C;  1QQR A;  2ONQ A;  1YNT E;  1K52 A;  4YWG G;  2I2Y A;  1NYR A;  3W9C B;  4B0E A;  2WXP A;  1FNW A;  4HRS A;  3VR8 B;  2N7J A;  2L1A A;  1JML A;  5AUI A;  3AB5 A;  3SEB A;  1AW7 A;  3VR9 B;  3P42 A;  1FXI A;  3NZ3 A;  2QIL A;  1HZ6 A;  1F2R I;  1VZ8 A;  1JW9 D;  3LB8 C;  1E10 A;  4P6V F;  3AE9 B;  1XXG A;  2R61 A;  2ZW1 A;  3W5U B;  2JZP A;  3AEG B;  3Q8F A;  2D5G A;  1TKG A;  1ACC A;  1VR9 A;  4US9 A;  1SF0 A;  2BYT A;  1FFV A;  4JWS C;  1I4Q A;  4TQ1 A;  1XF5 L;  1IGC A;  4DXF A;  1V1P A;  1D6E C;  1YQ3 B;  2CJN A;  2JX5 A;  5JXV A;  1XLP A;  5BMI A;  3P1M A;  1RM6 C;  1GPX A;  1IGD A;  1DGJ A;  2K9X A;  2X38 A;  3FAH A;  1MPE A;  1TS4 A;  4GDL B;  2PMV A;  1WYG A;  1XCQ L;  1PDX A;  3PZ7 A;  4WUR A;  1L6V A;  2TSS A;  1EU3 A;  2MJD A;  3NVZ A;  4AQ7 A;  2MH7 A;  1JWB D;  1N60 A;  4KKJ A;  3BK1 A;  2K5P A;  5I4D A;  3ZYY X;  1QOB A;  1FO4 A;  1MVK A;  1ET9 A;  1FNV A;  1SB3 C;  1YJI A;  2Y3A A;  5G5H A;  1HQR D;  1FIQ A;  2JSV X;  3ZJV A;  3N9Y C;  5FR3 A;  2KDM A;  4A55 A;  3ZJT A;  1FMA D;  1FCL A;  1VRA B;  4WIP A;  1SEB D;  2E3T A;  1F0Z A;  4MH8 A;  1TKE A;  2E6X A;  4P16 A;  1ZP0 B;  2WXF A;  3Q8B A;  1RYJ A;  1XO3 A;  1C79 A;  1N61 A;  2KAJ A;  3AEA B;  1F77 A;  4KX6 B;  4Q2J A;  2AQ3 B;  4XDD A;  3T3O A;  1B9R A;  4USA A;  3U52 E;  1UUP A;  1C4P A;  3SR6 A;  2JWU A;  2XN9 C;  2RDH A;  3MC0 B;  1C77 A;  3FIL A;  3PZ8 A;  2PVO D;  5LNK 1;  4JE3 B;  4GDK B;  2PKO A;  2W3S A;  1ZDX A;  3AMZ A;  3SFD B;  4ZYS A;  3B2F A;  3IXS A;  4L23 A;  4YTP B;  1EM7 A;  1PGB A;  3I57 A;  1QIL A;  3TEZ A;  5EE9 A;  2WDV B;  3E9S A;  3RPF C;  1VZ6 A;  1OFF A;  1TS3 A;  3TEY A;  4TMA B;  1UWM A;  1J7A A;  1N5X A;  2DWQ A;  2LHE A;  1QOA A;  1UWX A;  3Q8C A;  3R2T A;  5AUK A;  1L0X B;  2SEB D;  3IAS 1;  1KRH A;  2J53 A;  1CK1 A;  2INN E;  4YTN B;  1I4R A;  1KTK A;  5H8Y E;  4US8 A;  4ZHP A;  1SSN A;  1ET6 A;  1GAQ B;  4ZHO A;  2KAC A;  4MT5 A;  1WSP A;  2HTM E;  4GLS C;  1T5X D;  5TSS A;  4A90 A;  5EE0 A;  1OQQ A;  2IDY A;  4IDI A;  2JU6 X;  2GRI A;  2KWD A;  1RFK A;  1JRP A;  3MP9 A;  3HVD A;  3U2S C;  2OED A;  3KQ4 A;  1TZO A;  3ABV B;  3URY A;  4ARC A;  1YJJ A;  1WRI A;  2KQ4 X;  4D2K A;  2BTE A;  3KWL A;  4ZRP A;  1YN5 A;  3U7Z A;  3W2D A;  3BVG A;  2J52 A;  3AEB B;  3AH7 A;  1QF6 A;  4A8X C;  4HEA 1;  2EKI A;  3CWI A;  1EWY C;  3AEF B;  4WQM A;  3TUO A;  1V1P B;  2WP9 B;  2WXG A;  1E7P B;  1QT9 A;  1B1Z A;  4PT5 A;  1ZDV A;  1SJH D;  5FK9 C;  1IUE A;  1N63 A;  2L52 A;  2WU2 B;  3Q8E A;  2V3N A;  3Q69 A;  1WWT A;  5H92 C;  3DWM A;  1JCK B;  4OW0 A;  2DYO A;  3P4S B;  3BYT B;  4XWW A;  2DLB A;  3P4P B;  2L32 A;  4JX1 C;  4J3O D;  5EE3 A;  2LJI A;  1TY0 A;  4HJG E;  1DOX A;  2IGH A;  4KGT A;  2M19 A;  4M0W A;  4RGT A;  1C4C A;  1DOY A;  1J7B A;  3P4R B;  1TKY A;  1D4B A;  3GS2 A;  2QIE B;  3BII D;  4IKG A;  4C7Z A;  4R3D A;  1K53 A;  2FUG 1;  2GB1 A;  3LXF A;  1MI0 A;  4JWU C;  5C2T B;  2J42 A;  3BWU D;  4REZ A;  3O13 A;  3ZQ4 A;  3W1S A;  4MM3 B;  4NJC A;  3IT6 B;  4YSY B;  2V3P A;  2KMM A;  2WXK A;  2Z8L A;  3FIL B;  2MJ3 A;  1L0V B;  3E56 A;  1JWS D;  1Q10 A;  4NAW B;  2WXR A;  2JYE A;  2LHD A;  2BT6 A;  1C9F A;  1K50 A;  1WGK A;  1FXA A;  3MFG A;  2M0A A;  1TYG B;  3EA6 A;  3NUH B;  3CIR B;  4RF0 A;  3TSS A;  2WQY B;  4RGM A;  3L4P A;  1CJE A;  2BS3 B;  1UNS A;  2ON8 A;  1VDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...