1BMLC

Complex of the catalytic domain of human plasmin and streptokinase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
361
structure length
318
Chain Sequence
SVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQAKSVDVEYTVQFTPLNPDDDTKLLKTLAIGDTITSQELLAQAQSILNKTHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASMIN
publication title Crystal structure of the catalytic domain of human plasmin complexed with streptokinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 67
structure length 318
sequence length 361
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.150 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bmlC03
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bmlC02
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bmlC01
1L4ZB 1C4PA 1L4DB 1QQRA 1BMLC
chains in the Genus database with same CATH superfamily
3AE7B 4WJPA 5JHAA 1NI2A 2IGDA 1I4RA 3RPFC 1HQRD 2AQ3B 4NQKE 2KDBA 2FAZA 2WXQA 4G3XB 1YJIA 2FBWB 3OLMD 4UDUC 3ML8A 3GE3C 4MSMB 3ZO5B 4HPMB 1OEYA 3VUXA 2OOBB 3IT6B 1IBXB 3N1ZC 1T0RC 2WDRB 3I3TB 3RCZA 3J9CA 3ZXVA 4ANWA 4KSKC 1YQ4B 1M94A 2MEKA 3A9KA 4HEA1 3C8YA 4MGZE 1MHXA 1JWMD 1V97A 1C4CA 2O6VB 1TS2A 5C1ZA 2H88B 2K22A 5J17A 3A4SC 3RZWC 3ABVB 1F2RI 1IGDA 4KIKA 1ZPSA 4YTPB 1GG3A 3ZNID 1F9JA 4EZKA 4RGMA 2QC8A 2LFIA 3VFKA 3N20C 4DHZB 3JSVA 2NBVB 3AU4A 1KOTA 3PRPB 3RMKC 3R66C 1GJZA 3NVYA 3B2FA 2CS4A 2MLBA 4FJYA 2GOWA 1J0GA 4YTNB 1GB4A 3DWMA 1EWCA 3DBHI 2YEPF 3Q8BA 3P2BA 1SE2A 4EUTA 3L13A 2DYMA 5DPSA 2ZCBA 1XXGA 1OQQA 3L08A 3ZTCA 2JXXA 2QCZA 3DBSA 2LMCA 3U2SC 1J8CA 3SEBA 1QOAA 1TS3A 3AEGB 2RR9A 2VZKB 3UIOB 2KTRA 1FXIA 3KVFB 1CMXB 4IC7B 4ICVA 2N9EB 5D2MB 3A33B 2AL6A 3GZNB 4GSWA 3VXWA 3P4RB 4A90A 5CHFA 4W9KA 2WU2B 2SEBD 4YT0B 2AEHA 3NRZA 2AWTA 4IWOA 2NBUA 1HTOA 3IBEA 3PV1A 3ZQ4A 3Q2AC 4NY0A 1C3TA 3TSSA 4OVZA 4II3B 4RGOS 2REXA 4DDID 4KZCA 1E8YA 4RM8A 4KGSA 5TR5A 2KANA 1KLVA 4XWWA 3KWLA 2JX5A 4MACA 1K51A 3Q3NC 3HIZA 2GMIC 3P4SB 4JGHB 2KC2A 2BS3B 4GDLA 1EU3A 1OTRB 4EZLA 4FJVB 2ZPYA 2Q5WD 4GLSC 2JRIB 1QOGA 1GAQB 2BW2A 4WJNA 4AP4C 4MSQB 1ZDVA 3VDZA 4US9A 4WJQA 2AQ2B 2V0GA 1V5TA 4FULA 2GBNA 5IA7A 4ICUA 1YIWA 3AI5A 1YJJA 2MBOA 2IO2B 4XE0A 2WXOA 1WZ0A 4AJYB 2W82A 3GOEA 2R61A 3DCGA 1DOYA 2LGYA 2LXCA 4HLEA 5DPRA 3QJZA 1WGYA 1WGRA 3UI3A 2JPHA 1FPYA 1SB3C 1L2NA 1NVID 1YX6B 2G4SA 4GIVA 1WSPA 2OJRA 1ESFA 3LB8C 1FRRA 1G6JA 2BB5A 1FNWA 2DAFA 2W55A 3GB1A 4HJGE 1VCBA 4YWGG 4C00A 5EE9A 2J52A 3HM3A 4ZRIA 4PS8A 4WH4A 3HRDD 3PRZA 2B3AA 2VH2A 3Q6BA 4RCOA 1PGAA 2CHXA 3H7PB 2N9PC 3TIXA 1MI0A 1XO3A 2X38A 1KTKA 2HDEA 2LVPA 2JU6X 4EE2A 1T6BX 4PS3A 4GXBA 5FR3A 2PVGC 4GDKA 1CK1A 4A8XC 3HM6X 1LM8B 3SHQA 4DXGA 2M56B 1I4XA 3MHSD 2KN5A 3W1SC 1E7PB 4ARCA 2JVCA 1WMHB 3Q3MC 3OG5A 2XK5B 3NVZA 4LNNA 3VH4B 2GBJA 5D3IB 2PTLA 2HJ1A 3H1UA 4LJOB 2K5PA 2MSED 1WFYA 2QDFA 1PQSA 1Y8RC 1WX8A 3M3JA 5FR6A 4BKSD 1KJTA 3A9JB 2ZPNA 2JYEA 2G4DB 3RYTA 1T0YA 1WXAA 2BVCA 2I1KA 2BPSA 2E6XA 2N7DA 4YL8A 1ZOYB 2FE8A 2QILA 4BBNC 2INNE 3WANA 1N6ZA 4RFBA 2EKIA 4WWNA 1IP9A 2I2YA 2D07B 2LI5A 2KZRA 3EFUA 4YSZB 1V86A 4YXDB 2NR2A 4BVUC 2M0AA 4MH0E 2HTHA 1OQYA 2ONQA 3DPDA 5L83A 2IY1B 5LXHA 1K52A 2BF8B 3RT3B 3RNBC 2KD0A 2LEKA 4M0WA 2G1EA 3VTWA 3L10B 1E7VA 2C7NB 3GE8C 1QLBB 1H8CA 4TV3A 3DBLB 4GGQA 2J0MA 1YX5B 4OHJA 2VH1A 1L4ZB 1P98A 1U4AA 1NENB 4C56C 4EFOA 2V3PA 2FCNA 3AEEB 2I1JA 2XNAC 4WQMA 5C3JB 3NS1A 2MWSB 3SDLC 2INPE 2NCNA 3C0RB 2BBCA 3T3NA 1EF5A 2XEWA 2N1WA 1UH6A 2JSVX 3O13A 4XWTA 3TMPB 3PVLA 3JYUA 2RPQA 3MJWA 2KVRA 2GB1A 3ENEA 1R4MI 2H89B 5E6PA 3VTUA 3RFZB 1V1PA 2A5UA 3PLUA 4FN2A 1VJKA 2PEAA 1TKEA 4MGKE 4F8CB 2JRHA 2CKHB 1VD2A 1BT0A 3K9PB 3ZRCA 1P9DU 2N9KA 4NQLB 2ACZB 3FILB 2MJEA 2NMQA 2WX0A 2MJ3A 2JWUA 2D3GA 2IO1B 4FBJB 4A6QA 4ASWC 2FUG1 4KKIA 3VVWB 3KW5B 1K50A 3LDZE 4N9F4 1UWMA 3AECB 4AWJA 4IG7B 1B9RA 4CYEA 4A20A 4C7YA 1D5ZC 2QIEB 3BK2A 2IPKD 4ANXA 2WLBA 4DXFA 2QSDA 3GP7A 4M8MA 2KT7A 5GXGB 5DPWA 3DBRI 2KX3A 3HK0A 1GC6A 3NZUA 2MHJA 1D4BA 1JWUD 2KWCA 3KWVA 5J18A 4RGNA 4P6VF 1OFFA 2E3TA 3AV8A 1S1QB 2M4NA 3RNCC 3MC0B 2WXRA 1YN4A 5CX3A 3MC9A 2K9XA 3E9SA 3BK1A 2Z0DB 4C7ZA 5E6OA 1E8WA 4C4VB 1I42A 2JZ3B 3ML9A 1TJEA 1LQBA 2NPTB 4KZ0A 1I7HA 4BZAA 3MHZA 1L0VB 3BYTB 2OHFA 2NBWB 1L6VA 1VLBA 1N62A 2ZVNA 1TZOA 2K8CA 1R7SA 3W9CB 3ZIMA 2FIDA 2ZW1A 1YMHE 2N9LA 1ZXIA 4P7IA 4A3PA 3QARA 2R2QA 3ZJVA 1VZ8A 3AE2B 5IAAC 1LXDA 4F7ZA 3PREA 2Y5PA 3WAMA 2BTEA 3CSTA 3EC8A 4WURA 4FADA 2JF5A 2D3AA 2KMMA 4FJZA 4ITKA 4LJPB 3DOWA 4N59A 3PZDA 2KKCA 2LJIA 4PS7A 3GS2A 4LNKA 1CJEA 1JCKB 3Q8CA 4IM0A 3HHMA 5D7GA 4AJWA 5H8YE 1TYGB 4WWPA 4L23A 1TIFA 2WDVB 1L0XB 3NZ3A 1WJUA 2WXPA 2WXFA 5JH5C 1QOFA 2ZVOA 1ISNA 4ZHOA 3PSEB 1NDDA 4P16A 2KWVB 2N7JA 3BY4B 4IDIA 2MBQA 2MBBB 1N63A 4W9JA 4BBNF 4TUUA 4ZRJA 2DHZA 2WU5B 4JWUC 5D6JB 3B0AA 1WI0A 5DPTA 1SGHA 3Q3JA 4K7SA 4DK5A 5JXVA 1A70A 3Q3FA 3ZJUA 3IAM1 4WIPA 3CWIA 4B0MA 1JWSD 4IM3A 3EHVA 2LGSA 2BWFA 2MCNB 2A4ZA 1V6EA 2ICIA 1WWTA 5EDSA 1JWAD 2NTSA 5EE0A 1XQQA 1UBQA 2WP9B 4NNJB 1LGRA 2ZJDA 3AE5B 5HG2A 5HI1A 1GNUA 4TKNA 1ENFA 1QILA 1JW9D 4I6PA 1V9JA 1AARA 3P63A 2IYDB 5H92C 5IOIA 3B2GA 2LWPA 5C2TB 4DBGA 2J42A 4W9FA 5T8IA 3DVNV 2KJ6A 2L83A 3APFA 2RDBC 2WXNA 4J3OD 2LRWA 1J7BA 2KLGA 2O2VB 4KGTA 2KJRA 4K7WA 2UWQA 1AYFA 5D3DA 2WQYB 4FA6A 2N1VA 4NJ6A 1KRHA 5AZHA 2BT6A 2WWZA 5C23A 3DWGC 4I6LB 1F52A 3PPAA 4C4VA 1F2RC 3SFDB 3X23A 3IT4B 1M4VA 3T3OA 1C76A 2NPTA 3ECIA 2K0PA 4JL9A 2KYWA 2DYOA 4NAWB 3KH0A 4P1BC 4W9CA 1WE7A 3NVWA 4YSXB 4ANUA 1H4RA 2KTFA 1JWBD 1V81A 1DGJA 4ZYNA 1UD7A 2MW5A 3U4EG 1FCLA 2KFKA 5FKAC 3VUWA 4OVUA 3CIRB 4MT5A 1WXVA 1WF9A 2EMSA 4A9AA 3PT2B 3AEAB 1FCCC 4D2KA 4EOYA 2OJWA 2M19A 5EE3A 2MP2B 4HXDA 3QX1A 1AN8A 1E10A 1P3QU 1IBXA 4JX1C 1TBEA 1FM0D 1DOIA 2NVUI 1ZUD2 2CHZA 3T8MA 2FIFA 4LDTD 2BWES 3M95A 3ONSA 2WX1A 1OGWA 2LGXA 1E9MA 2O6VA 3VH3B 4O1NA 1MHHE 1Z5SB 3P4QB 2FUHB 4IOIE 2SAKA 2EELA 3ETRA 4MM3B 1C78A 2IJ0A 4ARIA 5IN7A 1TS4A 4HROA 4G0NB 1JRUA 2LZ6A 2PLPA 3OJ4B 3QHTA 3OAWA 4X57B 1VDVA 4M8NA 2KQ4X 3FC4A 1WJNA 5KHQA 3AM9A 2IY0B 2BQQA 3E56A 4ZYSA 4HCPB 3W1SA 2WGSA 4JLCA 3U7ZA 3L4PA 2LRUA 3ZVVA 4MGYE 3MTNB 3AMZA 1K8RB 3ZJTA 1WY8A 3TEXA 2WDTB 3ZNZB 1UGJA 4KKJA 2AL3A 3KYCD 4II2B 2ASQA 1WR6E 3Q8EA 1HTQA 2BB6A 3R2TA 1E90A 2LD9A 2JYTA 1UNSA 1ZDXA 5AUIA 2FNJB 1BMLC 2C5LC 2R2OA 1TTNA 3DHGC 1EO6A 2DAJA 1R4MB 2MQJA 4WWOA 3V6EB 1E8ZA 4NJ7A 2V3NA 3DQVA 3H6NA 3TEYA 4RF1A 4J6IA 3N1YC 1K53A 1CZPA 3PLVA 2D2QA 4MH8A 5BMHA 1FXTB 5L95C 2L8JA 2HE7A 2PIAA 1WM3A 1C79A 1XLQA 2AX5A 4RMAA 5JZEB 3EFCA 4FHKA 1J19A 1FO4A 1GC7A 4NJCA 1XLOA 3I9V1 3TJPA 2BYVE 1AW7A 3ZW3A 1F77A 2BS2B 2K6QA 3RULA 4LNFA 2BS4B 2JT4B 3P4PB 3EUB2 2LUMA 2KO3A 4IWPA 4HPLB 3Q3OC 3RNFC 1PFDA 3ZXRA 1WJ6A 2C9WB 1C4PA 3AB5A 4AQ7A 5EE1A 1P7FA 4KDIC 1J7CA 1EM7A 1UGMA 3MFGA 3NY5A 1IUEA 4K81A 4HPPA 4IUMB 1HZ5A 3HVDA 5BYQA 1L6UA 2KDIA 3KLSX 4W9EA 2IDYA 3RZFA 1UF0A 3WA0A 3RNAC 4A55A 4US8A 3PHWB 4RM9A 2K8HA 3A1QB 1PYWD 1TZ1A 4LNIA 1JROA 4LLGM 2VRRB 3IFWB 2KAJA 1P1AA 2UYZB 4JE3B 3TUOA 3UQAA 2DLBA 2L0FA 1WX7A 1N5WA 4OZAA 1KFYB 3EGRA 3WCQA 2KK8A 2NS5A 4MM3A 1ZKHA 1Z2MA 2KFJA 2WHIA 1I4GA 2EKEC 3U7DA 4MELA 4WAAA 2DX5B 3BVMA 1XLNA 2JWZA 3KYDD 2MH7A 4IWQA 2EMTA 3T9LA 3A9KB 2CHWA 4B95A 4TMAB 1OQRA 3H7PA 3H8HA 1FNVA 3ZDMC 4HK2A 4YSYB 1MFWA 2KWDA 3QIJA 2W54A 1WGKA 2J53A 4KIKB 1NYQA 4XDCA 3H9DA 2J0KA 3ZNGC 1E6EB 2KN4A 2LVOA 3JSVB 2M0XA 3V61A 2DYBA 1HE8A 1WMHA 3JW0X 3NS8A 4B0EA 4GU2A 2KVZA 1SIJA 3MC8A 2L00B 2WXMA 2PW9A 4ANVA 5HHDG 2XK5A 2G9HD 5I4DA 1PGXA 3QA8A 3MJ5A 4DDGD 2KC1A 4WAFA 2KOXA 2L05A 2GBRA 2GBMA 2WXGA 4OZCA 5G2NA 3NJTA 3WAPA 2ZW0A 4MGIE 3UQBA 2MX2A 2WDQB 3JVZX 3A9JA 2IO3B 1HZ6A 1Q10A 1I4PA 2Z0EB 3Q14C 2KTRB 2WXIA 2BYTA 2K8BA 1T3QA 1TY0A 1CQVA 2DENB 4EEWA 2ZZPB 1GOZA 2RMMA 4LNOA 3DBHB 1SIFA 4W9HA 1GPXA 4TSSA 1SSNA 2LGIA 4EKUA 2DZMA 4PK1A 5MPOA 4NPNA 2RPVA 1DOXA 2LHDA 4TQ0A 3C19A 4FHJA 4W9DA 1BUIC 3VR9B 2DBYA 2JZZA 2KQSA 3AXCA 2WYQA 1PUTA 2BKFA 4B9KA 3AEBB 4OW0A 3WIMA 1R4NI 1WJ4A 4BKSA 3ALBA 2TSSA 1WH3A 2INDC 1NBFC 3R3MA 2IZVB 5HKHA 4YTMB 4M01A 1PGBA 2UU7A 4JPSA 2DZJA 4JWSC 3M62B 3RUIB 3KUCB 2L52A 1V1OA 1SBBB 5LLIA 3RD2A 1FEHA 2JY6A 1FXAA 2RGFA 2C7MB 4M02A 4I6NB 1FMAD 3ZDTA 4L1BA 4HWIB 2AYOB 3KUDB 1ROEA 2MRPA 3VRBB 3KQ4A 3RN9C 1F0ZA 3N1XC 3PZ8A 4LK0M 2CJNA 1D5MC 2D10A 2KDEB 2L76A 2ZEQA 2K3UA 3PS6A 4EZJA 2MBEA 4XC2A 1WGGA 5IKCM 1HXYD 2JXTA 4BOSC 1QF6A 5CHVC 1V5OA 2KACA 3UINB 4RH6A 4KV2A 2L32A 3W5VB 2IBIB 1RM6C 3FILA 3I57A 3NUHB 4WWMA 2PKOA 1UBIA 2KXJA 2ON8A 2CJOA 3U30A 4XYCA 4FLHA 2VZKD 4MJSB 1T5XD 1WR1A 3DVGY 3VTVA 1KLGD 2QJLA 5BO4B 2M17A 2LASA 2BYEA 4MDKE 3TBLD 2GBKA 3BYYB 4E71A 3EA6A 2QEJC 3ZTDA 1TKGA 3HUIA 2L1AA 1FRDA 4M00A 4OZBA 1YN5A 1FIQA 1QZEA 4DQOC 1BXTA 3R7RA 5JHBA 1ZE3D 1SXTA 1FFUA 1P0RA 4P1CC 3TL5A 3O65B 4BAXA 1TKYA 4ZRQA 4GDKB 2Z59B 1F1HA 1LFDA 1Q0WB 3QQ8B 2RSUA 2RDHA 1GUAB 1JALA 4HKZE 1EUVB 4DXAB 4N58A 3U8ZA 4AUQC 3Q8AA 3D32A 2HD5B 3AEDB 1JMLA 4K3BA 1IGCA 2W3SA 1YQBA 3P42A 2QHOA 4TQ1A 5E6JA 3R8BA 3S2AA 2D3BA 1C9FA 2Y3AA 3P1MA 2GI9A 2JQRB 1QT9A 2QMTA 3PHXB 3NVVA 1UUPA 5AUKA 2BKRB 4PYUA 3ZRFA 4PT5A 5HFYA 5G55A 3CSFA 1LO5D 1WXMA 3AEFB 2NTTA 1SE9A 1WXQA 5E6NA 3SD5A 1JQ4A 3PRMB 3FKYA 3V6CB 1QKZA 4KX6B 2LVQA 1WXSA 3U52E 2JZPA 2YEPB 3IG3A 1UELA 4LTUA 4R3DA 2Y5CA 1RYJA 5CHWA 2PE6B 3UGBB 1TS5A 2N7EA 4GN1A 1HA5A 3FAHA 3AE8B 1ZGUB 4HRSA 3UF8A 3DVGX 3L16A 4LCDE 4M0WB 5AZFA 1XCQL 4AOFA 4RGTA 4XX5A 5LXIB 1VRAB 3LYYA 1RAXA 3VUYA 4W9GA 2WS3B 2DZIA 3DHHC 1WM2A 3B1LX 3TCAA 3NHEB 1RFAA 3BINA 1QOBA 2N4FA 5AZGA 1SE3A 2IGHA 5CTRC 1RFKA 3APCA 3DVNU 5TSSA 3DHIC 3QC8B 4MJSA 3N9YC 3R2IA 1WYGA 1C4AA 3AE4B 2AQ1B 3QWZB 4N6EB 4DWFA 2PMVA 1SF0A 3GZNI 4ZDVA 4FXCA 2M8SA 4LDTB 3H7SA 4ZHPA 1RWSA 1XD3B 3V05A 2J0JA 3BVGA 1N61A 5DCNA 3WAOA 4KGRA 3OWEB 3HVZA 3LJ3A 1V1PB 4W9LA 3N3KB 1WRDB 2BYFA 3AU5A 3WALA 3SR6A 3PO0A 4XZ4A 3AULA 4G11A 2KDFB 1YNTE 1WYWB 2W9NA 4KVGB 3QCAA 3I5JC 1ZP0B 2WNMA 2D5GA 1ET6A 1SJED 4GOCA 1SEBD 1T0QC 2KHWB 4HVBA 1YOVB 2ZNVB 3DDCB 3KUZA 2O2VA 1N60A 2XN9C 4GMVA 3TEWA 1WZ3A 3RI7C 2V4IB 2C60A 2RDGA 3BIID 4CQNA 3EECA 1N5XA 4BKTA 2PJHA 3W1YA 3IVFA 5D94A 1IPGA 2INCC 2J7QB 2ZCCA 2V3SA 1XT9B 1HEZE 2V9HA 3V60A 1MVKA 4MEMA 4NAWA 4BFRA 1V49A 1I4HA 1FNUA 1XLPA 3Q8FA 1VR9A 2KWUB 2WXKA 1MJDA 4WQOB 4IKGA 1Y56A 4HJKA 1J7AA 3L54A 2K6DB 4BKGA 1Q5WB 3M63B 2C7HA 1OEYJ 2FCMA 4S0RA 3SU8X 1I4QA 4GB9A 2KQ7A 2OEDA 1MPEA 1NI3A 1E7UA 2LJ5A 2G45B 2K39A 1AWDA 1EU4A 3VRAB 1UWXA 3Q69A 2MBHA 4S17A 3MP9A 3N32A 2WXLA 1EF1A 2WXJA 2MP2A 3ZGZA 1ACCA 1NEKB 4ZOHC 3NZSA 4NAMA 3DBRB 2J4XA 5IO9A 5BMGA 3L17A 3VQIA 4CO7A 1Q1OA 4KSLC 3W2DA 1RLFA 1L0YB 2L7RA 1A5RA 1C1YB 2M1MA 3L0WB 3BZDB 1T0SC 5G5GA 4E74A 1L7YA 4IW0A 2WXHA 4ZRPA 2D3CA 2X8XX 2KMAA 2KJHB 3AN1A 4AS1A 4K1RB 4Q2JA 1JRPA 1WIAA 2W3RA 2CR5A 2MJDA 5FK9C 1X1MA 2KX0A 1WE6A 2JUOA 3BWUD 3NOBA 2KDMA 4H2AA 4L2YA 1KH0A 3UIPB 2V4LA 1D5XC 3IXSA 2CU1A 4PYZA 2FCSA 1YJ1A 2PE9A 1KLUD 2LUEA 3PGEA 1C77A 3PTFC 3CF6E 3CMMB 2N9XA 4HCNB 1FD6A 3ZYYX 2GRIA 1WX9A 3QK0A 3OJ3A 3R7QA 1R4NB 4KDLB 4B6WA 3RNGC 1WGDA 4IM2A 3ZKJC 1ZW7A 5BYRA 3AE6B 1D3ZA 4CHKA 1MG8A 2DNFA 3RNEC 4BOZB 5BMIA 2K25A 3AE3B 1VZ7A 2L0TA 2LHEA 2Z8LA 4K7UA 3AE9B 1SE4A 1VZ6A 5KHOA 2RD0A 2DWQA 4K3CA 3ZUNA 2CU3A 4W9IA 5J2RA 2BGFA 1E0ZA 4OVVA 1L5PA 3IAS1 4XDDA 2FCQA 1E5WA 1XEEA 2HJ8A 3BVZA 2XBBC 4ZRKA 3VR8B 3V62A 3ZNHB 1DYQA 1KM7A 2K1FA 4NZLB 2MA9B 3SFEB 2LXAA 2YVCA 5GMVA 2D11A 1PDXA 3VHTC 4ACFA 4URKA 1I35A 1STEA 4JQWC 4RNAA 4XGAB 1L4DB 4QAYA 3K9OB 3X0WA 3IHPC 4HKQA 2ZNVC 1V2YA 1XCTL 2KNBA 1RRBA 2PVOD 1YQ3B 2G3QB 1TGZB 1P7EA 3AH7A 3URYA 3NG0A 1ET9A 3DBLI 2Y5BB 2N0SB 4DHJD 4RF0A 4REZA 1TT5B 5BYSA 3LXFA 1QQRA 2PPHA 3AE1B 4G50A 4DHZE 5AEKB 1IYFA 3I63C 5LNK1 3N30A 2V1YA 1KF6B 3VAWA 1UZXB 1GB1A 5IP4D 3PZ7A 1NYRA 1D6EC 1WRIA 1E8XA 4JIOU 4A3OA 1S3SG 1XF5L 3W5UB 1V8CA 4E3CA 2HTME 4HDOA 3B08A 1TY2A 3QAQA 1B1ZA 5G5HA 1SJHD 2KLCA 1YD8U 3A4RA 2I38A 2YLMA 1MG4A 2IO0B 4GDLB 2O6VD 2LGDA 1FFVA 2GLSA 4F1SA 2L3ZA 2KFKB 3APDA 2DZKA 3A1QA 1YN3A 3ZLZA 3V3XA 1WGHA 1ZXHA 4DHJB 4WJOA 3TEZA 3B9JA 4HDQA 2B76B 2KMCA 2IGGA 4C80A 1EWYC 4USAA 1V80A
chains in the Genus database with same CATH topology
3AE7B 5AUIA 4PT5A 2IGDA 5HFYA 3RFZB 1I4RA 3RPFC 1BMLC 1HQRD 1LO5D 1V1PA 2AQ3B 3AEFB 2NTTA 1WXQA 1VJKA 2WXQA 1JQ4A 1YJIA 2FBWB 1TKEA 4UDUC 1QKZA 4KX6B 2V3NA 3IT6B 3U52E 2JZPA 4RF1A 2N9KA 3TEYA 1IBXB 2ACZB 3FILB 2MJEA 1K53A 2WDRB 2NMQA 2YEPB 1CZPA 2MJ3A 3J9CA 2JWUA 4MH8A 1YQ4B 5BMHA 4A6QA 2MEKA 4HEA1 2PIAA 2FUG1 3C8YA 1MHXA 1JWMD 1V97A 1C4CA 4LTUA 1C79A 4R3DA 1XLQA 2AX5A 1RYJA 2Y5CA 4KKIA 1TS2A 1FO4A 1K50A 2H88B 2K22A 4NJCA 1XLOA 1UWMA 3I9V1 1TS5A 3AECB 1AW7A 3ABVB 1F77A 2BS2B 1HA5A 3FAHA 2BS4B 1B9RA 3AE8B 1F2RI 1IGDA 4HRSA 1ZPSA 4YTPB 4C7YA 1D5ZC 3P4PB 1XCQL 2QIEB 3EUB2 3BK2A 2LUMA 2IPKD 4RGMA 2WLBA 2LFIA 1PFDA 4DXFA 2QSDA 4RGTA 3GP7A 5GXGB 1C4PA 3AB5A 4AQ7A 5EE1A 1VRAB 1P7FA 3LYYA 1D4BA 1JWUD 3NVYA 1J7CA 3KWVA 1EM7A 3MFGA 3B2FA 2WS3B 4RGNA 4P6VF 1OFFA 1IUEA 2E3TA 3AV8A 4YTNB 1GB4A 1QOBA 3DWMA 3MC0B 1EWCA 2WXRA 1HZ5A 1YN4A 2YEPF 3Q8BA 1SE2A 2K9XA 3HVDA 1SE3A 3E9SA 3BK1A 5BYQA 2IGHA 1L6UA 3KLSX 4C7ZA 2DYMA 1RFKA 1XXGA 1OQQA 2IDYA 5TSSA 2LMCA 3N9YC 3R2IA 1WYGA 1C4AA 3AE4B 2AQ1B 1TJEA 4N6EB 3U2SC 4A55A 4US8A 3SEBA 1QOAA 1TS3A 2PMVA 1SF0A 1PYWD 1I7HA 1JROA 3MHZA 4FXCA 4LLGM 3AEGB 1L0VB 2VZKB 3BYTB 1FXIA 2OHFA 4ZHPA 2KAJA 1L6VA 4JE3B 1RWSA 3TUOA 3V05A 1VLBA 1N62A 2DLBA 3BVGA 1N61A 1TZOA 4KGRA 3OWEB 1N5WA 4OZAA 1KFYB 3EGRA 3HVZA 3WCQA 1R7SA 1V1PB 3W9CB 3P4RB 3SR6A 4A90A 3PO0A 2ZW1A 1YMHE 2N9LA 2WU2B 2SEBD 1YNTE 4YT0B 1ZXIA 3NRZA 1I4GA 3ZJVA 1ZP0B 3ZQ4A 1VZ8A 2WNMA 3AE2B 3BVMA 2D5GA 1ET6A 1SJED 1XLNA 1SEBD 3TSSA 2MH7A 4OVZA 2Y5PA 4RGOS 2BTEA 4WURA 4TMAB 1OQRA 1N60A 2XN9C 4KGSA 3TEWA 3H8HA 2V4IB 2KMMA 4ITKA 2RDGA 4N59A 3BIID 2LJIA 1FNVA 4CQNA 4XWWA 1N5XA 3KWLA 3GS2A 1CJEA 4YSYB 1JCKB 3Q8CA 2JX5A 4MACA 1K51A 5D7GA 3P4SB 2KWDA 2BS3B 1EU3A 2W54A 5H8YE 1TYGB 1HEZE 1WGKA 4L23A 1MVKA 2J53A 2WDVB 1I4HA 1FNUA 1L0XB 1NYQA 1XLPA 2Q5WD 3NZ3A 3Q8FA 4GLSC 4XDCA 1VR9A 1QOGA 1GAQB 2WXPA 2BW2A 2WXKA 1E6EB 2KN4A 2WXFA 1QOFA 4RF0A 4IKGA 1Y56A 1J7AA 1ZDVA 4ZHOA 4B0EA 1SIJA 4P16A 4US9A 2N7JA 2WXMA 2PW9A 1I4QA 2AQ2B 5HHDG 2V0GA 4IDIA 2OEDA 1N63A 1MPEA 2G9HD 3TEZA 1NI3A 5I4DA 1PGXA 3MJ5A 1AWDA 1EU4A 1YJJA 2WU5B 4WAFA 4JWUC 3VRAB 1UWXA 3Q69A 2WXGA 3MP9A 4XE0A 2WXOA 4OZCA 5JXVA 2ZW0A 1A70A 2WXLA 2W82A 3ZJUA 2R61A 2WXJA 1DOYA 3IAM1 4WIPA 3CWIA 4B0MA 1JWSD 3ZGZA 1ACCA 1NEKB 4ZOHC 3UI3A 2WDQB 4NAMA 2ICIA 1WWTA 2J4XA 5BMGA 1HZ6A 1SB3C 1Q10A 3VQIA 1JWAD 1NVID 1I4PA 2NTSA 5EE0A 1WSPA 3W2DA 1ESFA 1L0YB 2WXIA 3LB8C 1FRRA 2BYTA 1T3QA 1TY0A 2WP9B 1CQVA 3BZDB 2BB5A 3AE5B 5HG2A 5G5GA 5HI1A 2WXHA 4ZRPA 1FNWA 1ENFA 1GOZA 1JW9D 1QILA 2RMMA 2W55A 3GB1A 4HJGE 4YWGG 3P63A 1GPXA 4TSSA 5H92C 1SSNA 2LGIA 3B2GA 5EE9A 5C2TB 5MPOA 2J52A 1DOXA 2RPVA 3AN1A 4AS1A 4Q2JA 1JRPA 2LHDA 2J42A 2W3RA 4TQ0A 2MJDA 5T8IA 1BUIC 3VR9B 4WH4A 5FK9C 2DBYA 3HRDD 2L83A 3BWUD 1PUTA 2KDMA 2WXNA 4H2AA 4RCOA 4L2YA 1PGAA 1KH0A 4J3OD 1J7BA 3AEBB 1D5XC 4KGTA 4OW0A 3IXSA 1AYFA 1MI0A 1XO3A 2X38A 1KTKA 2HDEA 5D3DA 2WQYB 1KLUD 1C77A 2JU6X 1KRHA 4EE2A 1T6BX 2BT6A 2TSSA 3DWGC 1FD6A 3ZYYX 2GRIA 1F2RC 5FR3A 3SFDB 2PVGC 3IT4B 1M4VA 1CK1A 3T3OA 4A8XC 1C76A 2K0PA 4YTMB 2DYOA 4NAWB 1PGBA 4JPSA 4JWSC 3NVWA 4REZA 2L52A 4YSXB 4DXGA 1V1OA 5BYRA 1SBBB 3AE6B 1FEHA 2M56B 1FXAA 1I4XA 1FMAD 1JWBD 5BMIA 1E7PB 4ARCA 1DGJA 3AE3B 1VZ7A 4L1BA 2LHEA 2Z8LA 3U4EG 3AE9B 1SE4A 1ROEA 1FCLA 1VZ6A 3VRBB 3KQ4A 2DWQA 5FKAC 1F0ZA 2CU3A 3NVZA 3CIRB 4MT5A 5D3IB 3PZ8A 4A9AA 2PTLA 3AEAB 4LK0M 2CJNA 1D5MC 1E0ZA 1FCCC 4D2KA 2K5PA 1L5PA 3IAS1 2K3UA 4XDDA 1XEEA 3BVZA 2M19A 2JXTA 1HXYD 5EE3A 3VR8B 1QF6A 2KACA 1AN8A 4RH6A 1E10A 1DYQA 2JYEA 2L32A 4NZLB 3W5VB 3SFEB 1RM6C 1IBXA 3FILA 4JX1C 1FM0D 3I57A 3NUHB 1PDXA 2E6XA 1DOIA 2PKOA 2ON8A 4WWMA 1ZOYB 2CJOA 2FE8A 1ZUD2 2QILA 1STEA 4RNAA 2INNE 1L4DB 2VZKD 1T5XD 4RFBA 2EKIA 2I2YA 1KLGD 4YSZB 1E9MA 2QJLA 4HKQA 1XCTL 4O1NA 1MHHE 4YXDB 2M0AA 3P4QB 2PVOD 1YQ3B 1P7EA 2ONQA 3AH7A 4IOIE 3URYA 1ET9A 2SAKA 3BYYB 2EELA 3ETRA 3EA6A 1K52A 2N0SB 2QEJC 4MM3B 1C78A 1TKGA 2IJ0A 1FRDA 2L1AA 2LEKA 1YN5A 1TS4A 2G1EA 3HUIA 4M0WA 4OZBA 4ARIA 4HROA 1FIQA 1QQRA 3LXFA 2PLPA 5BYSA 3AE1B 4DQOC 1QLBB 1VDVA 5LNK1 1BXTA 2KQ4X 1KF6B 4OHJA 3FC4A 1L4ZB 1ZE3D 1GB1A 1SXTA 3PZ7A 1FFUA 1NYRA 1D6EC 1WRIA 1NENB 4C56C 3AM9A 2V3PA 1TKYA 4ZRQA 3AEEB 4GDKB 2XNAC 4WQMA 1XF5L 3W5UB 3E56A 4ZYSA 1V8CA 5C3JB 3NS1A 3W1SA 2HTME 1TY2A 2RDHA 2INPE 3U7ZA 1B1ZA 5G5HA 3L4PA 1JALA 2BBCA 4HKZE 1SJHD 3T3NA 3AMZA 4N58A 3ZJTA 2I38A 3Q8AA 3TEXA 2JSVX 4GDLB 3O13A 3AEDB 1JMLA 1UGJA 1FFVA 4KKJA 4XWTA 1IGCA 2W3SA 3P42A 4TQ1A 5E6JA 1YN3A 3Q8EA 3R8BA 3V3XA 1C9FA 2Y3AA 1ZXHA 2BB6A 3R2TA 3P1MA 2JYTA 2GI9A 1UNSA 1ZDXA 1QT9A 2B76B 2GB1A 2JQRB 2QMTA 2H89B 2IGGA 3B9JA 3NVVA 1EWYC 4C80A 1UUPA 5AUKA 4USAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4Z B;  1C4P A;  1L4D B;  1QQR A;  1BML C; 
#chains in the Genus database with same CATH topology
 3AE7 B;  4WJP A;  5JHA A;  1NI2 A;  2IGD A;  1I4R A;  3RPF C;  1HQR D;  2AQ3 B;  4NQK E;  2KDB A;  2FAZ A;  2WXQ A;  4G3X B;  1YJI A;  2FBW B;  3OLM D;  4UDU C;  3ML8 A;  3GE3 C;  4MSM B;  3ZO5 B;  4HPM B;  1OEY A;  3VUX A;  2OOB B;  3IT6 B;  1IBX B;  3N1Z C;  1T0R C;  2WDR B;  3I3T B;  3RCZ A;  3J9C A;  3ZXV A;  4ANW A;  4KSK C;  1YQ4 B;  1M94 A;  2MEK A;  3A9K A;  4HEA 1;  3C8Y A;  4MGZ E;  1MHX A;  1JWM D;  1V97 A;  1C4C A;  2O6V B;  1TS2 A;  5C1Z A;  2H88 B;  2K22 A;  5J17 A;  3A4S C;  3RZW C;  3ABV B;  1F2R I;  1IGD A;  4KIK A;  1ZPS A;  4YTP B;  1GG3 A;  3ZNI D;  1F9J A;  4EZK A;  4RGM A;  2QC8 A;  2LFI A;  3VFK A;  3N20 C;  4DHZ B;  3JSV A;  2NBV B;  3AU4 A;  1KOT A;  3PRP B;  3RMK C;  3R66 C;  1GJZ A;  3NVY A;  3B2F A;  2CS4 A;  2MLB A;  4FJY A;  2GOW A;  1J0G A;  4YTN B;  1GB4 A;  3DWM A;  1EWC A;  3DBH I;  2YEP F;  3Q8B A;  3P2B A;  1SE2 A;  4EUT A;  3L13 A;  2DYM A;  5DPS A;  2ZCB A;  1XXG A;  1OQQ A;  3L08 A;  3ZTC A;  2JXX A;  2QCZ A;  3DBS A;  2LMC A;  3U2S C;  1J8C A;  3SEB A;  1QOA A;  1TS3 A;  3AEG B;  2RR9 A;  2VZK B;  3UIO B;  2KTR A;  1FXI A;  3KVF B;  1CMX B;  4IC7 B;  4ICV A;  2N9E B;  5D2M B;  3A33 B;  2AL6 A;  3GZN B;  4GSW A;  3VXW A;  3P4R B;  4A90 A;  5CHF A;  4W9K A;  2WU2 B;  2SEB D;  4YT0 B;  2AEH A;  3NRZ A;  2AWT A;  4IWO A;  2NBU A;  1HTO A;  3IBE A;  3PV1 A;  3ZQ4 A;  3Q2A C;  4NY0 A;  1C3T A;  3TSS A;  4OVZ A;  4II3 B;  4RGO S;  2REX A;  4DDI D;  4KZC A;  1E8Y A;  4RM8 A;  4KGS A;  5TR5 A;  2KAN A;  1KLV A;  4XWW A;  3KWL A;  2JX5 A;  4MAC A;  1K51 A;  3Q3N C;  3HIZ A;  2GMI C;  3P4S B;  4JGH B;  2KC2 A;  2BS3 B;  4GDL A;  1EU3 A;  1OTR B;  4EZL A;  4FJV B;  2ZPY A;  2Q5W D;  4GLS C;  2JRI B;  1QOG A;  1GAQ B;  2BW2 A;  4WJN A;  4AP4 C;  4MSQ B;  1ZDV A;  3VDZ A;  4US9 A;  4WJQ A;  2AQ2 B;  2V0G A;  1V5T A;  4FUL A;  2GBN A;  5IA7 A;  4ICU A;  1YIW A;  3AI5 A;  1YJJ A;  2MBO A;  2IO2 B;  4XE0 A;  2WXO A;  1WZ0 A;  4AJY B;  2W82 A;  3GOE A;  2R61 A;  3DCG A;  1DOY A;  2LGY A;  2LXC A;  4HLE A;  5DPR A;  3QJZ A;  1WGY A;  1WGR A;  3UI3 A;  2JPH A;  1FPY A;  1SB3 C;  1L2N A;  1NVI D;  1YX6 B;  2G4S A;  4GIV A;  1WSP A;  2OJR A;  1ESF A;  3LB8 C;  1FRR A;  1G6J A;  2BB5 A;  1FNW A;  2DAF A;  2W55 A;  3GB1 A;  4HJG E;  1VCB A;  4YWG G;  4C00 A;  5EE9 A;  2J52 A;  3HM3 A;  4ZRI A;  4PS8 A;  4WH4 A;  3HRD D;  3PRZ A;  2B3A A;  2VH2 A;  3Q6B A;  4RCO A;  1PGA A;  2CHX A;  3H7P B;  2N9P C;  3TIX A;  1MI0 A;  1XO3 A;  2X38 A;  1KTK A;  2HDE A;  2LVP A;  2JU6 X;  4EE2 A;  1T6B X;  4PS3 A;  4GXB A;  5FR3 A;  2PVG C;  4GDK A;  1CK1 A;  4A8X C;  3HM6 X;  1LM8 B;  3SHQ A;  4DXG A;  2M56 B;  1I4X A;  3MHS D;  2KN5 A;  3W1S C;  1E7P B;  4ARC A;  2JVC A;  1WMH B;  3Q3M C;  3OG5 A;  2XK5 B;  3NVZ A;  4LNN A;  3VH4 B;  2GBJ A;  5D3I B;  2PTL A;  2HJ1 A;  3H1U A;  4LJO B;  2K5P A;  2MSE D;  1WFY A;  2QDF A;  1PQS A;  1Y8R C;  1WX8 A;  3M3J A;  5FR6 A;  4BKS D;  1KJT A;  3A9J B;  2ZPN A;  2JYE A;  2G4D B;  3RYT A;  1T0Y A;  1WXA A;  2BVC A;  2I1K A;  2BPS A;  2E6X A;  2N7D A;  4YL8 A;  1ZOY B;  2FE8 A;  2QIL A;  4BBN C;  2INN E;  3WAN A;  1N6Z A;  4RFB A;  2EKI A;  4WWN A;  1IP9 A;  2I2Y A;  2D07 B;  2LI5 A;  2KZR A;  3EFU A;  4YSZ B;  1V86 A;  4YXD B;  2NR2 A;  4BVU C;  2M0A A;  4MH0 E;  2HTH A;  1OQY A;  2ONQ A;  3DPD A;  5L83 A;  2IY1 B;  5LXH A;  1K52 A;  2BF8 B;  3RT3 B;  3RNB C;  2KD0 A;  2LEK A;  4M0W A;  2G1E A;  3VTW A;  3L10 B;  1E7V A;  2C7N B;  3GE8 C;  1QLB B;  1H8C A;  4TV3 A;  3DBL B;  4GGQ A;  2J0M A;  1YX5 B;  4OHJ A;  2VH1 A;  1L4Z B;  1P98 A;  1U4A A;  1NEN B;  4C56 C;  4EFO A;  2V3P A;  2FCN A;  3AEE B;  2I1J A;  2XNA C;  4WQM A;  5C3J B;  3NS1 A;  2MWS B;  3SDL C;  2INP E;  2NCN A;  3C0R B;  2BBC A;  3T3N A;  1EF5 A;  2XEW A;  2N1W A;  1UH6 A;  2JSV X;  3O13 A;  4XWT A;  3TMP B;  3PVL A;  3JYU A;  2RPQ A;  3MJW A;  2KVR A;  2GB1 A;  3ENE A;  1R4M I;  2H89 B;  5E6P A;  3VTU A;  3RFZ B;  1V1P A;  2A5U A;  3PLU A;  4FN2 A;  1VJK A;  2PEA A;  1TKE A;  4MGK E;  4F8C B;  2JRH A;  2CKH B;  1VD2 A;  1BT0 A;  3K9P B;  3ZRC A;  1P9D U;  2N9K A;  4NQL B;  2ACZ B;  3FIL B;  2MJE A;  2NMQ A;  2WX0 A;  2MJ3 A;  2JWU A;  2D3G A;  2IO1 B;  4FBJ B;  4A6Q A;  4ASW C;  2FUG 1;  4KKI A;  3VVW B;  3KW5 B;  1K50 A;  3LDZ E;  4N9F 4;  1UWM A;  3AEC B;  4AWJ A;  4IG7 B;  1B9R A;  4CYE A;  4A20 A;  4C7Y A;  1D5Z C;  2QIE B;  3BK2 A;  2IPK D;  4ANX A;  2WLB A;  4DXF A;  2QSD A;  3GP7 A;  4M8M A;  2KT7 A;  5GXG B;  5DPW A;  3DBR I;  2KX3 A;  3HK0 A;  1GC6 A;  3NZU A;  2MHJ A;  1D4B A;  1JWU D;  2KWC A;  3KWV A;  5J18 A;  4RGN A;  4P6V F;  1OFF A;  2E3T A;  3AV8 A;  1S1Q B;  2M4N A;  3RNC C;  3MC0 B;  2WXR A;  1YN4 A;  5CX3 A;  3MC9 A;  2K9X A;  3E9S A;  3BK1 A;  2Z0D B;  4C7Z A;  5E6O A;  1E8W A;  4C4V B;  1I42 A;  2JZ3 B;  3ML9 A;  1TJE A;  1LQB A;  2NPT B;  4KZ0 A;  1I7H A;  4BZA A;  3MHZ A;  1L0V B;  3BYT B;  2OHF A;  2NBW B;  1L6V A;  1VLB A;  1N62 A;  2ZVN A;  1TZO A;  2K8C A;  1R7S A;  3W9C B;  3ZIM A;  2FID A;  2ZW1 A;  1YMH E;  2N9L A;  1ZXI A;  4P7I A;  4A3P A;  3QAR A;  2R2Q A;  3ZJV A;  1VZ8 A;  3AE2 B;  5IAA C;  1LXD A;  4F7Z A;  3PRE A;  2Y5P A;  3WAM A;  2BTE A;  3CST A;  3EC8 A;  4WUR A;  4FAD A;  2JF5 A;  2D3A A;  2KMM A;  4FJZ A;  4ITK A;  4LJP B;  3DOW A;  4N59 A;  3PZD A;  2KKC A;  2LJI A;  4PS7 A;  3GS2 A;  4LNK A;  1CJE A;  1JCK B;  3Q8C A;  4IM0 A;  3HHM A;  5D7G A;  4AJW A;  5H8Y E;  1TYG B;  4WWP A;  4L23 A;  1TIF A;  2WDV B;  1L0X B;  3NZ3 A;  1WJU A;  2WXP A;  2WXF A;  5JH5 C;  1QOF A;  2ZVO A;  1ISN A;  4ZHO A;  3PSE B;  1NDD A;  4P16 A;  2KWV B;  2N7J A;  3BY4 B;  4IDI A;  2MBQ A;  2MBB B;  1N63 A;  4W9J A;  4BBN F;  4TUU A;  4ZRJ A;  2DHZ A;  2WU5 B;  4JWU C;  5D6J B;  3B0A A;  1WI0 A;  5DPT A;  1SGH A;  3Q3J A;  4K7S A;  4DK5 A;  5JXV A;  1A70 A;  3Q3F A;  3ZJU A;  3IAM 1;  4WIP A;  3CWI A;  4B0M A;  1JWS D;  4IM3 A;  3EHV A;  2LGS A;  2BWF A;  2MCN B;  2A4Z A;  1V6E A;  2ICI A;  1WWT A;  5EDS A;  1JWA D;  2NTS A;  5EE0 A;  1XQQ A;  1UBQ A;  2WP9 B;  4NNJ B;  1LGR A;  2ZJD A;  3AE5 B;  5HG2 A;  5HI1 A;  1GNU A;  4TKN A;  1ENF A;  1QIL A;  1JW9 D;  4I6P A;  1V9J A;  1AAR A;  3P63 A;  2IYD B;  5H92 C;  5IOI A;  3B2G A;  2LWP A;  5C2T B;  4DBG A;  2J42 A;  4W9F A;  5T8I A;  3DVN V;  2KJ6 A;  2L83 A;  3APF A;  2RDB C;  2WXN A;  4J3O D;  2LRW A;  1J7B A;  2KLG A;  2O2V B;  4KGT A;  2KJR A;  4K7W A;  2UWQ A;  1AYF A;  5D3D A;  2WQY B;  4FA6 A;  2N1V A;  4NJ6 A;  1KRH A;  5AZH A;  2BT6 A;  2WWZ A;  5C23 A;  3DWG C;  4I6L B;  1F52 A;  3PPA A;  4C4V A;  1F2R C;  3SFD B;  3X23 A;  3IT4 B;  1M4V A;  3T3O A;  1C76 A;  2NPT A;  3ECI A;  2K0P A;  4JL9 A;  2KYW A;  2DYO A;  4NAW B;  3KH0 A;  4P1B C;  4W9C A;  1WE7 A;  3NVW A;  4YSX B;  4ANU A;  1H4R A;  2KTF A;  1JWB D;  1V81 A;  1DGJ A;  4ZYN A;  1UD7 A;  2MW5 A;  3U4E G;  1FCL A;  2KFK A;  5FKA C;  3VUW A;  4OVU A;  3CIR B;  4MT5 A;  1WXV A;  1WF9 A;  2EMS A;  4A9A A;  3PT2 B;  3AEA B;  1FCC C;  4D2K A;  4EOY A;  2OJW A;  2M19 A;  5EE3 A;  2MP2 B;  4HXD A;  3QX1 A;  1AN8 A;  1E10 A;  1P3Q U;  1IBX A;  4JX1 C;  1TBE A;  1FM0 D;  1DOI A;  2NVU I;  1ZUD 2;  2CHZ A;  3T8M A;  2FIF A;  4LDT D;  2BWE S;  3M95 A;  3ONS A;  2WX1 A;  1OGW A;  2LGX A;  1E9M A;  2O6V A;  3VH3 B;  4O1N A;  1MHH E;  1Z5S B;  3P4Q B;  2FUH B;  4IOI E;  2SAK A;  2EEL A;  3ETR A;  4MM3 B;  1C78 A;  2IJ0 A;  4ARI A;  5IN7 A;  1TS4 A;  4HRO A;  4G0N B;  1JRU A;  2LZ6 A;  2PLP A;  3OJ4 B;  3QHT A;  3OAW A;  4X57 B;  1VDV A;  4M8N A;  2KQ4 X;  3FC4 A;  1WJN A;  5KHQ A;  3AM9 A;  2IY0 B;  2BQQ A;  3E56 A;  4ZYS A;  4HCP B;  3W1S A;  2WGS A;  4JLC A;  3U7Z A;  3L4P A;  2LRU A;  3ZVV A;  4MGY E;  3MTN B;  3AMZ A;  1K8R B;  3ZJT A;  1WY8 A;  3TEX A;  2WDT B;  3ZNZ B;  1UGJ A;  4KKJ A;  2AL3 A;  3KYC D;  4II2 B;  2ASQ A;  1WR6 E;  3Q8E A;  1HTQ A;  2BB6 A;  3R2T A;  1E90 A;  2LD9 A;  2JYT A;  1UNS A;  1ZDX A;  5AUI A;  2FNJ B;  1BML C;  2C5L C;  2R2O A;  1TTN A;  3DHG C;  1EO6 A;  2DAJ A;  1R4M B;  2MQJ A;  4WWO A;  3V6E B;  1E8Z A;  4NJ7 A;  2V3N A;  3DQV A;  3H6N A;  3TEY A;  4RF1 A;  4J6I A;  3N1Y C;  1K53 A;  1CZP A;  3PLV A;  2D2Q A;  4MH8 A;  5BMH A;  1FXT B;  5L95 C;  2L8J A;  2HE7 A;  2PIA A;  1WM3 A;  1C79 A;  1XLQ A;  2AX5 A;  4RMA A;  5JZE B;  3EFC A;  4FHK A;  1J19 A;  1FO4 A;  1GC7 A;  4NJC A;  1XLO A;  3I9V 1;  3TJP A;  2BYV E;  1AW7 A;  3ZW3 A;  1F77 A;  2BS2 B;  2K6Q A;  3RUL A;  4LNF A;  2BS4 B;  2JT4 B;  3P4P B;  3EUB 2;  2LUM A;  2KO3 A;  4IWP A;  4HPL B;  3Q3O C;  3RNF C;  1PFD A;  3ZXR A;  1WJ6 A;  2C9W B;  1C4P A;  3AB5 A;  4AQ7 A;  5EE1 A;  1P7F A;  4KDI C;  1J7C A;  1EM7 A;  1UGM A;  3MFG A;  3NY5 A;  1IUE A;  4K81 A;  4HPP A;  4IUM B;  1HZ5 A;  3HVD A;  5BYQ A;  1L6U A;  2KDI A;  3KLS X;  4W9E A;  2IDY A;  3RZF A;  1UF0 A;  3WA0 A;  3RNA C;  4A55 A;  4US8 A;  3PHW B;  4RM9 A;  2K8H A;  3A1Q B;  1PYW D;  1TZ1 A;  4LNI A;  1JRO A;  4LLG M;  2VRR B;  3IFW B;  2KAJ A;  1P1A A;  2UYZ B;  4JE3 B;  3TUO A;  3UQA A;  2DLB A;  2L0F A;  1WX7 A;  1N5W A;  4OZA A;  1KFY B;  3EGR A;  3WCQ A;  2KK8 A;  2NS5 A;  4MM3 A;  1ZKH A;  1Z2M A;  2KFJ A;  2WHI A;  1I4G A;  2EKE C;  3U7D A;  4MEL A;  4WAA A;  2DX5 B;  3BVM A;  1XLN A;  2JWZ A;  3KYD D;  2MH7 A;  4IWQ A;  2EMT A;  3T9L A;  3A9K B;  2CHW A;  4B95 A;  4TMA B;  1OQR A;  3H7P A;  3H8H A;  1FNV A;  3ZDM C;  4HK2 A;  4YSY B;  1MFW A;  2KWD A;  3QIJ A;  2W54 A;  1WGK A;  2J53 A;  4KIK B;  1NYQ A;  4XDC A;  3H9D A;  2J0K A;  3ZNG C;  1E6E B;  2KN4 A;  2LVO A;  3JSV B;  2M0X A;  3V61 A;  2DYB A;  1HE8 A;  1WMH A;  3JW0 X;  3NS8 A;  4B0E A;  4GU2 A;  2KVZ A;  1SIJ A;  3MC8 A;  2L00 B;  2WXM A;  2PW9 A;  4ANV A;  5HHD G;  2XK5 A;  2G9H D;  5I4D A;  1PGX A;  3QA8 A;  3MJ5 A;  4DDG D;  2KC1 A;  4WAF A;  2KOX A;  2L05 A;  2GBR A;  2GBM A;  2WXG A;  4OZC A;  5G2N A;  3NJT A;  3WAP A;  2ZW0 A;  4MGI E;  3UQB A;  2MX2 A;  2WDQ B;  3JVZ X;  3A9J A;  2IO3 B;  1HZ6 A;  1Q10 A;  1I4P A;  2Z0E B;  3Q14 C;  2KTR B;  2WXI A;  2BYT A;  2K8B A;  1T3Q A;  1TY0 A;  1CQV A;  2DEN B;  4EEW A;  2ZZP B;  1GOZ A;  2RMM A;  4LNO A;  3DBH B;  1SIF A;  4W9H A;  1GPX A;  4TSS A;  1SSN A;  2LGI A;  4EKU A;  2DZM A;  4PK1 A;  5MPO A;  4NPN A;  2RPV A;  1DOX A;  2LHD A;  4TQ0 A;  3C19 A;  4FHJ A;  4W9D A;  1BUI C;  3VR9 B;  2DBY A;  2JZZ A;  2KQS A;  3AXC A;  2WYQ A;  1PUT A;  2BKF A;  4B9K A;  3AEB B;  4OW0 A;  3WIM A;  1R4N I;  1WJ4 A;  4BKS A;  3ALB A;  2TSS A;  1WH3 A;  2IND C;  1NBF C;  3R3M A;  2IZV B;  5HKH A;  4YTM B;  4M01 A;  1PGB A;  2UU7 A;  4JPS A;  2DZJ A;  4JWS C;  3M62 B;  3RUI B;  3KUC B;  2L52 A;  1V1O A;  1SBB B;  5LLI A;  3RD2 A;  1FEH A;  2JY6 A;  1FXA A;  2RGF A;  2C7M B;  4M02 A;  4I6N B;  1FMA D;  3ZDT A;  4L1B A;  4HWI B;  2AYO B;  3KUD B;  1ROE A;  2MRP A;  3VRB B;  3KQ4 A;  3RN9 C;  1F0Z A;  3N1X C;  3PZ8 A;  4LK0 M;  2CJN A;  1D5M C;  2D10 A;  2KDE B;  2L76 A;  2ZEQ A;  2K3U A;  3PS6 A;  4EZJ A;  2MBE A;  4XC2 A;  1WGG A;  5IKC M;  1HXY D;  2JXT A;  4BOS C;  1QF6 A;  5CHV C;  1V5O A;  2KAC A;  3UIN B;  4RH6 A;  4KV2 A;  2L32 A;  3W5V B;  2IBI B;  1RM6 C;  3FIL A;  3I57 A;  3NUH B;  4WWM A;  2PKO A;  1UBI A;  2KXJ A;  2ON8 A;  2CJO A;  3U30 A;  4XYC A;  4FLH A;  2VZK D;  4MJS B;  1T5X D;  1WR1 A;  3DVG Y;  3VTV A;  1KLG D;  2QJL A;  5BO4 B;  2M17 A;  2LAS A;  2BYE A;  4MDK E;  3TBL D;  2GBK A;  3BYY B;  4E71 A;  3EA6 A;  2QEJ C;  3ZTD A;  1TKG A;  3HUI A;  2L1A A;  1FRD A;  4M00 A;  4OZB A;  1YN5 A;  1FIQ A;  1QZE A;  4DQO C;  1BXT A;  3R7R A;  5JHB A;  1ZE3 D;  1SXT A;  1FFU A;  1P0R A;  4P1C C;  3TL5 A;  3O65 B;  4BAX A;  1TKY A;  4ZRQ A;  4GDK B;  2Z59 B;  1F1H A;  1LFD A;  1Q0W B;  3QQ8 B;  2RSU A;  2RDH A;  1GUA B;  1JAL A;  4HKZ E;  1EUV B;  4DXA B;  4N58 A;  3U8Z A;  4AUQ C;  3Q8A A;  3D32 A;  2HD5 B;  3AED B;  1JML A;  4K3B A;  1IGC A;  2W3S A;  1YQB A;  3P42 A;  2QHO A;  4TQ1 A;  5E6J A;  3R8B A;  3S2A A;  2D3B A;  1C9F A;  2Y3A A;  3P1M A;  2GI9 A;  2JQR B;  1QT9 A;  2QMT A;  3PHX B;  3NVV A;  1UUP A;  5AUK A;  2BKR B;  4PYU A;  3ZRF A;  4PT5 A;  5HFY A;  5G55 A;  3CSF A;  1LO5 D;  1WXM A;  3AEF B;  2NTT A;  1SE9 A;  1WXQ A;  5E6N A;  3SD5 A;  1JQ4 A;  3PRM B;  3FKY A;  3V6C B;  1QKZ A;  4KX6 B;  2LVQ A;  1WXS A;  3U52 E;  2JZP A;  2YEP B;  3IG3 A;  1UEL A;  4LTU A;  4R3D A;  2Y5C A;  1RYJ A;  5CHW A;  2PE6 B;  3UGB B;  1TS5 A;  2N7E A;  4GN1 A;  1HA5 A;  3FAH A;  3AE8 B;  1ZGU B;  4HRS A;  3UF8 A;  3DVG X;  3L16 A;  4LCD E;  4M0W B;  5AZF A;  1XCQ L;  4AOF A;  4RGT A;  4XX5 A;  5LXI B;  1VRA B;  3LYY A;  1RAX A;  3VUY A;  4W9G A;  2WS3 B;  2DZI A;  3DHH C;  1WM2 A;  3B1L X;  3TCA A;  3NHE B;  1RFA A;  3BIN A;  1QOB A;  2N4F A;  5AZG A;  1SE3 A;  2IGH A;  5CTR C;  1RFK A;  3APC A;  3DVN U;  5TSS A;  3DHI C;  3QC8 B;  4MJS A;  3N9Y C;  3R2I A;  1WYG A;  1C4A A;  3AE4 B;  2AQ1 B;  3QWZ B;  4N6E B;  4DWF A;  2PMV A;  1SF0 A;  3GZN I;  4ZDV A;  4FXC A;  2M8S A;  4LDT B;  3H7S A;  4ZHP A;  1RWS A;  1XD3 B;  3V05 A;  2J0J A;  3BVG A;  1N61 A;  5DCN A;  3WAO A;  4KGR A;  3OWE B;  3HVZ A;  3LJ3 A;  1V1P B;  4W9L A;  3N3K B;  1WRD B;  2BYF A;  3AU5 A;  3WAL A;  3SR6 A;  3PO0 A;  4XZ4 A;  3AUL A;  4G11 A;  2KDF B;  1YNT E;  1WYW B;  2W9N A;  4KVG B;  3QCA A;  3I5J C;  1ZP0 B;  2WNM A;  2D5G A;  1ET6 A;  1SJE D;  4GOC A;  1SEB D;  1T0Q C;  2KHW B;  4HVB A;  1YOV B;  2ZNV B;  3DDC B;  3KUZ A;  2O2V A;  1N60 A;  2XN9 C;  4GMV A;  3TEW A;  1WZ3 A;  3RI7 C;  2V4I B;  2C60 A;  2RDG A;  3BII D;  4CQN A;  3EEC A;  1N5X A;  4BKT A;  2PJH A;  3W1Y A;  3IVF A;  5D94 A;  1IPG A;  2INC C;  2J7Q B;  2ZCC A;  2V3S A;  1XT9 B;  1HEZ E;  2V9H A;  3V60 A;  1MVK A;  4MEM A;  4NAW A;  4BFR A;  1V49 A;  1I4H A;  1FNU A;  1XLP A;  3Q8F A;  1VR9 A;  2KWU B;  2WXK A;  1MJD A;  4WQO B;  4IKG A;  1Y56 A;  4HJK A;  1J7A A;  3L54 A;  2K6D B;  4BKG A;  1Q5W B;  3M63 B;  2C7H A;  1OEY J;  2FCM A;  4S0R A;  3SU8 X;  1I4Q A;  4GB9 A;  2KQ7 A;  2OED A;  1MPE A;  1NI3 A;  1E7U A;  2LJ5 A;  2G45 B;  2K39 A;  1AWD A;  1EU4 A;  3VRA B;  1UWX A;  3Q69 A;  2MBH A;  4S17 A;  3MP9 A;  3N32 A;  2WXL A;  1EF1 A;  2WXJ A;  2MP2 A;  3ZGZ A;  1ACC A;  1NEK B;  4ZOH C;  3NZS A;  4NAM A;  3DBR B;  2J4X A;  5IO9 A;  5BMG A;  3L17 A;  3VQI A;  4CO7 A;  1Q1O A;  4KSL C;  3W2D A;  1RLF A;  1L0Y B;  2L7R A;  1A5R A;  1C1Y B;  2M1M A;  3L0W B;  3BZD B;  1T0S C;  5G5G A;  4E74 A;  1L7Y A;  4IW0 A;  2WXH A;  4ZRP A;  2D3C A;  2X8X X;  2KMA A;  2KJH B;  3AN1 A;  4AS1 A;  4K1R B;  4Q2J A;  1JRP A;  1WIA A;  2W3R A;  2CR5 A;  2MJD A;  5FK9 C;  1X1M A;  2KX0 A;  1WE6 A;  2JUO A;  3BWU D;  3NOB A;  2KDM A;  4H2A A;  4L2Y A;  1KH0 A;  3UIP B;  2V4L A;  1D5X C;  3IXS A;  2CU1 A;  4PYZ A;  2FCS A;  1YJ1 A;  2PE9 A;  1KLU D;  2LUE A;  3PGE A;  1C77 A;  3PTF C;  3CF6 E;  3CMM B;  2N9X A;  4HCN B;  1FD6 A;  3ZYY X;  2GRI A;  1WX9 A;  3QK0 A;  3OJ3 A;  3R7Q A;  1R4N B;  4KDL B;  4B6W A;  3RNG C;  1WGD A;  4IM2 A;  3ZKJ C;  1ZW7 A;  5BYR A;  3AE6 B;  1D3Z A;  4CHK A;  1MG8 A;  2DNF A;  3RNE C;  4BOZ B;  5BMI A;  2K25 A;  3AE3 B;  1VZ7 A;  2L0T A;  2LHE A;  2Z8L A;  4K7U A;  3AE9 B;  1SE4 A;  1VZ6 A;  5KHO A;  2RD0 A;  2DWQ A;  4K3C A;  3ZUN A;  2CU3 A;  4W9I A;  5J2R A;  2BGF A;  1E0Z A;  4OVV A;  1L5P A;  3IAS 1;  4XDD A;  2FCQ A;  1E5W A;  1XEE A;  2HJ8 A;  3BVZ A;  2XBB C;  4ZRK A;  3VR8 B;  3V62 A;  3ZNH B;  1DYQ A;  1KM7 A;  2K1F A;  4NZL B;  2MA9 B;  3SFE B;  2LXA A;  2YVC A;  5GMV A;  2D11 A;  1PDX A;  3VHT C;  4ACF A;  4URK A;  1I35 A;  1STE A;  4JQW C;  4RNA A;  4XGA B;  1L4D B;  4QAY A;  3K9O B;  3X0W A;  3IHP C;  4HKQ A;  2ZNV C;  1V2Y A;  1XCT L;  2KNB A;  1RRB A;  2PVO D;  1YQ3 B;  2G3Q B;  1TGZ B;  1P7E A;  3AH7 A;  3URY A;  3NG0 A;  1ET9 A;  3DBL I;  2Y5B B;  2N0S B;  4DHJ D;  4RF0 A;  4REZ A;  1TT5 B;  5BYS A;  3LXF A;  1QQR A;  2PPH A;  3AE1 B;  4G50 A;  4DHZ E;  5AEK B;  1IYF A;  3I63 C;  5LNK 1;  3N30 A;  2V1Y A;  1KF6 B;  3VAW A;  1UZX B;  1GB1 A;  5IP4 D;  3PZ7 A;  1NYR A;  1D6E C;  1WRI A;  1E8X A;  4JIO U;  4A3O A;  1S3S G;  1XF5 L;  3W5U B;  1V8C A;  4E3C A;  2HTM E;  4HDO A;  3B08 A;  1TY2 A;  3QAQ A;  1B1Z A;  5G5H A;  1SJH D;  2KLC A;  1YD8 U;  3A4R A;  2I38 A;  2YLM A;  1MG4 A;  2IO0 B;  4GDL B;  2O6V D;  2LGD A;  1FFV A;  2GLS A;  4F1S A;  2L3Z A;  2KFK B;  3APD A;  2DZK A;  3A1Q A;  1YN3 A;  3ZLZ A;  3V3X A;  1WGH A;  1ZXH A;  4DHJ B;  4WJO A;  3TEZ A;  3B9J A;  4HDQ A;  2B76 B;  2KMC A;  2IGG A;  4C80 A;  1EWY C;  4USA A;  1V80 A; 
#chains in the Genus database with same CATH homology
 3AE7 B;  5AUI A;  4PT5 A;  2IGD A;  5HFY A;  3RFZ B;  1I4R A;  3RPF C;  1BML C;  1HQR D;  1LO5 D;  1V1P A;  2AQ3 B;  3AEF B;  2NTT A;  1WXQ A;  1VJK A;  2WXQ A;  1JQ4 A;  1YJI A;  2FBW B;  1TKE A;  4UDU C;  1QKZ A;  4KX6 B;  2V3N A;  3IT6 B;  3U52 E;  2JZP A;  4RF1 A;  2N9K A;  3TEY A;  1IBX B;  2ACZ B;  3FIL B;  2MJE A;  1K53 A;  2WDR B;  2NMQ A;  2YEP B;  1CZP A;  2MJ3 A;  3J9C A;  2JWU A;  4MH8 A;  1YQ4 B;  5BMH A;  4A6Q A;  2MEK A;  4HEA 1;  2PIA A;  2FUG 1;  3C8Y A;  1MHX A;  1JWM D;  1V97 A;  1C4C A;  4LTU A;  1C79 A;  4R3D A;  1XLQ A;  2AX5 A;  1RYJ A;  2Y5C A;  4KKI A;  1TS2 A;  1FO4 A;  1K50 A;  2H88 B;  2K22 A;  4NJC A;  1XLO A;  1UWM A;  3I9V 1;  1TS5 A;  3AEC B;  1AW7 A;  3ABV B;  1F77 A;  2BS2 B;  1HA5 A;  3FAH A;  2BS4 B;  1B9R A;  3AE8 B;  1F2R I;  1IGD A;  4HRS A;  1ZPS A;  4YTP B;  4C7Y A;  1D5Z C;  3P4P B;  1XCQ L;  2QIE B;  3EUB 2;  3BK2 A;  2LUM A;  2IPK D;  4RGM A;  2WLB A;  2LFI A;  1PFD A;  4DXF A;  2QSD A;  4RGT A;  3GP7 A;  5GXG B;  1C4P A;  3AB5 A;  4AQ7 A;  5EE1 A;  1VRA B;  1P7F A;  3LYY A;  1D4B A;  1JWU D;  3NVY A;  1J7C A;  3KWV A;  1EM7 A;  3MFG A;  3B2F A;  2WS3 B;  4RGN A;  4P6V F;  1OFF A;  1IUE A;  2E3T A;  3AV8 A;  4YTN B;  1GB4 A;  1QOB A;  3DWM A;  3MC0 B;  1EWC A;  2WXR A;  1HZ5 A;  1YN4 A;  2YEP F;  3Q8B A;  1SE2 A;  2K9X A;  3HVD A;  1SE3 A;  3E9S A;  3BK1 A;  5BYQ A;  2IGH A;  1L6U A;  3KLS X;  4C7Z A;  2DYM A;  1RFK A;  1XXG A;  1OQQ A;  2IDY A;  5TSS A;  2LMC A;  3N9Y C;  3R2I A;  1WYG A;  1C4A A;  3AE4 B;  2AQ1 B;  1TJE A;  4N6E B;  3U2S C;  4A55 A;  4US8 A;  3SEB A;  1QOA A;  1TS3 A;  2PMV A;  1SF0 A;  1PYW D;  1I7H A;  1JRO A;  3MHZ A;  4FXC A;  4LLG M;  3AEG B;  1L0V B;  2VZK B;  3BYT B;  1FXI A;  2OHF A;  4ZHP A;  2KAJ A;  1L6V A;  4JE3 B;  1RWS A;  3TUO A;  3V05 A;  1VLB A;  1N62 A;  2DLB A;  3BVG A;  1N61 A;  1TZO A;  4KGR A;  3OWE B;  1N5W A;  4OZA A;  1KFY B;  3EGR A;  3HVZ A;  3WCQ A;  1R7S A;  1V1P B;  3W9C B;  3P4R B;  3SR6 A;  4A90 A;  3PO0 A;  2ZW1 A;  1YMH E;  2N9L A;  2WU2 B;  2SEB D;  1YNT E;  4YT0 B;  1ZXI A;  3NRZ A;  1I4G A;  3ZJV A;  1ZP0 B;  3ZQ4 A;  1VZ8 A;  2WNM A;  3AE2 B;  3BVM A;  2D5G A;  1ET6 A;  1SJE D;  1XLN A;  1SEB D;  3TSS A;  2MH7 A;  4OVZ A;  2Y5P A;  4RGO S;  2BTE A;  4WUR A;  4TMA B;  1OQR A;  1N60 A;  2XN9 C;  4KGS A;  3TEW A;  3H8H A;  2V4I B;  2KMM A;  4ITK A;  2RDG A;  4N59 A;  3BII D;  2LJI A;  1FNV A;  4CQN A;  4XWW A;  1N5X A;  3KWL A;  3GS2 A;  1CJE A;  4YSY B;  1JCK B;  3Q8C A;  2JX5 A;  4MAC A;  1K51 A;  5D7G A;  3P4S B;  2KWD A;  2BS3 B;  1EU3 A;  2W54 A;  5H8Y E;  1TYG B;  1HEZ E;  1WGK A;  4L23 A;  1MVK A;  2J53 A;  2WDV B;  1I4H A;  1FNU A;  1L0X B;  1NYQ A;  1XLP A;  2Q5W D;  3NZ3 A;  3Q8F A;  4GLS C;  4XDC A;  1VR9 A;  1QOG A;  1GAQ B;  2WXP A;  2BW2 A;  2WXK A;  1E6E B;  2KN4 A;  2WXF A;  1QOF A;  4RF0 A;  4IKG A;  1Y56 A;  1J7A A;  1ZDV A;  4ZHO A;  4B0E A;  1SIJ A;  4P16 A;  4US9 A;  2N7J A;  2WXM A;  2PW9 A;  1I4Q A;  2AQ2 B;  5HHD G;  2V0G A;  4IDI A;  2OED A;  1N63 A;  1MPE A;  2G9H D;  3TEZ A;  1NI3 A;  5I4D A;  1PGX A;  3MJ5 A;  1AWD A;  1EU4 A;  1YJJ A;  2WU5 B;  4WAF A;  4JWU C;  3VRA B;  1UWX A;  3Q69 A;  2WXG A;  3MP9 A;  4XE0 A;  2WXO A;  4OZC A;  5JXV A;  2ZW0 A;  1A70 A;  2WXL A;  2W82 A;  3ZJU A;  2R61 A;  2WXJ A;  1DOY A;  3IAM 1;  4WIP A;  3CWI A;  4B0M A;  1JWS D;  3ZGZ A;  1ACC A;  1NEK B;  4ZOH C;  3UI3 A;  2WDQ B;  4NAM A;  2ICI A;  1WWT A;  2J4X A;  5BMG A;  1HZ6 A;  1SB3 C;  1Q10 A;  3VQI A;  1JWA D;  1NVI D;  1I4P A;  2NTS A;  5EE0 A;  1WSP A;  3W2D A;  1ESF A;  1L0Y B;  2WXI A;  3LB8 C;  1FRR A;  2BYT A;  1T3Q A;  1TY0 A;  2WP9 B;  1CQV A;  3BZD B;  2BB5 A;  3AE5 B;  5HG2 A;  5G5G A;  5HI1 A;  2WXH A;  4ZRP A;  1FNW A;  1ENF A;  1GOZ A;  1JW9 D;  1QIL A;  2RMM A;  2W55 A;  3GB1 A;  4HJG E;  4YWG G;  3P63 A;  1GPX A;  4TSS A;  5H92 C;  1SSN A;  2LGI A;  3B2G A;  5EE9 A;  5C2T B;  5MPO A;  2J52 A;  1DOX A;  2RPV A;  3AN1 A;  4AS1 A;  4Q2J A;  1JRP A;  2LHD A;  2J42 A;  2W3R A;  4TQ0 A;  2MJD A;  5T8I A;  1BUI C;  3VR9 B;  4WH4 A;  5FK9 C;  2DBY A;  3HRD D;  2L83 A;  3BWU D;  1PUT A;  2KDM A;  2WXN A;  4H2A A;  4RCO A;  4L2Y A;  1PGA A;  1KH0 A;  4J3O D;  1J7B A;  3AEB B;  1D5X C;  4KGT A;  4OW0 A;  3IXS A;  1AYF A;  1MI0 A;  1XO3 A;  2X38 A;  1KTK A;  2HDE A;  5D3D A;  2WQY B;  1KLU D;  1C77 A;  2JU6 X;  1KRH A;  4EE2 A;  1T6B X;  2BT6 A;  2TSS A;  3DWG C;  1FD6 A;  3ZYY X;  2GRI A;  1F2R C;  5FR3 A;  3SFD B;  2PVG C;  3IT4 B;  1M4V A;  1CK1 A;  3T3O A;  4A8X C;  1C76 A;  2K0P A;  4YTM B;  2DYO A;  4NAW B;  1PGB A;  4JPS A;  4JWS C;  3NVW A;  4REZ A;  2L52 A;  4YSX B;  4DXG A;  1V1O A;  5BYR A;  1SBB B;  3AE6 B;  1FEH A;  2M56 B;  1FXA A;  1I4X A;  1FMA D;  1JWB D;  5BMI A;  1E7P B;  4ARC A;  1DGJ A;  3AE3 B;  1VZ7 A;  4L1B A;  2LHE A;  2Z8L A;  3U4E G;  3AE9 B;  1SE4 A;  1ROE A;  1FCL A;  1VZ6 A;  3VRB B;  3KQ4 A;  2DWQ A;  5FKA C;  1F0Z A;  2CU3 A;  3NVZ A;  3CIR B;  4MT5 A;  5D3I B;  3PZ8 A;  4A9A A;  2PTL A;  3AEA B;  4LK0 M;  2CJN A;  1D5M C;  1E0Z A;  1FCC C;  4D2K A;  2K5P A;  1L5P A;  3IAS 1;  2K3U A;  4XDD A;  1XEE A;  3BVZ A;  2M19 A;  2JXT A;  1HXY D;  5EE3 A;  3VR8 B;  1QF6 A;  2KAC A;  1AN8 A;  4RH6 A;  1E10 A;  1DYQ A;  2JYE A;  2L32 A;  4NZL B;  3W5V B;  3SFE B;  1RM6 C;  1IBX A;  3FIL A;  4JX1 C;  1FM0 D;  3I57 A;  3NUH B;  1PDX A;  2E6X A;  1DOI A;  2PKO A;  2ON8 A;  4WWM A;  1ZOY B;  2CJO A;  2FE8 A;  1ZUD 2;  2QIL A;  1STE A;  4RNA A;  2INN E;  1L4D B;  2VZK D;  1T5X D;  4RFB A;  2EKI A;  2I2Y A;  1KLG D;  4YSZ B;  1E9M A;  2QJL A;  4HKQ A;  1XCT L;  4O1N A;  1MHH E;  4YXD B;  2M0A A;  3P4Q B;  2PVO D;  1YQ3 B;  1P7E A;  2ONQ A;  3AH7 A;  4IOI E;  3URY A;  1ET9 A;  2SAK A;  3BYY B;  2EEL A;  3ETR A;  3EA6 A;  1K52 A;  2N0S B;  2QEJ C;  4MM3 B;  1C78 A;  1TKG A;  2IJ0 A;  1FRD A;  2L1A A;  2LEK A;  1YN5 A;  1TS4 A;  2G1E A;  3HUI A;  4M0W A;  4OZB A;  4ARI A;  4HRO A;  1FIQ A;  1QQR A;  3LXF A;  2PLP A;  5BYS A;  3AE1 B;  4DQO C;  1QLB B;  1VDV A;  5LNK 1;  1BXT A;  2KQ4 X;  1KF6 B;  4OHJ A;  3FC4 A;  1L4Z B;  1ZE3 D;  1GB1 A;  1SXT A;  3PZ7 A;  1FFU A;  1NYR A;  1D6E C;  1WRI A;  1NEN B;  4C56 C;  3AM9 A;  2V3P A;  1TKY A;  4ZRQ A;  3AEE B;  4GDK B;  2XNA C;  4WQM A;  1XF5 L;  3W5U B;  3E56 A;  4ZYS A;  1V8C A;  5C3J B;  3NS1 A;  3W1S A;  2HTM E;  1TY2 A;  2RDH A;  2INP E;  3U7Z A;  1B1Z A;  5G5H A;  3L4P A;  1JAL A;  2BBC A;  4HKZ E;  1SJH D;  3T3N A;  3AMZ A;  4N58 A;  3ZJT A;  2I38 A;  3Q8A A;  3TEX A;  2JSV X;  4GDL B;  3O13 A;  3AED B;  1JML A;  1UGJ A;  1FFV A;  4KKJ A;  4XWT A;  1IGC A;  2W3S A;  3P42 A;  4TQ1 A;  5E6J A;  1YN3 A;  3Q8E A;  3R8B A;  3V3X A;  1C9F A;  2Y3A A;  1ZXH A;  2BB6 A;  3R2T A;  3P1M A;  2JYT A;  2GI9 A;  1UNS A;  1ZDX A;  1QT9 A;  2B76 B;  2GB1 A;  2JQR B;  2QMT A;  2H89 B;  2IGG A;  3B9J A;  3NVV A;  1EWY C;  4C80 A;  1UUP A;  5AUK A;  4USA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...