1BMLC

Complex of the catalytic domain of human plasmin and streptokinase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
361
structure length
318
Chain Sequence
SVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQAKSVDVEYTVQFTPLNPDDDTKLLKTLAIGDTITSQELLAQAQSILNKTHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the catalytic domain of human plasmin complexed with streptokinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords PLASMIN
total genus 67
structure length 318
sequence length 361
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.150 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bmlC03
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bmlC02
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bmlC01
1QQRA 1L4DB 1L4ZB 1C4PA 1BMLC
chains in the Genus database with same CATH superfamily
2KMCA 3U2SC 3V05A 3BY4B 1C79A 1N5XA 4LLGM 2PPHA 1KLUD 4W9DA 2GMIC 4OW0A 1PDXA 2PE9A 2K9XA 2K8HA 2MJDA 3TSSA 3DQVA 2J0MA 4FLHA 3TIXA 3U7ZA 4HK2A 5AZGA 2J4XA 4MELA 3BYTB 3M3JA 2OEDA 4M02A 2INDC 2JSVX 2LXAA 1V9JA 2K22A 3B2FA 4HKQA 1LM8B 2N7DA 2SAKA 2JZPA 2H88B 2G3QB 2KN4A 4B6WA 2BPSA 3O65B 4PT5A 3VRBB 2KDFB 1JROA 5FK9C 5HHDG 4BFRA 1Z2MA 1J8CA 4RCOA 4ANWA 1N62A 4C7YA 2RDHA 1S1QB 5IKCM 2GBRA 2LJIA 2L0FA 4IDIA 3PLUA 2JRHA 3PVLA 1C3TA 1ZKHA 4RM9A 4ZRPA 3WA0A 2MBOA 3DWGC 4MSQB 2K6DB 4HLEA 3BVZA 3R7QA 2XK5A 1RYJA 2MEKA 1NI3A 2BB6A 3DVNU 1EWCA 2D10A 3MC9A 4P16A 3HVZA 1CJEA 2L52A 3AU4A 4LNKA 3CWIA 1D5XC 2LI5A 2WXJA 3UIOB 3N20C 1TZOA 4B95A 1JRUA 2IZVB 3TUOA 2BS3B 2HE7A 3SEBA 1FCLA 3ZTCA 3ZGZA 1TT5B 4ICVA 4GB9A 3QQ8B 3MC8A 3SFEB 5JHAA 4WAAA 3RUIB 3DPDA 2V1YA 4C4VA 1I4RA 4BOSC 1I4QA 2L8JA 4WJQA 2C5LC 1S3SG 4DHJD 2K8BA 4EE2A 3PRMB 3NOBA 4JGHB 1ISNA 5IP4D 2DYBA 2CU1A 1TKGA 1U4AA 2LWPA 2PVGC 1KOTA 2PMVA 1MG8A 2IY0B 3ETRA 3P2BA 1J19A 4JWSC 4EZKA 5E6PA 4MDKE 2IJ0A 2KMAA 4W9FA 5JHBA 2PLPA 2XBBC 4MEMA 3H1UA 3ZKJC 3GS2A 1E7PB 1RFAA 1XLQA 3T3NA 2KVZA 4IUMB 5J18A 1WYWB 1I42A 4YXDB 5JXVA 2Y5BB 1V86A 4LTUA 4B0MA 3NVZA 3AEBB 2M56B 1IP9A 3MJ5A 3AE8B 5EE0A 3BIID 2DZMA 3N1ZC 1J7BA 1ZGUB 2D3AA 1WGYA 2KFJA 1V1PB 4KV2A 5D6JB 4US8A 1T0SC 2INCC 1SIJA 4FA6A 2X8XX 2DYMA 5EE3A 1KFYB 2UYZB 1C4PA 1ZUD2 4KDLB 3QIJA 2KWDA 2LHEA 2WYQA 4L23A 4HDOA 1L4DB 2OHFA 4NPNA 5D2MB 2WXLA 2XNAC 2PTLA 4WWPA 5JZEB 1L7YA 1YJ1A 2Y5PA 3OWEB 1RLFA 2EMTA 3RNEC 2KQ4X 1PFDA 4BAXA 2G4SA 3ZNZB 1C4AA 3P4SB 1C4CA 4I6LB 2JF5A 3GE8C 4KVGB 2WDQB 5EE9A 2YVCA 2G4DB 4HJKA 1SJHD 3AI5A 3PO0A 4ZHOA 4MT5A 2D2QA 2K1FA 3BWUD 2ZVNA 4AP4C 4M8NA 1E0ZA 4BBNC 4TSSA 3IT4B 1J0GA 2KFKA 2QHOA 2ZCBA 3PSEB 5IOIA 3GZNB 2K0PA 1ACCA 3X0WA 1YX6B 5EE1A 3GZNI 1E90A 2W54A 2D3GA 1WM2A 2MX2A 2MLBA 4JX1C 2WDVB 4P1CC 1JW9D 2QC8A 2KC1A 1EO6A 1L4ZB 1MFWA 4IM2A 4YT0B 1TBEA 5HKHA 4TQ1A 2WQYB 2MW5A 3DBLI 4R3DA 1I4XA 2NBVB 1ZXHA 2FIFA 3DBLB 1JQ4A 1XO3A 2LUEA 1E10A 3OAWA 1D5MC 3VH4B 3QHTA 2MJEA 1T0QC 2V4IB 4ZHPA 5LLIA 3V3XA 3B2GA 4TV3A 1GG3A 2KWCA 1WM3A 4IWPA 3L10B 4WH4A 5E6JA 3Q69A 5FR3A 4HKZE 3ZIMA 1FXIA 3ZUNA 1SF0A 4C00A 4XDDA 2N1VA 4IOIE 2C7NB 2KX3A 3PT2B 1ENFA 1HE8A 2KTFA 1T6BX 5DCNA 1ZOYB 3UIPB 2DZJA 4WAFA 4NAWB 4HCNB 3UINB 4L1BA 3WALA 4WURA 2L1AA 4WJNA 3U30A 4MGIE 3DHHC 1KJTA 1E7VA 2W9NA 3IAM1 1NENB 1WE6A 5GXGB 4D2KA 1KH0A 3TEZA 3Q3NC 5FKAC 3EC8A 4FJZA 1HA5A 4LDTD 3NVYA 3FAHA 4UDUC 3ZLZA 2RPQA 3ZRCA 2JUOA 4XE0A 2WU2B 5DPSA 3VTVA 2KJHB 2B76B 2JU6X 3DBRB 3NVVA 1BMLC 3AN1A 1TS2A 4ZYSA 3LB8C 2DWQA 3IAS1 3H8HA 1ZPSA 4L2YA 4A20A 3QA8A 3URYA 1WGRA 1BT0A 4YTPB 1P9DU 1Q1OA 2ZW0A 1FXTB 2ZW1A 5AZHA 2WX1A 1WXSA 3HRDD 4KKJA 3AEGB 4MGKE 1TKYA 1GB4A 1VRAB 4US9A 5IA7A 4GXBA 3IT6B 1UGMA 3SFDB 3EECA 4ZRQA 4CO7A 1EUVB 4P1BC 4KIKA 3SR6A 4JIOU 2KZRA 2V3PA 4ANUA 1JWSD 1P7EA 2K8CA 2BYEA 3AE7B 1OQYA 4MSMB 3KUCB 4W9GA 3H7PB 4KSLC 4MM3B 2NPTB 3NUHB 3BYYB 1HXYD 2IGDA 3Q3FA 3B0AA 2IDYA 3H9DA 3EFUA 5IO9A 3M95A 4YTNB 5DPTA 1H4RA 5CHVC 3APCA 1WJNA 3BINA 1L0XB 3VDZA 4XWWA 1R4NI 2G1EA 4RGMA 1F0ZA 4DXGA 1RFKA 4ANVA 3OJ3A 2J42A 2EELA 3VR8B 1FRDA 4WQOB 2QILA 4GDKA 4RF0A 2HD5B 1V2YA 1LO5D 1GPXA 1QILA 1LGRA 1AARA 4LK0M 1EU3A 2RSUA 5AUKA 4TQ0A 3HUIA 3V60A 4ZYNA 3L17A 4WIPA 2BBCA 3AE6B 2KN5A 4N59A 2JT4B 3TCAA 5C3JB 2INPE 3PRZA 5LNK1 2RDGA 1DGJA 4M01A 3QJZA 3AU5A 3Q3JA 4IWQA 3V62A 1E8WA 1TTNA 2I2YA 4RNAA 2Y3AA 3RULA 1A5RA 1HEZE 4WWNA 4ZRJA 3HHMA 4A6QA 1I35A 2FCMA 1FXAA 1YN3A 1NEKB 4ICUA 3R2TA 1JWMD 1YX5B 1B1ZA 3EUB2 1AYFA 5H8YE 2DYOA 3Q8EA 3ZW3A 3KW5B 1UBQA 1DYQA 5AUIA 2DENB 3V6EB 3HM6X 3QC8B 1K53A 3EFCA 2M4NA 1GAQB 3WAPA 3B9JA 1VZ6A 3P63A 2UU7A 2A4ZA 1OQRA 2IGHA 4JWUC 1ZDVA 1HZ5A 2XEWA 2WXNA 1WSPA 4YWGG 3N3KB 3PHXB 3AEAB 2V0GA 4HCPB 2OJWA 2BYFA 2W3RA 1IGDA 1E8YA 3WAOA 4LCDE 1XEEA 1GC6A 1UH6A 4AWJA 1YMHE 1C76A 1QLBB 4NNJB 4E71A 1WGHA 1K50A 1XCTL 2RR9A 3B1LX 4XDCA 5CHWA 2Z0EB 4TMAB 2JQRB 3EHVA 2M1MA 3AECB 3CIRB 4I6PA 1X1MA 2W82A 1UZXB 4BKTA 5EDSA 4PK1A 5HFYA 1QOAA 1GOZA 5TR5A 1F77A 2XK5B 5AZFA 1UBIA 2BS4B 3JYUA 3SDLC 1WGGA 1L6UA 3N1YC 2KJ6A 2MSED 1FCCC 3NJTA 2KWVB 3Q3OC 1I4HA 4WJOA 1YJJA 2L7RA 1TIFA 2EKIA 3KYDD 4JL9A 3TEYA 1L2NA 1V5OA 1UUPA 2CHXA 4M0WA 3AE9B 2EMSA 2GOWA 3PRPB 5AEKB 2AL6A 1NVID 3ONSA 1JMLA 4HPMB 3VXWA 4E74A 3BZDB 3P4RB 1WGDA 1WXVA 3HM3A 4KZCA 1E5WA 2WDRB 5J17A 3V61A 4ASWC 4RMAA 1V49A 2E6XA 3RNCC 4CHKA 5C23A 4RGNA 2ON8A 1XLPA 2FIDA 2NTTA 3C8YA 2L76A 1WRIA 5J2RA 1NI2A 5G2NA 4YSZB 2D5GA 3RYTA 4E3CA 3N32A 3DBSA 4N6EB 4W9HA 3BVMA 3AULA 2IO0B 1Q5WB 4GLSC 3PV1A 2KFKB 1HZ6A 2J53A 3RMKC 3V6CB 4W9IA 1XXGA 3VVWB 4CQNA 3W9CB 2V4LA 2V9HA 4XGAB 1E8XA 2AQ2B 2X38A 3QAQA 1EF1A 5GMVA 1LQBA 1QF6A 2DX5B 4GN1A 4LJPB 2KX0A 1E8ZA 4NJ6A 1UGJA 2KDBA 4A90A 3I57A 2WXPA 1M4VA 2JVCA 4XC2A 3A9KB 4PYZA 3L08A 2GBJA 2FCSA 1KLGD 1FD6A 1MPEA 2Q5WD 3IFWB 1FIQA 5KHQA 3UQBA 1FNWA 3DBHB 4HVBA 4XYCA 5IN7A 3AM9A 1WXQA 3DBHI 4BZAA 4HWIB 2N9LA 3CSFA 2J52A 1TS4A 1K51A 1WMHB 5G5HA 4EFOA 2L05A 3A4SC 3OJ4B 2KACA 4MACA 3RNBC 3VRAB 2CR5A 2CU3A 2MHJA 4W9KA 4OHJA 5E6NA 5T8IA 4A8XC 1FNUA 3L54A 2KXJA 4EKUA 1K8RB 1Y56A 2BGFA 2D07B 1D4BA 2KD0A 1WRDB 1EWYC 1YQBA 3W1SC 1RM6C 2QSDA 2N9KA 2PVOD 4P6VF 3EGRA 2ONQA 2CKHB 3KWLA 3K9OB 4NZLB 1STEA 2FCNA 1SB3C 1DOXA 3MC0B 1ZE3D 2V3SA 3VTUA 1P98A 3X23A 4EEWA 3ABVB 1ZDXA 2KAJA 3VTWA 3RNAC 1OQQA 4A3OA 1MG4A 5IAAC 3A33B 2MRPA 2CS4A 3KLSX 1KTKA 4OZCA 4YTMB 3KYCD 4K1RB 2CHZA 1T0YA 1HTOA 3E9SA 3QCAA 5KHOA 2KDMA 3FILB 2N7EA 2ZPNA 2PJHA 3DCGA 4OVVA 5HG2A 2MBBB 4JE3B 2MBEA 3P1MA 5LXIB 5G55A 1LFDA 3PS6A 2N9PC 1JCKB 2C7MB 2I1KA 2LASA 3JSVB 2PIAA 4FN2A 3DWMA 2DBYA 1PYWD 3L4PA 2GLSA 1E7UA 1QQRA 4NAMA 4II2B 3NS1A 2ZNVB 3RFZB 2MP2A 4DDID 5BMHA 1XQQA 3GB1A 2N9EB 2DZIA 1TKEA 2NPTA 1TZ1A 2KLCA 3Q14C 1DOIA 3R66C 5BYSA 4GOCA 4A9AA 2KANA 3SD5A 3O13A 5I4DA 4C56C 3VUYA 3A4RA 3M63B 2KDEB 1JRPA 2D3CA 3U4EG 4JLCA 4BKGA 4HDQA 4XWTA 3RCZA 3PZDA 2D11A 4TKNA 1QKZA 4C80A 1FFVA 2KQ7A 1D6EC 1FEHA 3CF6E 3NY5A 2DHZA 3R7RA 4W9JA 3GOEA 1KRHA 1UWMA 4MGYE 3ZNGC 4MH8A 4P7IA 3NZUA 1XLNA 1WH3A 1V80A 4PS8A 4W9LA 5MPOA 1OFFA 1YQ3B 2L0TA 4G11A 1FPYA 2QMTA 3Q6BA 2Z59B 3W5VB 2PW9A 3C0RB 2BYTA 4ZRIA 3GE3C 4G0NB 2NCNA 2I38A 1JWAD 3NZSA 2GBMA 2LGSA 4DK5A 4DBGA 1F2RI 3LJ3A 1EM7A 4FJVB 2M19A 4JPSA 4NJCA 4KDIC 2WXHA 1Z5SB 2I1JA 1TY2A 4HXDA 3VUWA 3P4QB 1VZ7A 2LMCA 2WHIA 1UWXA 2OOBB 4NAWA 3W5UB 1UD7A 4HROA 4J6IA 4EUTA 2L3ZA 2TSSA 2DAFA 1WIAA 2W3SA 2L00B 2MWSB 4CYEA 1WJUA 2R61A 1T3QA 3H7SA 3TL5A 1WI0A 4AQ7A 1NDDA 2NR2A 3ZJTA 2KHWB 4ITKA 2FUG1 1WX9A 3AXCA 4DHZE 3C19A 2K6QA 3QX1A 2KYWA 4MM3A 2KTRB 3MHSD 2E3TA 1YOVB 2O6VD 4KGRA 2WXIA 1PUTA 3L16A 1F1HA 4EZLA 1FM0D 2C7HA 1J7CA 2O6VB 3Q2AC 3K9PB 1C77A 3VQIA 2AQ1B 2KQSA 3PGEA 1PGAA 2C60A 1VLBA 1T0RC 1ESFA 3ZO5B 2XN9C 3I3TB 3AE3B 3J9CA 2JRIB 3NRZA 1WFYA 2LGIA 3AV8A 1V97A 5G5GA 2KOXA 3I63C 1C1YB 1FO4A 1XT9B 2VZKD 2NBWB 1ZW7A 1L0VB 2VH1A 4IM0A 2BYVE 4IWOA 1TGZB 4TUUA 3UQAA 4ARCA 2PE6B 2AL3A 1BUIC 3VFKA 4HRSA 1QOBA 2N9XA 3AE4B 2QJLA 2GRIA 4NJ7A 4I6NB 3L0WB 1SE3A 1Q10A 4WQMA 1VCBA 3WAMA 5D94A 1TJEA 3DVGY 4IW0A 2JX5A 2WXGA 4DHZB 2J0JA 4A3PA 2BWES 4YSYB 2WNMA 2K25A 4F8CB 2BF8B 3NS8A 4FHJA 5JH5C 3QWZB 1J7AA 3AEDB 4N9F4 2LVPA 4LNNA 1V5TA 4K81A 4DQOC 3W1SA 3UGBB 1F2RC 4EOYA 4ZRKA 3UF8A 4YL8A 5BYQA 4AOFA 4C4VB 1SGHA 3VHTC 2LXCA 1WYGA 4FBJB 4LNIA 1L6VA 4MJSA 2DLBA 3A9JB 3PREA 2YEPB 2M8SA 3ML9A 3T9LA 3NG0A 1IBXA 4WWOA 1R4MI 1SXTA 2MH7A 3WANA 5HI1A 5C1ZA 3DBRI 1N5WA 5CX3A 4QAYA 3H7PA 1WE7A 2JWUA 3RD2A 2Z8LA 4FADA 2AWTA 3OLMD 4RM8A 4B0EA 4LNFA 3FILA 4S0RA 1WGKA 1MHXA 4K7WA 3IVFA 1V1OA 4AJYB 1YJIA 4RGTA 2GB1A 2KT7A 2VZKB 3QK0A 2FUHB 4BVUC 5L83A 1WXMA 3Q8BA 1WXAA 2LGDA 1EF5A 2CJOA 2WGSA 3N9YC 3A9KA 2SEBD 5TSSA 3KQ4A 3ZDMC 1IBXB 2RDBC 2HJ8A 4AJWA 2BW2A 1V81A 3MHZA 1F9JA 2WDTB 2J0KA 2MP2B 4KZ0A 2QCZA 4DXAB 4GIVA 4ZOHC 4G3XB 1GJZA 3Q3MC 1LXDA 3IBEA 1MI0A 1WJ4A 1OGWA 2WXOA 1FRRA 3HK0A 2KO3A 3ZQ4A 2BQQA 2ZJDA 5H92C 2IO1B 2BTEA 2WP9B 1JWBD 1MHHE 4O1NA 2K3UA 2LEKA 1N63A 2MBQA 2EKEC 2BB5A 3FKYA 3LDZE 4IKGA 4DDGD 1R4NB 4WJPA 4URKA 1IYFA 2FE8A 2JPHA 4WWMA 5D3IB 4G50A 2M0AA 2Z0DB 1B9RA 3AE2B 2ICIA 2KMMA 2MA9B 4KSKC 2N1WA 5DPRA 1WX7A 4RH6A 3HVDA 2M0XA 3CMMB 3U52E 1CZPA 4K7SA 1FMAD 1P3QU 1TY0A 3ML8A 3GP7A 2ZPYA 1YN4A 3TBLD 1VZ8A 4HJGE 2MJ3A 1RWSA 1KM7A 3DHIC 1WWTA 4NQKE 1M94A 4AUQC 1WR1A 3DVNV 2O2VA 4ZDVA 3KH0A 3TEWA 3Q8AA 1SSNA 2W55A 4XZ4A 2CHWA 2KC2A 4OVUA 2RPVA 1SE2A 1Q0WB 2WWZA 4GU2A 1E6EB 1FNVA 2KK8A 2QIEB 2GBKA 2PKOA 3OG5A 3WCQA 2WXKA 3KUZA 3U7DA 2CJNA 2WXFA 2BWFA 2IO3B 3DHGC 2JYEA 2MCNB 4XX5A 1GB1A 3ZJUA 2WU5B 2FNJB 3AEEB 2BVCA 1G6JA 2B3AA 3MJWA 3N30A 4KGSA 4KGTA 3AB5A 4M0WB 2ZVOA 2LRUA 3HIZA 3PHWB 4K3CA 1CMXB 1VR9A 4HPLB 2KKCA 1Y8RC 1L0YB 4BOZB 4EZJA 4B9KA 3JVZX 4N58A 3PZ7A 1JALA 4X57B 3AE5B 3JW0X 2IGGA 3ENEA 4S17A 2RD0A 1SJED 2KTRA 1C78A 1N6ZA 2DNFA 4K3BA 2WXMA 2LRWA 1P1AA 1SIFA 2INNE 4AS1A 3PPAA 5LXHA 1GUAB 2FAZA 1PGXA 3TMPB 2GBNA 1WY8A 2O2VB 1WF9A 3TJPA 2RMMA 5E6OA 3R2IA 3Q8CA 1AN8A 1WX8A 2ZNVC 2DAJA 3P4PB 2YEPF 3AMZA 4DXFA 5D7GA 1WZ0A 2L32A 1V8CA 3R3MA 4DWFA 4GDKB 4GSWA 2NVUI 3E56A 3VR9B 1T5XD 5L95C 3BVGA 4PS7A 2KDIA 3PTFC 1E9MA 4PS3A 2KWUB 1H8CA 4GDLA 4OVZA 1KF6B 4MH0E 4LJOB 1XLOA 3P42A 3RZWC 2MBHA 3S2AA 3SU8X 2LD9A 2ZEQA 3RT3B 2WS3B 2LVQA 1XD3B 4OZBA 1SE9A 3W2DA 2RGFA 3NHEB 3RN9C 1R4MB 2R2QA 4BKSA 2LGYA 1HQRD 4FXCA 2MQJA 1I4GA 2IBIB 2WXQA 2ASQA 3APFA 4KIKB 3JSVA 3A9JA 1WZ3A 1OEYJ 2IPKD 3VUXA 1SBBB 2WX0A 3I5JC 1PQSA 4GMVA 1F52A 4NQLB 1WJ6A 3IG3A 2JZZA 3MFGA 1YD8U 1BXTA 2WXRA 3PZ8A 2JXTA 3PLVA 3LYYA 2K39A 4BBNF 1XCQL 3AH7A 1DOYA 2KLGA 3ZXVA 1I4PA 4FJYA 2L83A 1ET6A 1P0RA 1QOGA 2M17A 2J7QB 1AW7A 2R2OA 1QZEA 1OEYA 2ACZB 4RFBA 5BMGA 2DZKA 3AEFB 1IPGA 1NYQA 3A1QA 1HTQA 1KLVA 1UELA 1FFUA 1ZP0B 2UWQA 4ACFA 1NYRA 3UI3A 2ZCCA 2D3BA 1MVKA 2G9HD 4LDTB 3Q8FA 4RGOS 3ZJVA 3CSTA 5DPWA 1IGCA 3H6NA 4ANXA 1K52A 1SEBD 3FC4A 3ZXRA 2BS2B 1QOFA 2BKRB 3BK1A 1JWUD 4BKSD 3DDCB 4IC7B 4REZA 5BYRA 1V6EA 2QEJC 3L13A 4ARIA 3DOWA 2IYDB 5C2TB 2VH2A 3SHQA 2A5UA 1YNTE 2N0SB 5BMIA 4FHKA 3VAWA 4GDLB 1PGBA 1OTRB 3IHPC 4JQWC 2Y5CA 2BT6A 2KJRA 3U8ZA 2PEAA 5BO4B 4IM3A 4IG7B 3BK2A 4KX6B 4Q2JA 3D32A 2NMQA 4W9EA 2REXA 4K7UA 5CHFA 3RPFC 2LHDA 3EA6A 2AX5A 5FR6A 3DVGX 4USAA 2LJ5A 3ZTDA 2LGXA 1YIWA 1NBFC 2JWZA 1UF0A 4MGZE 3LXFA 3I9V1 1EU4A 1N61A 1UNSA 3ZRFA 1C9FA 2FCQA 4KKIA 2NBUA 3T3OA 4MJSB 1GC7A 2KNBA 2JZ3B 1AWDA 2QDFA 4RF1A 4F1SA 4OZAA 4FULA 3T8MA 3N1XC 1VJKA 3ZYYX 1A70A 1N60A 4DHJB 2KVRA 3RNGC 2LVOA 2ZZPB 2AQ3B 2HDEA 3KWVA 1YN5A 2C9WB 2AEHA 2IY1B 3R8BA 2FBWB 3IXSA 2JYTA 4J3OD 3NZ3A 3B08A 1D3ZA 5D3DA 1L5PA 3ZNHB 1TS3A 5CTRC 3MP9A 2HTME 3ZVVA 4LNOA 2JXXA 2LUMA 4A55A 2G45B 4GGQA 3A1QB 1D5ZC 2HTHA 3RI7C 1SE4A 3APDA 2N7JA 4II3B 4M00A 2N4FA 2NTSA 2NS5A 3KUDB 2YLMA 3M62B 1WMHA 3NVWA 4C7ZA 1TYGB 4HEA1 1GNUA 4F7ZA 2WLBA 3W1YA 1ZXIA 1YQ4B 3ZNID 4NY0A 3ALBA 3KVFB 3ECIA 2V3NA 1V1PA 1P7FA 1RAXA 3ZDTA 1VDVA 3RNFC 1MJDA 2AYOB 1WR6E 1TS5A 3AE1B 1VD2A 2GI9A 4HPPA 2HJ1A 3QARA 1QT9A 1ROEA 4W9CA 3VH3B 2IO2B 3MTNB 2O6VA 2H89B 1CK1A 2BKFA 4M8MA 1ET9A 4PYUA 1IUEA 2JY6A 1I7HA 1XF5L 2LZ6A 1CQVA 3WIMA 3TEXA 4YSXB 1RRBA 3RZFA 4H2AA 2OJRA 2K5PA 1R7SA 2VRRB 2LFIA
chains in the Genus database with same CATH topology
3E9SA 3U2SC 1WWTA 3V05A 3SR6A 1C79A 1N5XA 4LLGM 1KLUD 2V3PA 1JWSD 1P7EA 4OW0A 2KDMA 3FILB 3TEWA 1PDXA 3AE7B 3Q8AA 1SSNA 2W55A 5HG2A 2K9XA 4JE3B 4MM3B 3P1MA 3NUHB 2MJDA 3BYYB 2RPVA 3TSSA 1SE2A 1HXYD 2IGDA 1E6EB 1FNVA 2QIEB 2IDYA 2PKOA 1JCKB 3U7ZA 3WCQA 2J4XA 2PIAA 2WXKA 4YTNB 3BYTB 2CJNA 2WXFA 3DWMA 2DBYA 2JYEA 1PYWD 3L4PA 2OEDA 1L0XB 2JSVX 4HKQA 3ZJUA 2K22A 3B2FA 1GB1A 1QQRA 2WU5B 4NAMA 3RFZB 3AEEB 3NS1A 4XWWA 2G1EA 4RGMA 2SAKA 2JZPA 1F0ZA 5BMHA 4DXGA 2H88B 2KN4A 4KGSA 1RFKA 3GB1A 4PT5A 4KGTA 1TKEA 3VRBB 1JROA 2J42A 5FK9C 3AB5A 5HHDG 2EELA 3VR8B 1FRDA 1DOIA 2QILA 4RCOA 4RF0A 5BYSA 1N62A 4C7YA 2RDHA 1VR9A 1LO5D 1GPXA 1QILA 4A9AA 2LJIA 4IDIA 3O13A 4LK0M 1EU3A 4TQ0A 1L0YB 5AUKA 4C56C 5I4DA 3HUIA 1JRPA 4ZRPA 4N58A 3DWGC 3PZ7A 4WIPA 1JALA 2BBCA 3AE6B 3AE5B 2IGGA 3U4EG 4N59A 1SJED 3BVZA 5C3JB 1C78A 2INPE 4XWTA 1RYJA 2WXMA 2MEKA 1NI3A 2BB6A 5LNK1 1EWCA 2INNE 2RDGA 1QKZA 4AS1A 4C80A 1FFVA 1DGJA 4P16A 1D6EC 1PGXA 1FEHA 1RWSA 3HVZA 1CJEA 2L52A 3CWIA 1D5XC 2RMMA 1KRHA 3R2IA 2WXJA 1AN8A 3Q8CA 1UWMA 1TZOA 3TUOA 2BS3B 3SEBA 4MH8A 1FCLA 3ZGZA 2I2YA 4RNAA 3P4PB 1XLNA 3SFEB 2YEPF 3AMZA 4DXFA 5D7GA 2Y3AA 5MPOA 1OFFA 1HEZE 1V8CA 2L32A 1YQ3B 4GDKB 4A6QA 3E56A 3VR9B 1T5XD 1FXAA 1I4RA 1I4QA 3BVGA 1YN3A 1NEKB 3R2TA 2QMTA 1JWMD 1E9MA 3W5VB 2PW9A 4EE2A 2BYTA 1B1ZA 3EUB2 1AYFA 4OVZA 5H8YE 1KF6B 2I38A 1JWAD 2DYOA 1XLOA 3P42A 1TKGA 3Q8EA 1F2RI 2PVGC 2WS3B 1EM7A 2PMVA 1DYQA 3ETRA 2M19A 4OZBA 5AUIA 4JPSA 4NJCA 4JWSC 2WXHA 3W2DA 1K53A 1TY2A 3P4QB 1VZ7A 2LMCA 1GAQB 1UWXA 2IJ0A 3B9JA 2PLPA 3W5UB 4HROA 1VZ6A 3P63A 1OQRA 2IGHA 4JWUC 1ZDVA 1HQRD 2TSSA 3GS2A 1HZ5A 2WXNA 1WSPA 2W3SA 4YWGG 1E7PB 1XLQA 4FXCA 3T3NA 3AEAB 2V0GA 2R61A 1I4GA 1T3QA 2W3RA 1IGDA 4YXDB 5JXVA 2WXQA 4AQ7A 4LTUA 4B0MA 2IPKD 3ZJTA 3NVZA 3AEBB 1SBBB 1XEEA 2M56B 4ITKA 2FUG1 1YMHE 1C76A 3MJ5A 3AE8B 1QLBB 3MFGA 5EE0A 3BIID 1J7BA 1K50A 1BXTA 1XCTL 2WXRA 3PZ8A 2JXTA 4XDCA 3LYYA 1V1PB 1XCQL 3AH7A 4TMAB 1DOYA 4US8A 2E3TA 1SIJA 1I4PA 2JQRB 2L83A 4KGRA 1ET6A 2WXIA 1QOGA 1PUTA 3AECB 1AW7A 2DYMA 1FM0D 1J7CA 3CIRB 2ACZB 5EE3A 1C77A 3VQIA 1KFYB 2AQ1B 4RFBA 1PGAA 1VLBA 5BMGA 1ESFA 1C4PA 2W82A 3AEFB 1ZUD2 1NYQA 2XN9C 3AE3B 3J9CA 1FFUA 1ZP0B 3NRZA 5HFYA 1QOAA 2LGIA 1GOZA 1NYRA 1V97A 3AV8A 2KWDA 3UI3A 2LHEA 1F77A 4L23A 5G5GA 1FO4A 1L4DB 2VZKD 2OHFA 2BS4B 2WXLA 1MVKA 2XNAC 1L0VB 2G9HD 1L6UA 2PTLA 3Q8FA 1FCCC 2Y5PA 3OWEB 4RGOS 2KQ4X 3ZJVA 1PFDA 4ARCA 1IGCA 1I4HA 1C4AA 3P4SB 1C4CA 1BUIC 1K52A 1SEBD 1YJJA 3FC4A 2WDQB 5EE9A 4HRSA 2EKIA 1QOBA 1SJHD 3AE4B 2QJLA 2GRIA 3PO0A 4ZHOA 3TEYA 2BS2B 4MT5A 1QOFA 1Q10A 1SE3A 1UUPA 3BK1A 4WQMA 3BWUD 4M0WA 3AE9B 1JWUD 1TJEA 1E0ZA 4REZA 2JX5A 2WXGA 5BYRA 4TSSA 3IT4B 1NVID 4YSYB 2QEJC 2WNMA 4ARIA 1JMLA 5C2TB 2K0PA 1ACCA 1YNTE 3BZDB 3P4RB 2N0SB 5EE1A 5BMIA 1J7AA 3AEDB 1PGBA 4GDLB 2WDRB 2Y5CA 2W54A 2BT6A 4DQOC 2E6XA 4RGNA 3W1SA 2ON8A 1F2RC 3BK2A 4KX6B 1XLPA 4JX1C 2NTTA 2WDVB 4Q2JA 2NMQA 3C8YA 5BYQA 1WRIA 1JW9D 4YSZB 3RPFC 2D5GA 2LHDA 3EA6A 2AX5A 1L4ZB 1WYGA 4N6EB 4USAA 4YT0B 4TQ1A 2WQYB 3BVMA 3LXFA 3I9V1 4R3DA 1L6VA 1EU4A 1I4XA 1N61A 2DLBA 1UNSA 4GLSC 1C9FA 1ZXHA 4KKIA 2YEPB 1JQ4A 1XO3A 3T3OA 1HZ6A 2J53A 1E10A 1IBXA 1D5MC 1AWDA 4RF1A 1XXGA 1SXTA 2MH7A 2MJEA 5HI1A 4CQNA 4OZAA 3W9CB 2V4IB 1VJKA 1N5WA 3ZYYX 1A70A 1N60A 4ZHPA 3V3XA 3B2GA 2AQ2B 2X38A 2JWUA 2Z8LA 2AQ3B 2HDEA 3KWVA 4WH4A 1YN5A 3Q69A 5E6JA 4B0EA 5FR3A 1QF6A 3FILA 4HKZE 1WGKA 1MHXA 1V1OA 1FXIA 1SF0A 1YJIA 4RGTA 3R8BA 2FBWB 2GB1A 4XDDA 3IXSA 1UGJA 4IOIE 2JYTA 4J3OD 4A90A 3I57A 3NZ3A 1ENFA 2VZKB 5D3DA 1L5PA 1T6BX 2WXPA 1ZOYB 1TS3A 1M4VA 3MP9A 2HTME 3Q8BA 4WAFA 4NAWB 2LUMA 2CJOA 4A55A 4L1BA 3N9YC 4WURA 1KLGD 2L1AA 1FD6A 1MPEA 2SEBD 5TSSA 2Q5WD 3KQ4A 1D5ZC 1IBXB 3IAM1 1NENB 1FIQA 2BW2A 1SE4A 3MHZA 2N7JA 5GXGB 1FNWA 4D2KA 1KH0A 2NTSA 3TEZA 3NVWA 4C7ZA 3AM9A 4ZOHC 1WXQA 1TYGB 4HEA1 5FKAC 2N9LA 2J52A 1MI0A 1K51A 1TS4A 2WLBA 5G5HA 1ZXIA 1YQ4B 1HA5A 2V3NA 2KACA 1V1PA 4MACA 1P7FA 3NVYA 3VRAB 2CU3A 2WXOA 4OHJA 1FRRA 1VDVA 3FAHA 5T8IA 4UDUC 1FNUA 4A8XC 1TS5A 4XE0A 3AE1B 2WU2B 3ZQ4A 1Y56A 2GI9A 1D4BA 5H92C 1EWYC 2B76B 2BTEA 2WP9B 2JU6X 1JWBD 1RM6C 1QT9A 1ROEA 2QSDA 1MHHE 3NVVA 1BMLC 2K3UA 1TS2A 2LEKA 2N9KA 3AN1A 4O1NA 1N63A 2PVOD 4P6VF 3EGRA 2BB5A 2ONQA 3LB8C 4IKGA 2DWQA 3IAS1 3H8HA 4ZYSA 1ZPSA 4L2YA 3KWLA 2H89B 2FE8A 4WWMA 3URYA 4NZLB 1STEA 4YTPB 5D3IB 1CK1A 2M0AA 1B9RA 2ZW0A 1SB3C 1DOXA 3MC0B 2ZW1A 3AE2B 1ZE3D 2ICIA 1ET9A 2KMMA 3HRDD 1IUEA 1I7HA 4KKJA 1XF5L 4RH6A 3HVDA 1CQVA 3ABVB 3TEXA 4YSXB 3AEGB 1ZDXA 2KAJA 1TKYA 3U52E 1OQQA 1GB4A 1VRAB 1CZPA 4US9A 1FMAD 1TY0A 3GP7A 4H2AA 3KLSX 3IT6B 1YN4A 2K5PA 1KTKA 4OZCA 3SFDB 4YTMB 1R7SA 1VZ8A 4ZRQA 4HJGE 2MJ3A 2LFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQR A;  1L4D B;  1L4Z B;  1C4P A;  1BML C; 
#chains in the Genus database with same CATH topology
 2KMC A;  3U2S C;  3V05 A;  3BY4 B;  1C79 A;  1N5X A;  4LLG M;  2PPH A;  1KLU D;  4W9D A;  2GMI C;  4OW0 A;  1PDX A;  2PE9 A;  2K9X A;  2K8H A;  2MJD A;  3TSS A;  3DQV A;  2J0M A;  4FLH A;  3TIX A;  3U7Z A;  4HK2 A;  5AZG A;  2J4X A;  4MEL A;  3BYT B;  3M3J A;  2OED A;  4M02 A;  2IND C;  2JSV X;  2LXA A;  1V9J A;  2K22 A;  3B2F A;  4HKQ A;  1LM8 B;  2N7D A;  2SAK A;  2JZP A;  2H88 B;  2G3Q B;  2KN4 A;  4B6W A;  2BPS A;  3O65 B;  4PT5 A;  3VRB B;  2KDF B;  1JRO A;  5FK9 C;  5HHD G;  4BFR A;  1Z2M A;  1J8C A;  4RCO A;  4ANW A;  1N62 A;  4C7Y A;  2RDH A;  1S1Q B;  5IKC M;  2GBR A;  2LJI A;  2L0F A;  4IDI A;  3PLU A;  2JRH A;  3PVL A;  1C3T A;  1ZKH A;  4RM9 A;  4ZRP A;  3WA0 A;  2MBO A;  3DWG C;  4MSQ B;  2K6D B;  4HLE A;  3BVZ A;  3R7Q A;  2XK5 A;  1RYJ A;  2MEK A;  1NI3 A;  2BB6 A;  3DVN U;  1EWC A;  2D10 A;  3MC9 A;  4P16 A;  3HVZ A;  1CJE A;  2L52 A;  3AU4 A;  4LNK A;  3CWI A;  1D5X C;  2LI5 A;  2WXJ A;  3UIO B;  3N20 C;  1TZO A;  4B95 A;  1JRU A;  2IZV B;  3TUO A;  2BS3 B;  2HE7 A;  3SEB A;  1FCL A;  3ZTC A;  3ZGZ A;  1TT5 B;  4ICV A;  4GB9 A;  3QQ8 B;  3MC8 A;  3SFE B;  5JHA A;  4WAA A;  3RUI B;  3DPD A;  2V1Y A;  4C4V A;  1I4R A;  4BOS C;  1I4Q A;  2L8J A;  4WJQ A;  2C5L C;  1S3S G;  4DHJ D;  2K8B A;  4EE2 A;  3PRM B;  3NOB A;  4JGH B;  1ISN A;  5IP4 D;  2DYB A;  2CU1 A;  1TKG A;  1U4A A;  2LWP A;  2PVG C;  1KOT A;  2PMV A;  1MG8 A;  2IY0 B;  3ETR A;  3P2B A;  1J19 A;  4JWS C;  4EZK A;  5E6P A;  4MDK E;  2IJ0 A;  2KMA A;  4W9F A;  5JHB A;  2PLP A;  2XBB C;  4MEM A;  3H1U A;  3ZKJ C;  3GS2 A;  1E7P B;  1RFA A;  1XLQ A;  3T3N A;  2KVZ A;  4IUM B;  5J18 A;  1WYW B;  1I42 A;  4YXD B;  5JXV A;  2Y5B B;  1V86 A;  4LTU A;  4B0M A;  3NVZ A;  3AEB B;  2M56 B;  1IP9 A;  3MJ5 A;  3AE8 B;  5EE0 A;  3BII D;  2DZM A;  3N1Z C;  1J7B A;  1ZGU B;  2D3A A;  1WGY A;  2KFJ A;  1V1P B;  4KV2 A;  5D6J B;  4US8 A;  1T0S C;  2INC C;  1SIJ A;  4FA6 A;  2X8X X;  2DYM A;  5EE3 A;  1KFY B;  2UYZ B;  1C4P A;  1ZUD 2;  4KDL B;  3QIJ A;  2KWD A;  2LHE A;  2WYQ A;  4L23 A;  4HDO A;  1L4D B;  2OHF A;  4NPN A;  5D2M B;  2WXL A;  2XNA C;  2PTL A;  4WWP A;  5JZE B;  1L7Y A;  1YJ1 A;  2Y5P A;  3OWE B;  1RLF A;  2EMT A;  3RNE C;  2KQ4 X;  1PFD A;  4BAX A;  2G4S A;  3ZNZ B;  1C4A A;  3P4S B;  1C4C A;  4I6L B;  2JF5 A;  3GE8 C;  4KVG B;  2WDQ B;  5EE9 A;  2YVC A;  2G4D B;  4HJK A;  1SJH D;  3AI5 A;  3PO0 A;  4ZHO A;  4MT5 A;  2D2Q A;  2K1F A;  3BWU D;  2ZVN A;  4AP4 C;  4M8N A;  1E0Z A;  4BBN C;  4TSS A;  3IT4 B;  1J0G A;  2KFK A;  2QHO A;  2ZCB A;  3PSE B;  5IOI A;  3GZN B;  2K0P A;  1ACC A;  3X0W A;  1YX6 B;  5EE1 A;  3GZN I;  1E90 A;  2W54 A;  2D3G A;  1WM2 A;  2MX2 A;  2MLB A;  4JX1 C;  2WDV B;  4P1C C;  1JW9 D;  2QC8 A;  2KC1 A;  1EO6 A;  1L4Z B;  1MFW A;  4IM2 A;  4YT0 B;  1TBE A;  5HKH A;  4TQ1 A;  2WQY B;  2MW5 A;  3DBL I;  4R3D A;  1I4X A;  2NBV B;  1ZXH A;  2FIF A;  3DBL B;  1JQ4 A;  1XO3 A;  2LUE A;  1E10 A;  3OAW A;  1D5M C;  3VH4 B;  3QHT A;  2MJE A;  1T0Q C;  2V4I B;  4ZHP A;  5LLI A;  3V3X A;  3B2G A;  4TV3 A;  1GG3 A;  2KWC A;  1WM3 A;  4IWP A;  3L10 B;  4WH4 A;  5E6J A;  3Q69 A;  5FR3 A;  4HKZ E;  3ZIM A;  1FXI A;  3ZUN A;  1SF0 A;  4C00 A;  4XDD A;  2N1V A;  4IOI E;  2C7N B;  2KX3 A;  3PT2 B;  1ENF A;  1HE8 A;  2KTF A;  1T6B X;  5DCN A;  1ZOY B;  3UIP B;  2DZJ A;  4WAF A;  4NAW B;  4HCN B;  3UIN B;  4L1B A;  3WAL A;  4WUR A;  2L1A A;  4WJN A;  3U30 A;  4MGI E;  3DHH C;  1KJT A;  1E7V A;  2W9N A;  3IAM 1;  1NEN B;  1WE6 A;  5GXG B;  4D2K A;  1KH0 A;  3TEZ A;  3Q3N C;  5FKA C;  3EC8 A;  4FJZ A;  1HA5 A;  4LDT D;  3NVY A;  3FAH A;  4UDU C;  3ZLZ A;  2RPQ A;  3ZRC A;  2JUO A;  4XE0 A;  2WU2 B;  5DPS A;  3VTV A;  2KJH B;  2B76 B;  2JU6 X;  3DBR B;  3NVV A;  1BML C;  3AN1 A;  1TS2 A;  4ZYS A;  3LB8 C;  2DWQ A;  3IAS 1;  3H8H A;  1ZPS A;  4L2Y A;  4A20 A;  3QA8 A;  3URY A;  1WGR A;  1BT0 A;  4YTP B;  1P9D U;  1Q1O A;  2ZW0 A;  1FXT B;  2ZW1 A;  5AZH A;  2WX1 A;  1WXS A;  3HRD D;  4KKJ A;  3AEG B;  4MGK E;  1TKY A;  1GB4 A;  1VRA B;  4US9 A;  5IA7 A;  4GXB A;  3IT6 B;  1UGM A;  3SFD B;  3EEC A;  4ZRQ A;  4CO7 A;  1EUV B;  4P1B C;  4KIK A;  3SR6 A;  4JIO U;  2KZR A;  2V3P A;  4ANU A;  1JWS D;  1P7E A;  2K8C A;  2BYE A;  3AE7 B;  1OQY A;  4MSM B;  3KUC B;  4W9G A;  3H7P B;  4KSL C;  4MM3 B;  2NPT B;  3NUH B;  3BYY B;  1HXY D;  2IGD A;  3Q3F A;  3B0A A;  2IDY A;  3H9D A;  3EFU A;  5IO9 A;  3M95 A;  4YTN B;  5DPT A;  1H4R A;  5CHV C;  3APC A;  1WJN A;  3BIN A;  1L0X B;  3VDZ A;  4XWW A;  1R4N I;  2G1E A;  4RGM A;  1F0Z A;  4DXG A;  1RFK A;  4ANV A;  3OJ3 A;  2J42 A;  2EEL A;  3VR8 B;  1FRD A;  4WQO B;  2QIL A;  4GDK A;  4RF0 A;  2HD5 B;  1V2Y A;  1LO5 D;  1GPX A;  1QIL A;  1LGR A;  1AAR A;  4LK0 M;  1EU3 A;  2RSU A;  5AUK A;  4TQ0 A;  3HUI A;  3V60 A;  4ZYN A;  3L17 A;  4WIP A;  2BBC A;  3AE6 B;  2KN5 A;  4N59 A;  2JT4 B;  3TCA A;  5C3J B;  2INP E;  3PRZ A;  5LNK 1;  2RDG A;  1DGJ A;  4M01 A;  3QJZ A;  3AU5 A;  3Q3J A;  4IWQ A;  3V62 A;  1E8W A;  1TTN A;  2I2Y A;  4RNA A;  2Y3A A;  3RUL A;  1A5R A;  1HEZ E;  4WWN A;  4ZRJ A;  3HHM A;  4A6Q A;  1I35 A;  2FCM A;  1FXA A;  1YN3 A;  1NEK B;  4ICU A;  3R2T A;  1JWM D;  1YX5 B;  1B1Z A;  3EUB 2;  1AYF A;  5H8Y E;  2DYO A;  3Q8E A;  3ZW3 A;  3KW5 B;  1UBQ A;  1DYQ A;  5AUI A;  2DEN B;  3V6E B;  3HM6 X;  3QC8 B;  1K53 A;  3EFC A;  2M4N A;  1GAQ B;  3WAP A;  3B9J A;  1VZ6 A;  3P63 A;  2UU7 A;  2A4Z A;  1OQR A;  2IGH A;  4JWU C;  1ZDV A;  1HZ5 A;  2XEW A;  2WXN A;  1WSP A;  4YWG G;  3N3K B;  3PHX B;  3AEA B;  2V0G A;  4HCP B;  2OJW A;  2BYF A;  2W3R A;  1IGD A;  1E8Y A;  3WAO A;  4LCD E;  1XEE A;  1GC6 A;  1UH6 A;  4AWJ A;  1YMH E;  1C76 A;  1QLB B;  4NNJ B;  4E71 A;  1WGH A;  1K50 A;  1XCT L;  2RR9 A;  3B1L X;  4XDC A;  5CHW A;  2Z0E B;  4TMA B;  2JQR B;  3EHV A;  2M1M A;  3AEC B;  3CIR B;  4I6P A;  1X1M A;  2W82 A;  1UZX B;  4BKT A;  5EDS A;  4PK1 A;  5HFY A;  1QOA A;  1GOZ A;  5TR5 A;  1F77 A;  2XK5 B;  5AZF A;  1UBI A;  2BS4 B;  3JYU A;  3SDL C;  1WGG A;  1L6U A;  3N1Y C;  2KJ6 A;  2MSE D;  1FCC C;  3NJT A;  2KWV B;  3Q3O C;  1I4H A;  4WJO A;  1YJJ A;  2L7R A;  1TIF A;  2EKI A;  3KYD D;  4JL9 A;  3TEY A;  1L2N A;  1V5O A;  1UUP A;  2CHX A;  4M0W A;  3AE9 B;  2EMS A;  2GOW A;  3PRP B;  5AEK B;  2AL6 A;  1NVI D;  3ONS A;  1JML A;  4HPM B;  3VXW A;  4E74 A;  3BZD B;  3P4R B;  1WGD A;  1WXV A;  3HM3 A;  4KZC A;  1E5W A;  2WDR B;  5J17 A;  3V61 A;  4ASW C;  4RMA A;  1V49 A;  2E6X A;  3RNC C;  4CHK A;  5C23 A;  4RGN A;  2ON8 A;  1XLP A;  2FID A;  2NTT A;  3C8Y A;  2L76 A;  1WRI A;  5J2R A;  1NI2 A;  5G2N A;  4YSZ B;  2D5G A;  3RYT A;  4E3C A;  3N32 A;  3DBS A;  4N6E B;  4W9H A;  3BVM A;  3AUL A;  2IO0 B;  1Q5W B;  4GLS C;  3PV1 A;  2KFK B;  1HZ6 A;  2J53 A;  3RMK C;  3V6C B;  4W9I A;  1XXG A;  3VVW B;  4CQN A;  3W9C B;  2V4L A;  2V9H A;  4XGA B;  1E8X A;  2AQ2 B;  2X38 A;  3QAQ A;  1EF1 A;  5GMV A;  1LQB A;  1QF6 A;  2DX5 B;  4GN1 A;  4LJP B;  2KX0 A;  1E8Z A;  4NJ6 A;  1UGJ A;  2KDB A;  4A90 A;  3I57 A;  2WXP A;  1M4V A;  2JVC A;  4XC2 A;  3A9K B;  4PYZ A;  3L08 A;  2GBJ A;  2FCS A;  1KLG D;  1FD6 A;  1MPE A;  2Q5W D;  3IFW B;  1FIQ A;  5KHQ A;  3UQB A;  1FNW A;  3DBH B;  4HVB A;  4XYC A;  5IN7 A;  3AM9 A;  1WXQ A;  3DBH I;  4BZA A;  4HWI B;  2N9L A;  3CSF A;  2J52 A;  1TS4 A;  1K51 A;  1WMH B;  5G5H A;  4EFO A;  2L05 A;  3A4S C;  3OJ4 B;  2KAC A;  4MAC A;  3RNB C;  3VRA B;  2CR5 A;  2CU3 A;  2MHJ A;  4W9K A;  4OHJ A;  5E6N A;  5T8I A;  4A8X C;  1FNU A;  3L54 A;  2KXJ A;  4EKU A;  1K8R B;  1Y56 A;  2BGF A;  2D07 B;  1D4B A;  2KD0 A;  1WRD B;  1EWY C;  1YQB A;  3W1S C;  1RM6 C;  2QSD A;  2N9K A;  2PVO D;  4P6V F;  3EGR A;  2ONQ A;  2CKH B;  3KWL A;  3K9O B;  4NZL B;  1STE A;  2FCN A;  1SB3 C;  1DOX A;  3MC0 B;  1ZE3 D;  2V3S A;  3VTU A;  1P98 A;  3X23 A;  4EEW A;  3ABV B;  1ZDX A;  2KAJ A;  3VTW A;  3RNA C;  1OQQ A;  4A3O A;  1MG4 A;  5IAA C;  3A33 B;  2MRP A;  2CS4 A;  3KLS X;  1KTK A;  4OZC A;  4YTM B;  3KYC D;  4K1R B;  2CHZ A;  1T0Y A;  1HTO A;  3E9S A;  3QCA A;  5KHO A;  2KDM A;  3FIL B;  2N7E A;  2ZPN A;  2PJH A;  3DCG A;  4OVV A;  5HG2 A;  2MBB B;  4JE3 B;  2MBE A;  3P1M A;  5LXI B;  5G55 A;  1LFD A;  3PS6 A;  2N9P C;  1JCK B;  2C7M B;  2I1K A;  2LAS A;  3JSV B;  2PIA A;  4FN2 A;  3DWM A;  2DBY A;  1PYW D;  3L4P A;  2GLS A;  1E7U A;  1QQR A;  4NAM A;  4II2 B;  3NS1 A;  2ZNV B;  3RFZ B;  2MP2 A;  4DDI D;  5BMH A;  1XQQ A;  3GB1 A;  2N9E B;  2DZI A;  1TKE A;  2NPT A;  1TZ1 A;  2KLC A;  3Q14 C;  1DOI A;  3R66 C;  5BYS A;  4GOC A;  4A9A A;  2KAN A;  3SD5 A;  3O13 A;  5I4D A;  4C56 C;  3VUY A;  3A4R A;  3M63 B;  2KDE B;  1JRP A;  2D3C A;  3U4E G;  4JLC A;  4BKG A;  4HDQ A;  4XWT A;  3RCZ A;  3PZD A;  2D11 A;  4TKN A;  1QKZ A;  4C80 A;  1FFV A;  2KQ7 A;  1D6E C;  1FEH A;  3CF6 E;  3NY5 A;  2DHZ A;  3R7R A;  4W9J A;  3GOE A;  1KRH A;  1UWM A;  4MGY E;  3ZNG C;  4MH8 A;  4P7I A;  3NZU A;  1XLN A;  1WH3 A;  1V80 A;  4PS8 A;  4W9L A;  5MPO A;  1OFF A;  1YQ3 B;  2L0T A;  4G11 A;  1FPY A;  2QMT A;  3Q6B A;  2Z59 B;  3W5V B;  2PW9 A;  3C0R B;  2BYT A;  4ZRI A;  3GE3 C;  4G0N B;  2NCN A;  2I38 A;  1JWA D;  3NZS A;  2GBM A;  2LGS A;  4DK5 A;  4DBG A;  1F2R I;  3LJ3 A;  1EM7 A;  4FJV B;  2M19 A;  4JPS A;  4NJC A;  4KDI C;  2WXH A;  1Z5S B;  2I1J A;  1TY2 A;  4HXD A;  3VUW A;  3P4Q B;  1VZ7 A;  2LMC A;  2WHI A;  1UWX A;  2OOB B;  4NAW A;  3W5U B;  1UD7 A;  4HRO A;  4J6I A;  4EUT A;  2L3Z A;  2TSS A;  2DAF A;  1WIA A;  2W3S A;  2L00 B;  2MWS B;  4CYE A;  1WJU A;  2R61 A;  1T3Q A;  3H7S A;  3TL5 A;  1WI0 A;  4AQ7 A;  1NDD A;  2NR2 A;  3ZJT A;  2KHW B;  4ITK A;  2FUG 1;  1WX9 A;  3AXC A;  4DHZ E;  3C19 A;  2K6Q A;  3QX1 A;  2KYW A;  4MM3 A;  2KTR B;  3MHS D;  2E3T A;  1YOV B;  2O6V D;  4KGR A;  2WXI A;  1PUT A;  3L16 A;  1F1H A;  4EZL A;  1FM0 D;  2C7H A;  1J7C A;  2O6V B;  3Q2A C;  3K9P B;  1C77 A;  3VQI A;  2AQ1 B;  2KQS A;  3PGE A;  1PGA A;  2C60 A;  1VLB A;  1T0R C;  1ESF A;  3ZO5 B;  2XN9 C;  3I3T B;  3AE3 B;  3J9C A;  2JRI B;  3NRZ A;  1WFY A;  2LGI A;  3AV8 A;  1V97 A;  5G5G A;  2KOX A;  3I63 C;  1C1Y B;  1FO4 A;  1XT9 B;  2VZK D;  2NBW B;  1ZW7 A;  1L0V B;  2VH1 A;  4IM0 A;  2BYV E;  4IWO A;  1TGZ B;  4TUU A;  3UQA A;  4ARC A;  2PE6 B;  2AL3 A;  1BUI C;  3VFK A;  4HRS A;  1QOB A;  2N9X A;  3AE4 B;  2QJL A;  2GRI A;  4NJ7 A;  4I6N B;  3L0W B;  1SE3 A;  1Q10 A;  4WQM A;  1VCB A;  3WAM A;  5D94 A;  1TJE A;  3DVG Y;  4IW0 A;  2JX5 A;  2WXG A;  4DHZ B;  2J0J A;  4A3P A;  2BWE S;  4YSY B;  2WNM A;  2K25 A;  4F8C B;  2BF8 B;  3NS8 A;  4FHJ A;  5JH5 C;  3QWZ B;  1J7A A;  3AED B;  4N9F 4;  2LVP A;  4LNN A;  1V5T A;  4K81 A;  4DQO C;  3W1S A;  3UGB B;  1F2R C;  4EOY A;  4ZRK A;  3UF8 A;  4YL8 A;  5BYQ A;  4AOF A;  4C4V B;  1SGH A;  3VHT C;  2LXC A;  1WYG A;  4FBJ B;  4LNI A;  1L6V A;  4MJS A;  2DLB A;  3A9J B;  3PRE A;  2YEP B;  2M8S A;  3ML9 A;  3T9L A;  3NG0 A;  1IBX A;  4WWO A;  1R4M I;  1SXT A;  2MH7 A;  3WAN A;  5HI1 A;  5C1Z A;  3DBR I;  1N5W A;  5CX3 A;  4QAY A;  3H7P A;  1WE7 A;  2JWU A;  3RD2 A;  2Z8L A;  4FAD A;  2AWT A;  3OLM D;  4RM8 A;  4B0E A;  4LNF A;  3FIL A;  4S0R A;  1WGK A;  1MHX A;  4K7W A;  3IVF A;  1V1O A;  4AJY B;  1YJI A;  4RGT A;  2GB1 A;  2KT7 A;  2VZK B;  3QK0 A;  2FUH B;  4BVU C;  5L83 A;  1WXM A;  3Q8B A;  1WXA A;  2LGD A;  1EF5 A;  2CJO A;  2WGS A;  3N9Y C;  3A9K A;  2SEB D;  5TSS A;  3KQ4 A;  3ZDM C;  1IBX B;  2RDB C;  2HJ8 A;  4AJW A;  2BW2 A;  1V81 A;  3MHZ A;  1F9J A;  2WDT B;  2J0K A;  2MP2 B;  4KZ0 A;  2QCZ A;  4DXA B;  4GIV A;  4ZOH C;  4G3X B;  1GJZ A;  3Q3M C;  1LXD A;  3IBE A;  1MI0 A;  1WJ4 A;  1OGW A;  2WXO A;  1FRR A;  3HK0 A;  2KO3 A;  3ZQ4 A;  2BQQ A;  2ZJD A;  5H92 C;  2IO1 B;  2BTE A;  2WP9 B;  1JWB D;  1MHH E;  4O1N A;  2K3U A;  2LEK A;  1N63 A;  2MBQ A;  2EKE C;  2BB5 A;  3FKY A;  3LDZ E;  4IKG A;  4DDG D;  1R4N B;  4WJP A;  4URK A;  1IYF A;  2FE8 A;  2JPH A;  4WWM A;  5D3I B;  4G50 A;  2M0A A;  2Z0D B;  1B9R A;  3AE2 B;  2ICI A;  2KMM A;  2MA9 B;  4KSK C;  2N1W A;  5DPR A;  1WX7 A;  4RH6 A;  3HVD A;  2M0X A;  3CMM B;  3U52 E;  1CZP A;  4K7S A;  1FMA D;  1P3Q U;  1TY0 A;  3ML8 A;  3GP7 A;  2ZPY A;  1YN4 A;  3TBL D;  1VZ8 A;  4HJG E;  2MJ3 A;  1RWS A;  1KM7 A;  3DHI C;  1WWT A;  4NQK E;  1M94 A;  4AUQ C;  1WR1 A;  3DVN V;  2O2V A;  4ZDV A;  3KH0 A;  3TEW A;  3Q8A A;  1SSN A;  2W55 A;  4XZ4 A;  2CHW A;  2KC2 A;  4OVU A;  2RPV A;  1SE2 A;  1Q0W B;  2WWZ A;  4GU2 A;  1E6E B;  1FNV A;  2KK8 A;  2QIE B;  2GBK A;  2PKO A;  3OG5 A;  3WCQ A;  2WXK A;  3KUZ A;  3U7D A;  2CJN A;  2WXF A;  2BWF A;  2IO3 B;  3DHG C;  2JYE A;  2MCN B;  4XX5 A;  1GB1 A;  3ZJU A;  2WU5 B;  2FNJ B;  3AEE B;  2BVC A;  1G6J A;  2B3A A;  3MJW A;  3N30 A;  4KGS A;  4KGT A;  3AB5 A;  4M0W B;  2ZVO A;  2LRU A;  3HIZ A;  3PHW B;  4K3C A;  1CMX B;  1VR9 A;  4HPL B;  2KKC A;  1Y8R C;  1L0Y B;  4BOZ B;  4EZJ A;  4B9K A;  3JVZ X;  4N58 A;  3PZ7 A;  1JAL A;  4X57 B;  3AE5 B;  3JW0 X;  2IGG A;  3ENE A;  4S17 A;  2RD0 A;  1SJE D;  2KTR A;  1C78 A;  1N6Z A;  2DNF A;  4K3B A;  2WXM A;  2LRW A;  1P1A A;  1SIF A;  2INN E;  4AS1 A;  3PPA A;  5LXH A;  1GUA B;  2FAZ A;  1PGX A;  3TMP B;  2GBN A;  1WY8 A;  2O2V B;  1WF9 A;  3TJP A;  2RMM A;  5E6O A;  3R2I A;  3Q8C A;  1AN8 A;  1WX8 A;  2ZNV C;  2DAJ A;  3P4P B;  2YEP F;  3AMZ A;  4DXF A;  5D7G A;  1WZ0 A;  2L32 A;  1V8C A;  3R3M A;  4DWF A;  4GDK B;  4GSW A;  2NVU I;  3E56 A;  3VR9 B;  1T5X D;  5L95 C;  3BVG A;  4PS7 A;  2KDI A;  3PTF C;  1E9M A;  4PS3 A;  2KWU B;  1H8C A;  4GDL A;  4OVZ A;  1KF6 B;  4MH0 E;  4LJO B;  1XLO A;  3P42 A;  3RZW C;  2MBH A;  3S2A A;  3SU8 X;  2LD9 A;  2ZEQ A;  3RT3 B;  2WS3 B;  2LVQ A;  1XD3 B;  4OZB A;  1SE9 A;  3W2D A;  2RGF A;  3NHE B;  3RN9 C;  1R4M B;  2R2Q A;  4BKS A;  2LGY A;  1HQR D;  4FXC A;  2MQJ A;  1I4G A;  2IBI B;  2WXQ A;  2ASQ A;  3APF A;  4KIK B;  3JSV A;  3A9J A;  1WZ3 A;  1OEY J;  2IPK D;  3VUX A;  1SBB B;  2WX0 A;  3I5J C;  1PQS A;  4GMV A;  1F52 A;  4NQL B;  1WJ6 A;  3IG3 A;  2JZZ A;  3MFG A;  1YD8 U;  1BXT A;  2WXR A;  3PZ8 A;  2JXT A;  3PLV A;  3LYY A;  2K39 A;  4BBN F;  1XCQ L;  3AH7 A;  1DOY A;  2KLG A;  3ZXV A;  1I4P A;  4FJY A;  2L83 A;  1ET6 A;  1P0R A;  1QOG A;  2M17 A;  2J7Q B;  1AW7 A;  2R2O A;  1QZE A;  1OEY A;  2ACZ B;  4RFB A;  5BMG A;  2DZK A;  3AEF B;  1IPG A;  1NYQ A;  3A1Q A;  1HTQ A;  1KLV A;  1UEL A;  1FFU A;  1ZP0 B;  2UWQ A;  4ACF A;  1NYR A;  3UI3 A;  2ZCC A;  2D3B A;  1MVK A;  2G9H D;  4LDT B;  3Q8F A;  4RGO S;  3ZJV A;  3CST A;  5DPW A;  1IGC A;  3H6N A;  4ANX A;  1K52 A;  1SEB D;  3FC4 A;  3ZXR A;  2BS2 B;  1QOF A;  2BKR B;  3BK1 A;  1JWU D;  4BKS D;  3DDC B;  4IC7 B;  4REZ A;  5BYR A;  1V6E A;  2QEJ C;  3L13 A;  4ARI A;  3DOW A;  2IYD B;  5C2T B;  2VH2 A;  3SHQ A;  2A5U A;  1YNT E;  2N0S B;  5BMI A;  4FHK A;  3VAW A;  4GDL B;  1PGB A;  1OTR B;  3IHP C;  4JQW C;  2Y5C A;  2BT6 A;  2KJR A;  3U8Z A;  2PEA A;  5BO4 B;  4IM3 A;  4IG7 B;  3BK2 A;  4KX6 B;  4Q2J A;  3D32 A;  2NMQ A;  4W9E A;  2REX A;  4K7U A;  5CHF A;  3RPF C;  2LHD A;  3EA6 A;  2AX5 A;  5FR6 A;  3DVG X;  4USA A;  2LJ5 A;  3ZTD A;  2LGX A;  1YIW A;  1NBF C;  2JWZ A;  1UF0 A;  4MGZ E;  3LXF A;  3I9V 1;  1EU4 A;  1N61 A;  1UNS A;  3ZRF A;  1C9F A;  2FCQ A;  4KKI A;  2NBU A;  3T3O A;  4MJS B;  1GC7 A;  2KNB A;  2JZ3 B;  1AWD A;  2QDF A;  4RF1 A;  4F1S A;  4OZA A;  4FUL A;  3T8M A;  3N1X C;  1VJK A;  3ZYY X;  1A70 A;  1N60 A;  4DHJ B;  2KVR A;  3RNG C;  2LVO A;  2ZZP B;  2AQ3 B;  2HDE A;  3KWV A;  1YN5 A;  2C9W B;  2AEH A;  2IY1 B;  3R8B A;  2FBW B;  3IXS A;  2JYT A;  4J3O D;  3NZ3 A;  3B08 A;  1D3Z A;  5D3D A;  1L5P A;  3ZNH B;  1TS3 A;  5CTR C;  3MP9 A;  2HTM E;  3ZVV A;  4LNO A;  2JXX A;  2LUM A;  4A55 A;  2G45 B;  4GGQ A;  3A1Q B;  1D5Z C;  2HTH A;  3RI7 C;  1SE4 A;  3APD A;  2N7J A;  4II3 B;  4M00 A;  2N4F A;  2NTS A;  2NS5 A;  3KUD B;  2YLM A;  3M62 B;  1WMH A;  3NVW A;  4C7Z A;  1TYG B;  4HEA 1;  1GNU A;  4F7Z A;  2WLB A;  3W1Y A;  1ZXI A;  1YQ4 B;  3ZNI D;  4NY0 A;  3ALB A;  3KVF B;  3ECI A;  2V3N A;  1V1P A;  1P7F A;  1RAX A;  3ZDT A;  1VDV A;  3RNF C;  1MJD A;  2AYO B;  1WR6 E;  1TS5 A;  3AE1 B;  1VD2 A;  2GI9 A;  4HPP A;  2HJ1 A;  3QAR A;  1QT9 A;  1ROE A;  4W9C A;  3VH3 B;  2IO2 B;  3MTN B;  2O6V A;  2H89 B;  1CK1 A;  2BKF A;  4M8M A;  1ET9 A;  4PYU A;  1IUE A;  2JY6 A;  1I7H A;  1XF5 L;  2LZ6 A;  1CQV A;  3WIM A;  3TEX A;  4YSX B;  1RRB A;  3RZF A;  4H2A A;  2OJR A;  2K5P A;  1R7S A;  2VRR B;  2LFI A; 
#chains in the Genus database with same CATH homology
 3E9S A;  3U2S C;  1WWT A;  3V05 A;  3SR6 A;  1C79 A;  1N5X A;  4LLG M;  1KLU D;  2V3P A;  1JWS D;  1P7E A;  4OW0 A;  2KDM A;  3FIL B;  3TEW A;  1PDX A;  3AE7 B;  3Q8A A;  1SSN A;  2W55 A;  5HG2 A;  2K9X A;  4JE3 B;  4MM3 B;  3P1M A;  3NUH B;  2MJD A;  3BYY B;  2RPV A;  3TSS A;  1SE2 A;  1HXY D;  2IGD A;  1E6E B;  1FNV A;  2QIE B;  2IDY A;  2PKO A;  1JCK B;  3U7Z A;  3WCQ A;  2J4X A;  2PIA A;  2WXK A;  4YTN B;  3BYT B;  2CJN A;  2WXF A;  3DWM A;  2DBY A;  2JYE A;  1PYW D;  3L4P A;  2OED A;  1L0X B;  2JSV X;  4HKQ A;  3ZJU A;  2K22 A;  3B2F A;  1GB1 A;  1QQR A;  2WU5 B;  4NAM A;  3RFZ B;  3AEE B;  3NS1 A;  4XWW A;  2G1E A;  4RGM A;  2SAK A;  2JZP A;  1F0Z A;  5BMH A;  4DXG A;  2H88 B;  2KN4 A;  4KGS A;  1RFK A;  3GB1 A;  4PT5 A;  4KGT A;  1TKE A;  3VRB B;  1JRO A;  2J42 A;  5FK9 C;  3AB5 A;  5HHD G;  2EEL A;  3VR8 B;  1FRD A;  1DOI A;  2QIL A;  4RCO A;  4RF0 A;  5BYS A;  1N62 A;  4C7Y A;  2RDH A;  1VR9 A;  1LO5 D;  1GPX A;  1QIL A;  4A9A A;  2LJI A;  4IDI A;  3O13 A;  4LK0 M;  1EU3 A;  4TQ0 A;  1L0Y B;  5AUK A;  4C56 C;  5I4D A;  3HUI A;  1JRP A;  4ZRP A;  4N58 A;  3DWG C;  3PZ7 A;  4WIP A;  1JAL A;  2BBC A;  3AE6 B;  3AE5 B;  2IGG A;  3U4E G;  4N59 A;  1SJE D;  3BVZ A;  5C3J B;  1C78 A;  2INP E;  4XWT A;  1RYJ A;  2WXM A;  2MEK A;  1NI3 A;  2BB6 A;  5LNK 1;  1EWC A;  2INN E;  2RDG A;  1QKZ A;  4AS1 A;  4C80 A;  1FFV A;  1DGJ A;  4P16 A;  1D6E C;  1PGX A;  1FEH A;  1RWS A;  3HVZ A;  1CJE A;  2L52 A;  3CWI A;  1D5X C;  2RMM A;  1KRH A;  3R2I A;  2WXJ A;  1AN8 A;  3Q8C A;  1UWM A;  1TZO A;  3TUO A;  2BS3 B;  3SEB A;  4MH8 A;  1FCL A;  3ZGZ A;  2I2Y A;  4RNA A;  3P4P B;  1XLN A;  3SFE B;  2YEP F;  3AMZ A;  4DXF A;  5D7G A;  2Y3A A;  5MPO A;  1OFF A;  1HEZ E;  1V8C A;  2L32 A;  1YQ3 B;  4GDK B;  4A6Q A;  3E56 A;  3VR9 B;  1T5X D;  1FXA A;  1I4R A;  1I4Q A;  3BVG A;  1YN3 A;  1NEK B;  3R2T A;  2QMT A;  1JWM D;  1E9M A;  3W5V B;  2PW9 A;  4EE2 A;  2BYT A;  1B1Z A;  3EUB 2;  1AYF A;  4OVZ A;  5H8Y E;  1KF6 B;  2I38 A;  1JWA D;  2DYO A;  1XLO A;  3P42 A;  1TKG A;  3Q8E A;  1F2R I;  2PVG C;  2WS3 B;  1EM7 A;  2PMV A;  1DYQ A;  3ETR A;  2M19 A;  4OZB A;  5AUI A;  4JPS A;  4NJC A;  4JWS C;  2WXH A;  3W2D A;  1K53 A;  1TY2 A;  3P4Q B;  1VZ7 A;  2LMC A;  1GAQ B;  1UWX A;  2IJ0 A;  3B9J A;  2PLP A;  3W5U B;  4HRO A;  1VZ6 A;  3P63 A;  1OQR A;  2IGH A;  4JWU C;  1ZDV A;  1HQR D;  2TSS A;  3GS2 A;  1HZ5 A;  2WXN A;  1WSP A;  2W3S A;  4YWG G;  1E7P B;  1XLQ A;  4FXC A;  3T3N A;  3AEA B;  2V0G A;  2R61 A;  1I4G A;  1T3Q A;  2W3R A;  1IGD A;  4YXD B;  5JXV A;  2WXQ A;  4AQ7 A;  4LTU A;  4B0M A;  2IPK D;  3ZJT A;  3NVZ A;  3AEB B;  1SBB B;  1XEE A;  2M56 B;  4ITK A;  2FUG 1;  1YMH E;  1C76 A;  3MJ5 A;  3AE8 B;  1QLB B;  3MFG A;  5EE0 A;  3BII D;  1J7B A;  1K50 A;  1BXT A;  1XCT L;  2WXR A;  3PZ8 A;  2JXT A;  4XDC A;  3LYY A;  1V1P B;  1XCQ L;  3AH7 A;  4TMA B;  1DOY A;  4US8 A;  2E3T A;  1SIJ A;  1I4P A;  2JQR B;  2L83 A;  4KGR A;  1ET6 A;  2WXI A;  1QOG A;  1PUT A;  3AEC B;  1AW7 A;  2DYM A;  1FM0 D;  1J7C A;  3CIR B;  2ACZ B;  5EE3 A;  1C77 A;  3VQI A;  1KFY B;  2AQ1 B;  4RFB A;  1PGA A;  1VLB A;  5BMG A;  1ESF A;  1C4P A;  2W82 A;  3AEF B;  1ZUD 2;  1NYQ A;  2XN9 C;  3AE3 B;  3J9C A;  1FFU A;  1ZP0 B;  3NRZ A;  5HFY A;  1QOA A;  2LGI A;  1GOZ A;  1NYR A;  1V97 A;  3AV8 A;  2KWD A;  3UI3 A;  2LHE A;  1F77 A;  4L23 A;  5G5G A;  1FO4 A;  1L4D B;  2VZK D;  2OHF A;  2BS4 B;  2WXL A;  1MVK A;  2XNA C;  1L0V B;  2G9H D;  1L6U A;  2PTL A;  3Q8F A;  1FCC C;  2Y5P A;  3OWE B;  4RGO S;  2KQ4 X;  3ZJV A;  1PFD A;  4ARC A;  1IGC A;  1I4H A;  1C4A A;  3P4S B;  1C4C A;  1BUI C;  1K52 A;  1SEB D;  1YJJ A;  3FC4 A;  2WDQ B;  5EE9 A;  4HRS A;  2EKI A;  1QOB A;  1SJH D;  3AE4 B;  2QJL A;  2GRI A;  3PO0 A;  4ZHO A;  3TEY A;  2BS2 B;  4MT5 A;  1QOF A;  1Q10 A;  1SE3 A;  1UUP A;  3BK1 A;  4WQM A;  3BWU D;  4M0W A;  3AE9 B;  1JWU D;  1TJE A;  1E0Z A;  4REZ A;  2JX5 A;  2WXG A;  5BYR A;  4TSS A;  3IT4 B;  1NVI D;  4YSY B;  2QEJ C;  2WNM A;  4ARI A;  1JML A;  5C2T B;  2K0P A;  1ACC A;  1YNT E;  3BZD B;  3P4R B;  2N0S B;  5EE1 A;  5BMI A;  1J7A A;  3AED B;  1PGB A;  4GDL B;  2WDR B;  2Y5C A;  2W54 A;  2BT6 A;  4DQO C;  2E6X A;  4RGN A;  3W1S A;  2ON8 A;  1F2R C;  3BK2 A;  4KX6 B;  1XLP A;  4JX1 C;  2NTT A;  2WDV B;  4Q2J A;  2NMQ A;  3C8Y A;  5BYQ A;  1WRI A;  1JW9 D;  4YSZ B;  3RPF C;  2D5G A;  2LHD A;  3EA6 A;  2AX5 A;  1L4Z B;  1WYG A;  4N6E B;  4USA A;  4YT0 B;  4TQ1 A;  2WQY B;  3BVM A;  3LXF A;  3I9V 1;  4R3D A;  1L6V A;  1EU4 A;  1I4X A;  1N61 A;  2DLB A;  1UNS A;  4GLS C;  1C9F A;  1ZXH A;  4KKI A;  2YEP B;  1JQ4 A;  1XO3 A;  3T3O A;  1HZ6 A;  2J53 A;  1E10 A;  1IBX A;  1D5M C;  1AWD A;  4RF1 A;  1XXG A;  1SXT A;  2MH7 A;  2MJE A;  5HI1 A;  4CQN A;  4OZA A;  3W9C B;  2V4I B;  1VJK A;  1N5W A;  3ZYY X;  1A70 A;  1N60 A;  4ZHP A;  3V3X A;  3B2G A;  2AQ2 B;  2X38 A;  2JWU A;  2Z8L A;  2AQ3 B;  2HDE A;  3KWV A;  4WH4 A;  1YN5 A;  3Q69 A;  5E6J A;  4B0E A;  5FR3 A;  1QF6 A;  3FIL A;  4HKZ E;  1WGK A;  1MHX A;  1V1O A;  1FXI A;  1SF0 A;  1YJI A;  4RGT A;  3R8B A;  2FBW B;  2GB1 A;  4XDD A;  3IXS A;  1UGJ A;  4IOI E;  2JYT A;  4J3O D;  4A90 A;  3I57 A;  3NZ3 A;  1ENF A;  2VZK B;  5D3D A;  1L5P A;  1T6B X;  2WXP A;  1ZOY B;  1TS3 A;  1M4V A;  3MP9 A;  2HTM E;  3Q8B A;  4WAF A;  4NAW B;  2LUM A;  2CJO A;  4A55 A;  4L1B A;  3N9Y C;  4WUR A;  1KLG D;  2L1A A;  1FD6 A;  1MPE A;  2SEB D;  5TSS A;  2Q5W D;  3KQ4 A;  1D5Z C;  1IBX B;  3IAM 1;  1NEN B;  1FIQ A;  2BW2 A;  1SE4 A;  3MHZ A;  2N7J A;  5GXG B;  1FNW A;  4D2K A;  1KH0 A;  2NTS A;  3TEZ A;  3NVW A;  4C7Z A;  3AM9 A;  4ZOH C;  1WXQ A;  1TYG B;  4HEA 1;  5FKA C;  2N9L A;  2J52 A;  1MI0 A;  1K51 A;  1TS4 A;  2WLB A;  5G5H A;  1ZXI A;  1YQ4 B;  1HA5 A;  2V3N A;  2KAC A;  1V1P A;  4MAC A;  1P7F A;  3NVY A;  3VRA B;  2CU3 A;  2WXO A;  4OHJ A;  1FRR A;  1VDV A;  3FAH A;  5T8I A;  4UDU C;  1FNU A;  4A8X C;  1TS5 A;  4XE0 A;  3AE1 B;  2WU2 B;  3ZQ4 A;  1Y56 A;  2GI9 A;  1D4B A;  5H92 C;  1EWY C;  2B76 B;  2BTE A;  2WP9 B;  2JU6 X;  1JWB D;  1RM6 C;  1QT9 A;  1ROE A;  2QSD A;  1MHH E;  3NVV A;  1BML C;  2K3U A;  1TS2 A;  2LEK A;  2N9K A;  3AN1 A;  4O1N A;  1N63 A;  2PVO D;  4P6V F;  3EGR A;  2BB5 A;  2ONQ A;  3LB8 C;  4IKG A;  2DWQ A;  3IAS 1;  3H8H A;  4ZYS A;  1ZPS A;  4L2Y A;  3KWL A;  2H89 B;  2FE8 A;  4WWM A;  3URY A;  4NZL B;  1STE A;  4YTP B;  5D3I B;  1CK1 A;  2M0A A;  1B9R A;  2ZW0 A;  1SB3 C;  1DOX A;  3MC0 B;  2ZW1 A;  3AE2 B;  1ZE3 D;  2ICI A;  1ET9 A;  2KMM A;  3HRD D;  1IUE A;  1I7H A;  4KKJ A;  1XF5 L;  4RH6 A;  3HVD A;  1CQV A;  3ABV B;  3TEX A;  4YSX B;  3AEG B;  1ZDX A;  2KAJ A;  1TKY A;  3U52 E;  1OQQ A;  1GB4 A;  1VRA B;  1CZP A;  4US9 A;  1FMA D;  1TY0 A;  3GP7 A;  4H2A A;  3KLS X;  3IT6 B;  1YN4 A;  2K5P A;  1KTK A;  4OZC A;  3SFD B;  4YTM B;  1R7S A;  1VZ8 A;  4ZRQ A;  4HJG E;  2MJ3 A;  2LFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...