1BN6A

Haloalkane dehalogenase from a rhodococcus species
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
291
structure length
291
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGVLPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNEIPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HALOALKANE DEHALOGENASE
publication title Haloalkane dehalogenases: structure of a Rhodococcus enzyme.
pubmed doi rcsb
source organism Rhodococcus sp.
total genus 102
structure length 291
sequence length 291
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 1998-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bn6A00
4J0DA 3PUIA 1G4HA 4AMYA 4C4XA 3G9TA 3T4UA 4DMHA 1VXRA 3W9BA 5C8ZA 4AZ0A 1WHSA 1J07A 4BATA 4QDUA 5CXUA 5CMLA 3C6BA 1ODSA 1CUJA 1VXOA 1R3DA 4J0KA 1XZLA 5FOQA 3NGMA 5ALZA 4E11A 3HJUA 4AO8A 2HRRA 7YASA 1DU4A 3DOIA 2CJPA 1ACJA 3IUJA 3O4IA 3R40A 4OU5A 4QZVA 4Y2YA 4KJXA 4CCWA 1Y7IA 3FNBA 4ZV9A 2VEOA 2J3QA 1BROA 3D2AA 3DCNA 3E0XA 1XRPA 4I19A 4MQMA 3BWXA 1WCYA 1LPAB 2PSHA 1NU8A 2GZRA 4CI9A 4J0CA 4DM7A 3G9UA 3WK8A 3U1TA 2PSEA 1ZICA 2QXTA 1XQXA 5CT6A 3QVMA 1WPXA 3WWCA 1A8UA 5LKAA 5A62A 2WIGA 1E8DA 5D7BA 4UHEA 2E3JA 3VXKA 5I9IA 5CT4A 2JGJA 1K63A 3TRDA 1NX9A 3WK5A 3D7RA 2OCKA 1ZD4A 4LYDA 3DQZA 3BIXA 4FLFA 4MWSA 2XMCA 2HIHA 2C58A 3H2GA 3ZLVA 1F0NA 4J03A 4OYLA 5D3ZA 4FNMA 3WA7A 4M0FA 1YAHA 5CTAA 5AKEA 2WJ3A 5AM0A 2BUAA 4FLMA 5AM4A 5DNWA 2X76A 4UBNA 5LZ9A 3WK9A 4E14A 4B6GA 5FPQA 1JMYA 3HLKA 1MTZA 3ZLUA 1DINA 5CT8A 4MQLA 5LIPA 2DFPA 4NZZA 3R0VA 4ZV7A 3MVEA 1UXOA 4K2AA 2WJ6A 3H2IA 1JKMA 4A16A 3WK4A 3F97A 5DTJA 1H23A 4UHBA 3C6XA 4HZGA 2D0DA 4NVRA 4E46A 5C7YA 1TCAA 4BZZA 2PKYX 5KREA 4H7KA 1OXMA 4ARAA 2XUIA 3YASA 5EIEA 1F8UA 3O4GA 2ZJ6A 4BDTA 1TIBA 4AX4A 5LZ4A 3IUNA 3E1GA 1X2EA 2ZJ7A 1YSCA 5HF5A 1W6RA 3IUMA 4X92A 4QDTA 3DYVA 5AI0A 4BVJA 5JAHA 3BDVA 4BE4A 1LGYA 1UFOA 4W1SA 3FVRA 3EQ8A 4ETWA 3LS2A 2WUEA 2ZYRA 3QPDA 3WK6A 4G1FA 1M33A 4Q1VA 2HFKA 1EVEA 3RK4A 1CUEA 2HA6A 4UFNA 2BGNA 2G5TA 4PF1A 1CV2A 1GT6A 5YASA 4N8EA 5DLPA 3A2NA 3HZOA 1TKRA 1ISPA 3IVMA 3DL7A 3ANSA 1XRNA 3QYJA 5FXMA 5ALDA 4BAUA 4QDOA 4RE6A 4Y7DA 2NW6A 3Q0TA 2ZYHA 2BCEA 3PUHA 4EBBA 1QIEA 4GI1A 3WKDA 4F0JA 2Y1KA 3R3ZA 1RYYA 3LLCA 1FJ2A 1XZDA 4Q3LA 2QUAA 4C89A 4FHZA 3DS8A 4H77A 1CUXA 4H7HA 5E4JA 5HKBA 1QO9A 2DHDA 5ALVA 1EVQA 4DLNA 4WFKA 5AKHA 1YA4A 1XROA 5EHZA 3GROA 4BZWA 3SX4A 5AIAA 1ZI6A 2JGEA 4DYHA 3R3UA 2HA5A 4Y2JA 1VE6A 1DQZA 1CVLA 3PF8A 3R41A 4FDMA 5AKIA 4J0GA 1CUCA 1LNSA 1QO7A 3KWFA 4GXNA 2PL5A 2PX6A 2DHEA 3G02A 2ZYSA 4MWTA 5K5EA 3GBSA 2WILA 1WOMA 1F0PA 1XZCA 4FBLA 2PSDA 3H2JA 1EK1A 3LCRA 2JIDA 4ZREA 4BTVA 2VJAA 1E5TA 4BP8A 5DJ5A 1UKAA 1AZWA 3HEAA 1P0PA 5AI4A 3I2JA 4Z49A 4L0CA 2OGSA 4B84A 4C4ZA 4ZI5A 1A8SA 1JT2A 3C5VA 4G4IA 2BKLA 4FKBA 3WL7A 3I1YA 3ILSA 3R3VA 2OG1A 5CH8A 3M82A 1DX6A 4TPKA 1QE3A 1E8NA 3ICVA 4DIUA 4B81A 3DNMA 5H3HA 1A88A 5K3DA 2VJCA 3STXA 3FYUB 3K2IA 3QBJA 4OCZA 1GPLA 1AQLA 2XLBA 3C43A 3P2MA 3RM3A 1CUYA 4N5HX 1UZAA 1YCDA 4P9NA 1EDBA 4UHHA 5EHQA 3HACA 2B61A 3KDAA 1XQVA 5ALGA 3C45A 4RGYA 1MAAA 2QKYA 3I2KA 1EB9A 2HA3A 4DNFA 1WB5A 2ROQA 4PV7A 3F98A 4QE3A 5IKXA 4CG1A 5A71A 3H2KA 1ZI9A 4B0PA 3TEJA 2RIPA 3BIWA 1K6EA 4UBOA 4KE7A 3O0DA 4Y2PA 1VLQA 2GBFA 3G9XA 2WUGA 5A7GA 2H7YA 4TVKA 4FWBA 4GECA 4XX1A 4QEKA 5KBYA 3CN9A 5K3BA 3NOXA 2QOEA 3FAKA 1IZ7A 2PVSA 3I2HA 2WHQA 4BB0A 2XUQA 5ALNA 1H2WA 5ALLA 2DCMA 4G8CA 2HRQA 5AOBA 1WM1A 3WZLA 1W76A 5A7FA 3FYUA 3G8YA 4ZXFA 4K6GA 4EY6A 3FYTA 1BU8A 1LPPA 4Y9SA 4OB7A 5AKZA 2Z8ZA 1SCQA 3H18A 2XB6A 4OD0A 2Z8XA 3DKKA 4EY8A 4J3JA 5AK4A 2WJ4A 2ZVDA 1IUOA 1DWPA 1D07A 2AJ8A 4L3WA 1XZKA 2HA2A 3IURA 4FOLA 1DWOA 5ALQA 1T2NA 3KSRA 4EB0A 1BS9A 3W2TA 3FOBA 4XVCA 2VJBA 5AJHA 4N5IX 1ZD2P 4UBLA 3WYDA 3M81A 4X90A 2WSLA 1MX1A 4M0EA 4FMPA 1VJ5A 3BF8A 2QTBA 3V1NA 5HFNA 1TRHA 3G0DA 4U2BA 5CBKA 3DL4A 3BJMA 2WM2A 3STYA 2XUAA 5FPPA 2X8BA 5CXXA 4C88A 4BE9A 3H2HA 5BWBA 2V96A 1W75A 2O2IA 3V9AA 2B9VA 1QIFA 3ESBA 3O4JA 1O6FA 1AURA 1PFQA 3F9CA 3F8SA 4X93A 5BWCA 1YB7A 1QIDA 2WHPB 4LKOA 2OPHA 3SC2A 4A23A 5JARA 1UK9A 3IA2A 3GELA 3IB3A 1EXWA 5AKKA 1U65A 4HXFB 1IVYA 2IITA 4KR0A 1XZMA 1NU6A 3C87A 1E89A 2XMRA 1USWA 4C01A 2OAGA 4P92A 1XLVA 1GGVA 3LP5A 2AJCA 3OOSA 1XZFA 3EQ9A 4OB8A 2WIKA 4HTAA 5E4YA 1CUVA 4CIBA 1TK3A 1G42A 3E4DA 3AZQA 2VAVA 4PO3X 2VAXA 5ALKA 1XRLA 1BEZA 2AJBA 2I78A 2HU5A 3CCBA 3I6MA 1LPBB 4U2GA 2XUJA 5K3EA 1QIGA 3WK7A 3M83A 1EI9A 4ZWNA 1EDDA 1T4MA 2XE4A 4Q34A 3WL6A 2WHPA 3G7NA 4JYMA 3O95A 5HFAA 4KEAA 4WY8A 4B0OA 5CURA 4IQ4A 2WIJA 5LZ7A 2ZYIA 3H04A 1EDEA 1QFMA 4AXBA 3WWEA 4KAFA 1QIMA 2RHTA 4X6XA 1XZEA 4GW3A 3D2CA 4BP9A 4X94A 1LZKA 1G5FA 1ZGBA 2ZJFA 1UWCA 3F67A 1VA4A 5IVHA 1XLUA 5AKLA 1GKKA 3FWHA 3ZLTA 2QVBA 3AIMA 2CKMA 3HI4A 2CZQA 3KXPA 3DLTA 3SWWA 1ORWA 2D5LA 2LIPA 5FDFA 2XQFA 1CQWA 1XFDA 5HZGA 2BAGA 1FFBA 1FFDA 4AB1A 1CFJA 2VT7A 2HL6A 3PFCA 5I7UA 5JD6A 3WIOA 3JYHA 5DYWA 2RONA 1SOMA 5DWDA 3TJMA 3ED1A 3H1BA 3AILA 4W1QA 4JH0A 4JEIA 4BBZA 1LPSA 1XZGA 2CEKA 4BTLA 3G9ZA 1VOTA 4DNQA 1ZI8A 1SC9A 5AKJA 1AUOA 2H7CA 5AM2A 1VZ3A 4RPCA 5AP9A 4XJVA 2BUCA 1K8QA 1KU6A 4WFJA 2DQZA 3JW8A 5AI5A 5ALSA 5A2GA 3V1KA 5CRIA 1YA8A 4M0MA 1HKHA 2DHCA 1LZLA 4YPVA 2FJPA 4JUIA 4H7FA 2H7XA 1E3QA 3DYIA 4J0HA 1UK8A 2O7VA 3FCYA 1ODTC 5JATA 1L7QA 1FFCA 1W1IA 1P0QA 2VT6A 5EIHA 3ZV7A 3JWEA 5HF9A 2XDWA 4WDQA 4X6UA 2XUKA 4PW0A 4B9AA 1SCKA 4LXHA 5AOCA 3AZOA 5HKAA 2JGLA 4AMZA 5FP0A 3EQ7A 2Z5GA 4LXGA 3I28A 1EINA 4DSZA 3S8YA 2XUPA 4WCVA 3OM8A 4HAIA 2B4KA 2J4FA 3H0CA 4G5XA 5DNVA 3BDIA 3O4HA 1AMNA 2RHWA 5FKJA 2OCGA 1QTIA 4EY5A 5ALPA 4XIIA 1YASA 5IVDA 1XKTA 1Q0RA 4H7EA 5EI5A 3O9MA 4OYYA 4QLAA 4UUQA 4B7ZA 3C6ZA 4AO6A 3OPMA 1QTRA 3X3HA 4GHWA 2WUDA 3MUNA 3WWDA 4HXEB 1P0MA 3WKBA 4EZIA 2QJRA 2EDCA 2K2QB 4DMKA 4J7AA 3D5EA 4PQEA 1RP1A 5T4EA 1QIHA 4IH9A 1CPYA 2XQKA 3HXKA 3WLAA 4BCDA 2XQIA 3I6ZA 3VVLA 3WIBA 4H35A 3R3XA 4L72A 2DQYA 3R3YA 4INZA 3PDCA 4F60A 1QZ3A 3GUUA 3FYUC 1XZHA 2PSJA 3G0BA 1C4XA 2G63A 5SYMA 4C87A 4C6HA 4GEGA 1HBJA 4W9RA 4MEBA 2O2GA 5CT9A 2V97A 3IBTA 4IHAA 1Q0ZA 3WI7A 2WFLB 3HSSA 3MUOA 2QR5A 3WWOA 2VJDA 1DWQA 1QGED 3A2MA 4FTWA 3WKCA 4G8DA 1N8SA 3MGAA 3STUA 5ALWA 5KWIA 2XUOA 3FBWA 4LYEA 4MXDA 4G8BA 1XZIA 1U8EA 3UUEA 2CMFA 2QMQA 3HYSA 2G5PA 3AUKA 1R88A 1ODCA 2OLEA 2V9ZA 2VF2A 1ZD5A 2Q0XA 5AK3A 5AI9A 2DR0A 2ACKA 1RWQA 3AJAA 2YXPX 2YYSA 4BC1A 1CEXA 4U2EA 1AX9A 1VKHA 1JFRA 4BDSA 4HXGA 5JADA 4LHEA 2WTMA 2RGUA 2FX5A 1MX9A 4DTCA 3VJMA 5ALRA 3BE8A 4QNNA 5CW2A 5JAPA 5AH0A 1CUGA 4KE9A 4EY4A 1GXSA 4GLBA 2VA9A 1MX5A 1WB6A 2Y2VA 1QONA 2CUTA 4B80A 4QDZA 1L7RA 3VDXA 2JF0A 2ZSIA 2WFLA 1XRQA 3WQHA 1VA5A 4K5QA 3WKAA 1K4YA 2H1IA 5CT5A 4UBKA 5AICA 5BV7A 4BRSA 1BCSA 1Q83A 2ORYA 2WTNA 5K3AA 4D9JA 4C4YA 3T52A 5JASA 1GPKA 4UFOA 3WL5A 4H0CA 2V98A 4G4GA 4KAAA 1JJFA 1QIJA 1DX4A 5FUMA 5F4ZA 1I6WA 1LPMA 3STTA 3I2FA 1H2YA 2WIDA 1ACLA 4Y2TA 1J2EA 4KAJA 2HA0A 4OUKX 4J0JA 2BFNA 2GBIA 1H2XA 1W52X 3D2BA 3H17A 1AGYA 5LLSA 4L9AA 4I4CA 3ZWQA 4EY7A 1GQRA 4FFWA 2PSFA 3IULA 5ALHA 1BCRA 1XZAA 4BAZA 1YAJA 5J3JA 2XMQA 4QDXA 3FSGD 2WHRA 3WJ2A 2JEYA 5D3KA 3V1MA 4EA6A 4PSUA 2Y2UA 1HQDA 4P08A 1UK7A 2OGTA 3B12A 2WIFA 3EF3A 3R3WA 4B83A 2EDAA 1CLEA 1LPNA 1R9MA 5DTIA 2WU3A 1C7IA 3FVTA 3VKFA 2CB9A 1BN7A 4N8SA 2Z3WA 4DNOA 1EK2A 5EGNA 1OILA 3A2LA 4PNZA 2JGMA 3PICA 5LYYA 4X6YA 4ZGBA 1CUSA 2VSQA 3KOOA 1DQYA 5AM3A 3RARA 5AKGA 4E15A 5I8PA 4ROTA 3BJRA 1CUZA 3L1HA 4GWLA 1O6GA 2QS9A 4UFPA 4Y2UA 3V48A 3QM1A 2HA7A 3FLAA 2PUHA 3AINA 1MNAA 1R50A 2QJWA 3STVA 4WFIA 3QMWA 2WFMA 1JU4A 3FSGA 3A70A 1U2EA 2GYWA 2J4CA 2PBLA 4CIAA 4EUSA 3ESAA 4AN0A 2AJLI 4BVLA 3D3NA 2VTVA 1ZOIA 3D59A 1QOZA 1FFEA 5FLKA 5IVIA 3U0VA 2WLSA 1IUNA 5ESRA 4B82A 5HF8A 4H18A 3K6KA 3PI6A 1CUAA 3CN7A 1UKCA 4PSCA 4U2FA 1Q84A 1G66A 5ALIA 1UOPA 4BCCA 2ZSHA 4Q82A 1B41A 5T4HA 2HFJA 4OSEA 2JGIA 3AFIA 3Q8WA 1R4ZA 3C8DA 2XQJA 5AM5A 4X95A 4LIPD 3FLEA 5ALYA 5C8XA 1YB6A 4IH4A 4IO0A 4U2DA 2WG1A 1ETHA 2VQ6A 2P8SA 2PPLA 4OU4A 3ANTA 2C0QA 4CCYB 4AZ3A 4DMCA 3G0IA 1JI3A 1JJIA 3FCXA 4FNGA 3ESCA 3NWOA 2C7BA 4Y2RA 1CUBA 2PM8A 4CG3A 4B85A 2QUBA 3D0KA 4X3CA 3DD5A 4H7DA 4W63A 2UZ0A 5DYYA 3M3DA 4X71A 2ACEA 1N5RA 1YS2X 4P93A 3C5WP 1QLWA 4Q3KA 1SFRA 3GZJA 1ZD3A 5JD5A 1PV1A 2YASA 5AI8A 1MT3A 3KD2A 1HDEA 5AK5A 1CQZA 5HK8A 4YX9A 4WY5A 1XZJA 2C5GA 4DSAA 3I1IA 2J3DA 1AC5A 2PUJA 5JZSA 5LZ8A 1R1DA 1XQWA 3WZMA 1IUPA 3W05A 3DJYA 2XUDA 4PSDA 1BE0A 4CCYA 1VZ2A 1UK6A 5C81A 1N1MA 1CUHA 2XLCA 3V1LA 2GBCA 2O7RA 4ITVA 2HU7A 4G9GA 5A7HA 1XLWA 4HVTA 5ISMA 2I03A 2OQIA 4X00A 3W04A 1MPXA 3BXPA 1MN6A 3WJ1A 1GKLA 2EEPA 4G4JA 3VISA 3C6YA 4TGLA 4FFVA 3KWJA 2OXEA 3OTQA 5AI6A 3DEAA 1KEZA 4AO7A 1GQSA 4UBMA 1JJBA 1UOQA 3WL8A 4BC0A 1ZGCA 5C8VA 2ECFA 5FRDA 5HF6A 2HU8A 2XT0A 3LIIA 2CBGA 5SYNA 2FUKA 1H2ZA 1ZIXA 4QLOA 5JYCA 1U4NA 4DNPA 4KACA 2AJDA 4ZRDA 2HDWA 1EX9A 2HM7A 2R11A 3VJLA 1CUIA 4Y2VA 2XMGA 4WDRA 5ALFA 3VJKA 1LLFA 5JAUA 2XMDA 4NMWA 1CUWA 3W06A 4KRXA 1XZBA 5JANA 2PU5A 1BN6A 3ZI7A 3F96A 3DDUA 1UT6A 1GPNA 4YASA 3RLIA 5JAOA 2C0PA 4BYMA 2HHAA 2HADA 5ALMA 3AIKA 5AM1A 1HLGA 5DYTA 3C70A 4DGQA 4YK7A 1QFSA 1LBTA 4KE8A 4UHCA 2XMBA 3G0CA 3CCCA 1H22A 2H9YA 1FSSA 1DTEA 1N5MA 3IDAA 3QMMA 2BUBA 3E3AA 1R9NA 4MEAA 1CR6A 5AKXA 2BGRA 2WFZA 2XQGA 2Z3ZA 1EA5A 4O08A 4MYDA 3WA6A 5HQ3B 1HPLA 4F5ZA 4BCBA 4MJ3A 4BAGA 3BL8A 4AN1A 2I3DA 1THGA 1JU3A 5A6VA 5CH3A 4QWMA 2RAUA 5JZ9A 1ORVA 3UMJA 2XMZA 3TGLA 4W1PA 2XUHA 1SCIA 5ALOA 1E66A 4GBGA 1ZJ4A 1EB8A 3QH4A 3WKEA 1BRTA 4KE6A 3WYNA 4Y2SA 5FV4A 2QM0A 5LZ5A 2JBWA 5JD4A 5ALUA 1J06A 5AK6A 1Y7HA 4J0IA 2BJHA 3NUZA 1KU0A 3QITA 3HRHA 4JYPA 3C8HA 1IZ8A 3EBLA 2WG0A 3BF7A 2OAEA 4GDMA 4H7IA 1AKNA 1A8QA 3OC0A 1Y37A 2I3ZA 3OG9A 3PFBA 5JALA 1K5PA 5ALEA 1CUFA 5JIBA 1WB4A 4UHFA 3GFFA 3W9UA 5HQ3A 5ALTA 1MNQA 4X85A 5BOVA 2VATA 1WHTA 3I2GA 2DSNA 4K6KA 3G0GA 2WKWA 1B6GA 4AQDA 3D4LA 3ESDA 2QXUA 4I3FA 5IVKA 5LZ2A 3QZUA 1YR2A 3B3QA 5HK9A 4HRXA 1UOOA 4X97A 4LXIA 3ICWA 1MO2A 3N2ZB 2Y6VA 4G9EA 4Y2XA 1MJ5A 1C7JA 1QJ4A 3SK0A 4U2CA 1XKLA 2G4LA 2IX9A 4X7BA 4K6HA 1PJAA 4H7JA 1WPRA 1TCBA 5EHNA 1YS1X 4KRYA 2RI6A 3DKRA 1CIJA 3L1IA 4BVKA 4W1RA 3A6ZA 1IMJA 2XI4A 2O2HA 1X2BA 4RNCA 2WUFA 4F21A 1OCEA 5IH7A 4UHDA 4JNCA 1J1IA 3PF9A 2XUGA 4Q05A 5D6OA 4XWGA 5EFZA 2QT9A 2OCLA 3N0TA 4MYSA 1F6WA 3OURA 3WMRA 3S2ZA 4FBMA 3DOHA 1MAHA 1JMKC 2R8BA 2GYVA 1VE7A 4DMFA 1THTA 3STWA 4A5SA 5KWJA 3EIOA 5E2IA 2WQZA 3H19A 1QIKA 2ONCA 1TQHA 4V2IA 2W6CX 4HRYA 4NS4A 1CUUA 2X5XA 4B9EA 1W4LA 4WJLA 3HC7A 5CH5A 4UPDA 3IIIA 1HL7A 4RE5A 1FFAA 3UUFA 6YASA 4OB6A 2WG2A 2AXEA 2QRUA 2W22A 5EIAA 2OQVA 1E8MA 5AO9A 4IH1A 3O9VA 1LBSA 2ES4A 3VVMA 3HABA 5EHXA 3B5EA 2HA4A 3CXUA 5HCUA 4OPMA 3PE6A 4QA9A 1BEEA 2FJ0A 5K3FB 4FLEA 5ALJA 2YH2A 1ZJ5A 4Y2QA 1P0IA 2OCIA 3RKSA 5JZBA 3QPAA 2GBGA 3I6YA 5LP1A 4S0XA 5K3CA 2WU4A 3AZPA 2QZPA 1UKBA 2JGKA 4QWWA 4UBJA 4EHBA 1EHYA 3FLBA 4X91A 3K9BA 4KYVA 2IIVA 3QMVA 2XMSA 3I2IA 5AOAA 3GA7A 5LKRA 3L1JA 5T4BA 4BRZA 4CG2A 1Z68A 1DT5A 2PU7A 2Y6UA 1S8OA 1XRRA 4HS9A 1LPOA 2B20A 1L7AA 3QPCA 2XUFA 3LIPA 5AHXA 2OGZA 1DT3A 5K3FA 1X70A 2GYUA 5ALXA 4ARBA 3IUQA 3ZPXA 2JGFA 5DNUA 1XRMA 1EH5A 1ZIYA 2C4HA 1GZ7A 4UBIA 1CUDA 3WWPA 2GZSA 4Q3OA 1CRLA 5E4TA 1MU0A 3H1AA 2C5FA 2JEZA 1XQYA 1TAHA 1A7UA 4N8DA 5AIBA 5T4FA 4CFSA 3AIOA 5AKYA 1TCCA 1QIIA
chains in the Genus database with same CATH superfamily
3IP8A 3CUSA 5I7FA 4OP3A 2IYLD 3V2IA 2YXEA 2EHJA 4G0PA 5BURA 1HI9A 2EHDA 1M2EA 4GT1A 2WWTA 1ZMTA 1Q50A 3RRJA 1K06A 4DMHA 2BHNA 2C04A 1VXRA 4HEHA 3W9BA 1SEPA 2E4VA 4BPRA 4W7HA 2YHIA 4CM4A 5C8ZA 4JLSA 2X3YA 3B20A 2WJVA 3GEDA 5HQTA 1HSOA 2VNSA 4B6JA 2H9IA 1CHDA 3G1WA 2X9QA 2I33A 3GCGA 3HBNA 4Q3BA 1OBHA 4JI5B 4AJPA 3KTDA 1UXJA 4CN8A 2BLLA 1P17A 2FRVA 4JC0A 3URKA 3NYIA 4BFZA 3ZTWA 5CFMA 4J0KA 5JCJD 2WNHA 3BZUA 3CBGA 3NGMA 2C4WA 4QFMA 4ZVLA 1P1CA 1BDBA 1FYWA 2GZ1A 4I8DA 4PWYA 1AY0A 4X54A 4D9EA 4JQOA 5K4HA 3IMFA 2BFAA 2F3TA 3K2EA 4E12A 5KDDA 1QRUA 3HJUA 4OQDA 3RTDA 4AO8A 4C6TB 7YASA 2H07A 3P4XA 4I99A 4YCBA 2R25B 4M9CA 3SHFA 1NW5A 3ILHA 4BJ3A 2I71A 1E5QA 2YC2C 3S29A 3FNRA 1IBCA 5AMXA 2VHQA 4NV1A 3I30X 2J0SA 5TMDA 3RVPA 1KVSA 5EKTA 2AF3C 5DHQA 3TLJA 1G8FA 3IKTA 4F1WA 4OKIA 4S12A 4XGNA 4BB5A 4X5OA 1EUCA 6CHYA 2C9OA 4E1BA 1GCGA 3QLUC 1J24A 4RLFA 1MMFB 1WUYA 3K1JA 1HDXA 1G8YA 4HFRA 4ZV9A 3NV9A 1N3BA 2HBZA 5B1EA 3B6EA 1QF7A 4DJJA 1C9KA 3D2AA 3KOZA 4FCWA 7ADHA 2A5LA 3TI7A 5FFFA 4YP6A 1HLPA 3D3QA 1GKIA 4WLOA 5JXWA 3NHBA 1LBQA 3GRRA 4II3A 4O8CA 4WBNB 3LYHA 1F51E 4YH1A 1Y4AE 1TO1E 2P8JA 3CNBA 4B44A 1HWYA 3EYAA 4IGAA 2C82A 4RHEA 1O7JA 4A8JB 4KJZA 3KV1A 1ISSA 3K9GA 1L4MA 4JI8B 2H52A 3U13A 2DLNA 3AKEA 2GPAA 3UCXA 3V1YA 4EJFA 2AVDA 4EJ2A 1EGVB 3H9JA 4CLRB 3AI1A 2INGX 1IB6A 1ESEA 3DSRA 2PZAA 1KYXA 1M1ZA 3AJDA 2QQ5A 2YN0A 4KQEA 1DEHA 3C39A 1ZK1A 1BKYA 2IYSA 1V96A 2R6JA 4NCKA 3QVMA 3KRTA 3QLJA 1ENYA 3UJ7A 2JFNA 4Q1DA 3N8IA 2J3IA 2P2SA 3L3BA 2H3HA 4KYUA 1F20A 4TOIA 4Z86A 3A32A 2PQ2A 1W94A 1E2QA 3RVNA 3QKSA 4Q37A 1BXRB 3BWBA 3BH6A 5BN4A 2EFYA 2JH9A 2DJ5A 4V0KA 4FEEA 4AICA 3F73A 5H3LA 3MJFA 1JA1A 1KI3A 1PVDA 1NQ5A 2FZKA 2OBNA 3VXKA 1W581 1D2EA 2OCYC 1G38A 1NW3A 2EGGA 1NLUA 1P9LA 1O97C 3C4QA 3WK5A 2A9RA 2OCKA 1H1LB 1T1GA 1TM1E 2WSBA 4KU4A 4YACA 2PBRA 1CQIB 1B6RA 1P45A 1WEHA 2HWYA 2JHAA 1JT9A 2NTYC 2PKEA 2Q8PA 4LYDA 4ZZ3A 1XL1A 4J0EA 3WLNA 2PMCA 3AJ9A 3P8ZA 2C2BA 1NQXA 2ZSUA 5KCMA 5IUJC 1MA3A 4FJ1A 3S40A 2XMCA 4S1WA 3HWRA 4ER3A 3DE2X 5DX1A 2SKDA 1KSJA 1I2DA 1KFBB 1IZ9A 1GM5A 3WY9A 5C51B 2F1RA 2V0CA 4CDMA 3CUYA 2ZRMA 2BWJA 4D79A 3CTMA 1FBTA 3EVNA 4RPGA 1GQFA 3QU5A 4O4IF 4B3TB 2ID4A 1DJLA 3WYFA 3SGLA 2P6OA 4HXYA 1BFUA 4AG6A 2VT2A 2HMWA 3HXTA 4JBYA 1KP9A 4B76A 2M6RA 2X6RA 4LI0A 1Z8DA 1YAHA 3I9NA 3H13A 4PSVA 3VTKA 5AKEA 5FAKA 1GDTA 2ZZNA 5IJAA 4YRPA 3K96A 4GI5A 2BUAA 2OKGA 3S5UA 1CRWG 4WXYB 4YJHB 1FDVA 3EY9A 2X76A 2BGKA 2BEUB 3CO0S 1QKKA 1HMYA 2ACWA 4UBNA 3ZDRA 5JBQA 1L5ZA 2AXQA 3A3OA 3IQEA 2EARA 1NXTA 3NONA 4B6GA 4AY5A 4RFVA 1V25A 2A1IA 2QTCA 1ENZA 1Q5PA 5FOSA 4EGFA 1RRCA 1QWSA 2VDJA 3AGPA 1PGJA 1I7LA 4QO7A 2EX1A 2CNNA 4IQ0A 1MTZA 1HT3A 3OT1B 1Q1ZA 3C7CB 3PWTA 5K9ZA 4FN5A 1TJ3A 3W5IA 3PA6A 2VTBA 4RF5A 2RHJA 2WK1A 2J5XA 4X7RA 1J8VA 2BHRA 1C1DA 3AKCA 3HCWA 1ZLYA 3ZI0A 3ZWVA 5E95A 2Y99A 3R0VA 4ZV7A 5KAPA 1RMTA 2V8BA 3W7BA 4H4DA 4Q4HB 3TQRA 3PI7A 3R7BA 1GL7A 5LMNB 2PRZA 2WJ6A 4F4DA 3H2IA 1J21A 1JAZA 5HM6A 3WFIA 3ESYA 3OPYI 2ZRPA 3LK6A 3F4BA 1H23A 1E7YA 4MS3B 3C6XA 1FTQA 3RU3A 1PI3A 3PXCX 4I5GA 3WGYA 4KO2S 2BZ1A 1HNWB 2XUZA 1TCAA 1QO0A 3N8DA 3FCAA 5KREA 5E7JA 1AB6A 1H0KA 2J5BA 2JGDB 2A9VA 3LQ2A 3PGMA 3RU9A 4UMFA 2G80A 3JQRA 5HKOA 4M7WA 4LFBB 1OAOC 3MOGA 4ARAA 1NQUA 2QE6A 3M8KA 2YV5A 3LLUA 3MPUA 2NMVA 1PL7A 4M1ZA 3IAAA 2VHZA 5CYOA 2JZOA 5J59A 2ZSJA 1WCWA 4C1NA 3B1WA 3O4GA 3WB0A 5EIEA 1F8GA 1OVGA 1UWVA 3PFGA 4E5PA 5I8WA 5LZ4A 4AKIA 1O58A 3CNHA 1ZFNA 4K46A 1K4KA 1HOTA 1WR8A 1T6YA 1V1RA 3AT1A 4QDTA 4GX1A 4BVJA 1FNBA 2NUPA 4YRZA 5FPHA 3U4HA 1PNTA 5A1TA 6LDHA 1XDUA 4I9UA 5LM3A 2IQIA 1TL7C 4LOHA 4DQXA 2IDMA 1RJFA 1M8PA 1KDTA 1NXOA 1KH3A 4K86A 4H59A 4IIEA 1E1RA 1F8YA 1K8YB 2HBYA 3QPDA 4N6NA 1K86A 3SEFA 4KXUA 5L4NA 3H5NA 2VDLB 5AVVA 3RYHB 3GT0A 1Z5UA 4H6WA 2JAUA 1JECA 4DQ0A 3O2SB 2C57A 3RK4A 4U8HA 3OIWA 2GKOA 4UFNA 5G3YA 3CW8X 4N82A 3WGVA 2DFDA 3E8MA 1II0A 1Z5NA 2LP4Y 1DIGA 2CDRA 3W6ZA 2LKCA 3LUGA 1P9OA 5A6SB 3AJEA 1V2GA 4N8EA 4JX8A 3A2NA 4C0AC 3OQNA 2WF5A 3H9UA 1ISPA 3ORHA 5CX1B 3ID6C 3FUXA 3T3IA 4O2RA 4WKPA 2FW8A 4X1YA 3KT6A 1JH8A 1XRNA 1MEJA 3OFKA 1P1BA 3IL2A 2CT8A 1WZIA 3HWX1 4X20B 5DGIA 5FXMA 4KVFA 1A4XA 2NSYA 3L8ZA 1JEAA 2BZ0A 1PGPA 3MMXA 2ZTSA 4FFPA 4TMVA 1WXFA 3I92A 3CTPA 4C76A 4QDOA 2XCQA 3U7EB 1Y4ZA 1WMAA 5IF9A 2YVUA 4BB9A 5EKDA 1P5ZB 4CT5A 2ODWA 2P3OA 3Q0TA 4Q00A 2BZSA 1ENPA 4TMYA 3TN7A 2PZJA 2BCEA 3PUHA 1Y6QA 3SOZA 4EBBA 4F0JA 1ZU5A 4UCQA 3R3ZA 1CDOA 5DW0A 2JCXA 1L7NA 5JEDA 2JFUA 2H59A 4XX0A 4GZ3A 2G0AA 3AWIA 1ZGHA 3PP8A 4ZI2A 4O0MA 3DS8A 4CDRA 4H77A 3I9LA 3N1UA 4JOBA 1GTZA 2RK6A 2QEQA 2ZSKA 3O94A 3AC0A 4JLKA 3FZEA 3K3PA 4AECA 2ZU0C 1KRHA 1EWYA 2YINC 3E5RA 3I23A 2RGRA 3CEMA 1J8MF 3R0IA 3ND8A 3GROA 3KE8A 1J99A 2QSYA 3EDYA 3PD1A 3RFFA 3B9PA 4BZWA 2C4MA 1Z33A 2ODQA 2C7VA 3G85A 3EYWA 3KOMA 4OJMX 4REMA 3IS3A 2JGEA 4EJSC 1M1YA 3SJUA 3SSAA 3TLGA 1LU9A 1NYQA 2IOYA 2Q9CA 4MO9A 5H4HA 4DYHA 5LYJB 5KKAA 3RF6A 2ADMA 4ZO9A 4QQKA 4FFLA 1WMEA 3IRUA 3UHPA 4AFNA 4PNPA 3A6HA 3R41A 3GCZA 3AB8A 4FDMA 4ON9A 4J0GA 5AKIA 4D9KA 5KJ1A 5A3RA 3PCXA 1KZ6A 2WU0A 1Y3DE 4BJ1A 1ZMBA 3UNXA 2Z3VA 3SM9A 5BV2P 3ST7A 3CLSC 4XRGA 1IJKA 3EFEA 2HHLA 2C4TA 1Z4OA 3G02A 5EFOA 5KTTA 4HD8A 3SF0A 4JGBA 4HWOA 4TLLB 5K5EA 5CAEB 2W83A 2QD3A 4NAHA 3COJA 1UH5A 3BB4A 2PWBA 1WOMA 1W73A 1GTVA 3BJEA 1SBQA 4L8FA 4LC9A 4LISA 5KYVA 1E1NA 2DQKA 3IGFA 4RTQA 3H2JA 1EK1A 3LCRA 1QP4A 3HB1A 5JSYA 1A4UA 3FA2A 3RWMB 4EL5A 1HOXA 4BTVA 3N0RA 4DWVA 2PHZA 4Y0NA 3F4LA 1MO3A 4H6XA 1QANA 4Q7JB 5B3AA 4BLQA 2VJAA 3M1AA 4X1KB 3USES 1DDIA 1QYCA 3E9EA 2J3EA 4H1HA 4WK6A 3V46A 5BVGA 1Y8ZA 5I48A 4WX2B 1JXQA 2PXXA 3BMXA 1E5TA 1MAVA 3VYSB 1XU9A 3TTXA 2C9DA 5TEVA 2DPMA 1FMJA 1AZWA 3Q3IA 1T25A 4TQUS 3C97A 4CKCA 3D6VA 4COOA 1DKNA 4UTRA 1JTEA 5C8DA 2WFAA 3D8BA 3I2JA 4L0CA 5AVYA 2H4YA 4B84A 5C5EA 4NATA 5GWXA 2D00A 4ZI5A 4ISBA 2O6LA 1Y9AA 2A5FA 4BY9E 1JT2A 2G0NA 3N2EA 1CQJA 3JYPA 1UM9A 4MW4A 3RYIA 1HGXA 1R0ZA 2JBAA 3QGMA 4AXXA 2HMAA 2AF4C 1NYTA 5H1YA 5JEEA 1NQOA 3I1YA 4TYPA 2VDWA 3IAS6 4HZUB 1Z0IA 4PONA 1R4NA 1SXJA 5DCYA 2FMFA 1ODKA 4LTNA 3D1VA 3CZMA 1C9DB 3EULA 4FS3A 3UW3A 5EJFA 3ENQA 1JDSA 2Q7DA 3WGQA 3E22B 4CMGA 4PGMA 5IMSA 1P5HA 1UZMA 3AG5A 1G9XA 1WDLA 2Q1TA 2YMMA 4NTZA 4XSHA 5H3HA 3OZVA 3UB2A 5K3DA 4E13A 4EZBA 5LQDA 4EYGA 3FYUB 2PWPA 1GNVA 3PIIA 3QBJA 4OJNA 1GPLA 4TSKA 1Y8CA 4XUDA 3K4PA 2ZWAA 2P5UA 5ECYA 5C4MA 2WD9A 4ERNA 1FP1D 2FSIA 5E6RA 5J5AA 1YCDA 5JE8A 1AE1A 2PGIA 1EDBA 1G7CA 3EPJA 1LRLA 2O1SA 1C5KA 4MVJD 5F3RA 3RS5A 1XQVA 1NJ1A 1CRPA 2EJTA 3EH2A 5F21A 4B4OA 3NC0C 4RCZA 3T38A 5F73A 5GQSA 4RGYA 3BB3A 4E5NA 1A4IA 2QKYA 4EF5A 4F6RB 1W30A 1K7CA 4E5DA 3HVHA 3FTEA 3FHOA 2FXVA 1N2ZA 4D82A 5IKXA 2AEJA 3CRZA 1N2CB 4MH0R 4PQYA 2XTJA 3COYA 3N74A 1ZCJA 4HP8A 3H4IA 1P4RA 3EVFA 4EHAA 1ZJJA 5FNVB 1NFRA 4U5QA 3GFPA 2NPIA 2Z43A 5FF9A 4EPWA 4QYTA 1PTJA 3BIWA 3TEJA 5DNYB 4FHFA 4UBOA 1DTWB 4Q3AA 4RHXA 3WGUA 1JVNA 5KYGA 2GBFA 4NARA 3U6KA 3MIIA 4G6ZA 2WIAA 2H7YA 4FWBA 3T7EA 1X6VA 2AWOA 4ACAA 4EVQA 3QELA 4L0QA 3ICOA 5FEUA 3O8NA 3SBDA 5FUYA 3UJHA 4EHDA 3OEHA 1SCUA 2YN2A 2WAXA 3RIGA 1IJFA 4KBGA 4YMIA 3KSAC 4BB0A 3VU1A 4QL3A 4AIIA 5K0GA 1GN8A 1H2WA 3PFIA 4GWKA 4MV6A 4JD5A 4JUCA 5HPYB 2VA8A 3KFXA 4YO8A 4EUNA 4NOMA 4P5PA 1U1CA 4I5FA 1RWVA 5AJYA 2UXCB 4MRMB 1P6XA 1VIMA 1W76A 4DJDC 3JQ6A 5A9SB 1R16A 1UBLS 2FVYA 3QXXA 5HZMA 5EE5B 1IHDA 4RY2A 1JBEA 1O94C 2ZRGA 1QHSA 4D25A 3A1NA 1L1QA 1QGYA 4BNNA 2CNDA 4P6VF 1BU8A 1JSZA 1TTQB 2KMLA 4C5BA 5IBCA 4LHZA 2JCBA 3LC0A 4B8YA 5AKZA 4TSRA 1CY1A 2VPTA 4EG7A 5F2NA 2ZEJA 5GY7A 1XDDA 3HB5X 3DFUA 4OHVA 4KFUA 4RABA 3EEBA 2XB6A 4AZSA 3CPSA 4FPXA 5K4GA 4NESA 2Z8XA 2O5VA 4EY8A 4J3JA 5CFQA 2QSUA 5CGZA 3AFHA 2RK4A 3P0FA 2K6GA 2WJ4A 4MTCA 4A8PA 2OHIA 4I9HA 1DWPA 3TMKA 1PJ8A 3WB2A 3AXTA 1G3MA 5AW6A 2I6SA 1N2BA 4MHOA 1MB0A 5KTPA 3DLHA 5EJGA 2UYHA 4QGGA 4RDHA 4BU0A 3B3GA 4R5HA 2WF7A 4X44A 2GXUA 3HKEA 5BQXA 4Z8YA 3NC4A 4IMRA 3AWDA 3G2JA 1JFSA 4NZOA 3R5JA 1YNOA 2DUMA 2JI8A 4Z5XA 1JL3A 1FS4A 3C1UA 1C0EA 4HWKA 3TDMA 4QT0A 5ALQA 4ND2A 2BFDB 2P11A 1BS9A 3CX7A 1U5AA 4V0LA 2EZUA 3N86A 4MARA 4C30A 5GINE 1EFAA 4TYQA 2A0WA 3DDZX 1M2FA 3RSLA 1RHJA 3O8LA 1NJ2A 1VKJA 3GH1A 1P2UA 2CXPA 1U80A 2XGOA 4TYMA 3OLVA 1GITA 3SP1A 3T3HA 3P71T 4D81A 3L4KA 2CSXA 1QHHA 3EZYA 4K0KB 1LBEA 1ZD2P 3L1VA 4UBLA 4E7PA 1FS5A 4CL3A 1DCMA 4X90A 4XOIA 4Q12A 1TGYA 3MRSA 3LDHA 2GEDA 1OLSB 1CHNA 2ISQA 1WJGA 1HYBA 4JGGA 4D9MA 1ZH0A 2Q2QA 2QTBA 4HDAA 1H5QA 2XBMA 3BREA 2V3CC 1XXHB 1FIUA 4GWGA 2ZPUA 4DC9A 4Q4AA 4QBFA 1CJBA 2OP1A 2WJHA 1DDOA 3CPJB 1HKUA 2WM2A 4G0XA 4LF7B 2QPTA 2EBFX 5SY4A 2EC5A 2YZ2A 4WXRA 5FPPA 3G2LA 1GZUA 1MJHA 3WRXA 1EK5A 1CY6A 1H85A 3CRMA 4IINA 1ZC3A 2IHTA 1V11A 1W5SA 2O2DA 1WO8A 3UAYA 3I1JA 3V9AA 1RRKA 2B9VA 4OKSA 1QIFA 3ESBA 2DGDA 1PWEA 2NYVA 3B1KA 4C9BA 3F9CA 4MS4A 4ZICA 1RWMA 3OAAD 5BWCA 5BYJA 3RUIA 5TGZA 2WHPB 2ZDQA 3DVAB 4JJFA 4URXR 2Z56A 2ZI5A 3SC2A 2PT5A 1L7BA 2H2FA 3B13B 4LZOA 3GELA 3IB3A 4HWGA 3SICE 3ZNQA 4EG8A 4NECA 3MF4A 1ZH6A 2VQFB 4JMLA 4EHLA 4ZARA 1UL1X 3HKDA 3KYCB 3WBBA 2JHFA 2GSWA 5D85A 5NLLA 1US8B 1NXSA 3GD7A 4FU0A 4ME6A 4NNJA 1ADBA 1G8SA 2D4HA 1KOJA 2JHPA 2P35A 2Y0PA 1QH1B 1XRJA 3MTAA 3QKRA 2QAIA 1UANA 1XMQB 4IIDA 4LYYA 1PZEA 1QDEA 5IT9A 2BMEA 5AXDA 1H6DA 1GOTA 1O54A 2QPLA 2Y1DA 4MUIA 1SUBA 1B23P 2IYEA 2GJSA 2KLHA 1ID8A 3H42B 2ODNA 2Q5FA 2OAGA 3P0RA 4P92A 5EXEA 4UNRA 5HM8A 1E61A 3PA8A 3RWOA 3W1EA 3LP5A 9GPBA 4OM8A 5K09A 4FEYA 3EQ9A 2J9GA 5HBGA 4BNMA 1N0WA 2LW7A 1K1EA 1SEVA 1YJXA 3L7IA 3MPOA 1FVFA 3WJ7A 1FLNA 4GGPA 3SQLA 1RXYA 1TK3A 1UDCA 2GNPA 3I2YX 1HFEL 3LHIA 3P0EA 4G5SA 3TTSA 2R79A 4FHCA 3DDSA 4IHKA 3ZX4A 5J43A 2YJ4A 3BFVA 2WR8A 3UW1A 5KQGA 1RU3A 3GFSA 1Q3TA 2ZANA 3JYLA 2L69A 3Q7SA 1W5EA 1Z82A 4GOND 4QAQA 5G4KB 5J5CA 2O0MA 3A1TA 3WX0A 1O0BA 3CCBA 2AG1A 2CF6A 2A59A 2GEJA 3GRVA 4YRTA 3I6MA 4IIJB 3PYMA 1ZESA 3QX3A 1BYUA 3TKAA 1JR3E 2ODEA 1J4AA 3M83A 2BGIA 1JA0A 5GP1A 3VDMA 3UG7A 3DMGA 2I2DA 3K1AB 4ZWNA 1EFKA 3OOEA 5D86A 1HSZA 2JA1A 2YWJA 2HJ9A 3ISVA 1KEEA 4OX9B 5BNZA 1ZSNA 3P96A 4L4UA 2Y1XA 4DMGA 4LJLA 2BFPA 1IY8A 1RC0A 1B4DA 2OV3A 4QM6A 4Z6KA 1VDZA 2ZBUA 4YRJA 1FYXA 3G7NA 3WL6A 2C8LA 4UTVA 1XVLA 1IZYA 1W4BA 2M6SA 3PC6A 3E8XA 4I9NA 4JP3A 1E3MA 1JNXX 1WSWA 2GUWA 2AUNA 2AOUB 5LLDA 5AW9A 4DIOA 4J90A 1JALA 3A6KA 5JU6A 3G6WA 2RB5A 3R6GA 4HGZA 3CVWA 3LUFA 2AYXA 4P4NA 5KMGB 5C5DA 2B82A 4I50B 4CU2A 4ZEVA 3V8MA 4Q9NA 2XJ9A 1W5BA 3S2GA 2YBDA 3ETGA 1WZ2A 3WDLA 1PR4A 1FQOA 5LZ7A 2V5UA 4P86A 1M72A 1OBFO 2MMCA 4F9TA 1I7SB 1TVCA 4GPEA 4B8WA 5JY1A 5CLLA 3LX5A 4BZXA 4QTYA 1K7SN 1RHUA 4UE6A 3LQYA 2DH6A 4KAFA 5FBHA 5FPSA 3KQTA 2PN1A 3LUBA 4P7FA 3WYBA 4GZ5A 2QU8A 3TFQA 2WD7B 4BMZA 1N1DA 4GW3A 2YYZA 1NQWA 3CISA 5K2OA 3D2CA 2DY1A 3GA5A 3Q8LA 1I4WA 2LIVA 4PEVA 1G20A 3IESA 3SZUA 1H8EA 1KJWA 2Q3MA 3HJRA 4XOUA 5D6NA 5IZ4A 4FONA 2V74B 3WE7A 1W5FA 2OOKA 4BN4A 1P7WA 2X40A 3ZW8A 1XLUA 3F4KA 5AKLA 1TKCA 3JD3A 5J1TB 4Q7KA 3FWHA 4ZEMA 4ARUA 1EHIA 1A5ZA 1SRQA 3K20A 3K5WA 4A2QA 2PV7A 3R9KA 1S7GA 3BXFA 3VSAA 5KNLA 2D62A 3V55A 1FDTA 1LW6E 3KXPA 5HILA 3JQPA 3MLBA 2R1UA 4YMLA 1KJNA 2J45A 5TQ2B 4DV7B 3SWWA 5HIKA 1N57A 3KKOA 4KR9A 4F3YA 2LIPA 1YZGA 1T8WA 2EKBA 3K0HA 4JT9A 4LI3X 3JQGB 3ILVA 2IYYA 1RDFA 3GVCA 1CR2A 1PR6A 1D6SA 1CQWA 1SBCA 4HN4B 4J75A 4LJ7A 3PGA1 2HUPA 5L3RA 1DRWA 1LF5A 3ORYA 4JEUA 1SIOA 2YVLA 5DHPA 3D9QX 4U7DA 4G1EB 2Z04A 5F52A 1UKVY 3PPIA 3PQEA 4RVFA 1WIWA 2XNKA 3L6OO 1SUSA 2ZRBA 4Q93A 4AB1A 3ZCSA 1SUIA 1CFJA 1WVGA 2AC4A 4G1BA 4QARA 3EW9A 1O87A 4G26A 3W2HA 4AX8A 5JS1A 2J3LA 1N2OA 2PQ6A 4BNYA 3DT8A 1OV6A 3PE3A 1BDJA 4XWTA 4D8XA 1N4AA 3CLTC 3ANMA 1CP3A 1NVVR 2HCTA 3H6KA 3QTBA 3ZDZB 4KR2A 1NVKA 1JLLB 4OMDA 3D7NA 4B1FA 1FFYA 5AUPB 3LPLA 5JNSA 4HNAB 4J7CA 2NP6A 3JYHA 1U6IA 4B31A 2HJGA 3QKWA 3DHWC 3GNTA 3OTIA 2BBTA 1K9VF 2BGLA 3CBQA 1SXGA 3EGXB 2J9FB 1N6NA 3FMOB 4OHRA 4OYHA 3TJMA 2ZSEA 5I3ZA 1WAMA 4GGMX 4JX9A 4RA9A 4EH1A 4AKEA 1RMYA 2XVMA 2ZE6A 1XELA 3O1HB 4JEIA 1E9SA 2VBGA 1FP4B 4M0PA 3VSEA 4BBZA 1LPSA 2B4TO 4ZALA 1ND5A 3FROA 5CA0F 2JAOA 4L1KA 4BTLA 4ZZ0A 5KOYA 3H3JA 2JLQA 1J2UA 3EGIA 4YJFB 2ZUVA 4OGKA 4WJZA 2EP7A 1SC9A 4US1R 4DDKA 2VUTA 4MQFA 4TKMA 4BGIA 5LL6P 1NUQA 2ZIWB 2D2XA 2J33A 2Z2IA 5A0VA 2BKVA 1SHJA 3A9VA 5KKNB 1J33A 2Q2OA 3RS4A 4YLGA 1GA4A 3SJAA 3D8SA 3ZVKA 4XJVA 2P3LA 4EPXA 4X8MA 3C15C 3ONDA 4E6EA 4Q7MB 4WW0A 1S3IA 1WTCA 1YZLA 1KU6A 2IDJA 2QN7A 2X9LA 4WFJA 1HT0A 3LWBA 3CKLA 1E0DA 4CM8B 3S7TA 2QN6A 4HO1X 5J5VA 2NT3A 3EODA 1ZY2A 1CJMA 4C7KA 3WAGA 1MEOA 3H5WA 3TJZA 1P4SA 1UT5A 1VLHA 2IHYA 5D3MA 4D0GA 1ZUIA 3WSTA 3BFXA 2YWRA 3RVRA 4XVUA 3V1KA 1PR5A 3MMZA 1YA8A 3IQXA 3SVTA 2B83A 2DHCA 4XTCS 4XA8A 5GJVC 1E58A 1LZLA 1W85A 3NVMB 3RU2A 5IJ9B 3OZSA 1G1MA 1K27A 3HCFA 4FT4A 3WLTA 2HW8A 2ICAA 1D04A 4DPKA 5EJ4A 4DSNA 3VOTA 1NSYA 1X7HA 3KR1A 1QCCA 2H5IA 4XFKA 1RJEA 1HFKA 2Q5CA 3DMNA 1F8XA 1GL3A 4ID3A 3PEWA 3JWJA 4LX0A 3RYFB 2BMJA 3W2GA 2AMJA 3WLEA 2QNBA 4EUEA 1G18A 2HD4A 2V7WA 4MVJH 3ZWBA 4A4DA 1YR9A 2JS7A 1QR2A 1L7QA 4NDAA 3AUAA 1TAUA 5LFAA 3VNBA 4QOFA 1ACMA 1ZX1A 4OQ4A 4PLTA 1D1QA 2VHTA 3EAQA 4TLBA 2PZGA 5EIHA 5LPNA 1HMPA 3RVJA 3RRNA 1DIRA 1RRVA 4BQQA 3I8XA 1PJTA 5HF9A 1ZD1A 1GAWA 4X6UA 1BKDR 1RNLA 2QE7A 3ANXA 4MVJG 2J7PD 1SPBS 1JHQA 1P61B 2FW7A 2OV6A 3O03A 4HL6A 3EZGA 3U31A 1PKEA 1FBNA 5BNIA 3T3GA 3AM5A 1R0BA 2Y0EA 3FKQA 2E5FA 4M1KA 3PFNA 3LQKA 4KQFA 4RKQA 4URWR 3ZOZA 4XI9A 3AZOA 5TEWA 2AI2A 4QUAA 3PUYA 4WESB 1D8AA 2QRVB 4WADA 1QH0A 1KJ9A 2IYOA 4KO3S 1MQSA 4REQB 5IPFA 5FB3A 2OGUA 2NNWB 3JU3A 2ZCVA 3EQ7A 3WLHA 1BE1A 4RJJA 2FN7A 4F2GA 1HV8A 5D87A 3S8YA 2NVWA 3W2EA 1QM5A 1KK2A 3I5XA 1BVUA 3QOXA 5DTQA 2QN8A 3ITKA 3TRIA 1QU3A 3KHSA 3EXIB 4MB6A 4F38A 1LX7A 3H9QA 2K7ZA 4QDJA 2J4FA 3ZE7A 3Q1LA 5EL0A 4EKIA 5DTRA 1ZXLA 1DOZA 1JTFA 1GU1A 1XN4A 5B12A 2H16A 2OC4A 3GLIB 3IDSA 1T5DX 4NG5A 5KYUB 1D5CA 2OR3A 4JY7A 4L8GA 1WDWB 2UUPA 3AVVA 5FKJA 2IW1A 2OCGA 1QTIA 3ZHRA 2H5LA 1T5IA 3H97A 5EYPB 2NP7A 1M2WA 4XIIA 1DEOA 1YASA 1HM5A 2ZWIA 1VG0B 4OQLA 2X42A 3O8OA 4NENA 4Y1FA 4XWWA 2OL4A 2UZ1B 2Q8NA 2V4ZA 1UPFA 2YQ5A 721PA 3ZX5A 1XV5A 4NNOA 4TZKA 3DH0A 1P19A 1RI1A 4H7EA 3VM6A 3NHRA 1NBMD 3D4NA 3FPBA 3UMGA 4UUQA 3SJBA 4CI9A 4KG7A 3OESA 1S9HA 4NEGA 1ZONA 1DV2A 2JFGA 2QZZA 2XOKA 3C2QA 3ND7A 5JECA 1N78A 4DRYA 1GFWA 3DMYA 4DLBA 2C99A 3FKSD 4AO6A 1R7RA 4ZT7A 1ZUNA 2CMGA 4OXIA 2V7UA 3K0SA 1SC6A 4IQ8A 4P58A 5ICFA 4EG5A 4AJ2A 3U0BA 1V45E 4QQ8A 2JD1A 2BGJA 2WUDA 4FYWA 1PCXA 2ZBEA 1EX7A 3M9WA 3WWDA 1SZPA 1D09A 2CNBA 3B38A 4HXEB 1LQTA 5IASA 1PTJC 2OB2A 2OBBA 4K87A 4AK9A 4D6XA 3AR4A 3EVGA 2J4DA 5LB2A 2K2QB 4DMKA 2PA3A 2LCQA 4IR7A 3JVDA 3EJ6A 4KMRA 2RCNA 4RQUA 4RKYA 1SA0B 1FU4A 1VPDA 1JLMA 3CR3C 4QEDA 1J9ZA 5LOVF 2PAAA 5DNDA 6REQB 2J7PA 4TLAA 4RHUA 5KYYB 4IJMA 9MHTA 3AOEA 1KJ8A 5H16A 5H7XA 2ZUWA 4PN7A 3M4JA 1NQVA 4UMDA 1TUBB 4H35A 3MAJA 5DKFA 2HV9A 4L72A 1LV8A 1EFPA 3L0IB 3T06B 4HVLA 2MINB 3NTVA 2PH5A 4EO4A 1ESCA 2G1AA 4F60A 5IZCA 4YXFA 2Y9PB 1KDVA 3UQZA 1XHEA 4Q3DA 4CV0A 1QYVA 2P69A 2GK7A 2XA1A 4L74A 2I4OA 3FRJA 4IHJB 1WZCA 3P26A 3O84A 3OO1A 1VECA 2PSJA 1WSBA 4JWKA 4LJKA 2GCGA 3TM5A 1FTGA 3LT2A 4DV1B 1C4XA 5SYMA 2BP7B 3EAGA 3L8CA 4YQZA 4B74A 4C6HA 4IZHA 4GEGA 2PH7A 1NC1A 1L1RA 3H7AA 5EA2A 4W9RA 1L5OA 4FT2A 1B8VA 2OD9A 3EC7A 4ZT2A 4AY4A 4C4AA 3C5CA 5CT9A 3RFXA 4XGIA 4QYIB 3BRWD 4BXOB 5ICSA 2V97A 3CT6A 4I55A 3BEOA 1UJ5A 1BWSA 5A02A 4IHAA 4WN9A 4PC6A 2JFQA 2WFLB 3HSSA 3CVUA 2PZLA 3FCEA 3ZVMA 4UKDA 1KOFA 4DUGD 1JDNA 1I4EB 2PX3A 5JS7A 3WICA 4WNCA 4N7JA 4ZVVA 1CK4A 1Z6QA 1DWQA 3A2MA 2MU1A 2QSJA 3M1LA 4FTWA 1Z34A 3TNJA 4ZO6A 2NVOA 4V0RA 2RHHA 2I6QA 3MGAA 3STUA 5JCOA 3O1LA 2W98A 5DGDA 1YIOA 3BGWA 1BXZA 1JJAA 4PXAA 5ALWA 2ORVA 2E7ZA 4HI0E 4D4LA 2R4QA 2ZU6A 5KWIA 2XBLA 3FBWA 2RKOA 1XZIA 3O3MB 2KX7A 3FKSA 2FKAA 5CB4B 5J40A 3FUCA 5T6MA 3WDSA 1PEAA 1YE8A 4V0SA 1JHMA 3ZV3A 3LBNA 1PDVA 4OXKA 5ARCA 1J20A 2DETA 4YJ3A 2IH4A 2UVPA 1U1FA 3N8GA 2DC1A 3BEDA 4PG5A 5EMLA 3KT3A 1T6XA 4KYTA 2GT1A 1ZD5A 2ASVA 5AI9A 4HLNA 3HCDA 5AYVA 2DR0A 4BX9A 4QOEA 1DXQA 3AJAA 4A2WA 3AY6A 3IIJA 1HE2A 1SKBA 4BC1A 4BXOA 4RMNA 4LX8A 2P68A 3GEHA 1GZ6A 3HYCA 1OZ0A 1JFRA 3ML1A 5EINA 4COKA 2QL7A 3P0HA 1ORIA 1AMUA 4BLOA 4QSMA 1Z4LA 4LNUB 5KC9A 1VCHA 3AEUA 2FX5A 3PHJA 3EZ7A 4YBRA 4DTCA 1EXDA 2B2CA 121PA 3CLSD 3VJMA 5CW2A 3KXLA 2CD9A 1GNRA 3IH5A 4L3VA 3TMYA 3WIDA 5COAA 5BWOA 1T1IA 5K0CA 1RT9A 3NXKA 4CLHA 1RC8A 5AJUA 3B8HA 3SEZA 4B87A 4CEHB 2LRHA 4EY4A 1ZHFA 2PO7A 3H84A 3G2OA 1QV6A 3HO1A 2VA9A 1MX5A 1WB6A 3GGOA 4ZCIA 3CZPA 3DV0A 5KNDD 3PK0A 4JB2A 1JR6A 3WRXC 3BZBA 4BGUA 2VWGA 2B0JA 1WXIA 4JI6B 1UZLA 2P90A 3VDXA 2BR3A 3VH3A 2C9MA 3OZXA 3WQHA 1Y1TA 2AR0A 3BAFA 3OZBA 4A7PA 3V8BA 1PQPA 4K5QA 2XXJA 4ASUD 1NHGA 4QVGA 1K4YA 3L4BC 4XIGS 1WMSA 1JIKA 2ZRJA 5T3UA 2M6LA 4C7OB 4D5EA 4GG1A 1CJTC 3KUXA 4KIWA 2PGOA 4CM6A 2WICA 3JYQA 3MILA 4OQQA 4CL2A 4BRSA 4MPTA 5FUVA 1H8HA 1BCSA 1Q83A 1JB9A 1X80A 2DSTA 3W3ZB 4DUGA 5K3AA 2JIBA 3BM5A 4QHTA 3UIEA 4J29A 3T52A 3IQIX 2FUNB 1EX1A 3QPWA 4IICA 1X1DA 2EG9A 2NVUB 5IM4F 3WL5A 2XIQA 4PIPA 1T10A 2EP8A 4JLWA 5SYAA 2I6GA 2IQ5A 5IAGA 4UXIA 3VPCA 3LYAA 3TLMA 1QIJA 1NWCA 4FQ8A 1R6AA 3IYLW 4FZ3A 5L8VA 5LDDC 1DX4A 1OQAA 3QE0A 3RVSA 5CBPB 5FUMA 1Q1BA 5K3OA 13PKA 1NBEA 4NBKA 1I6WA 2HUNA 2VR1A 3E9DA 4B8ZA 2IH2A 3OWHA 2Z2JA 2CSUA 3JWGA 1OI3A 2WIDA 3QJ5A 3TCNA 1TECE 1ACLA 4Y2TA 5DP2A 1YVRA 2E5LB 2P30A 2B30A 1TOAA 2RH8A 2VYVD 2W0MA 4OUKX 4F6LA 3AI3A 3OPXA 1CF4A 5BW5A 3S0JA 1MEEA 1RBZA 5KTSA 1N34B 1Z37A 2YBEA 4IIUA 1NVXQ 4MYRA 1RTKA 2XVYA 1H2XA 3AB3A 3IELA 1E63A 3RDPA 1FZQA 2J59A 2R00A 1FNDA 1FUIA 1AB5A 1T3ZA 3AF3A 3A9TA 4LWQA 3TAHA 5AVRA 3IOMA 3H17A 4O0LA 1Q44A 1PN3A 3PQDA 1FRZA 4FQ7A 2O8NA 2AKEA 2WNIA 5COQA 3H5VA 2IW3A 3ZWQA 2CL5A 4BNJA 3DKPA 2W71A 3G82C 1GQRA 3AY3A 2DXIA 2BI8A 3MWEA 4FFWA 2MR6A 3NAGA 5IUNC 3R7LA 3CG4A 3GDGA 3IULA 3AP2A 3KTAA 1XMVA 1VIAA 1BCRA 3MJ4A 4D6YA 1SURA 3PDJA 1XZAA 4BFCA 4QPCA 2XMQA 1E9BA 4RD1A 2GPTA 4FUQA 2Q1UA 3H83A 4GRIA 1X1BA 2JJ2D 2NT4A 3NI2A 2JEYA 2DAPA 5KYKA 5FJIA 4I4IA 3Q5GA 3QYPA 4L78A 3P9PA 4YQFA 1JKIA 4G0NA 4EA6A 2C7RA 1KYWA 2ODPA 1V1MB 4LE2A 2MSEB 1I9GA 1PRYA 3V3KA 4ITUA 4NR0A 4ASUA 1OLUA 3DL2A 4K9RA 4ZVRA 1HDYA 1S8AA 4BNUA 1RQGA 2HN9A 1ODIA 4M6WB 4BRUA 3I5YA 4WVLA 2AUTA 4IKPA 4BO9A 2REQB 3R3WA 1OGJA 5TB5A 4DCCA 2EJVA 2B6HA 1NX6A 1TLTA 2QX8A 1RYNA 4EJ6A 4X3OA 4DIKA 1RPNA 3K09A 4JT2A 3CWCA 1DNPA 1GVNB 3T4PA 4MR9B 2IYTA 1WPQA 4US0R 5DTIA 4QBIA 5K3SA 4CCAA 3GLFA 1C7IA 3G2PA 5DWVA 4JJ7A 1J8FA 4IDHA 3V8VA 2WWXA 1MB4A 1D8TA 1HC7A 2G82A 2CUZA 4V0OA 2D5AA 1WNFA 2W4MA 1N2XA 1FUYB 2CL7X 2Z3WA 5CDYA 5ELXA 3TLBA 4DCOA 1P2GA 2X23A 1XTKA 3IV9A 5DP1A 2O14A 2CLIB 3C4VA 4DNOA 2CV0A 4LZLA 1YVUA 2XYQA 2H11A 2FSFA 3AR8A 3DHYA 2ZI6A 4KX5A 4FOOA 3Q7RA 4MS1A 4N5NA 4D8TA 1YBFA 4Y18A 1ZNWA 3ZJTA 2C00A 4PNZA 1PEKE 1O94D 1HG0A 2P0EA 4W6ZA 2FPPB 4M1SA 4RK1A 4Y1GA 2OB1A 2OWDA 2OV2A 3BCHA 2V4UA 2WVAA 3QEKA 1NUHA 3UJAA 4U3JA 2O8EA 1QX3A 3FOCA 3IP9A 1P91A 1Q1QA 4P0QB 1IBLB 1B43A 2X15A 2FU5C 3KHKA 5AM3A 3K8QA 4LMBA 4PWZA 5KSOA 2KLBA 2PDAA 4GU5A 3JQQA 3H1EA 3AHEA 4EEZA 1BSVA 4IY1A 1Z0SA 2IOFK 3UOGA 4EB8A 3G9QA 3PHGA 4ROTA 3EGOA 1DC4A 1CUZA 2GD1O 3L1HA 4QFDA 4GWLA 3AHGA 5KHOC 1AQYA 2KW5A 4HT3B 1J90A 1VI5A 4CKBA 2WJJA 1IOWA 2HAEA 4FHEA 3RE1A 3BERA 3VTFA 4PFKA 4F71A 1BTOA 2CFCA 3GC6A 2UXDB 3QLVC 4FEAA 3AINA 3L8EA 3KVYA 2HXYA 3VKWA 1M6VB 2OECA 1SUWA 4W6QA 3ZEIA 4BGEA 1R50A 3S8MA 3X2EA 4U00A 5DB4A 4U9HS 1AHHA 1U2QA 4YALA 3OJEA 1ZGGA 4UUNA 1EVLA 1Z28A 2ORED 1QPZA 1GZSA 3ONWA 2EERA 4KLCA 3UXEA 2HK9A 4AWAA 4RA6A 4V39A 4CMBA 4I1VA 1N2SA 4R1OA 1PWHA 2I4NA 2P4HX 2VXOA 4K05A 2AUMA 5FTLA 1MW8X 3LQ4A 1IBMB 4YCMA 3FYCA 3LXRA 3GJTA 1QRAA 3JASA 2A3RA 4E3ZA 4EHFA 4G23A 5E38A 2PBLA 2CFRA 3K0FA 4TKUB 4XYMA 5HS4A 1SVKA 4RQBA 1DOHA 2C1XA 4RCVA 1M3SA 4JBIA 4D9GA 4ZYYA 1BQ4A 2XIJA 1GUBA 1U3VA 3M1IA 2CK3D 2V5AA 1KQ3A 1XWWA 3NGLA 4PPFA 2PGNA 1DO8A 1NMXA 3WIVA 2JJ1D 1O96B 1NOKA 1RLOA 3GJ0A 4PZUA 3ZI4A 4YAOA 2VHYA 3ZZTA 4QU0A 3PQ6A 4DIEA 4C7JA 1IONA 1QK4A 1W29A 2J9XB 2ZR9A 4MYTA 1SCBA 1EFDN 1BJTA 4AZ3B 2X0EA 5EWJB 4YROA 3LT0A 3NYWA 1D2CA 1ZXXA 4RS4A 3RASA 4JU8A 2XEDA 1JVSA 2ZI9A 3I3SR 3A6GA 3MJTA 4LHYA 3T9CA 4HNTA 2PUDA 4F7WA 1DKLA 3ROXA 2J48A 4ZHQB 2CE2X 2CHUA 2DX7A 1LK5A 3QA9A 4C3UA 3PYLA 1IATA 1N6IA 4QU5A 1BVHA 4IXWA 3B60A 4B82A 2PRJA 1OI4A 1U3WA 1QVZA 1TD9A 2FX3A 2Q5OA 4DDHA 4B3MB 2ZZMA 1JHYA 4W5RA 2O2EA 3JVVA 4X0EA 1U0TA 3LE8A 4S1OA 3CN7A 3H3FA 4U7HA 3TKYA 3K53A 5BUSA 2Z09A 1XVVA 3VU9A 4QOSA 4BCCA 5ENDA 3CUVA 4HFMA 4JFAA 2ZJYA 1Y63A 3COZA 4BNKA 1R9GA 5T4HA 2FFAA 3D0RA 1TEVA 4KMMA 3DVAA 3SJCA 4NU6A 5C35A 4P22A 1VE9A 4MPDA 4D4HA 3DT9A 3VPBA 2I6UA 4IWXA 5EP1A 1SBNE 1R4ZA 3M2TA 3RJMA 3KB8A 4G2TA 5KHLB 4QX6A 1MB3A 4B09A 2OVFA 3IVCA 3ROQA 1VYUA 4BVHA 3E9YA 4J16A 2QX4A 4Q9HA 1V3UA 3ZYCA 3R74A 4OOFA 4JB0A 2ATCA 1VPEA 1J22A 5IC4A 1P4GA 5J4HA 2GLXA 2PRSA 3KTOA 3ZWNA 4IH4A 4IS2A 1NJFA 1GARA 1V5EA 2HLNA 2EYUA 1AVTA 3O4FA 3P9KA 4P7BA 5F1PA 4CMEA 1W47A 4LAFA 1PVOA 3K9LA 4O2AB 1DKMA 2C2OA 2KHZA 3NT5A 1XYVA 3AEQB 5HVNA 2VRWA 1SR8A 3PXAA 2JVJA 4H3KB 3ANTA 3CYFA 1K6XA 1MR3F 2QN9A 4INOA 4KN8A 2J5RA 4OU4A 2PKQO 2FR8A 1TJNA 1C0KA 2AFIE 2FMIA 3E7PA 4NE9A 1XK6A 3W7VA 5G4LA 1CE8B 1XPUA 4TZ0A 3ESCA 4RIEA 3VZSA 3HUDA 1X7ZA 3R4VA 2C7BA 1DUVG 4FDVA 1QYWA 5CFOA 4ZV4A 1JSCA 1MO6A 4GOJA 2ZUFA 4O5AA 1X7YB 1CUBA 2NAPA 2D54A 4WK2B 4B85A 4X41A 2QUBA 5C7IO 4RCYA 2WTUA 1I3OA 2ZFUA 5DVZA 1QFZA 1SN7A 3DQQA 3GRKA 1VBFA 4HYTA 1PJBA 1EM6A 4B4WA 1HDIA 3LRPA 2QYSA 2UZ0A 2ZI7A 4DMMA 3Q3CA 5HIMA 4OGGA 3R5SA 1S2DA 1P18A 2ACEA 5DI3A 3R3SA 3UAGA 5ITSA 3ABSB 4I1UA 1EXNA 1IN4A 1WF6A 2GAOA 4R6XA 1EGAA 4JAVC 3OZWA 3FWYA 4P93A 3PUJA 1CW2B 3ZXXA 4JODA 4BU1A 1ODFA 1O8BA 4GM1A 3LRXA 5K20A 4E5KA 3PEEA 4B47A 2NO0A 1KJYA 1PGOA 3R6LA 2W2KA 4HQLA 4XIJA 5JZOA 2Q8QA 2Z4SA 5AI8A 4CM9D 4OUDA 1MT3A 1NGSA 4MEJA 1G8JA 1HDEA 1UUFA 4U39A 5IKEA 1OYYA 2GEFA 3CV3A 3ESXA 3I45A 3ZE8A 4B43A 2GXAA 3EGCA 1WDKA 4U7JA 5HK8A 1JQJC 4IJKA 2G5GX 2H6EA 1XZJA 1OV4A 1RFLA 2VKQA 1EG2A 3ZHQA 3WGTA 3OFJA 2Y71A 3NV7A 4FFBB 5KC8A 2ZK7A 1K98A 2OHFA 4BKPA 1R18A 4PAGA 4E5UA 3AVUA 5K05A 1GSOA 4MJ7A 2VQ3A 1NI4B 4HCJA 4URZR 2WB2A 3WZMA 1DJNA 5MFZA 2JB9A 5DHAA 3SPXA 3ILYA 1Y3AA 3TLXA 1RLIA 4UAVA 2XUDA 2FUEA 3GFRA 3H2ZA 3UJDA 4QJ3A 1ZK2A 2PX4A 4DQDA 4QDUA 4IG4A 3FH0A 2WP8J 3QU4A 1PDOA 4CCYA 3QOWA 5A03A 3P20A 1VBNA 2EBUA 4KO4S 1UK6A 3ZLJA 2OFFA 4FJ2A 1S3FA 3UT5A 4BLPA 1R9JA 3F71A 5C1PA 2FN4A 4RELA 3O7WA 5IZCC 5JYBA 1QF6A 2GBCA 2UYYA 3PVCA 1DAKA 2V9PA 4M49A 4KSCA 4TKLA 3LUJA 3SMVA 4TTAA 1FJHA 4G36A 4XWOA 1LWOA 2EP5A 2I03A 1U1IA 1Z73A 3DTTA 4IRUB 1SVMA 4NQRA 3W1WA 1ODJA 2X14A 2OQIA 3NTQA 4Z4QA 1LCIA 3TGWA 4OQYA 3EVDA 3C4JA 3EZ9A 3KQLA 3F1KA 4O4HF 2HBQA 2Q4TA 1L5VA 1WCIA 3BXPA 4B2YA 5TV2A 5BSEA 4A36A 5KDLA 3ZVNA 1WKCA 2PKCA 2AW3A 3DL0A 4G4JA 2QW8A 3CW2A 5KNDH 3F8TA 1SH7A 4YJ2B 2HLDD 3P52A 4TGLA 4FFVA 3RK1A 3PTAA 3OTQA 1Z29A 1OGYA 4HLCA 1T26A 2FLVA 4HDMA 3E3OA 3FDZB 3G59A 2FSGA 2AOWA 4ZIRB 4PTZA 4A8HA 1C3VA 4MI6A 5ILQA 5B2FA 4BNVA 3U5TA 1UOQA 2CLFB 3WL8A 4OQXA 1E0AA 4EB6B 3DZJA 3P2EA 3JD1A 4HNAA 5JCOC 3I5MA 4FNOA 1XZPA 4EPRA 1R4MB 3I4LA 1HFWA 3EFBA 2BFFB 4G5RA 3P4UA 4H27A 2IYQA 2ECFA 1JFLA 4KC0A 5FRDA 5KVQA 4RACA 2WRZA 1SCDA 2XT0A 1U7OA 1EUDA 2QTTA 4PS1A 5L4SA 3RSOA 4OATA 5SYNA 5CFNA 3F5MA 4NC9A 1H2ZA 1T9KA 2EWWA 1VG1A 2XW6A 3GLVA 3RRYA 4P4SA 1PK7A 3DOEA 3RS0A 2X9GA 3JQ9C 4KACA 4HAZA 2CNKA 5J63A 3HUUA 3HJAA 1E3EA 3BQMB 4BHTA 3PUXA 2UU9B 2QTMA 2QAJA 3L0BA 1SCJA 3VJLA 4FC7A 3D7KA 4M36A 3MHPA 3TL3A 5BR4A 2Y0DA 2XITA 4V0NA 3FFAA 1NBHA 3WLQA 3KQMA 5JTUA 2VTKA 1SXIA 1FE8A 1VSTA 5ALFA 1GG9A 4QASA 2BMDA 5BY2A 1XF1A 2NV6A 2D8MA 4R7ZA 3SZOA 5JAUA 5H83A 3FCSB 1CUWA 4IDOA 3TIGA 4GBED 4KRXA 1Z08A 3A1DA 1ECFA 2GD2A 2RH9B 1UCFA 2QM3A 2DFKB 2WEKA 2OO7A 4KFTA 4B71A 1N1GA 1JN0A 1UT6A 2XKBA 4RZXA 5CVDA 5F3DA 4Q1AA 3VV3A 4A0RA 1PLLA 5JZVA 1RXVA 2HGSA 3NBFA 4A26A 4O5OA 1WEKA 2JLVA 4QXAA 1ZM7A 4R98A 1ADFA 4EFKA 4BUJA 1XEAA 1A97A 2IPOA 2IK8A 3VC3A 1H0SA 2GM4A 1YXMA 1EX6A 3GG2A 1UPBA 4KAXA 1D6NA 2ZTMA 3Q6NA 1ZOSA 2AN1A 4M54A 4OHCA 4MMXB 2ZAOA 1FDSA 3R5HA 1Y5LA 4CIBA 1O03A 4MUXA 3CT4A 1QCYA 2VWQA 3RSSA 3TTYA 3DE1X 4EWLA 1NC3A 3C7KA 5AM1A 1HLGA 4TQAA 4BQPA 1M1NB 4PNHA 2Z5FA 4D4GA 3SIWA 2IHKA 1C3OB 3LQRA 4QFBA 3AEKB 2OT3B 4DGQA 3GP8A 1QFSA 1Z5ZA 2R65A 1ISFA 5JBIA 3R7AA 1H6AA 2JD2A 1JG3A 2Q07A 3SR0A 4CTNA 3LBFA 1E94E 1SG6A 4IOMA 5JJCA 3G0CA 3P27A 3CCCA 1H22A 1Z35A 2H9YA 3PWKA 2ABWA 3AONB 4JB8A 1RWNA 3FLMA 1DTEA 4LSWA 1L8AA 2DOKA 5EXPA 4YMVA 2HT6A 5KS2A 4EHNA 4TM8A 5F12A 3ZHZA 3SD7A 4I5DA 1B0AA 5ECWA 3HA2A 2HMYB 2WOOA 2AD1A 2GXSA 4MEAA 4OY3A 1E2HA 4LFCB 4NV0A 2IZ5A 3V4OA 4DQKA 1FX0B 3LF2A 1E1MA 2ZSDA 3WGMA 1CR6A 4Z4CA 3RH0A 5AKXA 2WFZA 1LA2A 4LWPA 1ISHA 2VO1A 1TDJA 3AEYA 3C3JA 3KL2A 4KHZA 1EA5A 1Z22A 4LQ4A 5KX5B 4KVGA 1IQPA 5J47A 2QTFA 3CLVA 3ETDA 4Q3CA 2MSDB 4MWZA 4N5DA 4MYDA 5B4UA 2G6TA 5JW6A 2I80A 1XMOB 4DADA 4B3DA 3FYHA 5H80A 4MJ3A 3NTRA 2FYTA 1THGA 3H4TA 2VJKA 3KXIA 3GFQA 2XYGA 4PTYA 4QWMA 3TVDA 1F0KA 2CNLA 2H92A 2GM5A 4OAOA 2QLMA 2W2QA 5K4AA 3ZQUA 4AS3A 1JUDA 2MSKA 4KQ2A 3WWYA 3A25A 4E33A 3AY0A 5JZ9A 2E6KA 2I4RA 4W1PA 4OG2A 3DO6A 2BKAA 2P6PA 2O1WA 1KKMA 3X1DA 4NYIQ 3EBOA 3TM4A 2R00C 3K8OE 5HKKD 3VKHA 1ZJ4A 4ODIA 2VVTA 3WKEA 2YL2A 1EVYA 3CE9A 4YCAA 4WLFA 3ED5A 2AFVA 2FZLA 5CDGA 4Y2SA 3GGDA 5FV4A 1KRWA 2QM0A 1F7UA 1EE2A 3RC1A 3TQTA 4R2WA 5BWMA 5ALUA 4TWBA 5AK6A 4CU5A 1Y7HA 4O02B 2BH9A 4G84A 3EC1A 4DB4A 1YQXA 3NUZA 4JIGA 1NJSA 2IBTA 2R62A 4P3KA 1A2BA 3PQ8A 4E4YA 1NZDA 1DMRA 2CJWA 4QAJA 1ZOOA 2B99A 4QEZA 4DCUA 5JSZA 3C8HA 1U0LA 4O8ZA 4M60A 4C3ZA 4HWRA 3LZ6A 1C41A 4UEJA 1YUBA 2RGNA 3PR1A 4GX0A 3E03A 3GLTA 5BRAA 1NFFA 1WMBA 2X2EA 4PPYA 4KXWA 4ZN6A 5D5PA 2W6NA 1NXQA 4MIYA 2OO5A 1A8PA 1KO1A 1LTKA 4DM4A 4XIYA 1LWNA 5G0VA 1CJCA 3CZ4A 4PLCA 1YRHA 3IE1A 1A50B 1P2BA 3HZZA 4RZ3A 4MVJF 821PA 4L8LA 1CR4A 5C7OO 1VL8A 1DC6A 5HQ3A 3LPMA 3K09C 4EGSA 1MGOA 2QTNA 2AN5A 2Y1GA 4XPIB 4J8PA 4B7AA 1C9YA 2O9JA 1GFIA 3ZJYA 2WZQA 4GF5A 1NNUA 1P4JA 3FWZA 5KOHA 2B3DA 3ADKA 1GUFA 4JN6B 3V8NA 1UT8A 3W78A 5I7EA 4U0KA 1JPNA 3I2GA 4HADA 5C80A 5JCZA 2R1TA 3H0KA 1OT5A 4K6KA 3TSZA 5CA1A 5KYWA 4R9NA 3KEQA 4D56A 1GO2A 1B6GA 3GPDG 1M2GA 3K94A 3URMA 4EG0A 5BVHB 5F1OA 3GLRA 1VIYA 3I04M 2JAWA 1A4RA 2BFMA 1EXVA 5FYQA 1MB9A 4FR5A 4LRQA 5FEMA 2PXAA 3FDIA 3H8SA 4ZQFA 1XKQA 3HB4X 3QZUA 4EM6A 5K8JB 5K0ZA 3N3AC 4Z4IA 4G5OA 4HRXA 3RS8A 4W5OA 1QHXA 3OCYA 2DU8A 3L82B 2AOXA 5CP8A 1S2LA 1F38A 2VSOA 1Z2NX 4X97A 1IM5A 5F9FA 4NY1A 1DIHA 4FFMA 3OIDA 3AFMA 4RM3A 4Q1CA 5DZSA 2AX3A 2C83A 2GLUA 3BD6A 3N2ZB 1YDEA 1AHPA 3NP7A 1RZUA 4HGNA 4B40A 2QWXA 1YJQA 3PPYA 4Z0NA 1T2FA 1N7GA 1MJ5A 3RODA 2AIRA 2X77A 1E1CB 1Q7EA 2A57A 3KZOA 2HJVA 4RDCA 5KYTA 2NU8B 3FAZA 1QJ4A 4KYIB 2J6CA 3ZWDA 1HDZA 1PJQA 1VLLA 1Z6GA 3ZHVA 2E4YA 3AOGA 3U7QA 4DG9A 1WQ4A 2IBSA 2G4LA 3F6SA 3VX4A 4F5EA 5EMNA 2G76A 2AGVA 1PJAA 1WPRA 2YZGA 3DLCA 1DQSA 1TZ2A 2XZDA 3AESA 5EHNA 1YS1X 4L2IB 3QEAZ 2ZIGA 5KQPA 3OTOB 2D1FA 3IB6A 4PNEA 2EJUA 2L18A 3U2QA 1CIJA 2ZRLA 3UMRA 4UE2A 5HMMA 1CRQA 3M49A 4LS3A 4CIWA 4F91B 5TS3A 1RQPA 3BXZA 4P38A 4FZVA 4TZ6A 3EDRA 2IEAA 1DE0A 2UZAA 3IEUA 1L4NA 5IAEA 2MMGA 1NMZA 1XL0A 3LC2O 4P80A 5JMOA 2WUFA 4NZPA 4F21A 1FX1A 1OCEA 4P31A 3IAFA 2WDZA 1V16B 4MVJI 1ORHA 1ECBA 4OHXA 5CVEA 4JNCA 4HNUA 1GQYA 4ZMRA 1QC5A 4HYYA 4IG9A 5EJIA 3TLEA 1QRTA 3FBGA 4XWGA 5EFZA 1GPWB 2FSHA 2WF9A 1U8ZA 4W8GA 1WMFA 3N0TA 4MYSA 3ADPA 4BO2A 2XNSA 4HX5A 2HH9A 1RTTA 1XRSB 2ZYTX 4HPJB 2X5KO 1Z38A 2BHTA 3WO0A 2BE7A 4B75A 4BV2A 4WOCA 4WACA 4FMCB 1JPJA 2XXBA 3F7OA 4RVGA 2HGZA 1LQUA 2EZTA 2P77A 4FBMA 5GPBA 4BVFA 1PVVA 2BCGY 3NBMA 3I5UA 1Y4UA 1NSFA 4X60A 2CXQA 1LI4A 1G6Q1 4LYHA 4CLDA 4DVGA 1Q21A 3DEYX 3I9MA 3TH5A 3GPLA 1ZN7A 5JRDS 2O8CB 3NZEA 4KPEC 1HT1E 1Z45A 3H19A 1YZKA 1Q7TA 2ONCA 3T4XA 3THOA 1VHJA 3I5AA 1R3UA 1HTWA 2I2AA 5JCXA 4WCFA 4NS4A 1CUUA 4XB6B 5C9ZA 3QE9Y 2X5XA 4QO8A 4IV8A 4U6SA 3RBVA 3C3BA 2H1RA 2DKFA 3CRNA 1HORA 4F96A 1UJCA 2PUVA 3RSFA 1R00A 3LFTA 3TTVA 3OZDA 1KO8A 3TVYA 2ZT7A 3FSRA 1W4LA 3BTVA 2AE1A 5CM2Z 1UJNA 4HGOA 1A9PA 4L51A 4OLJA 2G9ZA 4QVKA 3TGPA 3DOJA 3MTGA 1GTG1 4NEHB 5ULLA 5IXYA 1A98A 3HADA 3II6X 1EG7A 2M1ZA 2XJ4A 5TGDA 2AFIA 3HY3A 5JH7A 2GEBA 1JRLA 3LA6A 1QGAA 1TF2A 1LKZA 1ZQ9A 1AUQA 2QTVA 3QNUA 2G17A 1YR6A 4CMEC 1P73A 3DVRX 2A1TR 2GYYA 2QMEA 3QI7A 3NO4A 2OQVA 2BM0A 1VE5A 2BRUC 4GBMA 2HHJA 4Z1MD 5HYVA 4WHMA 5C46F 3O9VA 5H3CA 1PD0A 3NRBA 4ZD6A 3W2IA 3B1XA 3ITDA 2AG0A 3BMQB 4LW8A 3O83A 5B6IA 4AKHA 1EE1A 1BH2A 4GMDA 1AS3A 1QZZA 2FR8C 3CXUA 5HCUA 3NNSA 1QP8A 4OBBA 4P4TA 3RUPA 2X2OA 4BMCA 2ZOSA 2PR2A 4BYGA 5K3FB 3HGQA 2FB9A 1Q20A 3AL0C 5ALJA 2YH2A 3PCRB 5FUBA 4KP7A 2NX2A 2O6HA 4M0KA 1QVWA 1B6SA 1R5BA 1TEHA 3OEYA 4M9QA 2HX1A 5E6UA 3JRXA 1T8YA 2CXSA 3RKSA 1DBSA 4K3VA 3RQSA 5JZBA 3HP7A 1FLDA 1RXEA 2RI0A 4E0BA 1IY9A 4ND5A 4I8IA 3U44A 3BXXA 3I6YA 4NRDA 2E4UA 4OXYA 5AVJA 5ITZB 4MVCA 3B85A 1L5LA 1JV2B 5EMJA 3HMQA 3VR3D 3ETHA 4DR3B 4Q47A 1G55A 1KPIA 2HPHA 2XYPA 3AB7A 1ADGA 3QXHA 4RLSA 4YRFA 3VR6D 5IKPA 4DLWA 2G7MC 1BS1A 4TLCA 1P1JA 2QZPA 1G5HA 1KH1A 1X1SA 3ADDA 4AYTA 1TM4E 1T5SA 4MIKA 2V54A 4O2BA 2QIPA 3VPXA 1D4OA 3B6JA 1KMHB 4NIMA 5IW8A 1R0WA 4RL4A 2M6KA 3ZCQA 1EVIA 5SZJA 1NVUQ 2QPAA 3QV1A 5TNXA 4B3SB 4L57A 1YO6A 1NL3A 2ZQYA 4NZNA 4S1NA 2LZ0A 3CWZA 4L4YA 5FBLB 4XB1A 4JROA 4KYVA 5LSAA 2B7CA 2PMEA 1QYRA 1OH5A 1MOSA 3F90A 4EFLA 1I4OA 1NRWA 1YZQA 3HU3A 3IXMA 4MKFA 4E6PA 1QH8B 1SVUA 4J49A 2OYRA 4G85A 1P80A 3FCUB 1K8XB 3FPGA 4G2NA 3KQNA 2HMVA 3E27A 3RKUA 3GA7A 3AU9A 1DKRA 3DTYA 4HNSA 3DBRA 3F3YA 4YUXA 4O4LA 3EG9B 1Z68A 3SNHA 3NM4A 3A1FA 4ZI3A 4D8UA 3R75A 3HCCA 1MORA 4E09A 5ADUS 3E5HA 2F90A 2XUFA 4BQNA 1E2IA 3LIPA 2J6HA 2JVIA 3IPCA 5HR5A 1ICIA 4MKXA 2OBMA 2OGZA 3BXEA 1KEPA 3KOXA 5I5GA 1YMVA 4CEIA 5E7IA 1MP0A 2FSUA 3LW7A 3VO2A 1GT91 1Q2UA 4ZQEA 4A6DA