1BN6A

Haloalkane dehalogenase from a rhodococcus species
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
291
structure length
291
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGVLPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNEIPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE
publication title Haloalkane dehalogenases: structure of a Rhodococcus enzyme.
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
total genus 102
structure length 291
sequence length 291
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 1998-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bn6A00
1WOMA 5ALFA 3WJ2A 2XQGA 5AKYA 1QLWA 5KREA 3FLBA 4N8EA 4BTVA 1TIBA 1UOPA 1ETHA 4WFIA 2YYSA 1R50A 3BJMA 3STUA 2AXEA 5K5EA 1DQZA 4H7DA 2OPHA 4CCWA 2BGRA 1JKMA 4U2CA 5EHXA 4QE3A 5D3ZA 2VEOA 1XZDA 5FUMA 1LBTA 2WTNA 2DSNA 3BE8A 1ZD3A 5AI0A 4BZWA 4BCCA 3S8YA 1NU6A 4Y2VA 1CUZA 1GKLA 1G66A 3V1MA 3H0CA 1ZD4A 3LLCA 2P8SA 3AIOA 2X5XA 5ALNA 1X2EA 4WY5A 1IUOA 2FUKA 3M3DA 3Q8WA 3IUNA 4KE7A 5AKLA 3V48A 4JYPA 1XLWA 5JASA 2XUKA 4BB0A 4H7JA 1TCAA 4BZZA 2EEPA 4BDSA 4C4ZA 2HFJA 1MAHA 2HA3A 5HF6A 2I78A 5AK6A 4MEAA 2GYVA 3DOHA 3TJMA 1HDEA 2ZJ7A 5K3EA 4UHBA 1H2XA 4KE9A 4WDQA 1XRRA 1RYYA 4KAFA 5AKIA 3OC0A 4H7HA 1XZAA 5LIPA 3AFIA 3FOBA 5LKRA 4J0IA 3EBLA 2WSLA 4ZRDA 2OLEA 2DHEA 3G7NA 4JYMA 4LXHA 4S0XA 3QBJA 2FJ0A 3R3YA 2PBLA 2E3JA 4EY4A 4U2GA 1R1DA 5CT9A 4FHZA 4DSZA 2I03A 1N8SA 1A8QA 1GXSA 1SCKA 2PVSA 4ROTA 3WZMA 5C81A 3WI7A 1BCRA 1E66A 4BCDA 4GEGA 3WIOA 3PI6A 3G0DA 2OGTA 1W1IA 4NVRA 3AIMA 4DNPA 5CH3A 1MX5A 2XUIA 3WKEA 1YCDA 3DQZA 4HRYA 1QZ3A 1UWCA 3T52A 4H7EA 3O4HA 4AX4A 4BATA 3HSSA 4ZGBA 2K2QB 1VZ3A 4HZGA 4MWTA 3M83A 1OCEA 4F5ZA 4P9NA 1CQZA 2XLBA 1QIGA 1LPSA 4GDMA 5ALJA 4Z49A 2WHQA 3BWXA 5EHZA 3WMRA 4BE4A 2OAEA 1CUSA 3W05A 1ZOIA 4FNGA 2WG2A 3FWHA 1XZEA 2IX9A 1XLUA 1L7AA 5DTIA 2XMGA 4K6KA 5E2IA 5JD4A 1UFOA 3FSGD 3PF8A 3QMMA 3TGLA 4X6UA 2O2GA 2XQIA 1CPYA 5ALUA 1A88A 5A6VA 5JAPA 2D5LA 4FNMA 4CCYB 4EA6A 3AILA 2HU5A 2JEZA 3VJLA 1TQHA 3C43A 3DKRA 4H7FA 1ZJ4A 1FFCA 1QGED 2AJ8A 3VDXA 4WY8A 4BBZA 1MU0A 4N5IX 1P0QA 4O08A 3WWPA 1QOZA 4Q3OA 5AIBA 4L0CA 1FJ2A 4H0CA 1QIMA 1ZGBA 3FYUC 5F4ZA 1X2BA 4OB8A 3W2TA 2VAVA 1VZ2A 4MQMA 1FFBA 3AJAA 3F9CA 2RIPA 2B61A 1E8NA 5AI4A 3W9BA 2WUGA 4HTAA 3GROA 5ALTA 5HZGA 2ONCA 1EDBA 3K2IA 3G0GA 2OQIA 2WFLB 5HF5A 3A2LA 4Y9SA 4EY7A 3C6XA 1XZFA 4Y2XA 5CT5A 4UFOA 2O2HA 2PSHA 1ORWA 1UOQA 5FRDA 3FBWA 4QNNA 3R3XA 2VA9A 4BP8A 3C6ZA 3PF9A 5C8XA 4GI1A 1TKRA 5EHQA 4AMZA 4Y2YA 1LZKA 3N2ZB 3FCXA 1J07A 5A2GA 2HL6A 2ES4A 2JGEA 4PQEA 5ALXA 3F96A 1MN6A 4L3WA 1IMJA 4EB0A 3I2KA 4J7AA 4KE8A 1KU0A 2V9ZA 4CIAA 1UT6A 2AJBA 3WL6A 3LP5A 3DCNA 4I4CA 4BC1A 2PUJA 1T4MA 4M0EA 1QO9A 4DNOA 1JMKC 4OPMA 1XZBA 4UFPA 5AI8A 3HACA 4GXNA 5FLKA 4UUQA 1LPNA 1JU3A 2OGSA 4K6HA 4G5XA 1VOTA 1QJ4A 2QVBA 2Y1KA 5EFZA 4UBJA 4X90A 3QITA 5AK3A 1CUUA 4RE5A 3G9ZA 3O95A 1JMYA 3WWDA 5JIBA 1VA5A 2B4KA 5AI5A 3FLEA 5JZBA 4AN1A 1QIFA 2O2IA 4X94A 1VXOA 1UKBA 3R3ZA 1CUJA 3DD5A 3KDAA 3WZLA 2C5FA 1DWPA 5AM5A 2NW6A 4RE6A 4X93A 5CRIA 3AIKA 5KWIA 1W6RA 1ODTC 3AINA 4Y7DA 5E4YA 4XWGA 4HXEB 3O9VA 1R9NA 3VISA 2XUQA 5LZ9A 2JEYA 1XQWA 2ZYHA 5K3FA 2ZYSA 1UK8A 4JEIA 1DU4A 5JD5A 1H23A 1WHSA 2JGFA 4HXFB 1K8QA 1K4YA 1QFMA 3F97A 3ZI7A 4KR0A 5AKZA 5H3HA 3Q0TA 1GT6A 4IQ4A 3H17A 2WJ6A 4OB6A 1H2YA 2PSFA 1A8UA 5D7BA 3ZV7A 5D6OA 1BE0A 2IIVA 4H7KA 1U8EA 1SC9A 4FBMA 2AJCA 4TVKA 2XB6A 3QZUA 5IKXA 5LZ8A 2C0QA 2WHPB 5AJHA 3D2CA 1QIHA 2CB9A 2ZJ6A 5T4FA 4K5QA 1ODCA 1XZLA 3BIWA 2GBGA 2EDAA 3D4LA 4U2DA 1ZI6A 3OTQA 4C87A 2V97A 2DR0A 5BOVA 4U2BA 2Y6VA 2CEKA 2HA5A 5AM1A 1FFDA 3FSGA 1DQYA 1L7RA 3I2FA 2HU7A 3OPMA 3C8HA 1SFRA 3IUQA 5DNUA 4C4YA 2DCMA 1IZ7A 5AIAA 1XZCA 2CZQA 3FVRA 4MQLA 3QH4A 2DQYA 4LKOA 5JAHA 3KOOA 4KAAA 1CUFA 3C5WP 4JNCA 4AO6A 4FLEA 1YR2A 2PSDA 5I8PA 5AK4A 1Q0RA 4FLMA 2RGUA 5AM3A 5DWDA 2XMQA 4D9JA 1CUAA 5K3CA 5A7FA 2GBFA 2QS9A 2YXPX 4UHHA 2G5PA 4ARBA 1QIIA 5ALYA 2XT0A 4FFWA 3QYJA 4AZ3A 2H9YA 2VJDA 1WPRA 3V1LA 4ZV9A 5DTJA 3PICA 5JANA 1S8OA 4DTCA 1QIJA 3HXKA 4V2IA 1XRMA 2PPLA 1CUVA 2XUGA 2XUDA 1KU6A 2OXEA 2DHCA 4DMFA 2BJHA 1CUCA 4FOLA 3MUNA 1XQXA 4OU4A 5C7YA 4X85A 1XROA 3WYNA 2WU3A 4Q82A 1VXRA 1VE6A 3H19A 2XMDA 5JAOA 3DYIA 4B82A 5JZ9A 2XUAA 3C87A 1EK2A 4RGYA 2BAGA 3IURA 2GYUA 3K6KA 5JALA 5ALSA 4ZV7A 2O7RA 1QFSA 3QPCA 2JGLA 4GECA 2HA6A 3C70A 2RI6A 1YB7A 5AOAA 2HHAA 1B41A 2JF0A 4UBNA 5FKJA 5KBYA 4EBBA 1Y7HA 1CQWA 4G9GA 3UUFA 2J3DA 1DX6A 2DQZA 2QZPA 3WKAA 7YASA 1XZMA 1NX9A 1LBSA 3OG9A 4BYMA 2PM8A 5CXUA 5DYTA 1XLVA 4NS4A 4JUIA 3RM3A 3PUHA 2J4CA 3M81A 4KAJA 3WK7A 3D7RA 5CW2A 2ACEA 3WLAA 5JZSA 1Q84A 2ZSIA 3U0VA 4LYDA 1ZJ5A 1CUHA 5DLPA 2WIFA 3G0IA 5SYMA 1FFAA 4Y2QA 4H7IA 4X71A 2XMBA 3I2HA 5DYWA 1F6WA 2FX5A 1K63A 3DL7A 2WHRA 2HFKA 4B9EA 3HEAA 4B7ZA 1IUNA 5FPPA 2J3QA 2ECFA 3B3QA 4C6HA 4WJLA 3DJYA 3O4JA 2XDWA 1YAJA 4FTWA 5ALKA 5A7HA 5DNWA 3WQHA 3AZPA 1E5TA 2X8BA 1XRNA 2H1IA 5D3KA 4LHEA 1ZICA 3KWFA 1TCBA 2ROQA 4FWBA 4ARAA 2FJPA 4P93A 2D0DA 4Y2JA 4RPCA 4G4GA 3HLKA 4AN0A 3I1YA 3STWA 3O9MA 5J3JA 5K3FB 4J0GA 3I2JA 4QLOA 3G9UA 3RKSA 3D5EA 4UBOA 4MJ3A 1CEXA 1YS1X 1A7UA 3IULA 4AZ0A 2OAGA 4DIUA 5E4JA 4DM7A 1K5PA 2HA7A 4QDZA 5LLSA 3W06A 1CUYA 1EH5A 1ZIXA 1FSSA 2CUTA 2VSQA 2X76A 3I6MA 4MEBA 1EDEA 4A16A 4BP9A 2PU5A 2DHDA 1MO2A 1P0PA 1WM1A 2G63A 3AZQA 1DX4A 3NWOA 2WG0A 5IVKA 4ZWNA 5ALZA 4KJXA 3WKBA 1O6FA 3WWEA 3BF7A 2BFNA 2WJ4A 5ALPA 3A70A 3FYTA 2WIDA 3STXA 3WKDA 1UK9A 2AJLI 3OOSA 4J0KA 4W1PA 5KWJA 3GA7A 5FDFA 4K2AA 4DMHA 4PSDA 4G4JA 2QT9A 5CT4A 1THTA 2QJRA 2HRRA 5FP0A 5HFNA 1QTRA 2C5GA 2G4LA 1JU4A 1BEZA 3U1TA 5HF9A 1WCYA 3D0KA 2CMFA 4UBKA 5CBKA 3DNMA 4XIIA 2VATA 2WUEA 4CG2A 1Q83A 1EINA 3H1BA 2WUFA 3WIBA 2XE4A 1YS2X 1LNSA 5BWBA 1CUEA 4OU5A 3NGMA 2XMSA 1CUXA 4BC0A 1BU8A 5CMLA 1BS9A 2WIKA 4U2FA 2VJBA 1SOMA 3GFFA 4X6XA 4INZA 3G8YA 1UOOA 2RONA 1AQLA 4J03A 4FDMA 5ALRA 1GKKA 1W4LA 2VJAA 1XZGA 1VA4A 3EQ7A 5LZ7A 2ZYIA 1QIDA 3C45A 5AI9A 2Q0XA 3G0CA 3KSRA 1BN6A 4C89A 4CFSA 4ITVA 5AM0A 2J4FA 2WIJA 3H2IA 2QJWA 4IH9A 1VKHA 3ILSA 1E8MA 3ANTA 3H2GA 4QA9A 4NMWA 3QMWA 4B9AA 3WK4A 2CJPA 4EY6A 2QTBA 3E4DA 2OQVA 3ZLVA 5ISMA 1F8UA 5BV7A 4U2EA 1TK3A 5CXXA 5ALIA 2HA4A 1CUWA 4UHEA 3AUKA 3GUUA 5HF8A 4G8BA 3A2NA 3HYSA 3X3HA 5ALVA 2B20A 3D59A 5LZ2A 2C0PA 2XQKA 3GBSA 1DWQA 3ANSA 4MYDA 1VE7A 2I3ZA 3P2MA 3STTA 2HA0A 5AM2A 1J2EA 4OCZA 2PU7A 1DINA 2XI4A 3D2BA 1CLEA 2HADA 4Q05A 3BDIA 3W04A 4Y2TA 5SYNA 1JI3A 1MX1A 1WB5A 1BRTA 4WCVA 4G8DA 5CT8A 3SX4A 4EUSA 3WKCA 4ETWA 1YA8A 2BGNA 1NU8A 4E14A 4Y2SA 4H18A 1C4XA 3OURA 1ZGCA 4BRSA 2BCEA 1R9MA 3HJUA 5FXMA 2CBGA 2GBIA 5LZ5A 1XFDA 3OM8A 5AKXA 4W63A 1GQSA 1LGYA 1ORVA 3FCYA 4FBLA 1Y7IA 4N8DA 1D07A 1ZD5A 2QOEA 2XUFA 3R3WA 3ICVA 3V1NA 2C7BA 1H2ZA 2BUAA 3CXUA 4B85A 4B0OA 5E4TA 4BVKA 1HPLA 4XX1A 5ALOA 4QDXA 3I6ZA 4HRXA 2WFMA 5FOQA 3ZLUA 4L9AA 4DNQA 1JFRA 2G5TA 1CVLA 3ICWA 4AO7A 1M33A 1XZHA 4E15A 1BN7A 1T2NA 2GZRA 3E3AA 3H2JA 3STYA 3R40A 1GPKA 4F0JA 3MGAA 2GBCA 4FFVA 4BRZA 5LYYA 4CI9A 3PFCA 3G0BA 2HIHA 3EQ9A 3G02A 4C88A 3SK0A 4G4IA 2V96A 1R88A 4KEAA 1EB9A 2GZSA 5A71A 6YASA 3WK5A 1HLGA 5ALEA 4P92A 3FNBA 1ODSA 2HM7A 4OB7A 2UZ0A 1THGA 2PKYX 5ALGA 4WFJA 2WM2A 1GPNA 3BL8A 4HS9A 3F98A 5AOCA 4X92A 3WJ1A 4H77A 4EZIA 3QVMA 2O7VA 3QM1A 4MWSA 3C8DA 2JGMA 4Q3KA 4MYSA 4BAGA 2H7CA 3BDVA 1QO7A 2XUOA 1CUDA 3FYUA 2PSEA 4PSUA 3WA7A 1WHTA 1WPXA 5HK9A 1VJ5A 1UK6A 1J06A 2IITA 1AC5A 4XJVA 4OSEA 4PO3X 5AOBA 5LP1A 5AO9A 4YK7A 5AHXA 3O0DA 3I2GA 4C4XA 2WILA 1UKCA 4BAZA 1N5MA 2YASA 4P08A 5AKJA 1U4NA 5AI6A 5HKBA 3A6ZA 1JJBA 1IZ8A 4YASA 4OYLA 5IVHA 4W1SA 1L7QA 1YASA 4N8SA 3WYDA 3I2IA 4LXIA 1LPMA 3WL7A 4XVCA 1CRLA 2XQJA 2HA2A 4ZREA 3ED1A 1UXOA 4QEKA 3ZWQA 4QDUA 1W52X 4BVJA 3H2KA 4PNZA 3WWCA 1UKAA 1W76A 4LYEA 4QLAA 3F67A 4RNCA 4CG1A 1KEZA 1GGVA 4AO8A 3VVMA 1SCIA 3FAKA 5JD6A 1HL7A 1CUGA 4HXGA 5AM4A 4W1QA 1XQYA 4X00A 5EIAA 4OYYA 5JADA 1DT3A 2XUJA 1F0PA 5LKAA 4G9EA 3SWWA 2W6CX 3RLIA 1W75A 4BE9A 3HZOA 3CCCA 4UHDA 3BJRA 3E1GA 4B83A 1XRPA 4H35A 2R8BA 1EK1A 2XUHA 3FVTA 4Y2UA 2Z8ZA 1WB4A 5BWCA 1ISPA 4J3JA 3MUOA 4J0CA 4ZI5A 4UHFA 1GZ7A 4WFKA 1OILA 2WUDA 1MPXA 2QUAA 5FV4A 5EHNA 3W9UA 1MAAA 1ZI8A 1EDDA 2C4HA 5HCUA 2CKMA 3RK4A 1IVYA 2Z8XA 3QPDA 1MT3A 1YA4A 1QIEA 2OG1A 2VTVA 3DDUA 1P0MA 5ALMA 4B80A 1UZAA 4ZXFA 3WL8A 1DTEA 1IUPA 2VAXA 2Y2VA 4IHAA 1EA5A 1G42A 1AMNA 3BIXA 3R41A 3IA2A 5K3BA 1AGYA 4C01A 1ZIYA 1JJIA 3NOXA 3DOIA 4NZZA 2ORYA 4L72A 1GPLA 1H22A 3LCRA 5T4EA 5IH7A 5I9IA 3C6YA 1AZWA 3ESCA 1XKTA 4FMPA 1B6GA 1EVEA 4J0HA 3LIIA 5JARA 5ALLA 3R3VA 4B84A 3N0TA 4TGLA 2OCGA 1C7IA 1E8DA 1ACLA 3DYVA 2WHPA 3UUEA 3IIIA 3DL4A 1H2WA 5DJ5A 2RHWA 3D3NA 2Z3WA 3V9AA 4QDTA 3EQ8A 3EIOA 4FLFA 2WU4A 4KRXA 1CV2A 2VJCA 5YASA 5ESRA 3VJMA 2WIGA 5DYYA 4F60A 2EDCA 3H04A 4UHCA 3O4GA 5ALHA 1EXWA 1X70A 1DWOA 1FFEA 3JW8A 1YB6A 3BF8A 1HBJA 4PV7A 5C8VA 1I6WA 3PUIA 3SC2A 2XQFA 3EF3A 3KWJA 3QMVA 4CG3A 4HVTA 4HAIA 4AXBA 1RWQA 1YSCA 3IUJA 3ESDA 4GW3A 2BKLA 1F0NA 1MJ5A 2QMQA 5JAUA 2C58A 1P0IA 1EVQA 3ESAA 3YASA 2OGZA 4IH4A 1E89A 4X6YA 1LPBB 2H7XA 3WK8A 3JYHA 4UPDA 5HFAA 4WDRA 5ALWA 1J1IA 4I3FA 3MVEA 3ZLTA 2QXTA 5HQ3A 3NUZA 2QKYA 1Z68A 1G5FA 1BROA 4BTLA 4A23A 1R4ZA 1GQRA 3STVA 1RP1A 1LPPA 4AMYA 4CIBA 4G1FA 1VLQA 2QR5A 3DLTA 2XMCA 3JWEA 3R3UA 2QRUA 1U65A 5CURA 3LS2A 1BEEA 5T4HA 3HRHA 1EB8A 5IVIA 3B12A 1EX9A 4DYHA 4QWMA 5CH5A 4BDTA 1CIJA 1CUIA 3RARA 4PF1A 2JGIA 3FYUB 4J0JA 3VJKA 5JATA 1Q0ZA 3DEAA 1CR6A 1U2EA 4UFNA 3WK6A 1PJAA 4A5SA 4B0PA 3IVMA 2AJDA 2PSJA 2LIPA 1N5RA 1XZKA 4DGQA 4K6GA 2XLCA 3IUMA 2XMZA 2ZYRA 3I6YA 3L1IA 3FLAA 4LXGA 3WA6A 2PL5A 4IH1A 1A8SA 1G4HA 1YAHA 5HKAA 4BVLA 1R3DA 2PUHA 3CN7A 4QWWA 1ZD2P 3G9TA 2QUBA 3VKFA 4GBGA 1E3QA 2VF2A 3QPAA 5CTAA 2V98A 3I28A 2ZSHA 1PV1A 5AKKA 5T4BA 5K3AA 5AP9A 3PE6A 4TPKA 3LIPA 3H18A 2WTMA 3L1HA 2VT7A 1JT2A 2HRQA 4X97A 5DNVA 2WFZA 3R0VA 3AZOA 4J0DA 4PW0A 4I19A 2JGJA 4MXDA 5AKEA 4BCBA 4DMCA 4JH0A 4EHBA 4UBLA 3TEJA 2WJ3A 2XUPA 2WLSA 3ESBA 2WKWA 3K9BA 1MNQA 5AKGA 2PX6A 2XMRA 2ZVDA 3G9XA 1OXMA 4DNFA 4DSAA 3B5EA 2VQ6A 3H2HA 3WL5A 3BXPA 1MX9A 3CN9A 1LPAB 4DMKA 1LPOA 4G8CA 4YPVA 3HI4A 1XKLA 4EY5A 5EI5A 2OCLA 1USWA 2H7YA 2I3DA 4BAUA 3HC7A 3M82A 5AICA 5EIEA 2YH2A 1WB6A 3VXKA 5EIHA 3S2ZA 5I7UA 2GYWA 4B81A 1BCSA 2BUCA 3CCBA 2Y6UA 3IB3A 2Z3ZA 3H1AA 4X95A 2WQZA 3IDAA 2QXUA 3I1IA 4AB1A 1AUOA 4B6GA 5AK5A 4Q1VA 1QIKA 4KACA 1EI9A 1AURA 2RHTA 3L1JA 4UBIA 2RAUA 4UBMA 2Y2UA 3WWOA 1LZLA 2ACKA 2JBWA 3PFBA 3DS8A 1ZI9A 1TCCA 3VVLA 5C8ZA 1ACJA 4QDOA 1XZIA 1XQVA 4F21A 4GLBA 4DLNA 1JJFA 1XZJA 3TRDA 1PFQA 1AX9A 4M0FA 1TAHA 1XRQA 1XRLA 1TRHA 4LIPD 4Y2PA 1O6GA 1CFJA 4E46A 1QE3A 3D2AA 4IO0A 1MNAA 4PSCA 5K3DA 2HDWA 5ALDA 2DFPA 4QZVA 1MTZA 1Y37A 2OCKA 4OUKX 4YX9A 3GZJA 4Y2RA 4CCYA 5EGNA 5CT6A 4OD0A 5AKHA 5CH8A 5HK8A 3O4IA 1LLFA 4Q34A 4X91A 3T4UA 2QM0A 3A2MA 3UMJA 3ZPXA 1K6EA 4X3CA 4W9RA 3IBTA 4FKBA 4GWLA 4GHWA 5FPQA 1DT5A 1HQDA 4W1RA 2WG1A 2W22A 4AQDA 5A62A 1AKNA 3PDCA 3E0XA 5IVDA 1CUBA 5JYCA 2ZJFA 4Q3LA 3WK9A 2B9VA 5A7GA 4KE6A 5ALQA 4M0MA 1EHYA 3KXPA 4KRYA 5LZ4A 2BUBA 1QONA 1QTIA 2JGKA 3F8SA 4KYVA 5HQ3B 3HABA 2HU8A 2R11A 3C6BA 3C5VA 1N1MA 1SCQA 2VT6A 1UK7A 3DKKA 2Z5GA 2JIDA 4E11A 3GELA 3KD2A 2WFLA 3V1KA 4N5HX 4X7BA 4EY8A 1HKHA 1C7JA 5AH0A 2OCIA
chains in the Genus database with same CATH superfamily
1COWD 5TB5A 4OHBA 4C22A 3F5SA 4ZC8A 2JNWA 4GMKA 5F4BA 3NWBA 2Q6LA 2XQGA 1LK7A 4O2LA 4P36A 5I9TA 5TQ2A 3ZHTA 4EHKA 4OUDA 5KREA 3PKJA 1JXMA 1P74A 1B23P 5IJZA 2X3YA 4KXMA 3B9PA 5A3QA 1DC5A 1TIBA 3OC6A 3T5DA 3WJ2A 3OFJA 1NASA 2YYSA 2P0AA 4OGLA 5FUWA 2P2ZA 1DBSA 1M2JA 1U1GA 1BVRA 2JGNA 3FGPA 1SHKA 3R0IA 3PNMA 1MO6A 4IIJB 3I6QA 4D3FA 1FDWA 3DHVA 3OA0A 3SJAA 1JJVA 2JGAA 3NC1C 4JL8A 4AL4A 1QFXA 5K5EA 1DQZA 4H7DA 2OPHA 5EZQA 3AXSA 4OX9B 1L4NA 1OXVA 2GVNA 1GGNA 2JZOA 1JKMA 2QM7A 4JI3B 3JQCA 5REQA 2AQ8A 4BGUA 1SHUX 3CKLA 4IS3A 4CEJB 1UZMA 3RTBA 3W0LB 1TEZA 1ISFA 2I4LA 1B6TA 4R51A 3ITEA 5E1DA 4GMGA 2VSXA 4L6CA 7ADHA 1YQQA 4TT8A 3VKHA 3KDPA 4PPQA 5KTNA 3LI2A 1SUCA 1TFUA 2JI7A 3MWEB 5AI0A 3AHEA 2M6SA 3DEKA 4V0SA 3S8YA 5K05A 3FB1A 2VHVA 4RDHA 3EDYA 3ZEAA 5AVRA 4XARA 2F00A 2WJPA 3EASA 4C0SA 1T0PA 1ZD4A 3PRJA 3DTVB 4RFSA 2BISA 1NSTA 2RGEA 1E1RA 2NQTA 4XFJA 3A3KA 4Z3OA 1O4WA 3DHYA 4WK2B 3F8TA 1MAWA 1ZJYA 3WNCA 1V7PC 4C7OA 4IGFA 4RDIA 4V0OA 4YT4A 1QP4A 4FD3A 5JMPA 2NOAA 4NZPA 2QPAA 2VDWB 4UAUA 1X2EA 4WY5A 1G8MA 2V58A 4PZLA 5C0OE 1FS6A 3HUTA 2QT1A 2WAAA 4TMYA 2DH5A 3Q3GE 4H3KB 1OI4A 3RJTA 3ZU6A 1HMPA 3Q8WA 2AXNA 2CNKA 2JCXA 1XLTC 1GCOA 1FDUA 2MIIA 3L7NA 5HBRA 1Z6YA 3V7YA 2DUNA 1AHNA 1LJ8A 3PEWA 5C37A 3PUZA 3SEQA 5C80A 4WTOA 2PYDA 3QVJA 1C14A 2H06A 1OJLA 3VVCA 3ZJ5A 1V35A 2QUKA 1GNVA 2XCUA 5GOZA 4HO1X 2EP7A 2Z0MA 4XVHA 5AW5A 1VYTA 3V48A 1ZM4A 1U0LA 2GEBA 2YZGA 4MWCA 5FAKA 5JASA 1W94A 2VA8A 4O8CA 2QL6A 4WKOA 1VKZA 5L6MB 4H7JA 2HLPA 4DJDC 1MBZA 4BZZA 1YR8A 4C4ZA 1FS4A 3BMOB 4Z2YA 2WMDA 5F5LA 2NZ8A 4O3MA 1Z5PA 1JPJA 3J81A 1AQJA 2GEFA 3T9FA 2C7PA 3CNOA 1JQ5A 2E6UX 2FW8A 1K86A 3INRA 2QSUA 2GYVA 3DOHA 1TCVA 2GR9A 4XJXA 3HVRA 4F9GA 1ZD1A 2MSCB 2C9DA 4MV1A 5K3EA 1VRWA 3OEYA 1LX7A 1RQ2A 2CSXA 1ND6A 2J46A 3T3GA 2Z3VA 3F5DA 4UHBA 1J2JA 1H2XA 3INTA 1CRQA 3OIGA 4KE9A 3K32A 2O0KA 4E12A 2PX8A 1X7DA 2WEKA 1NF8A 3RSLA 2VSOA 1JEDA 4MUMA 1DUIA 1OV6A 2IY8A 1V48A 4PQYA 2B21A 3K70D 1CDOA 3EE6A 3GEEA 4PVDA 1MUUA 1Q1ZA 1XYYA 2ZUBA 4XGRA 4XGQA 3TQIA 3G3EA 5BNWA 2PUFA 4DDHA 3U5TA 2AWOA 2XDQB 1W36B 3QBEA 4REQB 5LKRA 4YXWA 3IDFA 2I5PO 5MFPA 3EW9A 3TSCA 3U26A 4DZZA 4ZRDA 4JC4A 5AW3A 3QEBZ 2EF1A 5T6MA 4EFDA 2DHEA 3ANYB 1G41A 5F73A 4D3ZA 1ZGGA 1PZXA 4BNJA 2Q46A 4TS1A 3VO9A 4Y6LA 3FFXA 4N3AA 3CNLA 4JYMA 3ET5A 4OO3A 4DCPA 2Q6OA 1E4EB 3RF6A 4Q1AA 5DI3B 2PCJA 1W4CA 5BWNA 2NXNA 4NE9A 4YQZA 5ENDA 1IHDA 2FW9A 3B7WA 4LDNA 2Q8NA 4ACBA 1QG4A 1TQ4A 1YE5A 2FMUA 2ZVPX 1E1CB 2H4XA 4IVRA 3SKVA 2NNLD 1WXQA 1U11A 2B8TA 3N2GA 2FQQA 4XWKA 3P2JA 2FZ5A 5BRJA 1WE2A 2J0UA 4ALJA 4I50B 3BB3A 4UE3S 3GGDA 2X9LA 1D3AA 1I8TA 2ZPUA 3QEMA 1M2GA 4KXFB 2D5CA 1A7JA 1EXVA 1SCKA 3OZFA 4LK3A 3HY4A 3CA8A 5D5HA 3S7ZA 3WI7A 3U7HB 1H6DA 3COPA 3KXLA 1K7FB 4N7RA 2NU7B 4FT2A 3WIOA 2G7ZA 2PEZA 3GJRA 3M7IA 2OGTA 2QX8A 4O5OA 4IEFB 4H3SA 3ZU4A 2FTKE 1I4TD 1XTPA 2HJVA 2GN9A 1KO1A 4DE5A 2QQFA 3N7TA 2IT1A 2OVFA 5CTJA 3FFBA 3P97A 3AWIA 4H4CA 1SIOA 4QBIA 4UNIA 2PV7A 5CFZA 3M2TA 5TVGA 3DQZA 2FNAA 3N58A 3U9LA 4JI0B 3TZLA 1B93A 5FEUA 2IK8A 4HRYA 1QZ3A 2ATCA 3PL1A 3GEHA 2R7AA 3I0NA 1Z22A 3FRIA 3Q7PA 3DR5A 5EPUA 4DLXA 1A8IA 4H7EA 1V2GA 4Z3DA 5JY1A 2CL0X 1UWLA 3IIEA 2IZ1A 4HWOA 4MK4A 3NBUA 4EO4A 1R4NB 1Z8DA 2IE0A 3HSSA 3I5XA 1FS5A 3EXIB 4RULA 3T1QA 2MYNA 1VZ3A 2IYYA 4FCWA 1N7IA 1PZHA 5K8LA 3U80A 3OMLA 2RC5A 3G89A 1ES9A 3V6LA 3WB1A 4P9NA 2FHPA 1CQZA 2VJPA 2C77A 2XLBA 4MQEB 4W6ZA 1RXVA 2SKDA 1Z12A 3C3BA 3GVHA 3V8QA 1HF3A 3JQ7A 4CNQA 1KR2A 3BWXA 3W7VA 3SVTA 1EQAA 3AESB 1N6PA 2QVCA 3EG9B 4GNRA 5EHZA 4AKGA 1PJTA 3JQAA 4KRGA 4LTNA 5EJ9A 2F1KA 3KQNA 2QYTA 5ICMA 4KO1S 4D9BA 3I01M 3HKDA 2W6ZA 4NCNA 4QUJA 1GEEA 3VTFA 4PO3X 4FEGA 1A2QA 3NCHA 2P2LA 1QGUA 4GP6A 1FYXA 3VR2A 4TXLA 5I48A 1N6KA 1AE1A 3DZIA 3ZHXA 3S2EA 3RRFA 2WG2A 3FWHA 1XZEA 4GO1A 3VSAA 2QMOA 3HU1A 4BJ3A 2NADA 3OHSX 1FYEA 4HWKA 4XZ3A 2ATVA 2WYUA 5E7IA 2XCSB 1ZH4A 5KVCA 3EPJA 3UGTA 4YRDA 4CKWA 1XKXA 5L6LB 2ORVA 2ODWA 4EB3A 3R4VA 4ZI7F 3VYRB 1FYDA 2Y92A 3QMMA 5DHUA 1F20A 1VYHA 5DM0A 2AZXA 3COYA 1V6AA 3H3XA 4D41A 1JPNA 3O0TA 4ZCRA 3OO1A 3RSGA 4IXDA 1Z73A 1SK8A 4WZZA 1NLZA 1N7GA 2F6RA 3ZE1B 1EFCA 3PKZA 4MRMA 3QU5A 3UATA 4CM7A 2E89A 3GRKA 4XI9A 3DAHA 3EX7C 5CJJA 1IRIA 3LHSA 5L3QB 3EQ2A 1NKSA 3ASYA 4GOMD 5B1HA 5JAPA 4ZTZB 4QEDA 1QMGA 1I2CA 3TSWA 3V7FA 3W1WA 2ZPTX 3D02A 3WIDA 4BV3A 2O2CA 1K7XB 4QVGA 3K71B 4BNFA 4FIZA 3REOA 2NIPA 4JQCA 1VLZA 3BL6A 3AILA 2OZLB 2VBGA 3N2KB 4A2PA 1WP4A 2GZ1A 3FPCA 1TQHA 1JHMA 4WOPA 4M9UA 2A9KA 2Q2NA 2PO5A 4O63O 4X62B 1MC8A 1ZS9A 2I99A 4FFSA 5IBQA 3ZWDA 1FFCA 1QE5A 3MG9A 3C85A 2DY1A 3RUIA 2I4OA 3TMAA 3DOEA 4WY8A 1CLUA 5JSYA 4HFRA 2PMKA 5KINB 3QPBA 5H9VA 4BBZA 1M73E 1P0QA 1YWGO 3I0MA 1DRVA 2RHOA 2CT8A 3DQPA 1QOZA 4IV8A 1EFRD 1FVXA 1EMDA 4KI0A 1DJMA 3G2HA 3A4YA 5AIBA 5FX2A 4L0CA 1T13A 1KS2A 5E3IA 4PIVA 5EQFA 2JAPA 3FYUC 4XJTA 2PDAA 1U0SY 3W5UA 3OE4A 1QZTA 1KYXA 2VAVA 3IJPA 4B3IA 1VZ2A 3V32A 4RH0A 3SZLA 4MCJA 3AF2A 4QU0A 1I24A 4OOEA 3LCCA 3WLRA 1JJ7A 4H0FA 1OWNA 4FHFA 2W7TA 2IBSA 1FFBA 2DJIA 3RSHA 2BEUB 2GAAA 2RIPA 4I2NA 1KJJA 2X5JO 5HR5A 5JUWA 1TEVA 3AF5A 1GFZA 1UBLS 4LECA 4TMTA 5EAIA 5K09A 4IXWA 2WWTA 3IV7A 5MN4A 4IEIA 1VJTA 5AI4A 3GROA 5ALTA 1SU4A 3M4XA 3CF0A 1PJSA 3R7SA 4NE7A 1Y3AA 1L4YA 2VNJA 4GBED 2XBUA 3A9WA 2OKCA 4B4KA 3PC8C 2AQKA 3BGWA 5IBRA 3X1JA 3O73A 3FWKA 2WFLB 2FFJA 3O7WA 3A32A 2W90A 3ZV4A 3ZI4A 1GKYA 2ODPA 1B0ZA 3DR3A 4XTCS 4EY7A 4EL5A 2VDVE 2GJAA 1XZFA 3C15C 4K40A 4Y2XA 5CT5A 1I13A 5FB3A 5TT1A 1P1BA 1Y9EA 2NAFA 5IVPA 4ROSA 4ARIA 2IOFA 4MW9A 1QF9A 2Q3HA 4DARA 5FRDA 1K9VF 4MR8B 1TADA 3IRUA 2I22A 3WDKA 1QHNA 1TZBA 1L4KA 2R86A 3FBWA 4F6LA 2XNHA 4CTMA 3VZQA 4KNWA 4XPZA 5KNDD 2UZIR 1UMDA 3H4IA 3KAKA 4GI1A 3JYQA 2OENG 4DZTA 2HMVA 1RFLA 3CTPA 4Y2YA 4M86A 2Y76A 1LZKA 4QUDA 4V1CA 3KVRA 2RGNC 1OYOA 1QCCA 1L5SA 2O23A 5A2GA 2GOYA 2HL6A 3TQFA 2ES4A 2B6NA 5IAEA 5DBFA 1XTSA 2GO7A 3JQGA 1HTBA 5ALXA 4QOJA 3QE2A 4PYKA 4L8WB 2WUVA 1HDXA 2WV7A 3VKGA 3N9IA 3I2KA 1SZCA 2II6A 1NC1A 1MFZA 1P1IA 5DTQA 5B2ZA 5CD9A 1T36B 1D7AA 5JWOA 4P3XA 4INAA 1CK4A 3KCNA 4I6EA 4BVHA 1SIWA 4B2IA 3LL4A 2NZJA 3ML1A 1DKPA 1YACA 3LP5A 2CF6A 4Q16A 4K3VA 3ROXA 1A0OA 1JFVA 1PW7A 2FN3A 4R40A 4Q9DA 4EG8A 1QDEA 1KPHA 5BSFA 5AXCA 3FH0A 4MCAA 4MUYA 4PRYA 4Q1FA 2XNDA 2ZU6A 4KXLA 1Q0LA 3KR2A 2VVTA 4M0EA 3VKWA 3VZRA 5E3HA 4DNOA 1ZM2A 1FJHA 3B85A 2F4NA 4MW1A 4YONB 2Z8YA 3RFFA 3MRSA 2ZTSA 2EYUA 2O8CA 5F7JA 1ZUIA 4B6OA 1IIBA 4KITB 2X58A 2V7VA 4RK6A 4JUAA 4K9KA 1YS4A 4UUQA 4DC0A 1P5JA 1R0LA 3DV0A 1FFYA 1A76A 2VPIA 2AB0A 4A2CA 1JU3A 2ZIGA 4IMPA 4D9NA 5BV1A 1NG9A 2HF8A 3EUAA 4K6HA 4UHJA 1P4RA 4AJIA 4YRAA 2ZJ0A 1ZL2A 1XTBA 1FDTA 3DDNA 1NY6A 1XDGA 4GX5A 2IZ0A 3Q2IA 2GPJA 1M2NA 5GM2A 1EEXB 2VSYA 4HGNA 5EFZA 5JBIA 4PYIA 4X90A 2JATA 3KJNA 1XZQA 3BH7A 4GZMA 2IKSA 1AF7A 3GFSA 2QX7A 3H5IA 3T3NA 2CGEA 4QJ5A 1L5HA 3DWEX 3ZVNA 4LJYA 1GNRA 3K4PA 4M2LA 4KSCA 2R47A 3H9EO 3W2EA 3RNLA 2P7HA 4CEIB 3VNVA 3SNHA 1H0HA 4UE6A 1JLHA 1CP3A 5CITA 1S96A 1GRNA 4P4UA 3NR2A 1UXGA 1SPXA 4TTSA 1A8PA 2TS1A 2O2IA 2QMZA 2ZT6A 4DKXA 1VXOA 4LQ4A 3U4CA 5FJJA 2V7WA 3PIIA 1E7SA 5JD4A 1MO5A 1DG9A 1PFUA 1Z0IA 2GXUA 3TOXA 2HK6A 4XUDA 3IPYA 1ZAYA 3DM5A 4WKPA 4BFYA 3VGPA 1GZUA 3I1FA 1S8FA 2W4QA 4X93A 1E9SA 5CIWA 4GMDA 3QMPA 1MIOA 2GKGA 1G8AA 3THWA 3PNQA 2ZRLA 3CLKA 3L7BA 4TRMA 1CY0A 1YGYA 4OFBA 1SB9A 3DBHB 4J49A 4E88A 4YAIA 3G8AA 1UEIA 2FOXA 3QGMA 4HXEB 1QYVA 4JLDA 3LBFA 2ZI9A 2CUKA 1WW3A 1QR2A 2NZWA 3VZPA 4M37A 1OU4A 3UXHA 2JEYA 5LZ9A 4KHPB 3W5VA 3C7CB 3O94A 1L0BA 3I04M 4HDRB 4TZTA 2ZYSA 3JRNA 2O6HA 2QN7A 1CJCA 1Q17A 3PHHA 4G5FA 4CLEA 4FSHA 4NPHA 1G18A 3S27A 5BWLA 2JGFA 2WU1A 3PI7A 4KWTA 4XGKA 3GJZA 4RZUA 4PCAA 3CRNA 1XXHE 3CFYA 2CXQA 1A97A 3B6IA 4D5GA 4I4TB 8AT1A 1K4YA 3F97A 4RTRA 1IN8A 1CZRA 2A0XA 3PE4A 1CE8B 5CVEA 1N8NA 4ZOCA 5ANRB 3PHIA 4HZUB 4KQKA 1OKKD 1KZYC 3GN1A 4IQ4A 1G0NA 3RIGA 5JSZB 1SC4A 1IRXA 4N0PA 4OB6A 4UEJA 2EV9A 5B1SA 5JJ5A 3W5HA 3FYCA 2G76A 1OGYA 1SCNE 5D6OA 4GD3Q 5F1PA 2CMGA 3UFXA 5B2EA 3AVXA 3EGOA 3OICA 1LQTA 4MYUA 2MYUA 4NMXB 4XB6B 2WNIA 4BGVA 1U8EA 1SC9A 4WKCA 1KZ9A 1ZNQO 1QYIA 4LSGA 2QGFA 1W34A 3VPGA 1Y8QA 2CMKA 4I9FA 3L7DA 3QUTA 4X8HA 1K8ZB 2WRZA 5I9BA 2W8BA 3SE7A 4K87A 3NHWA 4MKFA 1V43A 2B25A 3THSA 3ED5A 5KTKA 2DJ5A 3P9ZA 1Y4UA 3D2CA 3SSOA 2ZWAA 2B98A 3GMSA 5FNVA 4GR4A 4KUEA 3H11A 5ES3A 5T4FA 2G70A 1DRWA 3GVIA 3U31A 1SG9A 1L5NA 2NM0A 2BSQA 3KPVA 4U2DA 4EIWA 1DSSG 3OU7A 5I9SA 5FOUA 3ZHOA 3AH8A 4HY3A 1QS0B 3MC1A 3IPLA 2P2CA 1JTEA 1OLSA 4RGQA 4U2BA 1CYEA 2XAUA 1T8UA 1HT3A 4NH4A 1V26A 2GCGA 2HA5A 1SC3A 4GKBA 3VDQA 4M0CA 4QG3A 1XCGB 3AC0A 4S1WA 3EXEB 1D5WA 4CT4B 4L0DA 4OKIA 1WXIA 2H4FA 4ZAVA 3AQIA 1FFDA 4ENQA 4YCSA 3FG9A 1L7RA 2O1WA 5DHPA 1RQNA 1RXIA 3T9CA 3OUTA 3GAMA 4A3SA 2H48A 5FLXA 3OPMA 4GMHA 3EPRA 4KTTE 3SGLA 4FC6A 5LC1A 3UGQA 1YK0A 1NAHA 2C5LA 3L46A 5JQGB 5ED4A 1JLMA 2JJYA 2OFWA 4C4YA 1TYEB 3C3JA 1IZ7A 4QAQA 4Q00A 4C78A 3RVPA 5BQ5A 4EPYA 2OBMA 4HDSA 5E1BA 3T7SA 5DN6D 3QH4A 4IS2A 2D0IA 2DQYA 3WGIA 3UW3A 3ZE0B 1G21B 4K46A 2ZXEA 3LD9A 2E9SA 4MLCA 5KI6A 3ZNOA 4RCYA 1HDIA 2A3RA 4OAPA 2BMJA 4B4VA 2W0SA 1QGAA 3C5WP 4DJAA 4MQUA 4JNCA 1D09A 1PJBA 2C4MA 4AO6A 4BECA 4TS3A 5D86A 4DCJA 1RRPA 1CB7A 4FFLA 2NZUG 4R31A 3ZU2A 2XCRB 4KNVA 1V1JA 4DTIA 1XA3A 4DDWA 2QHXA 5BWMA 4FLMA 4TZ0A 3A7DA 2RGUA 3MT8A 4PX5A 2FEMA 2DE0X 1VFPA 4YJFB 1SBCA 4BBPA 5JY6A 4WA8A 2ODQA 4IAOA 1XF9A 3EFOB 1FUIA 4LV5B 3IAUA 1CUAA 2BKUA 1EFUA 2QS9A 1UXIA 2CL5A 4OK6A 1DTSA 2BM9A 1V8FA 2I3AA 3A6GA 3RUEA 2BV3A 1WMFA 2X1LA 5DGDA 2XVAA 1RXCA 1O9HA 4IDQA 1HLFA 3RRYA 1QPGA 3ZWVA 4BXOA 1FSGA 3NTOA 4M8LA 2NVBA 2F2TA 4I81A 4TL7A 4YR9A 4WLVA 1O58A 1T29A 5A02A 2ZBRA 1M1ZA 2H9YA 3CNEA 1WPRA 2D2XA 1VDZA 2VP9A 4ZVLA 4RA6A 4ENSA 1XTIA 2SBTA 2Z57A 2NYVA 4HPXB 5DTJA 5FFFA 2PPVA 4RLFA 2ONJA 3IL2A 4IG9A 5LN1A 3PEUA 2GTIA 4TWJA 1G7TA 4URHA 1T9DA 2VWPA 2OCAA 2Q5OA 3F3YA 3KT3A 3FJYA 3QUAA 4P7KA 5TPZA 3HXKA 5LNK6 1T6XA 4ONEA 3TX6A 4BO8A 5JDCA 5BYJA 3NXSA 2FR8A 5I45A 5TSDA 2PPLA 2ALJA 5DM1A 4I0WB 1M5RA 1ML3A 3OQ6A 1QVZA 4YP7A 1H66A 3OT4A 4LE2A 2XUGA 1UDCA 4MP8A 3FSEA 3RT7A 5JT1A 1Y6GA 5KDLA 2KLHA 5IJAA 1ZVVA 1SU7A 1C3VA 5CW1A 2QVZX 1DKOA 1LS1A 1HDYA 3FNHA 2DHCA 4KCGA 2O20A 4NATA 3RIXA 3DDOA 3RVOA 4FOLA 1N6RA 2YCBA 4Z4EA 1EU1A 4KPFC 5KYNA 3AUFA 2HHCA 2EFEB 2YY5A 4R9NA 4UEQA 4HQFA 3MOIA 3LO8A 3OQNA 1YL5A 1CR1A 2W6MA 4MRPA 1QHYA 4PEVA 3WYNA 4DJTA 2WU3A 3ABQB 2R84A 4Q82A 3KBOA 3LBHA 2JD0A 1KFEB 1VE6A 4JJKA 4XSVA 4L74A 2BGKA 4A5OA 3W5JA 1M0SA 4A26A 3B3GA 3EN0A 1JSCA 5D5QA 5IC6A 1EIZA 1ZM3A 2R6GA 4M60A 5JAOA 1W0KD 1UAYA 3ESZA 1ZJWA 5JZ9A 3L1VA 1SOWA 3L6DA 4HPWA 4BQNA 3LNCA 1M8GA 2IWRA 5F7OA 3QW2A 5DGIA 1ADYA 3KOWA 1RBMA 1TKCA 5EEGA 4F3KA 4CMKA 5I3ZA 5CYOA 3PC3A 3SQXA 2H2DA 4WN3A 1AU9A 2H0AA 3NKLA 3P20A 3ROPA 5JALA 4ZV7A 1AK9A 3ZX5A 4Z4GA 3DEZA 4HAYA 4Q1DA 5CVVA 4U7TB 1HRKA 4KBFA 2CUZA 1JXQA 3TVTA 2BEJA 3S99A 4TV8A 1FDRA 1CD5A 3QQPA 2PZEA 4YAKA 3L4SO 2ZWIA 4Z7OB 4YCCA 1M76A 2JF0A 3OHPA 4UBNA 1JYEA 1RRMA 4X84A 3TQRA 1Y7HA 5E6RB 2G67A 4NBTA 4NCJA 1T9GR 2IYFA 4EW2A 4PLCA 2EHJA 1F17A 2UXCB 3L3BA 4EFKA 4PRZA 3WL5A 5EMJA 4AJEA 5I7AA 1BOOA 2RGWA 3IH5A 3UUFA 1E2UA 1U99A 3HCFA 2F3TA 3N87A 3LGSA 4NPCA 2WMOB 4HQKA 1UMCA 3QWIA 5KYYA 5BN1A 1EWRA 2OHGA 2ORWA 2JFNA 2GB4A 1YQUA 5DBGA 2VRNA 2IY7A 3L8MA 1X19A 1Y42X 4G24A 3I39X 1PE0A 5AW8A 3R0ZA 3KQQA 5DYTA 5DNCA 1TM1E 1TU0A 2QK4A 1GHTA 2Y9PB 3OCZA 4KQWA 1NPTO 1JT9A 1QP8A 3DCYA 4MA4A 5KHLB 2VK1A 4M0LA 4ZO7A 1NNLA 3EEOA 1WUKS 4NXNB 2HN9A 3QE3A 2VPXA 3M81A 1JQLB 4LX8A 4YGYA 2JAHA 2ADOA 3OEHD 1IZ9A 1DFHA 4N12A 5A0VA 5HIIA 3O5AA 2FPIB 2QAGA 4U7GA 2DH6A 3HV2A 1BMTA 4GPZA 4YQEA 2ZSIA 2G07A 2QX9A 1WW2A 3OZSA 1PN3A 4X20B 1CUHA 2QWXA 4LG1A 4GZ3A 2MT9A 2AUMA 1OXBB 3FTEA 3TKLA 3HU3A 1PYDA 2NU6A 2H51A 4BZQA 4PSVA 3G0IA 4JVMA 4Q4JB 5SYMA 3ZK9A 1UFQA 1JAXA 4H7IA 1W59A 1YC2A 2DT5A 2FGKA 2H1CA 3QOYA 4X71A 3RO7A 1CR0A 3QLUA 4DR7B 5DYWA 4DXDA 2ZIAA 4EHJA 2GF0A 1R00A 4DSUA 1OWMA 4JDUA 5IYZF 3DL7A 1E6LA 2Y9MB 1NT2A 1T8TA 2WHRA 3T5GA 4DPMA 1JLRA 3T1OA 3MFYA 3QW4B 3OU2A 2JEOA 3ROGA 4CQNA 5J9FA 3PCRB 4LI0A 5CNIA 2WOOA 3B1KA 1KNQA 4B7ZA 2UYQA 3ZH2A 1Y7LA 4R2WA 1MOQA 1K3TA 4WJLA 4JDPA 1LDMA 3FOWA 4P0TA 5K6RA 5HIJA 4CMHA 1LWOA 4C9BA 2ZXUA 3UW1A 1MB3A 5DGCA 4IJKA 4I4NA 1YB4A 1P3DA 2BFEA 1V95A 3FX2A 3OHMA 4N7MA 2ZM5A 5DNWA 4Q24A 4HUQA 4AS2A 5A0TA 2OQ2A 1S7GA 2PWYA 4J7UA 3B2EA 3TYXA 1L8OA 2ZYUX 4CKEB 1E5TA 2YOHA 4D81A 4EW6A 5L3VA 4EG6A 1TO1E 3ONDA 2VP5A 4PGHA 2XRYA 2I6XA 4XIYA 1T0IA 2H1IA 4B34A 4QQFA 1R74A 1WXEA 4V38A 3TL3A 7MHTA 2NMVA 4MPTA 4LHEA 3ZHBA 2RI0A 4NS1A 4ARAA 2GCOB 2ROQA 2FJPA 4KU4A 2QJFA 4O02B 2D0DA 3CRVA 4P93A 4UULA 2FP4A 1E0DA 2ZYVX 1OYVA 1QU2A 2YC4C 4DN6A 4QREA 3RKRA 3Q5GA 2LIVA 2V7GA 5HILA 2I2CA 4YTEA 2ID7A 4MUFA 5CDGA 1JB1A 3IMEA 4EPWA 3HLKA 2XZDA 3I1YA 4IDHA 4ZVKA 2Q41A 5DU2A 1ZA1A 3WVNA 3STWA 3ZWYA 4BHTA 2B99A 3O9MA 1WBDA 4KV7A 3F6CA 1V9CA 1B00A 3P2KA 3G2OA 5BWOA 3I52A 4A0RA 1V1RA 4KN6A 1P77A 3RKSA 4F86A 5KSWB 1SC6A 3KUXA 3LW8A 1J9ZA 4UBOA 4ZCMA 4MJ3A 1Q0TA 1CVRA 1G55A 1A7UA 4HI0E 1X1BA 3I9FA 1DC7A 1KETA 1Y89A 3EVDA 3ZKAA 4AZ0A 3FW1A 4NV1A 1XD9A 1B8PA 3OSZA 1DC3A 2JS7A 3KUCA 3LO5A 4IOKA 4LXXA 1TVEA 4JQOA 5J59A 3H13A 5J5AA 3K5IA 4CQMA 1K66A 1K68A 1L1QA 3PC2A 1YRYE 2REBA 2C92A 1U9ZA 1DDOA 3L05A 4JUBA 4NQRA 3S3TA 2VCYA 3H9GA 2BTQA 3OOWA 4HYQA 3GRCA 4B6SA 1Z4PX 2CUTA 1QFJA 1L4BA 2R4QA 2WWIA 2VSQA 2ZU0C 3MGKA 3I6MA 2VH1A 3HYLA 4YBRA 1YOVA 1Z25A 1TJ4A 2BDUA 2OQRA 2W6OA 4J4TA 1YR9A 1U5BB 4MVJA 3H05A 2Q8QA 5K8IA 3IRVA 1TO6A 4P86A 3GP3A 4C29A 5HUHA 1I51A 5ICCA 2DWQA 1DX4A 3PRYA 1PEKE 4DT1B 4NEQA 5LFAA 4D4JA 3IILA 3TQSA 1JHQA 2IBTA 1GYPA 4ZOBA 1P4HA 2IXDA 5FWNA 2EW1A 4G37A 3HK2A 3ABZA 4TTJA 1AQUA 4HLQB 4OMDA 3W1EA 1O6FA 5C5EA 3BF7A 3I72A 4QASA 1ZK1A 2OCPA 3H9UA 4U02A 4F84A 1NHWA 1YVUA 2RHGB 5JFGA 5ALPA 4Q3NA 3AT1A 3RJ5A 2O0MA 3KQHA 1CS4C 3IODA 4QX6A 3QV1A 2LRHA 5DNEA 4ZO9A 3AEQA 2FWJA 3DJFA 4IDCA 1KI8A 3BTSA 1IHUA 5FFNA 2ZRMA 1KHHA 4ZC1A 3UJCA 3WQRA 1MW9X 3K0CC 3H9CA 5EZYB 1KVQA 4QT4A 4ZCIA 5COAA 4DDMA 4LVOA 4CM8B 1IAVA 3HB9A 1O5OA 1ISMA 2B83A 3GHHA 4GQBA 4I55A 2E4WA 2QT9A 4YP0A 1KJQA 2H9IA 2M9MA 1O94C 5JSKA 2X9QA 5F23A 3V97A 3QBDA 4UAVA 3Q6IA 4YRKA 3GDGA 1XL0A 1SB8A 5G40A 2XBMA 1SBQA 1NUUA 3MT7A 4JC0A 2SNIE 4JXJA 2C5GA 1PT6A 3SM3A 1BEZA 4LF4B 1N36B 1UPCA 2JIPA 3C5HA 4O25A 5C1IA 1JWBB 3DTYA 1WCYA 1I94B 3KJHA 4JXKA 5BURA 2FN7A 1ZL0A 4CLHA 1FRFS 1XO1A 1R0XA 1RM0A 3QHQA 3V2UA 3ZBTA 4EI9A 1SVNA 4UBKA 4FNAA 2SECE 4I50F 5CBKA 3CVXA 4PHFA 5IANA 2O3SA 3DNMA 1N6OA 4CU5A 3SBDA 1TKBA 1RKQA 2Z8YM 3F5FA 3L2OB 5KMGB 1SXQA 3DOCA 4TXHA 2VATA 4CG2A 3ISJA 1NBWB 1X7YB 1D0VA 1VMIA 2X8AA 3HBFA 3MT0A 1Y81A 3IR7A 3P9KA 4NYMR 4MUAA 2FV8A 2WUFA 1NUPA 1KC1A 3AJ8A 4LFBB 2X77A 1YS2X 1MR3F 2BELA 3V55A 1LNSA 1Q74A 1DEHA 4G23A 1NVXQ 1O9GA 3GJTA 3EC7A 3H1GA 5DBHX 1I1HA 2IYRA 4N5LA 1M2FA 3IQHX 4M0UA 3C6MA 2FZKA 3LZCA 3WB9A 5JYEA 1JUDA 4HGRA 3EZ7A 4KQ1A 1L1FA 2ZAYA 4J76A 4B2YA 4OQDA 3ZJTA 5IJXA 2W6JD 3R3JA 4Y67A 2Q28A 3IQWA 4FSXA 5G3ZA 2PYIA 3LCMA 4K9MA 1NNI1 5H8WA 2PUGA 3JZDA 2ZAOA 4IJ6A 4OMCA 3V4SA 3PXGA 1YB2A 4JSTA 3WSVA 1VG9B 2J3HA 3PENA 4INZA 4JEHA 2W93A 1DNPA 2Q6KA 3E5NA 1UOOA 2DU8A 4KWIA 3VYTB 4DF3A 2GPTA 4YAOA 1X13A 4Q7LA 2DR2A 1VLHA 4UNRA 3AB7A 4S12A 3OUZA 4NR0A 2W2KA 2CV2A 2FGJA 1UQUA 2OXFA 4MICA 4A0QA 1TM5E 5B3LA 2JI9A 2NSYA 1RIIA 4F93B 1ZGHA 1ZBQA 1Y9ZA 2Z2ZA 5CR9A 4X63A 2Q0XA 3ETCA 3SN6A 1RAIA 3C98A 1GPDG 2CJFA 1UDWA 2UYYA 4LTMA 1JG3A 4TRJA 2QX6A 1VGRA 5EJAA 5JHHB 10MHA 3EEQA 2QRPA 4KRFA 4FDVA 4D6YA 3W2HA 2L42A 1QH1B 2VLIA 3C6KA 4OQZA 3KJGA 4MV7A 2ZIZA 1AKYA 3ZTTA 4JV5B 1EFAA 3GF4A 3H2IA 4MWDA 4DJJA 1OXSC 1SQ0A 5TNXA 3KZKA 4RVUA 2KM1A 3DFUA 4PANA 3UK6A 4WBNA 1KP2A 2NVOA 2ZI3A 1KOGA 2GD0A 4JLVA 4R1TA 1PQWA 3EHDA 2AWNA 4YR7A 2JD2A 4B9AA 4JJEA 4YT8A 2CEAA 3OBIA 1RI4A 1BO6A 2J4DA 4D4GA 2XJ4A 2VP3A 2ZSAA 3MWDA 1UC8A 2YNMA 4KPGA 2V1XA 3J81k 4NYJR 3TLCA 2ZWPA 5K3SA 5AVWA 3W2FA 5K8VA 1JW9B 3L0CA 2QY6A 1DKUA 3ZYCA 5FR2A 2XYHA 4YI5A 4UXJA 1TK3A 5I6DA 5CXXA 2ZWMA 1Z6PA 3DO8A 1SZJG 3PXEA 4F2DA 2VPPA 2AIRA 1U28C 1QX4A 1SUWA 2Q0QA 3GUUA 2J32A 3HYSA 4JUFA 4NJEB 1V0JA 1T9GS 1KNXA 2B20A 2PS9A 3GWZA 2AN1A 1H1DA 1W1UA 2W2MA 4F11A 2XQKA 2J0EA 3GBSA 5G0VA 3KYBA 1FC0A 5KNCD 4MYDA 2B37A 2KYRA 4QPCA 4RQAA 4TLLB 5JXGA 4U1RA 3T3MB 2I3ZA 5AM2A 1WS6A 1KQFA 4MX8A 5EWMA 2UZ3A 2XCLA 1NVKA 1BFDA 3GLFB 4NOMA 2H08A 3D2BA 1K3FA 4XEHA 4YCBA 1PL6A 4ZA2A 2HADA 3BULA 3PS9A 5NULA 3RFCA 3FTCA 3FGOA 3MJSA 4JSRA 5ECGC 2IU4A 2FSFA 4AC9A 1PL7A 3EVNA 3EGCA 3P9PA 4NABA 2VT2A 3BAFA 3FFAA 1IHOA 2ERXA 5A1TA 3K30A 4OP3A 1DZIA 5CB4B 4U0JA 3UM9A 4XPIB 4AJKA 3K31A 4EQ6B 3FHJA 4FVTA 4L85A 2Y93A 4NOKA 3RAEC 1H94A 2Z5LA 2X0DA 3WKCA 1DBRA 1MEJA 3CMCO 1N5JA 5KSYA 2WINI 1CBUA 1PKXA 3D3WA 4UATA 4P5EA 4IGKA 1NU8A 4OLHA 2JFFA 5ESWA 4YV1A 4N1AA 3CRZA 1W0JA 1ODFA 4FM9A 2RHHA 4H18A 4E7PA 1C4XA 5HX7A 5TMDA 2C99A 4Q39A 4ZP1A 3O26A 2AGVA 3ZJYA 4RTSA 4DM4A 1OXTA 3AFHA 5KQLA 1Z0JA 2CVHA 3F6RA 1ESDA 1KEVA 4RA9A 5JCJD 3EGWA 4TX1A 4X8OA 3OLYA 2BGJA 3KUUA 5F76A 5I7WA 5K0FA 3TLEA 4EOGA 4YGXB 1KDYA 3ADKA 3T9BA 1NY5A 1VYUA 3KSZO 4HMQA 3SXPA 2PZKA 3IBCA 1KRXA 2DFTA 3U7FB 4LISA 5GONA 3DBRA 3OM8A 1ZGZA 1D8TA 4NFYA 2ZUEA 1E7YA 2FLVA 2TMDA 4EK9A 2ASVA 4HH3C 1LGYA 2C2GA 4BP1A 1SHZA 3FCYA 4HOYA 2N1BA 4FBLA 4WRRA 1Y7IA 5DGHA 1KI6B 1D07A 4ZDWA 1K8XB 3KAJA 1J8VA 3M6IA 5EKDA 3Q3IA 2OCXA 2VCEA 3THYA 1CULC 1KPGA 2D5BA 2FMKA 3D8NA 5H4GA 1ZR2A 4O4LF 1FRZA 1FZQA 1BXZA 4MIEA 5LQRA 3FTDA 4RXMA 1KWKA 3OCXA 4F3RA 2BUAA 5JO9A 4YJ3F 1JE0A 5K6AA 2P41A 2NVWA 4L02A 4E2ZA 5CUQA 2GARA 5M3BA 4KOEC 3AYXB 3MN1A 3G1TA 1IXRC 4BVKA 1XE3A 3Q1KA 4FFPA 1BD4A 5DHSA 3T3EA 1XALA 4HT3B 1MG0A 2VP0A 1RWPA 3DZKA 1BWSA 3CF4A 3I6ZA 2UZ1A 3GDHA 3HPRA 3M34A 4HRXA 4LWQA 4UMDA 2ZSUA 1WNTA 3ND8A 3QHAA 5C46F 4WZAB 1TQ6A 4L9AA 1Q20A 2YIVX 4MPPA 2GTPA 1JFFA 4MHOA 1J9EA 2G5TA 4B45A 1CVLA 1CZLA 3DFKA 3TJRA 1XZHA 5EKXA 3C4QA 3PHJA 5D3MA 2GI4A 1SVKA 4NDAA 4C21A 4E15A 3Q4GA 5B4UA 1ORTA 2R4TA 4L4UA 4G0YA 1WXFA 4QLBA 1NW6A 1X1CA 2CXHA 1IQPA 3H6GA 2AOUB 3ORHA 2VJKA 3Q2OA 1EX6A 1X9GA 5KAPA 4V1CI 3R3HA 4H08A 1Z47A 3C1AA 1XK6A 1J4AA 3OOEA 3PLNA 4IHQA 2BY4A 2JFVA 4RHCA 4X41A 1AKMA 4GYKA 5I01A 1XCMA 2PG3A 4BZPA 5CD1A 1WUJS 2Q6VA 1B0AA 3HKBB 4MV9A 4ZMBA 3PJRA 4KR9A 2CN1A 2QUZA 4RVDA 1SCUA 4CI9A 2CC2A 4OGFA 3OTGA 3GCXA 5A5VA 3L79A 2QVYX 3KU4A 1TLFA 1QQTA 4YT2A 2FXIA 3EQ9A 3FZYA 2XCIA 3H4TA 4C88A 4CKBB 5JAIA 4E5PA 1OAOC 3R76A 2VPWA 4X24A 5FTLA 1R88A 2FCAA 3ZW9A 1XQ6A 1EB9A 1WVGA 2HNKA 5ARDA 1VJDA 1HLGA 3A31A 3WK5A 3EF0A 1E5VA 5ALEA 5BV8A 4LF6B 2WE8A 5EPEA 4P92A 2EG9A 4H3VA 3FNBA 3LAWA 5FBHA 1KRHA 2BFBA 4NCIA 2AI2A 3IOEA 5A0FA 4IQFA 1C9KA 2HF7A 4JC8A 2RG7A 3VRHA 4YPOA 2ZCVA 3I83A 4B3GA 4CF3A 2V54A 2VZ9A 3DKPA 3JR7A 1MKYA 1QFZA 4PZ9A 3M6XA 5K0EA 3B6ZA 4KQEA 3LCVB 1UFRA 2NTNA 4HS9A 1G7SA 3ESXA 3H83A 3F98A 4HLCA 4IWXA 2QZJA 3OZWA 1QGOA 2F67A 2B35A 4OSPA 5IAJA 1V11B 2X8JA 5JCOC 4HS4A 5DF1A 3CS3A 2BEVB 1JQAA 2O0JA 4PYOA 2CFRA 1ULAA 2B78A 4G5RA 4RD6A 3HP1A 1K6JA 2GH1A 3IUYA 5JG7A 4B3MB 4J75A 4OQFA 3C8DA 5BN3A 4YT5A 3A27A 4NENB 1NQWA 2HSZA 4XQ9A 4W99A 3ROEA 1VCHA 4MCHA 1J9GA 1DJNA 4HADA 5CXSA 1IBMB 3AVUA 5GJBA 3GRUA 3HP7A 1QO7A 4DJEC 4NEGA 4ZCQA 4EYSA 1RCUA 1UMKA 1KZ7B 4P5PA 3C2QA 5KDDA 4K8RB 2RBKA 1NMQA 4MRMB 4Z9AA 5FOTA 4PYLA 3WOHA 3TUZC 2BSXA 4PLHA 5FADA 4G81A 4YYEA 2H3HA 4PSUA 3M3PA 1W30A 3OLZA 2NV6A 2PKWA 5TVKA 4ZT4A 3JYLA 1OFUA 3IEXA 1I14A 2ZYAA 4OV6B 3ZC3A 1N32B 2FY8A 1WPXA 2PAFA 3A6LA 3DQQA 4GQIA 1Y1TA 2B2NA 4KIGA 3LY7A 2HLDA 1NFRA 4IHJA 3PNKA 2PD3A 1XXLA 1J06A 1VE3A 3H8SA 4ISBA 4TWRA 1RWMA 1U7OA 1KEUA 1AC5A 3K0AA 3OJXA 4DMLA 3ZEIA 4OSEA 3BE5A 4IIFA 4XVQA 1YCGA 3GVCA 4GVPA 1G8SA 2W2LA 1FFXA 3FR7A 3IP1A 3MTJA 4X1KB 1VDMA 3TRHA 3G5LA 4GE0A 4GUDA 4MRVA 5AO9A 3TGWA 1J2RA 4DCCA 1QOQB 4RHTA 3PQ7A 4OQ4A 2G4VA 1V5IA 1EFKA 1QVRA 1ZYUA 1C0LA 2TMGA 2BP7A 2XIQA 1ZUNB 3EMVA 3NKVA 3TNFA 1KL7A 4P08A 1U4NA 1WMDA 5AI6A 2IE8A 1GAXA 5EP2A 2BONA 4EX7A 4NULA 4YHHB 2J85A 4M9QA 5EMKA 1FYWA 4LHSA 3VBCA 4CF7A 1SCAA 1ZVJA 4Q9LA 5LR6A 1GL6A 1SVMA 4ED9A 3U7GA 1IY0A 5HBGA 2YWCA 4ENTA 2X19A 2IUTA 3E1KA 3L0YA 4KQXA 4WY2A 2CYBA 5ARBA 3GA5A 3K0FA 4O1HA 2Y0DA 2VN8A 1LPMA 1O95A 3L07A 5DHTA 4EARA 2HBZA 1X1EA 2XQJA 4PICA 5JCZA 4ZREA 1O3YA 5EPOA 3R7BA 1PTJA 2J7PD 1P2DA 1HDZA 3I0ZA 3WXBA 1HYBA 2CFIA 4QDUA 3VR5D 5AVXA 1W5FA 3I92A 3H2KA 4EHFA 2XXBA 4PNZA 5IKPA 5GP1A 2P9QA 4ABYA 5JLJA 4ID9A 1PR6A 2WJHA 4QLAA 4NY1A 2J9ZB 3QA3E 1A9SA 1EJBA 2EWMA 2KWIA 4UU0A 1KEZA 1GGVA 4G1MB 4IDDA 2CE7A 4AO8A 1YQGA 4CF6A 3PUVA 1W5AA 1HL7A 1CUGA 1TM2A 3GPLA 4XYEA 1JEAA 1NKTA 3T7TA 5CFOA 3PYLA 4D79A 4MLDA 5A5DA 4X00A 2FMTA 2H29A 3OIVA 4A8TA 1N4DA 1XTQA 4N6GA 1MG5A 5JS6A 1P2BA 5JADA 1I9GA 2QUJA 1OXXK 1CVIA 4QULA 4KODA 2V9CA 3VPSA 3DBLA 4G9EA 1A96A 3NNDA 2W6CX 4RC9A 5CFPA 3SWWA 5P8WA 5ICEA 2BFWA 3TLMA 1GLVA 4HL6A 3WWYA 4XM0A 2B1IA 3KJZA 2D1FA 4WVLA 2IYXA 1B7GO 3HZOA 1M34B 3CCCA 4RV5A 4UHDA 5EUMA 4WGFA 1RJ9A 1W85A 2O05A 4K3UA 4AJ1A 1KEEB 1UMDB 2PZLA 2XWSA 3BJRA 3VC7A 1ZAKA 4CLDA 2EW8A 1OLXB 2AT1A 2ZI6A 5ECYA 4MW5A 3PQ8A 4YRGA 3KTDA 1E99A 3V5NA 2CHQA 2PX4A 1L5OA 3RB8A 3P27A 4GPD1 3NIBA 1FX0B 3B1YA 3FVTA 1EDZA 1ZN8A 3R5KA 2UYCA 4EHHA 4FOOA 4W5JA 1RW4A 4ZJZA 4J0CA 5IMBA 4IZIA 3SEFA 1T4CB 3AV3A 3DEFA 3NLLA 4OL0A 4PZ0A 4QGGA 4GLLA 3SSMA 3QKWA 3WTCA 3CC8A 1OILA 1PR9A 4KXNA 4ZT6A 1GTSA 2PX2A 2WUDA 3PUYA 4LDJA 4UJ5A 3TIXB 5F1OA 1PG5A 4OXIA 4ZCLA 1JEOA 4B48A 5FFMA 3CG0A 4V2UA 4DDTA 4IMIB 1SKYB 2P2YA 3AHDA 4BNYA 1RI5A 3LX4A 1WQ3A 3FF4A 2QN8A 3BH6A 1FNBA 1AKEA 2O8EB 4Y1RB 3P4XA 4Q7QA 5CB0A 1ZUWA 2BGGA 1W7AA 2D6FA 2PXXA 1IDOA 1K4KA 1SH7A 3LG2A 5BPHA 3KAQA 1E3LA 4Q3BA 2XHEA 1JDUA 1H3NA 2B4TO 2YQ4A 3F3SA 3GYGA 2NSHA 3VHXA 3FHTA 2OG1A 1W36C 2O1XA 2BFFA 4EHIA 3OI7A 5AHOA 1QFYA 1W5BA 2OM6A 1U8YA 3RFXA 5B64A 4B80A 4BE7B 3G79A 5E1OA 4Z9YA 1JWLA 1ML4A 4L76A 4UARA 4FZ5A 4EGQA 2JLBA 4MVJM 1SO8A 1GIAA 2PS3A 1JTFA 3ZWPA 4DWOA 3WL8A 2R5FA 2JFWA 3SX2A 4JJGA 1W0CA 5IK2A 5FBQB 3VR6A 2CCGA 4ER0A 3F3MA 1XVAA 3RC2A 2FWRA 5TS3A 2Y2VA 4DIMA 1TGYA 4IHAA 1EA5A 1G42A 4D4HA 3BIXA 4FMDB 4N3NA 4WGGA 4GI5A 2BMDA 1UBGA 2GNAA 3OWOA 1U8AA 3E35A 1X92A 3FGZA 2HTEA 4RWEA 1AGYA 1A4UA 4RS3A 4BNWA 1G2IA 1ZO8A 2WKQA 1B3RA 2E4AA 2EERA 1MQ8B 3K94A 1N33B 1HT1E 2AFIA 4KN5A 4YA6A 1NR1A 4YCDA 5LYJB 3U9SA 3DOIA 5JHGB 1XTKA 4CFYA 1QVVA 1FZTA 1HDRA 1W46A 5I7SA 2VJLA 2AKAB 4LNAA 4L72A 3KKNA 1V8BA 2CD7A 2UZAA 1KJZA 4X54A 5DHAA 3FDZB 3MCUA 4G5HA 4XCVA 3KD3A 2X8LA 1SUAA 1UUFA 4ZAGA 3GRAA 1FNSA 5T4EA 3F2VA 4Z5XA 5IH7A 5CX1A 2I4TA 2XF8A 3F0TA 4FT4A 1EPUA 4JJZA 1S4MA 1KYYA 3OPXA 3K1AA 4YRZA 1K6IA 3VH3A 2QN3A 4ZU1X 2PKQP 3ZWCA 1NVEA 3BXEA 4D44A 2ADMA 3BQNB 2ZB7A 1GCGA 1RYDA 3MAAC 4JLBA 5LSAA 4EQZA 1AHHA 1GDDA 3Q7SA 1SBZA 2GAJA 4Q9HA 3JASB 5JARA 4O1IA 3R3VA 2A57A 1HO3A 4B84A 4CKZA 1N2OA 1UPXA 2GRJA 2ZSEA 3IPAA 3N0TA 3I32A 5DEOA 2HIMA 2G1KA 4ARVA 1PX2A 1WY5A 2VF8A 3GG2A 5JSQA 4BVEA 5C1PA 1QANA 4B87A 2WHPA 4NU5A 2I3GA 3V3TA 4JP8A 3NT5A 1RWNA 5U4XA 4MWOA 1X6VA 3CW8X 3K09C 4NAVA 1VL1A 3UO8B 2YRFA 2ZG6A 3FA2A 1X7XA 5EP3A 5BQPA 2FQWA 3PGMA 1ILEA 4Z9FA 3NTLA 4LSWA 2UYHA 2YIMA 1Z08A 1ZXBA 3IKLA 4H15A 3EDCA 1A3CA 6Q21A 1VHLA 5EIXA 1JS1X 1T43A 3EZ2A 3SC4A 4K0KB 4D25A 4B3SB 3B1ZA 4M1ZA 3E3MA 2IELA 3KDSE 3NYWA 2H3EA 4G5QA 3U3ZA 1MX3A 4PHHA 3IE2A 1U1DA 1RXEA 5HTKA 1C3LA 3O74A 4WI1A 5IASA 5CNKA 2Q5FA 3WXMA 5LDDC 3EPHA 3F71A 3IQXA 3PDJA 1MXHA 1T0HB 4B6JA 4PZEA 1X1RA 3H04A 3T1HB 2ZJZA 4II3A 4UHCA 2ODEA 3U4HA 3SXUA 2NSDA 5ALHA 1IM5A 2AK3A 1DWOA 3FMGA 4ESOA 3PIRA 2AZDA 3K73O 1J70A 1Y8QB 2FR1A 1RBZA 3BF8A 4ZAZA 3H2SA 1KOFA 4F3TA 4S24A 3L77A 2VQFB 5C8VA 1I6WA 3PUIA 4G5YA 4C06A 3AUTA 1J5EB 1H9AA 1TA0A 4PE5B 3VHRA 1EWYA 4J1NA 2ZP1A 4CMAA 1ULBA 1RWQA 1YSCA 1YS6A 3IAM1 2O8NA 4MS3A 1YZGA 2Y71A 4YEDA 4BNDA 4ENUA 2OOKA 2QMEA 5G0UA 1RAHA 1JHDA 2VJMA 1U3WA 1P4GA 3NHZA 1N3IA 4BV9A 4AS1A 4E1BA 4U9UA 4BPBA 3ZIUA 4BQQA 2C58A 3KR0A 1EVQA 3ESAA 3YASA 4AFNA 4MYRA 1KSHA 1MRNA 5HKKD 2CNNA 4N76A 1XOIA 4X6YA 5TXGA 4AP5A 2H7XA 3PFWO 5F2KA 3G9QA 2OBFA 4UPDA 3VPXA 1VGVA 2G1AA 2X2OA 1P6QA 2Q8PA 2PEYA 3N70A 2QENA 3EVGA 1S3SA 3RVJA 3S28A 4DLYA 2OCDA 3PJGA 1X80A 4JHLA 1JQBA 1IU9A 1R4MB 3IIMA 5FCDA 1Y6FA 1YZTA 5JH7B 1NYTA 1GZ6A 2QXTA 5HQ3A 4NU0A 3MTEA 1PG0A 4KN8A 4OMUA 1T5BA 3TTWA 3ZY6A 1U7WA 5FHRA 3MUEA 2WZCA 3UJ8A 2DTXA 2KSQA 4WL0A 2PJDA 3BGSA 3MF4A 4EI2A 1I9CA 2VRBA 2QTAA 4GLOA 1NTOA 1VL2A 2H5IA 2QMUA 2CHEA 2I1LA 1GVNB 4OJQA 3O7MA 1YRAA 3W6UA 4CHGA 2VHTA 1Z0SA 4UD6A 4D8TA 3FWZA 3U81A 1PK7A 1NV8A 2PZJA 4OVKA 4G1FA 4AMYA 4CIBA 2C4WA 5LVAA 3ELBA 2E49A 3PQ4A 2VKTA 2XTAA 1J24A 3AYZB 5CU7A 2QR5A 1PJ4A 4P80A 3FNEA 1W2GA 2EBHX 5JCXA 2DETA 3ENVA 4BUCA 2J7KA 5PGMA 3KOMA 2NG1A 1K7SN 1U65A 2QRJA 5CURA 5DFAA 4XCQA 1GUDA 3GNLA 5A3RA 1LSJA 3CJTA 3PX2A 2RGXA 4Z8XA 4M89A 5T4HA 4XVUA 5C2JB 2I2WA 5ILOA 4GPAA 1MVNA 3WHKA 1DRJA 3NP9A 3WAJA 4Q4AA 3U3DA 1H8EA 1RHMA 3I4CA 3K0BA 4V3CA 4EL0A 1CF4A 1FP1D 4F7WA 4MSUA 1LU9A 1OWLA 3N86A 4Z51A 1U5CA 4I2VA 3RARA 5IXYA 5AJXA 1S6YA 4ND5A 3JWPA 1HM5A 3GJ4A 1NOIA 2ZGVA 5HFJA 3VJKA 3FSJX 3OZRA 3CV3A 1AO0A 2A92A 1UC4B 2VRCA 5JATA 1F2UB 3ELYA 4PAGA 5D1HA 3QUCA 3RU3A 4MIYA 2VR1A 3TQCA 4ZICA 3RSSA 2IF0A 2XF2A 1OLOA 1L7MA 2BFCB 2JLQA 3S1LA 4ALIA 4DREA 3GFBA 4FI3F 2UUBB 2MDTA 3OFND 1QVWA 3IVMA 1JLLA 5JDCC 1I1QB 1JQDA 2AJDA 1NJSA 1UANA 3H1EA 4PG5A 3TR6A 4RTQA 3I42A 1P7CA 2YY7A 5K0SA 4IWNA 1FBNA 4WZBA 3KYJB 2FPUA 2PZGA 4LJ7A 5IFKA 5KOYA 5JTTA 3IFSA 1X7GA 3OQIB 4AJJA 4FXOA 1CEYA 1C8KA 2NTYC 4A82A 2C2OA 4QSMA 1LVHA 4FYVA 2VT3A 3E18A 1O89A 4LY9A 4JBWA 4C2UA 4UREA 5JNSA 2EZTA 3WA6A 4E3WA 3RHTA 4QATA 3USZA 1N8KA 3CB4A 3KEFA 3F4LA 1CJTC 3MCZA 1LSUA 1T25A 1WDMA 2PWBA 2J5BA 3RYCB 1YAHA 1ODJA 3DZGA 4Q19A 1JHAA 1NXSA 1WTAA 1B42A 3L7MA 4Z4CA 5J58A 1TF2A 4PBRA 5IG2A 1VJRA 3CMMA 1JHVA 4BWYA 1XTZA 2ATEA 3W6NA 4RVSA 3ZUGA 4WASA 3O91A 1TYCA 1BXRB 1U4OA 4LJLA 4CVNA 2VF2A 2D0OB 4K9QA 2V98A 4RXTA 3UWKA 3O8CA 3E8SA 2QORA 2ZSHA 3I28A 3LKZA 1JEQA 1HORA 2FSPA 4W9NA 5AKKA 5AP9A 1HUQA 3ZD6A 5K7SA 1YC5A 1SQSA 3O8QB 1GU1A 1M1NA 1NA5A 1RM5A 2FF5A 1I3MA 2JRCA 4YMVA 4WNCA 1KXJA 2OM2A 4MVJI 4Q15A 3RUAA 4QHYA 3AOGA 4UQPA 1E3DA 2WTMA 3L1HA 4LJKA 5E0KB 4PCVA 3BSWA 1EFPB 2C4TA 4I3GA 1JT2A 4RD3A 4AN4A 5TEVA 2FDRA 3SEZA 3W6ZA 3WP0A 1TU3A 1WA5A 2D8AA 2P0YA 3R0VA 1CEQA 1J56A 1E6MA 2C29D 3AZOA 5ED0A 3T1VA 1Y82A 4RSMA 4O4IA 5TRTA 5KX5A 5FQOA 1GRVA 3H2BA 4Z1MD 1UIRA 1VSTA 1X9IA 2J6BA 2NQ8A 4LW8A 4J0QA 4HF7A 1LQUA 1YVEI 3GMDA 3ZCRA 2JGJA 5EZYF 5B3JC 3CUEF 4PZPA 5AT1A 3PT5A 5AKEA 4MPDA 1UR5A 4JP3A 3U4MA 1DIRA 4EHBA 3C41J 1E7WA 5KC8A 4LE1A 3RVLA 3T35A 1G1MA 1UMCB 1XD2A 4L16A 3THOA 2DVMA 2XUPA 4HTFB 1QUFA 3DG9A 1U8FO 3H1FA 2QTHA 2GN2A 2FN9A 1KC3A 5I7EA 3EFHA 1E9EA 3TN7A 2WKWA 4MKZA 1ZBDA 1PZEA 1U9CA 4CUKA 3T3OA 4ESHA 3INNA 2W6QA 1PJQA 1TVKB 1FFSA 5AHWA 5EJEA 3LT5A 3FOFC 1Q7CA 4P4LA 4TN5A 4ZO6A 1U2GA 4CTOA 2XSZA 4US2R 2J08A 2DFVA 3LQ2A 1YUNA 3NTUA 3S1SA 1FMLA 3AHHA 4E5YA 2V8BA 2ZVDA 4PLPA 2C42A 2ORED 2ZB8A 5HDQA 3ZQUA 4EP1A 2G77B 2YHUA 3T8YA 3W34A 3EAQA 4OQXA 1LLCA 4Q1CA 2YIDA 4URVR 4MI6A 1MJNA 3H87A 1EFHA 2YQ5A 3GARA 5DTMA 4EBFA 4HN9A 4ETMA 5JAMA 3FTQA 2QAGB 2H52A 2R85A 2BE9A 3BXPA 3JQ8A 1RAGA 3IQZA 3PFKA 3GEGA 5FJIA 5A06A 2Q1UA 5KJFA 3WFZA 2Z58A 3IQFA 3IDOA 1SXJD 2BHNA 3GW8A 4QBHA 3GT7A 3AXTA 1IMOA 2XYGA 1LPOA 5FL7A 4DMKA 1M0EA 5ITSA 3HI4A 4QGBA 3D6AA 3AR2A 4F6RA 3JQFC 4Q3EA 4YMUA 4J6FA 2XTJA 4MVJH 3AJDA 3O82A 5E6UA 2JH8A 4MKRA 2IW3A 3E9MA 3GY0A 3L01A 4MWEA 4ZJPA 4MUIA 1FFHA 2A0KA 3DOOA 3M82A 2Q49A 3CWZA 1CDZA 1DCTA 1MJHA 1P33A 1THZA 3KE9A 2XXJA 3AVPA 2ECPA 4AMGA 1IJKA 4YUYA 1TJ3A 1T15A 3Q41A 3OIDA 3S2ZA 5I7UA 4ZU3A 3AR9A 2GSWA 2GYWA 4ZD6A 1NVFA 4JZYA 1L5WA 1RTTA 4MV0A 3TLJA 1GRRA 5GINE 3RODA 4BNMA 1E3EA 4JNKA 4K81B 2EL7A 4EYKA 3T3IA 1BCSA 4KWHA 1Q50A 4NU8X 1M1YA 3QKUA 3VFDA 4O2RA 4INJA 1LDNA 4P0PB 5KWVA 2C04A 5BR8B 3CCFA 3H1AA 4DLKA 1T8YA 1N0IA 4UTPA 3WJ7A 3CU5A 2E37A 1TUEA 2WQZA 3BMXA 1FUUA 3E3OA 3GJ6A 1JHZA 3EA4A 2VZ8A 4E6EA 2CLDX 1R8YA 1VMKA 5H68A 3R9WA 4QECA 2XRZA 1WXWA 2IPOA 2V03A 3GJ0A 1AUOA 2VUIB 1TF5A 4BMXA 5IJ0A 2AZMA 5MF6A 1KJ9A 2D2IA 1E2NA 3FNGA 1T1SA 1E1QD 2OSBA 4Q1VA 3RBAA 2Q29A 1QIKA 1M5TA 2GBPA 2GD1O 2Y0BA 3SDZA 3B1XA 4PQFA 3VV2A 3ZY3A 4RTPA 1EI9A 2PZFA 5EKSA 4RADA 2BE7A 2W83A 2Y2UA 3D4PA 1LZLA 4I4LA 4N0MA 5KTYA 1Q6ZA 3PFBA 5TR9A 3DS8A 3T9EA 3MS4A 3TK1A 1DRKA 4C0LA 3NCTA 4CL3A 1G2PA 1Q0UA 1SUPA 1XZIA 2QE7A 3HR4A 1FMJA 4DVJA 3E9ZA 3HDQA 4XLLA 4GSKA 1BS2A 4F21A 8ATCA 4D9CA 1P8AA 3HJAA 4AMVA 1QGDA 3T7DA 3QRWA 1TLTA 3NBKA 3OMXA 3QJYA 1XZJA 3MA0A 3P8ZA 2ZUTA 5DLQC 4B17A 4N41A 5BYKA 2A7QA 1Q1BA 3WY9A 5DLDA 2XYQA 3CLUC 4ILKA 2PJRA 2NU8A 1TAHA 3BMQA 2XIJA 1VL6A 1XRQA 2IDKA 3SYKA 2W98A 1VP3A 5U9CA 5D85A 1XRLA 3OT5A 2YHBA 3FOCA 1ZNXA 4HQNA 4JR1A 4RD0A 1USVA 1T0UA 5JMOA 3G13A 1FUYB 1ZNZA 5DPMA 5LOVB 1Q0SA 3BC1A 3UZUA 1RPNA 3B51X 1ZRHA 5K3DA 2CXOA 2IFTA 2QP4A 2AR9A 1CR4A 2NAPA 2MINA 4J16C 4DV2B 3D6TB 2A1TR 1Z28A 1KFKB 4IJUA 3FCEA 4LBWA 1EIWA 3RVBA 3NBMA 4I5GA 2BTQB 1VPEA 4TMVA 1G6HA 2OCKA 2CHVA 4OUKX 4D0RA 4CGZA 4OHMA 2E5LB 4CCYA 4JJ7A 1VYVA 1U0TA 2X7HA 4X1YA 1TVMA 2IXGA 2VHQA 2HRCA 5D7NA 5AKHA 2Z9BA 2IHYA 1CWUA 3HE3A 3BFKA 4MO9A 3V1UA 1RI3A 1LV8A 3K3PA 5T64A 5CB4F 1XPUA 5JNRA 2RIRA 4LXTA 2BF7A 1NFQA 5D1NA 1XMJA 1SU8A 2QTRA 4G4SP 4JOBA 5F5NA 4X91A 5HCNA 3T4UA 2OFXA 3A2MA 3UMJA 3TDMA 3ZPXA 4ZCTA 4NXMB 1K6EA 1DJLA 5EUBA 3FF1A 3AL3A 4D98A 5M29A 2ZS8A 1UINA 3SS7X 2FHSA 4J1TC 2FLKA 4W9RA 1EWKA 2DQKA 3TUJC 3IBTA 5U4QA 3L4BC 5JNWA 1TIKA 4JVOA 1TXGA 3EFEA 1MJGA 2R68A 1DBIA 4NMHA 4GOLD 4PBTA 5E1MA 3HNPA 2W22A 1X87A 2G06A 5JV5A 3A1UA 2H4HA 1YMUA 4C0AC 1AKNA 2C9BA 4WCFB 4D4KA 3K5WA 2OHOA 2HI0A 4IFEA 5UKDA 1KY2A 3B78A 3WBJA 2WD8A 3J7AC 3STHA 4Z2AA 3FWNA 1EK0A 5JPDA 3WK9A 2B9VA 2X41A 3WSWA 4B35A 4XDGA 1PK9A