1BNJA

Barnase wildtype structure at ph 9.0
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Microbial ribonuclease
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bnjA00
3HOHA 1UCJA 2F5WA 2KF4A 1BSEA 1BVIA 2F4YA 1RCKA 1I2EA 1CH0A 2RNTA 3AHWA 2BIRA 4HAAA 3DGYA 1LNIA 1UCKA 1I8VA 1BRHA 4GHOA 1BRSA 1I0VA 1I70A 1UCIA 1ZGXA 1X1YA 1YGWA 1AQZA 1BNJA 1X1XA 3BIRA 1RDSA 1RSNA 2KF5A 3DH2A 2AADA 1RN4A 1LOVA 1LOWA 1BSCA 1BRJA 1B3SA 1IYYA 1JBTA 1RTUA 1PYLA 1FW7A 3AGOA 1BIRA 1BANA 1BNIA 2F56A 1BSDA 1TRQA 3AGNA 3D5GA 1LRAA 1BNEA 1B2XA 2ZA4A 3AHSA 1GMPA 1MGRA 2KAAA 1RGEA 1RGFA 1BSAA 4HOHA 1I0XA 3SYUA 1BRKA 1RLSA 4RNTA 1PY3A 1X1UA 6GSPA 1GSPA 1RGLA 1BRGA 3WR2A 1T2HA 1T2IA 1I2GA 1X1WA 2RBIA 1BUJA 4J5KA 1RGCA 1A2PA 1RNTA 1B2ZA 4J5GA 3D5IA 1AY7A 1BNSA 1MGWA 1FZUA 1JBRA 1FUSA 1RGAA 4BU4A 2KF6A 8RNTA 1B27A 1GOUA 1FUTA 7RNTA 1BU4A 1YNVX 1BGSA 1LOYA 1Q9EA 1B2MA 2KF3A 1B2SA 1I3IA 1RGKA 1RNBA 1RCLA 3D4AA 1GOYA 1YVSA 5BU4A 3WHOA 3BU4A 2GSPA 3GSPA 1B20A 5RNTA 1BAOA 1BNFA 1RHLA 1TTOA 1DETA 2C4BA 3URPA 1UCLA 1HYFA 1SARA 1BRNL 3A5EA 1RGHA 3RNTA 3KCHA 4GSPA 1TRPA 1RMSA 2SARA 9RNTA 1B2UA 1RGGA 1BSBA 1G02A 1R4YA 1GMQA 2F5MA 1I2FA 1FYSA 4BIRA 2BU4A 1GOVA 6RNTA 7GSPA 1BNRA 1BRIA 1C54A 1BNGA 1HZ1A 5BIRA 1I3FA 3Q3FA 1DE3A 2HOHA 5HOHA 2AAEA 1GMRA 5GSPA 1JBSA 1BOXA 1RN1A 1B21A
chains in the Genus database with same CATH superfamily
3HOHA 2KF4A 2YX9A 1IVXA 4BTYA 1BSEA 1N5HA 4AEQA 1I2EA 2RNTA 1KD14 3NHXA 4HAAA 3DGYA 4GL6A 3DGLA 4EYCA 5JPUA 3B4OA 2INXA 3WMDA 1IU7A 2OWPA 4FMAA 4HM2B 4GHOA 3V98A 3N9HA 1Q7HA 3NQZA 1UI7A 3HZPA 3LMLA 3NV0A 3BIRA 3BLZA 1RDSA 1SIIA 5TGNA 1SQWA 4R4KA 2AADA 1ZO2A 3H51A 3K0ZA 1JB5A 3FGYA 4K1VA 1ROVA 3WOFB 2HMMB 3G0KA 1JBTA 3D3LA 3MHEA 1PYLA 1FGQA 2LYXA 1W6CA 1E97A 3DM8A 1BANA 1IDPA 1V57A 3G16A 1M904 2E2TA 1VQ53 2F56A 3DZLA 4RZMA 1N8QA 2CW9A 1E3RA 1SIHA 4WP5A 1BNEA 3H3HA 2CC3A 2ZA4A 3AHSA 2CWTA 3F7SA 1O7WB 4O3VA 2FXTA 5ELJA 3CCL3 1JRQA 3CCS3 5CF2A 3LTCA 1RGEA 3G713 1RGFA 3HX8A 1BSAA 1SJWA 5G1LA 3FF0A 2J8XB 2W9PA 1RJOA 2Z77A 1KC84 3JUOA 1GY6A 4RNZA 4U13A 1ISKA 2LQVA 4ILFA 3X40A 4STDA 3UNLA 4R9LA 4WYKB 2K3DA 1QAFA 5G1KA 5AYSC 2GEYA 1O7NB 2JQ5A 2RBIA 4L7KA 3UJMA 4J5KA 4H61A 3EJVA 2XGNA 1JKGA 1RNTA 2W56A 3CPOA 4J5GA 3D5IA 1DVDA 1VQQA 3EB8A 2KF6A 3F14A 4XDVA 3ZG5A 1NO3A 2QGUA 3KKGA 3SOYA 8RNTA 7RNTA 1FUTA 2GEXA 2H0GA 2OTJ3 4LGQA 3B4PA 2HMJB 1YNVX 2OOVC 1LOYA 3EC9A 1RKYA 2GBXB 1B2SA 1I3IA 4I5QA 4R80A 1RCLA 3D4AA 2V1LA 1ULJB 2BMOB 3S28A 5BU4A 4N6TA 1OH0A 3BU4A 2GSPA 3CNXA 3Q90A 1B20A 4KFFA 1W6GA 3N8BA 3TDGA 1RHLA 3UL6A 1UGHI 3RGAA 5RNTA 1GY7A 1TU5A 4IIAA 4WFOA 1MOLA 1IT8A 1SARA 3SOAA 3WOEB 1TP6A 1UUWB 2P09A 1U5OA 9RNTA 2QEX3 4N6UA 1YGEA 4HM4B 3X42A 2F5MA 4L8OA 1UW1A 3ECFA 4MMYB 1FUWA 1TFOA 1GOVA 1NU3A 2OQEC 1EEJA 3MG1A 2K54A 4HM3B 5FGOA 3MG3A 1JN5A 1BNGA 3L0RA 4EC6A 5BIRA 3Q3FA 1K28A 2CFGA 4MEIA 1G0TA 1W5ZA 4N3VA 2AAEA 3U97A 1JBSA 1M9GA 1IV9A 1ROAA 3KE7A 2CK3H 1B21A 2IYJA 3KIIA 2XF3A 1QVG2 2F5WA 1Q40A 1CEWI 2F4YA 1RCKA 3AHWA 3CCU3 4K1UA 5IEPA 2IA7A 5IG5A 5AIFA 4BTXA 1BRSA 1OHSA 2BMQB 3SVAA 1G96A 2ML5A 4Q53A 1AQZA 1VQ73 3N54B 1YJN3 1OF5A 2P0XA 3PGBA 1X1XA 3SLUA 4LSOA 1VQL3 5I97A 4MMZB 3DH2A 3DUKA 3F8XA 4XB5A 2BO9B 1LOVA 3DY5A 5EQLA 5G2GA 4HM8B 1UGIA 3BNEA 4BL3A 3MG2A 1BSCA 1BRJA 3CU3A 1B3SA 1FA3A 5M18A 1EG9B 2E2UA 2BHMA 1VQ83 5AEWB 1YJW3 2XH9A 1BIRA 3LYGA 3CD63 2C10A 1N5PA 1NDOB 3FG3A 1YI23 2XRXB 3AGNA 1JB2A 4WWUC 3ALAA 1LRAA 3OW22 3VGNA 1B2XA 2IMJA 3KSED 4N6MA 1GD3A 4R9KA 1LXEA 1W7CA 1MGRA 1UI8A 4KZ1A 4CJNA 1OGXA 1W6YA 1AVKA 4BL2A 4HZBB 1T5YA 1I0XA 2KXGA 1SPUA 3LTBA 4XBXA 3V92A 1A2VA 2W0QA 2CFWA 1NJI4 5CK6A 1LVNA 2HMNB 3MWZA 3CXC2 1YHQ3 4I4KA 1VQ93 1M1K4 1AV4A 1QAKA 1UUGB 1WNHA 3GAXA 2O9UX 1GS3A 3SXXA 1DMNA 1GSPA 1IVUA 3NX0A 1RGLA 1T2IA 2W6JH 1FGTA 1WTHA 1X1WA 1LQMB 2BT3A 4HM7B 1PFPA 3UL5A 1S5AA 4RBNA 2CX1A 1Q824 4EW5A 5CXOA 1GD4A 4WYKA 3NUVA 3ZFZA 3OWSA 3DGNA 1FZUA 1A67A 1Q814 1JBRA 5AIHA 1RGAA 1O7PB 2STDA 2UUGC 4XBTA 4O8SA 4L8PA 4BU4A 3PXMA 1BU4A 1N9JA 3ER7A 2Z6BA 1AVLA 4OUQA 5BXQA 4N6V0 1Q9EA 1B2MA 2KF3A 1ZS7A 1KSIA 4HM1B 3S5CA 2ML6A 2CHCA 3WHOA 1WMOA 4NHFA 3GSPA 5IG4A 1Z1SA 1EA2A 2W2CA 1D6ZA 1QJGA 1YVBI 1BNFA 1NWWA 1E3VA 3A76A 1DETA 1VQK3 3S67A 3NV0B 3FLJA 1HYFA 5FW5A 3JVCA 3CCJ3 3JUPA 4J8TA 3RNTA 4MMXB 1TIJA 1OACA 2CH9A 2D42A 1OHPA 3LOYA 1QMAA 3HK4A 1LQGC 1V58A 1B2UA 1RGGA 3WODG 3F8HA 3NBBA 5DRVA 5STDA 3UB1A 4JRFA 1I2FA 3K63A 3DMCA 4FCJA 1JB4A 1C7HA 3E99A 1CYVA 4JF8A 1C54A 4RNYA 2BNGA 5AI1A 1D6UA 3I553 2K0MA 3CMA3 4H3UA 3NM7A 4HZ9B 3EN8A 3J7Yd 5HOHA 1IQYA 5GSPA 1ZX2A 4PEJA 4AKYA 4IT7A 3AGOA 5AYRB 2CG1A 1GY5A 1UCJA 2H0HA 2MF7A 1TJDA 1BVIA 4NPBA 5JPPA 5IF6A 1CH0A 4DKIA 3QK9A 4EBGA 1LNIA 4BTWA 1Q864 3KSPA 2GBWB 2XSHB 1D6YA 3GZYB 5D83A 5ELUA 1J2BA 2I9WA 1UCIA 1NB3I 1X1YA 3T8NA 3PCRA 1M1XB 3T0UA 3X3YA 1A90A 3NQYA 1BNJA 1VQ43 3S29A 4J9AA 4N6LA 3I0YA 5CLKA 4FMBA 4LMIA 1RN4A 2P0MA 2XGLA 1DVCA 4O2HA 5IERA 1MWRA 1W00A 1VQO3 3NM2A 1LNHA 5CF1A 1US1A 1EKMA 1IQXA 1BUQA 2HMKB 1BNIA 4FR9A 1VQ63 1Q42A 3RGRA 4XBYA 1BSDA 3F40A 1TRQA 2XSOB 3BNBA 2HMLB 1RN7A 3D5GA 1WMNA 2JDIH 3WDGB 8CHOA 1V74A 1MWUA 2KAAA 2A15A 5IW9A 1CQSA 3CNMA 1IK3A 2L4VA 1YIJ3 1FGMA 3BNDA 2IUKA 1VZZA 1RLSA 3CCR3 4FMDA 2CFKA 3OXAA 2R41A 1RRHA 4XM4A 3X3ZA 1JNQA 4FCZA 2O3OA 1JJ22 2CFDA 6GSPA 1BRGA 1W02A 3WR2A 3K9MC 5KP3A 3AMOB 3FG1A 1I2GA 4HBRA 3B7CA 3LT9A 3PZWA 1Q7Y4 1QALA 4LEHA 1A2KA 4X2HA 3FZWA 3JUNA 5AIGA 2RSXA 2RCDA 3Q1CA 1JN5B 1OGZA 3EQQB 1AY7A 1BNSA 2HMOB 3FKAA 4KFEA 4GB5A 1L5GB 3FH1A 1WMPA 3D9RA 1GOUA 5IG3A 5EVHA 5IENA 4IPBA 4CPKA 3IPTA 1Q40B 2F86B 3LT8A 4HM6B 3ROBA 5KP4A 2XFTA 3EX9A 3PYJA 1KWIA 4KFDA 3CCM3 2UX0A 1RGKA 1FGRA 4K90B 1FGOA 3GZRA 4K61A 1IVWA 2C11A 2CWVA 1OCVA 3FF2A 3G4S3 2R4IA 1U8CB 3G8ZA 3STDA 3HIGA 1BAOA 3WA2X 2M7OA 1TFKA 2ZDJA 5AEUB 1OF5B 4HYZA 2C4BA 2GU3A 4N6NB 1BRNL 2WGQA 1OHOA 3HIIA 2E2VA 3A5EA 5JBSA 4HKVB 4EV5A 1TRPA 3K5TA 2F98A 1RMSA 4TX4A 3O8YA 1RRLA 1G02A 6STDA 3K7CA 1GMQA 3MYTA 1TUHA 2B24B 2BU4A 3EBTA 1W2ZA 3CC73 3M8CA 1BRIA 1HZ1A 1NNVA 1OUNA 3D79A 3OX9A 4HM5B 5EEOA 3S27A 2CG0A 2ZL8A 1GMRA 1W01A 2Z7AA 1BOXA 3NXJA 1VQP3 3X3XA 4OK0A 1MWTA 3V99A 1VQN3 2PNCA 4OVMA 3CME3 3MSOA 1MWSA 3IMAB 2BIRA 2H0IA 2W04A 2RGQA 3DGMA 1EQKA 2P05A 2Y73A 3FCSB 4XDWA 1CYUA 3PS8A 1UCKA 3VF1A 1I8VA 3LTDA 3MKIA 4FMCA 1BRHA 3FG4A 2CKFB 4MJDA 1I0VA 4AKZA 2QA43 1I70A 1T3BA 1ZGXA 1YGWA 3KZTA 4WHAA 2MC8A 1QVF2 2YFJB 3GZXB 2OCTA 2OOVA 1WQLB 3G6E3 3SX1A 1RSNA 2D1WA 2KF5A 2SBLA 3U1WA 3OWUA 3KFQC 3VSYA 4LZIA 5M19A 3T8UA 1DYUA 5AIIA 1IV7A 1Y4KA 1LOWA 1UDII 1IYYA 1RTUA 3KN4A 2FNQA 4QWTA 2KCDA 1LOXA 4G1MB 1FW7A 2WOHA 2IUJA 7STDA 3WA3A 1DMQA 1DMMA 2QIYA 1O7MB 2W03A 3CCQ3 1K734 2L1SA 2RFRA 3I563 1R4CA 1ULIB 3EE1A 3DXOA 2CX0A 3Q2PA 2BMRB 1VQM3 2WGOA 3IJEB 3JUMA 1JZDA 1N9EA 5IG0A 3F9SA 3CPW2 1GMPA 2WO0A 5DREA 2IY2A 3EN1B 2OQEA 1K9M4 4ZM8A 2KRTA 3NBJA 4HOHA 3BNCA 1HKXA 3RDEA 3SYUA 1UUVB 2GXFA 1BRKA 4HM0B 1BNRA 2GU1A 3HI7A 4RNTA 3CC23 3FSDA 1F8NA 1PY3A 3PCSA 1AR0A 4X2OA 1JKGB 1X1UA 2W56B 5D81A 2ZHXB 1T2HA 1N8R4 1KQS2 1ASKA 2F99A 1O7GB 4ORLA 1BUJA 4LYLB 1IQ8A 1RGCA 2CIUA 2Z76A 1A2PA 2WOFA 1B2ZA 1STFI 3MPHA 4KVHA 4EXRA 1K8A4 4CCVA 2OTL3 1MGWA 1STDA 3AMOA 3BB9A 2PZVA 1W4NA 1FUSA 3NBRA 5M1AA 5BVBA 3EF8A 2XEPA 5D82A 1HU9A 1B27A 1IVVA 2YFLB 3CCE3 2B1XB 5IEOA 4N6OB 3OWYA 1YJ93 2XFSA 1BGSA 2UGIA 4FCMA 2P38A 1O7HB 5A0OB 1RNBA 3EHCA 2CWUA 4NREA 2W9QA 1GOYA 3OV4A 1YVSA 3F7XA 4CDLA 1YIT3 1GYBA 4KT3B 2XR8B 3B8LA 2Q07A 3LH4A 3DGOA 3GZBA 3JUQA 5HGRA 1OPYA 1TTOA 3EBYA 3URPA 1UCLA 5LC6A 1IT7A 3LZAA 1JZOA 1RGHA 1K41A 3KCHA 4GSPA 2FGTA 1W2B2 3CCV3 2YFIB 1PU4A 2SARA 3CC43 1JV2B 3LTAA 5KP1A 1BSBA 1EUIC 1R4YA 3QRDA 4HVNA 1FYSA 4BIRA 4O02B 3LXUX 6RNTA 1S723 7GSPA 3ZG0A 5LC7A 1I3FA 3GWRA 3X41A 2Y74A 4EV2A 1DE3A 3GRDA 2HOHA 1NB5I 1MNLA 4HJLB 4R1KA 3SEDA 1RN1A 2CFLA
chains in the Genus database with same CATH topology
3HOHA 1UCJA 2F5WA 2KF4A 1BSEA 1BVIA 2F4YA 1RCKA 1I2EA 1CH0A 2RNTA 3AHWA 2BIRA 4HAAA 3DGYA 1LNIA 1UCKA 1I8VA 1BRHA 4GHOA 1BRSA 1I0VA 1I70A 1UCIA 1ZGXA 1X1YA 1YGWA 1AQZA 1BNJA 1X1XA 3BIRA 1RDSA 1RSNA 2KF5A 3DH2A 2AADA 1RN4A 1LOVA 1LOWA 1BSCA 1BRJA 1B3SA 1IYYA 1JBTA 1RTUA 1PYLA 1FW7A 3AGOA 1BIRA 1BANA 1BNIA 2F56A 1BSDA 1TRQA 3AGNA 3D5GA 1LRAA 1BNEA 1B2XA 2ZA4A 3AHSA 1GMPA 1MGRA 2KAAA 1RGEA 1RGFA 1BSAA 4HOHA 1I0XA 3SYUA 1BRKA 1RLSA 4RNTA 1PY3A 1X1UA 6GSPA 1GSPA 1RGLA 1BRGA 3WR2A 1T2HA 1T2IA 1I2GA 1X1WA 2RBIA 1BUJA 4J5KA 1RGCA 1A2PA 1RNTA 1B2ZA 4J5GA 3D5IA 1AY7A 1BNSA 1MGWA 1FZUA 1JBRA 1FUSA 1RGAA 4BU4A 2KF6A 8RNTA 1B27A 1GOUA 1FUTA 7RNTA 1BU4A 1YNVX 1BGSA 1LOYA 1Q9EA 1B2MA 2KF3A 1B2SA 1I3IA 1RGKA 1RNBA 1RCLA 3D4AA 1GOYA 1YVSA 5BU4A 3WHOA 3BU4A 2GSPA 3GSPA 1B20A 5RNTA 1BAOA 1BNFA 1RHLA 1TTOA 1DETA 2C4BA 3URPA 1UCLA 1HYFA 1SARA 1BRNL 3A5EA 1RGHA 3RNTA 3KCHA 4GSPA 1TRPA 1RMSA 2SARA 9RNTA 1B2UA 1RGGA 1BSBA 1G02A 1R4YA 1GMQA 2F5MA 1I2FA 1FYSA 4BIRA 2BU4A 1GOVA 6RNTA 7GSPA 1BNRA 1BRIA 1C54A 1BNGA 1HZ1A 5BIRA 1I3FA 3Q3FA 1DE3A 2HOHA 5HOHA 2AAEA 1GMRA 5GSPA 1JBSA 1BOXA 1RN1A 1B21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOH A;  1UCJ A;  2F5W A;  2KF4 A;  1BSE A;  1BVI A;  2F4Y A;  1RCK A;  1I2E A;  1CH0 A;  2RNT A;  3AHW A;  2BIR A;  4HAA A;  3DGY A;  1LNI A;  1UCK A;  1I8V A;  1BRH A;  4GHO A;  1BRS A;  1I0V A;  1I70 A;  1UCI A;  1ZGX A;  1X1Y A;  1YGW A;  1AQZ A;  1BNJ A;  1X1X A;  3BIR A;  1RDS A;  1RSN A;  2KF5 A;  3DH2 A;  2AAD A;  1RN4 A;  1LOV A;  1LOW A;  1BSC A;  1BRJ A;  1B3S A;  1IYY A;  1JBT A;  1RTU A;  1PYL A;  1FW7 A;  3AGO A;  1BIR A;  1BAN A;  1BNI A;  2F56 A;  1BSD A;  1TRQ A;  3AGN A;  3D5G A;  1LRA A;  1BNE A;  1B2X A;  2ZA4 A;  3AHS A;  1GMP A;  1MGR A;  2KAA A;  1RGE A;  1RGF A;  1BSA A;  4HOH A;  1I0X A;  3SYU A;  1BRK A;  1RLS A;  4RNT A;  1PY3 A;  1X1U A;  6GSP A;  1GSP A;  1RGL A;  1BRG A;  3WR2 A;  1T2H A;  1T2I A;  1I2G A;  1X1W A;  2RBI A;  1BUJ A;  4J5K A;  1RGC A;  1A2P A;  1RNT A;  1B2Z A;  4J5G A;  3D5I A;  1AY7 A;  1BNS A;  1MGW A;  1FZU A;  1JBR A;  1FUS A;  1RGA A;  4BU4 A;  2KF6 A;  8RNT A;  1B27 A;  1GOU A;  1FUT A;  7RNT A;  1BU4 A;  1YNV X;  1BGS A;  1LOY A;  1Q9E A;  1B2M A;  2KF3 A;  1B2S A;  1I3I A;  1RGK A;  1RNB A;  1RCL A;  3D4A A;  1GOY A;  1YVS A;  5BU4 A;  3WHO A;  3BU4 A;  2GSP A;  3GSP A;  1B20 A;  5RNT A;  1BAO A;  1BNF A;  1RHL A;  1TTO A;  1DET A;  2C4B A;  3URP A;  1UCL A;  1HYF A;  1SAR A;  1BRN L;  3A5E A;  1RGH A;  3RNT A;  3KCH A;  4GSP A;  1TRP A;  1RMS A;  2SAR A;  9RNT A;  1B2U A;  1RGG A;  1BSB A;  1G02 A;  1R4Y A;  1GMQ A;  2F5M A;  1I2F A;  1FYS A;  4BIR A;  2BU4 A;  1GOV A;  6RNT A;  7GSP A;  1BNR A;  1BRI A;  1C54 A;  1BNG A;  1HZ1 A;  5BIR A;  1I3F A;  3Q3F A;  1DE3 A;  2HOH A;  5HOH A;  2AAE A;  1GMR A;  5GSP A;  1JBS A;  1BOX A;  1RN1 A;  1B21 A; 
#chains in the Genus database with same CATH topology
 3HOH A;  2KF4 A;  2YX9 A;  1IVX A;  4BTY A;  1BSE A;  1N5H A;  4AEQ A;  1I2E A;  2RNT A;  1KD1 4;  3NHX A;  4HAA A;  3DGY A;  4GL6 A;  3DGL A;  4EYC A;  5JPU A;  3B4O A;  2INX A;  3WMD A;  1IU7 A;  2OWP A;  4FMA A;  4HM2 B;  4GHO A;  3V98 A;  3N9H A;  1Q7H A;  3NQZ A;  1UI7 A;  3HZP A;  3LML A;  3NV0 A;  3BIR A;  3BLZ A;  1RDS A;  1SII A;  5TGN A;  1SQW A;  4R4K A;  2AAD A;  1ZO2 A;  3H51 A;  3K0Z A;  1JB5 A;  3FGY A;  4K1V A;  1ROV A;  3WOF B;  2HMM B;  3G0K A;  1JBT A;  3D3L A;  3MHE A;  1PYL A;  1FGQ A;  2LYX A;  1W6C A;  1E97 A;  3DM8 A;  1BAN A;  1IDP A;  1V57 A;  3G16 A;  1M90 4;  2E2T A;  1VQ5 3;  2F56 A;  3DZL A;  4RZM A;  1N8Q A;  2CW9 A;  1E3R A;  1SIH A;  4WP5 A;  1BNE A;  3H3H A;  2CC3 A;  2ZA4 A;  3AHS A;  2CWT A;  3F7S A;  1O7W B;  4O3V A;  2FXT A;  5ELJ A;  3CCL 3;  1JRQ A;  3CCS 3;  5CF2 A;  3LTC A;  1RGE A;  3G71 3;  1RGF A;  3HX8 A;  1BSA A;  1SJW A;  5G1L A;  3FF0 A;  2J8X B;  2W9P A;  1RJO A;  2Z77 A;  1KC8 4;  3JUO A;  1GY6 A;  4RNZ A;  4U13 A;  1ISK A;  2LQV A;  4ILF A;  3X40 A;  4STD A;  3UNL A;  4R9L A;  4WYK B;  2K3D A;  1QAF A;  5G1K A;  5AYS C;  2GEY A;  1O7N B;  2JQ5 A;  2RBI A;  4L7K A;  3UJM A;  4J5K A;  4H61 A;  3EJV A;  2XGN A;  1JKG A;  1RNT A;  2W56 A;  3CPO A;  4J5G A;  3D5I A;  1DVD A;  1VQQ A;  3EB8 A;  2KF6 A;  3F14 A;  4XDV A;  3ZG5 A;  1NO3 A;  2QGU A;  3KKG A;  3SOY A;  8RNT A;  7RNT A;  1FUT A;  2GEX A;  2H0G A;  2OTJ 3;  4LGQ A;  3B4P A;  2HMJ B;  1YNV X;  2OOV C;  1LOY A;  3EC9 A;  1RKY A;  2GBX B;  1B2S A;  1I3I A;  4I5Q A;  4R80 A;  1RCL A;  3D4A A;  2V1L A;  1ULJ B;  2BMO B;  3S28 A;  5BU4 A;  4N6T A;  1OH0 A;  3BU4 A;  2GSP A;  3CNX A;  3Q90 A;  1B20 A;  4KFF A;  1W6G A;  3N8B A;  3TDG A;  1RHL A;  3UL6 A;  1UGH I;  3RGA A;  5RNT A;  1GY7 A;  1TU5 A;  4IIA A;  4WFO A;  1MOL A;  1IT8 A;  1SAR A;  3SOA A;  3WOE B;  1TP6 A;  1UUW B;  2P09 A;  1U5O A;  9RNT A;  2QEX 3;  4N6U A;  1YGE A;  4HM4 B;  3X42 A;  2F5M A;  4L8O A;  1UW1 A;  3ECF A;  4MMY B;  1FUW A;  1TFO A;  1GOV A;  1NU3 A;  2OQE C;  1EEJ A;  3MG1 A;  2K54 A;  4HM3 B;  5FGO A;  3MG3 A;  1JN5 A;  1BNG A;  3L0R A;  4EC6 A;  5BIR A;  3Q3F A;  1K28 A;  2CFG A;  4MEI A;  1G0T A;  1W5Z A;  4N3V A;  2AAE A;  3U97 A;  1JBS A;  1M9G A;  1IV9 A;  1ROA A;  3KE7 A;  2CK3 H;  1B21 A;  2IYJ A;  3KII A;  2XF3 A;  1QVG 2;  2F5W A;  1Q40 A;  1CEW I;  2F4Y A;  1RCK A;  3AHW A;  3CCU 3;  4K1U A;  5IEP A;  2IA7 A;  5IG5 A;  5AIF A;  4BTX A;  1BRS A;  1OHS A;  2BMQ B;  3SVA A;  1G96 A;  2ML5 A;  4Q53 A;  1AQZ A;  1VQ7 3;  3N54 B;  1YJN 3;  1OF5 A;  2P0X A;  3PGB A;  1X1X A;  3SLU A;  4LSO A;  1VQL 3;  5I97 A;  4MMZ B;  3DH2 A;  3DUK A;  3F8X A;  4XB5 A;  2BO9 B;  1LOV A;  3DY5 A;  5EQL A;  5G2G A;  4HM8 B;  1UGI A;  3BNE A;  4BL3 A;  3MG2 A;  1BSC A;  1BRJ A;  3CU3 A;  1B3S A;  1FA3 A;  5M18 A;  1EG9 B;  2E2U A;  2BHM A;  1VQ8 3;  5AEW B;  1YJW 3;  2XH9 A;  1BIR A;  3LYG A;  3CD6 3;  2C10 A;  1N5P A;  1NDO B;  3FG3 A;  1YI2 3;  2XRX B;  3AGN A;  1JB2 A;  4WWU C;  3ALA A;  1LRA A;  3OW2 2;  3VGN A;  1B2X A;  2IMJ A;  3KSE D;  4N6M A;  1GD3 A;  4R9K A;  1LXE A;  1W7C A;  1MGR A;  1UI8 A;  4KZ1 A;  4CJN A;  1OGX A;  1W6Y A;  1AVK A;  4BL2 A;  4HZB B;  1T5Y A;  1I0X A;  2KXG A;  1SPU A;  3LTB A;  4XBX A;  3V92 A;  1A2V A;  2W0Q A;  2CFW A;  1NJI 4;  5CK6 A;  1LVN A;  2HMN B;  3MWZ A;  3CXC 2;  1YHQ 3;  4I4K A;  1VQ9 3;  1M1K 4;  1AV4 A;  1QAK A;  1UUG B;  1WNH A;  3GAX A;  2O9U X;  1GS3 A;  3SXX A;  1DMN A;  1GSP A;  1IVU A;  3NX0 A;  1RGL A;  1T2I A;  2W6J H;  1FGT A;  1WTH A;  1X1W A;  1LQM B;  2BT3 A;  4HM7 B;  1PFP A;  3UL5 A;  1S5A A;  4RBN A;  2CX1 A;  1Q82 4;  4EW5 A;  5CXO A;  1GD4 A;  4WYK A;  3NUV A;  3ZFZ A;  3OWS A;  3DGN A;  1FZU A;  1A67 A;  1Q81 4;  1JBR A;  5AIH A;  1RGA A;  1O7P B;  2STD A;  2UUG C;  4XBT A;  4O8S A;  4L8P A;  4BU4 A;  3PXM A;  1BU4 A;  1N9J A;  3ER7 A;  2Z6B A;  1AVL A;  4OUQ A;  5BXQ A;  4N6V 0;  1Q9E A;  1B2M A;  2KF3 A;  1ZS7 A;  1KSI A;  4HM1 B;  3S5C A;  2ML6 A;  2CHC A;  3WHO A;  1WMO A;  4NHF A;  3GSP A;  5IG4 A;  1Z1S A;  1EA2 A;  2W2C A;  1D6Z A;  1QJG A;  1YVB I;  1BNF A;  1NWW A;  1E3V A;  3A76 A;  1DET A;  1VQK 3;  3S67 A;  3NV0 B;  3FLJ A;  1HYF A;  5FW5 A;  3JVC A;  3CCJ 3;  3JUP A;  4J8T A;  3RNT A;  4MMX B;  1TIJ A;  1OAC A;  2CH9 A;  2D42 A;  1OHP A;  3LOY A;  1QMA A;  3HK4 A;  1LQG C;  1V58 A;  1B2U A;  1RGG A;  3WOD G;  3F8H A;  3NBB A;  5DRV A;  5STD A;  3UB1 A;  4JRF A;  1I2F A;  3K63 A;  3DMC A;  4FCJ A;  1JB4 A;  1C7H A;  3E99 A;  1CYV A;  4JF8 A;  1C54 A;  4RNY A;  2BNG A;  5AI1 A;  1D6U A;  3I55 3;  2K0M A;  3CMA 3;  4H3U A;  3NM7 A;  4HZ9 B;  3EN8 A;  3J7Y d;  5HOH A;  1IQY A;  5GSP A;  1ZX2 A;  4PEJ A;  4AKY A;  4IT7 A;  3AGO A;  5AYR B;  2CG1 A;  1GY5 A;  1UCJ A;  2H0H A;  2MF7 A;  1TJD A;  1BVI A;  4NPB A;  5JPP A;  5IF6 A;  1CH0 A;  4DKI A;  3QK9 A;  4EBG A;  1LNI A;  4BTW A;  1Q86 4;  3KSP A;  2GBW B;  2XSH B;  1D6Y A;  3GZY B;  5D83 A;  5ELU A;  1J2B A;  2I9W A;  1UCI A;  1NB3 I;  1X1Y A;  3T8N A;  3PCR A;  1M1X B;  3T0U A;  3X3Y A;  1A90 A;  3NQY A;  1BNJ A;  1VQ4 3;  3S29 A;  4J9A A;  4N6L A;  3I0Y A;  5CLK A;  4FMB A;  4LMI A;  1RN4 A;  2P0M A;  2XGL A;  1DVC A;  4O2H A;  5IER A;  1MWR A;  1W00 A;  1VQO 3;  3NM2 A;  1LNH A;  5CF1 A;  1US1 A;  1EKM A;  1IQX A;  1BUQ A;  2HMK B;  1BNI A;  4FR9 A;  1VQ6 3;  1Q42 A;  3RGR A;  4XBY A;  1BSD A;  3F40 A;  1TRQ A;  2XSO B;  3BNB A;  2HML B;  1RN7 A;  3D5G A;  1WMN A;  2JDI H;  3WDG B;  8CHO A;  1V74 A;  1MWU A;  2KAA A;  2A15 A;  5IW9 A;  1CQS A;  3CNM A;  1IK3 A;  2L4V A;  1YIJ 3;  1FGM A;  3BND A;  2IUK A;  1VZZ A;  1RLS A;  3CCR 3;  4FMD A;  2CFK A;  3OXA A;  2R41 A;  1RRH A;  4XM4 A;  3X3Z A;  1JNQ A;  4FCZ A;  2O3O A;  1JJ2 2;  2CFD A;  6GSP A;  1BRG A;  1W02 A;  3WR2 A;  3K9M C;  5KP3 A;  3AMO B;  3FG1 A;  1I2G A;  4HBR A;  3B7C A;  3LT9 A;  3PZW A;  1Q7Y 4;  1QAL A;  4LEH A;  1A2K A;  4X2H A;  3FZW A;  3JUN A;  5AIG A;  2RSX A;  2RCD A;  3Q1C A;  1JN5 B;  1OGZ A;  3EQQ B;  1AY7 A;  1BNS A;  2HMO B;  3FKA A;  4KFE A;  4GB5 A;  1L5G B;  3FH1 A;  1WMP A;  3D9R A;  1GOU A;  5IG3 A;  5EVH A;  5IEN A;  4IPB A;  4CPK A;  3IPT A;  1Q40 B;  2F86 B;  3LT8 A;  4HM6 B;  3ROB A;  5KP4 A;  2XFT A;  3EX9 A;  3PYJ A;  1KWI A;  4KFD A;  3CCM 3;  2UX0 A;  1RGK A;  1FGR A;  4K90 B;  1FGO A;  3GZR A;  4K61 A;  1IVW A;  2C11 A;  2CWV A;  1OCV A;  3FF2 A;  3G4S 3;  2R4I A;  1U8C B;  3G8Z A;  3STD A;  3HIG A;  1BAO A;  3WA2 X;  2M7O A;  1TFK A;  2ZDJ A;  5AEU B;  1OF5 B;  4HYZ A;  2C4B A;  2GU3 A;  4N6N B;  1BRN L;  2WGQ A;  1OHO A;  3HII A;  2E2V A;  3A5E A;  5JBS A;  4HKV B;  4EV5 A;  1TRP A;  3K5T A;  2F98 A;  1RMS A;  4TX4 A;  3O8Y A;  1RRL A;  1G02 A;  6STD A;  3K7C A;  1GMQ A;  3MYT A;  1TUH A;  2B24 B;  2BU4 A;  3EBT A;  1W2Z A;  3CC7 3;  3M8C A;  1BRI A;  1HZ1 A;  1NNV A;  1OUN A;  3D79 A;  3OX9 A;  4HM5 B;  5EEO A;  3S27 A;  2CG0 A;  2ZL8 A;  1GMR A;  1W01 A;  2Z7A A;  1BOX A;  3NXJ A;  1VQP 3;  3X3X A;  4OK0 A;  1MWT A;  3V99 A;  1VQN 3;  2PNC A;  4OVM A;  3CME 3;  3MSO A;  1MWS A;  3IMA B;  2BIR A;  2H0I A;  2W04 A;  2RGQ A;  3DGM A;  1EQK A;  2P05 A;  2Y73 A;  3FCS B;  4XDW A;  1CYU A;  3PS8 A;  1UCK A;  3VF1 A;  1I8V A;  3LTD A;  3MKI A;  4FMC A;  1BRH A;  3FG4 A;  2CKF B;  4MJD A;  1I0V A;  4AKZ A;  2QA4 3;  1I70 A;  1T3B A;  1ZGX A;  1YGW A;  3KZT A;  4WHA A;  2MC8 A;  1QVF 2;  2YFJ B;  3GZX B;  2OCT A;  2OOV A;  1WQL B;  3G6E 3;  3SX1 A;  1RSN A;  2D1W A;  2KF5 A;  2SBL A;  3U1W A;  3OWU A;  3KFQ C;  3VSY A;  4LZI A;  5M19 A;  3T8U A;  1DYU A;  5AII A;  1IV7 A;  1Y4K A;  1LOW A;  1UDI I;  1IYY A;  1RTU A;  3KN4 A;  2FNQ A;  4QWT A;  2KCD A;  1LOX A;  4G1M B;  1FW7 A;  2WOH A;  2IUJ A;  7STD A;  3WA3 A;  1DMQ A;  1DMM A;  2QIY A;  1O7M B;  2W03 A;  3CCQ 3;  1K73 4;  2L1S A;  2RFR A;  3I56 3;  1R4C A;  1ULI B;  3EE1 A;  3DXO A;  2CX0 A;  3Q2P A;  2BMR B;  1VQM 3;  2WGO A;  3IJE B;  3JUM A;  1JZD A;  1N9E A;  5IG0 A;  3F9S A;  3CPW 2;  1GMP A;  2WO0 A;  5DRE A;  2IY2 A;  3EN1 B;  2OQE A;  1K9M 4;  4ZM8 A;  2KRT A;  3NBJ A;  4HOH A;  3BNC A;  1HKX A;  3RDE A;  3SYU A;  1UUV B;  2GXF A;  1BRK A;  4HM0 B;  1BNR A;  2GU1 A;  3HI7 A;  4RNT A;  3CC2 3;  3FSD A;  1F8N A;  1PY3 A;  3PCS A;  1AR0 A;  4X2O A;  1JKG B;  1X1U A;  2W56 B;  5D81 A;  2ZHX B;  1T2H A;  1N8R 4;  1KQS 2;  1ASK A;  2F99 A;  1O7G B;  4ORL A;  1BUJ A;  4LYL B;  1IQ8 A;  1RGC A;  2CIU A;  2Z76 A;  1A2P A;  2WOF A;  1B2Z A;  1STF I;  3MPH A;  4KVH A;  4EXR A;  1K8A 4;  4CCV A;  2OTL 3;  1MGW A;  1STD A;  3AMO A;  3BB9 A;  2PZV A;  1W4N A;  1FUS A;  3NBR A;  5M1A A;  5BVB A;  3EF8 A;  2XEP A;  5D82 A;  1HU9 A;  1B27 A;  1IVV A;  2YFL B;  3CCE 3;  2B1X B;  5IEO A;  4N6O B;  3OWY A;  1YJ9 3;  2XFS A;  1BGS A;  2UGI A;  4FCM A;  2P38 A;  1O7H B;  5A0O B;  1RNB A;  3EHC A;  2CWU A;  4NRE A;  2W9Q A;  1GOY A;  3OV4 A;  1YVS A;  3F7X A;  4CDL A;  1YIT 3;  1GYB A;  4KT3 B;  2XR8 B;  3B8L A;  2Q07 A;  3LH4 A;  3DGO A;  3GZB A;  3JUQ A;  5HGR A;  1OPY A;  1TTO A;  3EBY A;  3URP A;  1UCL A;  5LC6 A;  1IT7 A;  3LZA A;  1JZO A;  1RGH A;  1K41 A;  3KCH A;  4GSP A;  2FGT A;  1W2B 2;  3CCV 3;  2YFI B;  1PU4 A;  2SAR A;  3CC4 3;  1JV2 B;  3LTA A;  5KP1 A;  1BSB A;  1EUI C;  1R4Y A;  3QRD A;  4HVN A;  1FYS A;  4BIR A;  4O02 B;  3LXU X;  6RNT A;  1S72 3;  7GSP A;  3ZG0 A;  5LC7 A;  1I3F A;  3GWR A;  3X41 A;  2Y74 A;  4EV2 A;  1DE3 A;  3GRD A;  2HOH A;  1NB5 I;  1MNL A;  4HJL B;  4R1K A;  3SED A;  1RN1 A;  2CFL A; 
#chains in the Genus database with same CATH homology
 3HOH A;  1UCJ A;  2F5W A;  2KF4 A;  1BSE A;  1BVI A;  2F4Y A;  1RCK A;  1I2E A;  1CH0 A;  2RNT A;  3AHW A;  2BIR A;  4HAA A;  3DGY A;  1LNI A;  1UCK A;  1I8V A;  1BRH A;  4GHO A;  1BRS A;  1I0V A;  1I70 A;  1UCI A;  1ZGX A;  1X1Y A;  1YGW A;  1AQZ A;  1BNJ A;  1X1X A;  3BIR A;  1RDS A;  1RSN A;  2KF5 A;  3DH2 A;  2AAD A;  1RN4 A;  1LOV A;  1LOW A;  1BSC A;  1BRJ A;  1B3S A;  1IYY A;  1JBT A;  1RTU A;  1PYL A;  1FW7 A;  3AGO A;  1BIR A;  1BAN A;  1BNI A;  2F56 A;  1BSD A;  1TRQ A;  3AGN A;  3D5G A;  1LRA A;  1BNE A;  1B2X A;  2ZA4 A;  3AHS A;  1GMP A;  1MGR A;  2KAA A;  1RGE A;  1RGF A;  1BSA A;  4HOH A;  1I0X A;  3SYU A;  1BRK A;  1RLS A;  4RNT A;  1PY3 A;  1X1U A;  6GSP A;  1GSP A;  1RGL A;  1BRG A;  3WR2 A;  1T2H A;  1T2I A;  1I2G A;  1X1W A;  2RBI A;  1BUJ A;  4J5K A;  1RGC A;  1A2P A;  1RNT A;  1B2Z A;  4J5G A;  3D5I A;  1AY7 A;  1BNS A;  1MGW A;  1FZU A;  1JBR A;  1FUS A;  1RGA A;  4BU4 A;  2KF6 A;  8RNT A;  1B27 A;  1GOU A;  1FUT A;  7RNT A;  1BU4 A;  1YNV X;  1BGS A;  1LOY A;  1Q9E A;  1B2M A;  2KF3 A;  1B2S A;  1I3I A;  1RGK A;  1RNB A;  1RCL A;  3D4A A;  1GOY A;  1YVS A;  5BU4 A;  3WHO A;  3BU4 A;  2GSP A;  3GSP A;  1B20 A;  5RNT A;  1BAO A;  1BNF A;  1RHL A;  1TTO A;  1DET A;  2C4B A;  3URP A;  1UCL A;  1HYF A;  1SAR A;  1BRN L;  3A5E A;  1RGH A;  3RNT A;  3KCH A;  4GSP A;  1TRP A;  1RMS A;  2SAR A;  9RNT A;  1B2U A;  1RGG A;  1BSB A;  1G02 A;  1R4Y A;  1GMQ A;  2F5M A;  1I2F A;  1FYS A;  4BIR A;  2BU4 A;  1GOV A;  6RNT A;  7GSP A;  1BNR A;  1BRI A;  1C54 A;  1BNG A;  1HZ1 A;  5BIR A;  1I3F A;  3Q3F A;  1DE3 A;  2HOH A;  5HOH A;  2AAE A;  1GMR A;  5GSP A;  1JBS A;  1BOX A;  1RN1 A;  1B21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...