1BNJA

Barnase wildtype structure at ph 9.0
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Microbial ribonuclease
molecule keywords BARNASE
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bnjA00
1PY3A 1I2FA 1RN1A 1YGWA 4HOHA 1BRJA 1BSBA 1MGWA 2BU4A 2C4BA 1X1UA 4GHOA 2KF5A 1HZ1A 1UCIA 1B20A 1B21A 1RN4A 1I0VA 1GOVA 1GMPA 1BNGA 1RHLA 1LRAA 3GSPA 2KF3A 1BVIA 1X1XA 1FUSA 1BNSA 1BSAA 1BRSA 1RGHA 7RNTA 1RLSA 1JBSA 1RGCA 1RMSA 3AHSA 1C54A 1UCKA 1A2PA 1R4YA 1BSDA 1RNTA 2RNTA 4BIRA 9RNTA 2ZA4A 3D5GA 5RNTA 1X1YA 1BIRA 1B2UA 4GSPA 1CH0A 1I3IA 1LOYA 4BU4A 1B27A 6GSPA 6RNTA 3AHWA 3D5IA 1BSEA 2KAAA 1SARA 1BRKA 2F4YA 1RDSA 4HAAA 1GOUA 1LOWA 1BRIA 1BNEA 1YVSA 2F5WA 1I2GA 1BOXA 1TRPA 1DE3A 5GSPA 1RGGA 3D4AA 1RGFA 1RGAA 3SYUA 3WR2A 3HOHA 3KCHA 1G02A 1UCJA 1DETA 1RGKA 1JBRA 2AAEA 1BNRA 1LNIA 1BUJA 1IYYA 1GMRA 1BANA 1TRQA 3RNTA 1JBTA 1BRHA 1MGRA 2KF4A 1BRGA 1I70A 1I0XA 2GSPA 1GOYA 1RGLA 1RSNA 1B2MA 1HYFA 1X1WA 1RTUA 3A5EA 1FUTA 1RGEA 2BIRA 1Q9EA 1FYSA 3URPA 2F56A 1FZUA 1UCLA 1BU4A 3DH2A 1ZGXA 1I2EA 2AADA 1GMQA 3DGYA 3Q3FA 1RCKA 2HOHA 2RBIA 1B2XA 5HOHA 3AGNA 1GSPA 1YNVX 1I3FA 7GSPA 1I8VA 1B3SA 1B2ZA 1PYLA 1RCLA 2KF6A 5BU4A 1AQZA 1AY7A 3WHOA 1BGSA 1BNIA 3BU4A 8RNTA 1B2SA 1BRNL 1BNJA 1BSCA 2SARA 2F5MA 4J5GA 1RNBA 1BNFA 1LOVA 1BAOA 1T2IA 3BIRA 4RNTA 1FW7A 4J5KA 3AGOA 5BIRA 1TTOA 1T2HA
chains in the Genus database with same CATH superfamily
1PY3A 4O2HA 2HMNB 1MGWA 1MWUA 1UDII 2ZHXB 3V92A 2IMJA 2QIYA 4GHOA 4LEHA 1WNHA 3D9RA 1UCIA 1B21A 4BTYA 2C10A 1Q40A 4JRFA 4ORLA 1GMPA 4CJNA 1S723 1FGMA 1LRAA 2J8XB 2Z77A 3MWZA 1K28A 1OHSA 2WGQA 2L1SA 1VQ83 1KSIA 3FF0A 3SX1A 1ZS7A 3OXAA 1YIT3 1LNHA 1O7NB 3KE7A 3U1WA 1W6CA 5DREA 3S29A 3U97A 1DMMA 3KIIA 4EC6A 2XFSA 6STDA 1JB5A 4MEIA 5JPUA 1IDPA 2BT3A 3LZAA 1EKMA 3KZTA 1U5OA 4FMDA 2CK3H 2CFWA 1UCKA 2CH9A 2RCDA 1A2PA 2XRXB 3EC9A 3F9SA 3PCSA 1W7CA 5G1LA 5CF2A 1HU9A 5ELUA 4CDLA 1Q7Y4 1PFPA 2ZA4A 1CYVA 3I0YA 1LOXA 1KC84 3B7CA 3ER7A 2OWPA 3NQYA 3LYGA 4STDA 5AI1A 3FG1A 5EQLA 2WOHA 2XR8B 3N8BA 4AKZA 1ZX2A 4BU4A 3GWRA 3NM2A 4Q53A 4BTWA 1FA3A 2KAAA 1Q40B 3F7SA 1LVNA 2QA43 5AIFA 4HYZA 3MG1A 4AEQA 1RDSA 1E3RA 1Z1SA 2PNCA 4N6MA 3FCSB 5M19A 1GY5A 3X41A 3CC43 2P0XA 1BUQA 1YJN3 1YVSA 2F5WA 4OUQA 4L8PA 1RRLA 5G2GA 5GSPA 1GY6A 1DVDA 1VZZA 3WR2A 4N6OB 3X42A 1G02A 2YFJB 1DETA 3B8LA 3M8CA 1IU7A 3BNEA 1LNIA 1BUJA 4WYKB 1CEWI 4LYLB 1BANA 1GS3A 4GL6A 5LC7A 1UI7A 1N5PA 4EBGA 4MMYB 1GOYA 1RGLA 2GBXB 1HYFA 5STDA 3VGNA 5IENA 1Q824 3ECFA 1RTUA 1RJOA 1A2VA 1YI23 1RGEA 1FYSA 5KP1A 4R9KA 1STDA 2QGUA 2C11A 1VQ43 1EA2A 2OQEC 1ZGXA 3WODG 1I2EA 1TU5A 3FGYA 2IUKA 4XB5A 1RN7A 1B2XA 1JKGA 2W6JH 4KFFA 4KFDA 3T0UA 1S5AA 1I3FA 1L5GB 4CPKA 2CWTA 2GU1A 1B3SA 4FCMA 2F99A 1SIHA 3DGMA 4X2HA 1VQN3 1QALA 4FMCA 3JVCA 2IA7A 3LH4A 4WYKA 3BU4A 3NBBA 1BSCA 2STDA 3IJEB 5AEWB 2SARA 3CXC2 1MWRA 3CME3 2CWVA 3LTDA 3MPHA 3E99A 1QVG2 2YFIB 1TJDA 1BAOA 2L4VA 4KVHA 4RNTA 1YHQ3 1FW7A 1FGOA 1IV9A 2Q07A 1NO3A 3NBRA 3EF8A 5IG3A 1I2FA 1K734 1D6YA 1AVLA 1IQXA 1AV4A 1X1UA 4HJLB 3UJMA 1OPYA 2W03A 2IY2A 3FG4A 1CQSA 4HM1B 1ROVA 2I9WA 1KD14 1ZO2A 1RN4A 1W2ZA 3BB9A 1RHLA 1UGHI 1EG9B 1ULJB 3Q90A 3MKIA 2CG1A 2UX0A 1Q42A 3OWYA 4HZ9B 3UNLA 5IG4A 1BVIA 2HMJB 3GRDA 1A90A 1X1XA 2ML6A 5AYRB 3MG2A 4WWUC 1N5HA 4MMXB 1VQ73 3SEDA 1YVBI 1BRSA 1VQ53 3IPTA 1RLSA 4OVMA 1JJ22 2QEX3 4LSOA 1TFKA 1RGCA 2CFDA 4HBRA 4NHFA 3WA2X 1J2BA 1YIJ3 3X3YA 5D83A 2CWUA 3WA3A 3DGOA 2XF3A 1OUNA 1QJGA 2WGOA 3S67A 4OK0A 2MC8A 1F8NA 1US1A 3Q2PA 1VQO3 3K9MC 3V99A 3F7XA 2P0MA 4IT7A 2UGIA 3FKAA 1B27A 2FNQA 3AHWA 1BSEA 3AMOB 3EB8A 1VQ93 2D1WA 1AR0A 2CFLA 2CG0A 4HZBB 2ML5A 1W6GA 4RBNA 2XSOB 3PS8A 4LZIA 2FGTA 1EUIC 3FG3A 1W6YA 1LOWA 3NX0A 1YJW3 2BNGA 3FF2A 4KFEA 2YFLB 1UUVB 1I2GA 1MWTA 4HVNA 4MMZB 1BOXA 3JUOA 1DE3A 4R1KA 5M1AA 1ASKA 4LGQA 1NB3I 3D4AA 1IVUA 4N6UA 3SYUA 4EYCA 1RGKA 3S27A 3S28A 3S5CA 2AAEA 1HKXA 1IYYA 1W01A 3RNTA 1TRQA 4HM4B 2CW9A 1UI8A 2E2VA 3G4S3 1VQQA 1BRGA 2KF4A 5AYSC 1VQL3 2RFRA 1OHPA 1STFI 3F40A 4EXRA 1IQ8A 1RRHA 5EVHA 3NXJA 5LC6A 1IV7A 2Z7AA 3LMLA 1E3VA 1TUHA 1Q9EA 3KSED 4EV2A 5CXOA 2SBLA 1T3BA 1QMAA 1BU4A 1FGTA 4XBYA 1JNQA 1W00A 3DM8A 3H3HA 2D42A 1Q814 2HOHA 2RBIA 5HOHA 2OTJ3 3AGNA 3SXXA 3CCM3 1OF5A 1B2ZA 1WMPA 2KF6A 1TFOA 3MSOA 2HMLB 2W0QA 2YX9A 3CCQ3 4N6TA 1FUWA 2CC3A 1BNIA 4FCZA 4N6V0 8RNTA 1BRNL 3NV0B 2P09A 1NWWA 2UUGC 3B4PA 3LOYA 4H61A 4K90B 3OW22 1NB5I 3VSYA 1BNFA 3CCU3 3BIRA 3NUVA 3X3ZA 3T8NA 3UL6A 1NNVA 1WTHA 1T2HA 1WMOA 1NU3A 3O8YA 4I5QA 5DRVA 3EE1A 1R4CA 1BRJA 3ZG5A 2K54A 3OX9A 1ULIB 5CF1A 1HZ1A 4HM7B 1O7MB 2BHMA 5G1KA 3CCV3 1KQS2 1UGIA 1RKYA 2KCDA 2XH9A 1I0VA 1GOVA 3EBTA 2F98A 2Z76A 2M7OA 3GZRA 4HM0B 4L7KA 3ALAA 3SLUA 3GSPA 1N9EA 2OOVC 4QWTA 3CU3A 3CPW2 3CPOA 4R9LA 4WP5A 5I97A 4R80A 1BSAA 1DVCA 2CIUA 2PZVA 3CNMA 7RNTA 2Z6BA 3LTBA 3CCS3 2H0GA 1OGXA 2ZDJA 3FH1A 1FGQA 3D79A 3LTCA 2Y74A 4X2OA 2O3OA 1JBSA 3HI7A 4HM3B 3AHSA 3I563 1C54A 3JUQA 1O7WB 1RNTA 2V1LA 1E97A 2HMOB 2O9UX 4JF8A 4BIRA 3MYTA 1JZOA 3DGNA 3GAXA 3PYJA 9RNTA 5RNTA 1QAFA 1A67A 1V74A 1X1YA 1BIRA 1GD4A 2LQVA 2CX1A 3N9HA 4K1VA 3DMCA 3K63A 1NDOB 4I4KA 1VQ63 1CH0A 1I3IA 2B24B 1JV2B 4O02B 3STDA 3NBJA 1CYUA 1SARA 1BRKA 2GU3A 3GZYB 5IERA 3JUNA 1IQYA 1W5ZA 4HAAA 3J7Yd 2OOVA 4FMAA 5KP4A 1GOUA 3B4OA 4K1UA 3RGRA 3HIIA 3EN1B 3GZXB 1IVVA 5D82A 2OCTA 3X3XA 5IEPA 3CCL3 1U8CB 4AKYA 1N8R4 1TRPA 4O3VA 4RNYA 1UUWB 2W56A 5CK6A 3UB1A 3CCR3 3TDGA 2MF7A 1RGAA 2CKFB 2XEPA 4DKIA 1OACA 1UCJA 3K0ZA 1JBRA 1NJI4 2CFKA 1DYUA 4XBXA 3BNBA 1BNRA 2LYXA 3ZG0A 1UW1A 3V98A 1GMRA 3KN4A 1VQM3 3F8HA 2OQEA 1JKGB 4MJDA 1BRHA 4PEJA 3PGBA 1MGRA 4U13A 1M904 3EQQB 4IPBA 1I70A 1W4NA 2K0MA 1I0XA 2CHCA 1JN5B 2W04A 3DUKA 3KFQC 4N6LA 2P38A 1IK3A 5BVBA 1G0TA 5AEUB 3ZFZA 2Y73A 1TIJA 4H3UA 3SOYA 2E2UA 4IIAA 1SQWA 3X40A 5CLKA 3CCJ3 2BIRA 1LQGC 1O7PB 2R41A 1UCLA 2KXGA 3T8UA 4O8SA 3DH2A 4KT3B 2AADA 1GMQA 3DGYA 2XGLA 3N54B 3CCE3 1N9JA 4J9AA 3DY5A 1T5YA 1YNVX 3SOAA 3G713 2W56B 3L0RA 4XM4A 3EHCA 1OGZA 5M18A 2HMKB 1GY7A 2W9QA 3WHOA 3BNDA 4HM8B 3WOFB 4BL3A 4KZ1A 3RGAA 1W2B2 4WHAA 4HM5B 3QRDA 1GD3A 3JUPA 5AIGA 4J5GA 1DMQA 3DZLA 4K61A 4FR9A 1JN5A 3CNXA 1T2IA 4NPBA 3AGOA 3KSPA 1TTOA 5IG5A 3NHXA 1ROAA 5A0OB 3FSDA 4HOHA 1RN1A 1YGWA 2BMQB 3MHEA 1M1K4 1BSBA 3JUMA 3G6E3 1JZDA 2BU4A 1MWSA 2C4BA 3KKGA 5D81A 2KF5A 1JB2A 1MOLA 2K3DA 1SJWA 3LTAA 1GYBA 1K8A4 1B20A 1LQMB 1D6ZA 2GEYA 3VF1A 1QVF2 1BNGA 2XFTA 3K5TA 3NM7A 3NV0A 2R4IA 3PCRA 4GB5A 2JQ5A 2RSXA 3F14A 5IF6A 2BMRB 2KF3A 4BL2A 4CCVA 1IT7A 5IEOA 1FUSA 2XGNA 1G96A 3K7CA 3RDEA 2H0HA 1BNSA 3QK9A 5FW5A 3HK4A 1OHOA 2WOFA 1ISKA 3EX9A 1RGHA 2E2TA 3G0KA 2H0IA 3D3LA 4RZMA 4BTXA 1RMSA 4HM2B 4R4KA 1WMNA 1R4YA 1BSDA 1K41A 2RNTA 2WO0A 4XDWA 3PZWA 1Q864 3EN8A 1M9GA 3LXUX 1AVKA 2KRTA 1O7GB 3Q1CA 5EEOA 3UL5A 3D5GA 4XDVA 3ROBA 3DXOA 3OWUA 1B2UA 4GSPA 4L8OA 4HKVB 2BMOB 3WDGB 1LOYA 1LXEA 3LT9A 5KP3A 1FGRA 6GSPA 2XSHB 4XBTA 6RNTA 3D5IA 3CMA3 3CD63 1EQKA 1D6UA 1EEJA 1K9M4 1SIIA 2F4YA 1A2KA 4G1MB 1V58A 4EW5A 1C7HA 4FCJA 3BNCA 5FGOA 1YJ93 3GZBA 3H51A 1BRIA 2JDIH 1BNEA 3FLJA 4N3VA 3I553 5ELJA 1TP6A 1PU4A 5AIHA 1RGGA 3G16A 3NQZA 1RGFA 3A76A 3FZWA 3HIGA 3OWSA 4HM6B 2GEXA 3HOHA 3KCHA 4LMIA 4TX4A 1MNLA 3CC73 3AMOA 5TGNA 5BXQA 1UUGB 8CHOA 2RGQA 3HZPA 1JBTA 1IVWA 1Q7HA 5JPPA 2IUJA 4ZM8A 2GSPA 2W9PA 1JB4A 1W02A 2ZL8A 5AIIA 5JBSA 1RSNA 1B2MA 1X1WA 1IVXA 2GBWB 3EJVA 5IW9A 1IT8A 1KWIA 4ILFA 3A5EA 1FUTA 1OCVA 3LT8A 2BO9B 2P05A 3F8XA 3URPA 3WMDA 2B1XB 1VQK3 2F56A 1FZUA 2GXFA 1V57A 3DGLA 2A15A 2IYJA 3IMAB 3PXMA 3WOEB 1DMNA 2HMMB 3BLZA 3SVAA 2F86B 1RCKA 1M1XB 3Q3FA 3OV4A 4WFOA 1GSPA 1Y4KA 5HGRA 7GSPA 1I8VA 2CFGA 1N8QA 1PYLA 1RCLA 2CX0A 4J8TA 1AQZA 4N6NB 5BU4A 3CC23 1WQLB 4NREA 1AY7A 2OTL3 1BGSA 1B2SA 1SPUA 4EV5A 1YGEA 1BNJA 2FXTA 5IG0A 1JRQA 3G8ZA 2F5MA 1VQP3 1RNBA 1O7HB 4RNZA 1LOVA 1OH0A 3HX8A 2INXA 3EBYA 4J5KA 5BIRA 3MG3A 4FMBA 7STDA 1OF5B 1QAKA 2W2CA
chains in the Genus database with same CATH topology
1PY3A 1I2FA 1RN1A 1YGWA 4HOHA 1BRJA 1BSBA 1MGWA 2BU4A 2C4BA 1X1UA 4GHOA 2KF5A 1HZ1A 1UCIA 1B20A 1B21A 1RN4A 1I0VA 1GOVA 1GMPA 1BNGA 1RHLA 1LRAA 3GSPA 2KF3A 1BVIA 1X1XA 1FUSA 1BNSA 1BSAA 1BRSA 1RGHA 7RNTA 1RLSA 1JBSA 1RGCA 1RMSA 3AHSA 1C54A 1UCKA 1A2PA 1R4YA 1BSDA 1RNTA 2RNTA 4BIRA 9RNTA 2ZA4A 3D5GA 5RNTA 1X1YA 1BIRA 1B2UA 4GSPA 1CH0A 1I3IA 1LOYA 4BU4A 1B27A 6GSPA 6RNTA 3AHWA 3D5IA 1BSEA 2KAAA 1SARA 1BRKA 2F4YA 1RDSA 4HAAA 1GOUA 1LOWA 1BRIA 1BNEA 1YVSA 2F5WA 1I2GA 1BOXA 1TRPA 1DE3A 5GSPA 1RGGA 3D4AA 1RGFA 1RGAA 3SYUA 3WR2A 3HOHA 3KCHA 1G02A 1UCJA 1DETA 1RGKA 1JBRA 2AAEA 1BNRA 1LNIA 1BUJA 1IYYA 1GMRA 1BANA 1TRQA 3RNTA 1JBTA 1BRHA 1MGRA 2KF4A 1BRGA 1I70A 1I0XA 2GSPA 1GOYA 1RGLA 1RSNA 1B2MA 1HYFA 1X1WA 1RTUA 3A5EA 1FUTA 1RGEA 2BIRA 1Q9EA 1FYSA 3URPA 2F56A 1FZUA 1UCLA 1BU4A 3DH2A 1ZGXA 1I2EA 2AADA 1GMQA 3DGYA 3Q3FA 1RCKA 2HOHA 2RBIA 1B2XA 5HOHA 3AGNA 1GSPA 1YNVX 1I3FA 7GSPA 1I8VA 1B3SA 1B2ZA 1PYLA 1RCLA 2KF6A 5BU4A 1AQZA 1AY7A 3WHOA 1BGSA 1BNIA 3BU4A 8RNTA 1B2SA 1BRNL 1BNJA 1BSCA 2SARA 2F5MA 4J5GA 1RNBA 1BNFA 1LOVA 1BAOA 1T2IA 3BIRA 4RNTA 1FW7A 4J5KA 3AGOA 5BIRA 1TTOA 1T2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PY3 A;  1I2F A;  1RN1 A;  1YGW A;  4HOH A;  1BRJ A;  1BSB A;  1MGW A;  2BU4 A;  2C4B A;  1X1U A;  4GHO A;  2KF5 A;  1HZ1 A;  1UCI A;  1B20 A;  1B21 A;  1RN4 A;  1I0V A;  1GOV A;  1GMP A;  1BNG A;  1RHL A;  1LRA A;  3GSP A;  2KF3 A;  1BVI A;  1X1X A;  1FUS A;  1BNS A;  1BSA A;  1BRS A;  1RGH A;  7RNT A;  1RLS A;  1JBS A;  1RGC A;  1RMS A;  3AHS A;  1C54 A;  1UCK A;  1A2P A;  1R4Y A;  1BSD A;  1RNT A;  2RNT A;  4BIR A;  9RNT A;  2ZA4 A;  3D5G A;  5RNT A;  1X1Y A;  1BIR A;  1B2U A;  4GSP A;  1CH0 A;  1I3I A;  1LOY A;  4BU4 A;  1B27 A;  6GSP A;  6RNT A;  3AHW A;  3D5I A;  1BSE A;  2KAA A;  1SAR A;  1BRK A;  2F4Y A;  1RDS A;  4HAA A;  1GOU A;  1LOW A;  1BRI A;  1BNE A;  1YVS A;  2F5W A;  1I2G A;  1BOX A;  1TRP A;  1DE3 A;  5GSP A;  1RGG A;  3D4A A;  1RGF A;  1RGA A;  3SYU A;  3WR2 A;  3HOH A;  3KCH A;  1G02 A;  1UCJ A;  1DET A;  1RGK A;  1JBR A;  2AAE A;  1BNR A;  1LNI A;  1BUJ A;  1IYY A;  1GMR A;  1BAN A;  1TRQ A;  3RNT A;  1JBT A;  1BRH A;  1MGR A;  2KF4 A;  1BRG A;  1I70 A;  1I0X A;  2GSP A;  1GOY A;  1RGL A;  1RSN A;  1B2M A;  1HYF A;  1X1W A;  1RTU A;  3A5E A;  1FUT A;  1RGE A;  2BIR A;  1Q9E A;  1FYS A;  3URP A;  2F56 A;  1FZU A;  1UCL A;  1BU4 A;  3DH2 A;  1ZGX A;  1I2E A;  2AAD A;  1GMQ A;  3DGY A;  3Q3F A;  1RCK A;  2HOH A;  2RBI A;  1B2X A;  5HOH A;  3AGN A;  1GSP A;  1YNV X;  1I3F A;  7GSP A;  1I8V A;  1B3S A;  1B2Z A;  1PYL A;  1RCL A;  2KF6 A;  5BU4 A;  1AQZ A;  1AY7 A;  3WHO A;  1BGS A;  1BNI A;  3BU4 A;  8RNT A;  1B2S A;  1BRN L;  1BNJ A;  1BSC A;  2SAR A;  2F5M A;  4J5G A;  1RNB A;  1BNF A;  1LOV A;  1BAO A;  1T2I A;  3BIR A;  4RNT A;  1FW7 A;  4J5K A;  3AGO A;  5BIR A;  1TTO A;  1T2H A; 
#chains in the Genus database with same CATH topology
 1PY3 A;  4O2H A;  2HMN B;  1MGW A;  1MWU A;  1UDI I;  2ZHX B;  3V92 A;  2IMJ A;  2QIY A;  4GHO A;  4LEH A;  1WNH A;  3D9R A;  1UCI A;  1B21 A;  4BTY A;  2C10 A;  1Q40 A;  4JRF A;  4ORL A;  1GMP A;  4CJN A;  1S72 3;  1FGM A;  1LRA A;  2J8X B;  2Z77 A;  3MWZ A;  1K28 A;  1OHS A;  2WGQ A;  2L1S A;  1VQ8 3;  1KSI A;  3FF0 A;  3SX1 A;  1ZS7 A;  3OXA A;  1YIT 3;  1LNH A;  1O7N B;  3KE7 A;  3U1W A;  1W6C A;  5DRE A;  3S29 A;  3U97 A;  1DMM A;  3KII A;  4EC6 A;  2XFS A;  6STD A;  1JB5 A;  4MEI A;  5JPU A;  1IDP A;  2BT3 A;  3LZA A;  1EKM A;  3KZT A;  1U5O A;  4FMD A;  2CK3 H;  2CFW A;  1UCK A;  2CH9 A;  2RCD A;  1A2P A;  2XRX B;  3EC9 A;  3F9S A;  3PCS A;  1W7C A;  5G1L A;  5CF2 A;  1HU9 A;  5ELU A;  4CDL A;  1Q7Y 4;  1PFP A;  2ZA4 A;  1CYV A;  3I0Y A;  1LOX A;  1KC8 4;  3B7C A;  3ER7 A;  2OWP A;  3NQY A;  3LYG A;  4STD A;  5AI1 A;  3FG1 A;  5EQL A;  2WOH A;  2XR8 B;  3N8B A;  4AKZ A;  1ZX2 A;  4BU4 A;  3GWR A;  3NM2 A;  4Q53 A;  4BTW A;  1FA3 A;  2KAA A;  1Q40 B;  3F7S A;  1LVN A;  2QA4 3;  5AIF A;  4HYZ A;  3MG1 A;  4AEQ A;  1RDS A;  1E3R A;  1Z1S A;  2PNC A;  4N6M A;  3FCS B;  5M19 A;  1GY5 A;  3X41 A;  3CC4 3;  2P0X A;  1BUQ A;  1YJN 3;  1YVS A;  2F5W A;  4OUQ A;  4L8P A;  1RRL A;  5G2G A;  5GSP A;  1GY6 A;  1DVD A;  1VZZ A;  3WR2 A;  4N6O B;  3X42 A;  1G02 A;  2YFJ B;  1DET A;  3B8L A;  3M8C A;  1IU7 A;  3BNE A;  1LNI A;  1BUJ A;  4WYK B;  1CEW I;  4LYL B;  1BAN A;  1GS3 A;  4GL6 A;  5LC7 A;  1UI7 A;  1N5P A;  4EBG A;  4MMY B;  1GOY A;  1RGL A;  2GBX B;  1HYF A;  5STD A;  3VGN A;  5IEN A;  1Q82 4;  3ECF A;  1RTU A;  1RJO A;  1A2V A;  1YI2 3;  1RGE A;  1FYS A;  5KP1 A;  4R9K A;  1STD A;  2QGU A;  2C11 A;  1VQ4 3;  1EA2 A;  2OQE C;  1ZGX A;  3WOD G;  1I2E A;  1TU5 A;  3FGY A;  2IUK A;  4XB5 A;  1RN7 A;  1B2X A;  1JKG A;  2W6J H;  4KFF A;  4KFD A;  3T0U A;  1S5A A;  1I3F A;  1L5G B;  4CPK A;  2CWT A;  2GU1 A;  1B3S A;  4FCM A;  2F99 A;  1SIH A;  3DGM A;  4X2H A;  1VQN 3;  1QAL A;  4FMC A;  3JVC A;  2IA7 A;  3LH4 A;  4WYK A;  3BU4 A;  3NBB A;  1BSC A;  2STD A;  3IJE B;  5AEW B;  2SAR A;  3CXC 2;  1MWR A;  3CME 3;  2CWV A;  3LTD A;  3MPH A;  3E99 A;  1QVG 2;  2YFI B;  1TJD A;  1BAO A;  2L4V A;  4KVH A;  4RNT A;  1YHQ 3;  1FW7 A;  1FGO A;  1IV9 A;  2Q07 A;  1NO3 A;  3NBR A;  3EF8 A;  5IG3 A;  1I2F A;  1K73 4;  1D6Y A;  1AVL A;  1IQX A;  1AV4 A;  1X1U A;  4HJL B;  3UJM A;  1OPY A;  2W03 A;  2IY2 A;  3FG4 A;  1CQS A;  4HM1 B;  1ROV A;  2I9W A;  1KD1 4;  1ZO2 A;  1RN4 A;  1W2Z A;  3BB9 A;  1RHL A;  1UGH I;  1EG9 B;  1ULJ B;  3Q90 A;  3MKI A;  2CG1 A;  2UX0 A;  1Q42 A;  3OWY A;  4HZ9 B;  3UNL A;  5IG4 A;  1BVI A;  2HMJ B;  3GRD A;  1A90 A;  1X1X A;  2ML6 A;  5AYR B;  3MG2 A;  4WWU C;  1N5H A;  4MMX B;  1VQ7 3;  3SED A;  1YVB I;  1BRS A;  1VQ5 3;  3IPT A;  1RLS A;  4OVM A;  1JJ2 2;  2QEX 3;  4LSO A;  1TFK A;  1RGC A;  2CFD A;  4HBR A;  4NHF A;  3WA2 X;  1J2B A;  1YIJ 3;  3X3Y A;  5D83 A;  2CWU A;  3WA3 A;  3DGO A;  2XF3 A;  1OUN A;  1QJG A;  2WGO A;  3S67 A;  4OK0 A;  2MC8 A;  1F8N A;  1US1 A;  3Q2P A;  1VQO 3;  3K9M C;  3V99 A;  3F7X A;  2P0M A;  4IT7 A;  2UGI A;  3FKA A;  1B27 A;  2FNQ A;  3AHW A;  1BSE A;  3AMO B;  3EB8 A;  1VQ9 3;  2D1W A;  1AR0 A;  2CFL A;  2CG0 A;  4HZB B;  2ML5 A;  1W6G A;  4RBN A;  2XSO B;  3PS8 A;  4LZI A;  2FGT A;  1EUI C;  3FG3 A;  1W6Y A;  1LOW A;  3NX0 A;  1YJW 3;  2BNG A;  3FF2 A;  4KFE A;  2YFL B;  1UUV B;  1I2G A;  1MWT A;  4HVN A;  4MMZ B;  1BOX A;  3JUO A;  1DE3 A;  4R1K A;  5M1A A;  1ASK A;  4LGQ A;  1NB3 I;  3D4A A;  1IVU A;  4N6U A;  3SYU A;  4EYC A;  1RGK A;  3S27 A;  3S28 A;  3S5C A;  2AAE A;  1HKX A;  1IYY A;  1W01 A;  3RNT A;  1TRQ A;  4HM4 B;  2CW9 A;  1UI8 A;  2E2V A;  3G4S 3;  1VQQ A;  1BRG A;  2KF4 A;  5AYS C;  1VQL 3;  2RFR A;  1OHP A;  1STF I;  3F40 A;  4EXR A;  1IQ8 A;  1RRH A;  5EVH A;  3NXJ A;  5LC6 A;  1IV7 A;  2Z7A A;  3LML A;  1E3V A;  1TUH A;  1Q9E A;  3KSE D;  4EV2 A;  5CXO A;  2SBL A;  1T3B A;  1QMA A;  1BU4 A;  1FGT A;  4XBY A;  1JNQ A;  1W00 A;  3DM8 A;  3H3H A;  2D42 A;  1Q81 4;  2HOH A;  2RBI A;  5HOH A;  2OTJ 3;  3AGN A;  3SXX A;  3CCM 3;  1OF5 A;  1B2Z A;  1WMP A;  2KF6 A;  1TFO A;  3MSO A;  2HML B;  2W0Q A;  2YX9 A;  3CCQ 3;  4N6T A;  1FUW A;  2CC3 A;  1BNI A;  4FCZ A;  4N6V 0;  8RNT A;  1BRN L;  3NV0 B;  2P09 A;  1NWW A;  2UUG C;  3B4P A;  3LOY A;  4H61 A;  4K90 B;  3OW2 2;  1NB5 I;  3VSY A;  1BNF A;  3CCU 3;  3BIR A;  3NUV A;  3X3Z A;  3T8N A;  3UL6 A;  1NNV A;  1WTH A;  1T2H A;  1WMO A;  1NU3 A;  3O8Y A;  4I5Q A;  5DRV A;  3EE1 A;  1R4C A;  1BRJ A;  3ZG5 A;  2K54 A;  3OX9 A;  1ULI B;  5CF1 A;  1HZ1 A;  4HM7 B;  1O7M B;  2BHM A;  5G1K A;  3CCV 3;  1KQS 2;  1UGI A;  1RKY A;  2KCD A;  2XH9 A;  1I0V A;  1GOV A;  3EBT A;  2F98 A;  2Z76 A;  2M7O A;  3GZR A;  4HM0 B;  4L7K A;  3ALA A;  3SLU A;  3GSP A;  1N9E A;  2OOV C;  4QWT A;  3CU3 A;  3CPW 2;  3CPO A;  4R9L A;  4WP5 A;  5I97 A;  4R80 A;  1BSA A;  1DVC A;  2CIU A;  2PZV A;  3CNM A;  7RNT A;  2Z6B A;  3LTB A;  3CCS 3;  2H0G A;  1OGX A;  2ZDJ A;  3FH1 A;  1FGQ A;  3D79 A;  3LTC A;  2Y74 A;  4X2O A;  2O3O A;  1JBS A;  3HI7 A;  4HM3 B;  3AHS A;  3I56 3;  1C54 A;  3JUQ A;  1O7W B;  1RNT A;  2V1L A;  1E97 A;  2HMO B;  2O9U X;  4JF8 A;  4BIR A;  3MYT A;  1JZO A;  3DGN A;  3GAX A;  3PYJ A;  9RNT A;  5RNT A;  1QAF A;  1A67 A;  1V74 A;  1X1Y A;  1BIR A;  1GD4 A;  2LQV A;  2CX1 A;  3N9H A;  4K1V A;  3DMC A;  3K63 A;  1NDO B;  4I4K A;  1VQ6 3;  1CH0 A;  1I3I A;  2B24 B;  1JV2 B;  4O02 B;  3STD A;  3NBJ A;  1CYU A;  1SAR A;  1BRK A;  2GU3 A;  3GZY B;  5IER A;  3JUN A;  1IQY A;  1W5Z A;  4HAA A;  3J7Y d;  2OOV A;  4FMA A;  5KP4 A;  1GOU A;  3B4O A;  4K1U A;  3RGR A;  3HII A;  3EN1 B;  3GZX B;  1IVV A;  5D82 A;  2OCT A;  3X3X A;  5IEP A;  3CCL 3;  1U8C B;  4AKY A;  1N8R 4;  1TRP A;  4O3V A;  4RNY A;  1UUW B;  2W56 A;  5CK6 A;  3UB1 A;  3CCR 3;  3TDG A;  2MF7 A;  1RGA A;  2CKF B;  2XEP A;  4DKI A;  1OAC A;  1UCJ A;  3K0Z A;  1JBR A;  1NJI 4;  2CFK A;  1DYU A;  4XBX A;  3BNB A;  1BNR A;  2LYX A;  3ZG0 A;  1UW1 A;  3V98 A;  1GMR A;  3KN4 A;  1VQM 3;  3F8H A;  2OQE A;  1JKG B;  4MJD A;  1BRH A;  4PEJ A;  3PGB A;  1MGR A;  4U13 A;  1M90 4;  3EQQ B;  4IPB A;  1I70 A;  1W4N A;  2K0M A;  1I0X A;  2CHC A;  1JN5 B;  2W04 A;  3DUK A;  3KFQ C;  4N6L A;  2P38 A;  1IK3 A;  5BVB A;  1G0T A;  5AEU B;  3ZFZ A;  2Y73 A;  1TIJ A;  4H3U A;  3SOY A;  2E2U A;  4IIA A;  1SQW A;  3X40 A;  5CLK A;  3CCJ 3;  2BIR A;  1LQG C;  1O7P B;  2R41 A;  1UCL A;  2KXG A;  3T8U A;  4O8S A;  3DH2 A;  4KT3 B;  2AAD A;  1GMQ A;  3DGY A;  2XGL A;  3N54 B;  3CCE 3;  1N9J A;  4J9A A;  3DY5 A;  1T5Y A;  1YNV X;  3SOA A;  3G71 3;  2W56 B;  3L0R A;  4XM4 A;  3EHC A;  1OGZ A;  5M18 A;  2HMK B;  1GY7 A;  2W9Q A;  3WHO A;  3BND A;  4HM8 B;  3WOF B;  4BL3 A;  4KZ1 A;  3RGA A;  1W2B 2;  4WHA A;  4HM5 B;  3QRD A;  1GD3 A;  3JUP A;  5AIG A;  4J5G A;  1DMQ A;  3DZL A;  4K61 A;  4FR9 A;  1JN5 A;  3CNX A;  1T2I A;  4NPB A;  3AGO A;  3KSP A;  1TTO A;  5IG5 A;  3NHX A;  1ROA A;  5A0O B;  3FSD A;  4HOH A;  1RN1 A;  1YGW A;  2BMQ B;  3MHE A;  1M1K 4;  1BSB A;  3JUM A;  3G6E 3;  1JZD A;  2BU4 A;  1MWS A;  2C4B A;  3KKG A;  5D81 A;  2KF5 A;  1JB2 A;  1MOL A;  2K3D A;  1SJW A;  3LTA A;  1GYB A;  1K8A 4;  1B20 A;  1LQM B;  1D6Z A;  2GEY A;  3VF1 A;  1QVF 2;  1BNG A;  2XFT A;  3K5T A;  3NM7 A;  3NV0 A;  2R4I A;  3PCR A;  4GB5 A;  2JQ5 A;  2RSX A;  3F14 A;  5IF6 A;  2BMR B;  2KF3 A;  4BL2 A;  4CCV A;  1IT7 A;  5IEO A;  1FUS A;  2XGN A;  1G96 A;  3K7C A;  3RDE A;  2H0H A;  1BNS A;  3QK9 A;  5FW5 A;  3HK4 A;  1OHO A;  2WOF A;  1ISK A;  3EX9 A;  1RGH A;  2E2T A;  3G0K A;  2H0I A;  3D3L A;  4RZM A;  4BTX A;  1RMS A;  4HM2 B;  4R4K A;  1WMN A;  1R4Y A;  1BSD A;  1K41 A;  2RNT A;  2WO0 A;  4XDW A;  3PZW A;  1Q86 4;  3EN8 A;  1M9G A;  3LXU X;  1AVK A;  2KRT A;  1O7G B;  3Q1C A;  5EEO A;  3UL5 A;  3D5G A;  4XDV A;  3ROB A;  3DXO A;  3OWU A;  1B2U A;  4GSP A;  4L8O A;  4HKV B;  2BMO B;  3WDG B;  1LOY A;  1LXE A;  3LT9 A;  5KP3 A;  1FGR A;  6GSP A;  2XSH B;  4XBT A;  6RNT A;  3D5I A;  3CMA 3;  3CD6 3;  1EQK A;  1D6U A;  1EEJ A;  1K9M 4;  1SII A;  2F4Y A;  1A2K A;  4G1M B;  1V58 A;  4EW5 A;  1C7H A;  4FCJ A;  3BNC A;  5FGO A;  1YJ9 3;  3GZB A;  3H51 A;  1BRI A;  2JDI H;  1BNE A;  3FLJ A;  4N3V A;  3I55 3;  5ELJ A;  1TP6 A;  1PU4 A;  5AIH A;  1RGG A;  3G16 A;  3NQZ A;  1RGF A;  3A76 A;  3FZW A;  3HIG A;  3OWS A;  4HM6 B;  2GEX A;  3HOH A;  3KCH A;  4LMI A;  4TX4 A;  1MNL A;  3CC7 3;  3AMO A;  5TGN A;  5BXQ A;  1UUG B;  8CHO A;  2RGQ A;  3HZP A;  1JBT A;  1IVW A;  1Q7H A;  5JPP A;  2IUJ A;  4ZM8 A;  2GSP A;  2W9P A;  1JB4 A;  1W02 A;  2ZL8 A;  5AII A;  5JBS A;  1RSN A;  1B2M A;  1X1W A;  1IVX A;  2GBW B;  3EJV A;  5IW9 A;  1IT8 A;  1KWI A;  4ILF A;  3A5E A;  1FUT A;  1OCV A;  3LT8 A;  2BO9 B;  2P05 A;  3F8X A;  3URP A;  3WMD A;  2B1X B;  1VQK 3;  2F56 A;  1FZU A;  2GXF A;  1V57 A;  3DGL A;  2A15 A;  2IYJ A;  3IMA B;  3PXM A;  3WOE B;  1DMN A;  2HMM B;  3BLZ A;  3SVA A;  2F86 B;  1RCK A;  1M1X B;  3Q3F A;  3OV4 A;  4WFO A;  1GSP A;  1Y4K A;  5HGR A;  7GSP A;  1I8V A;  2CFG A;  1N8Q A;  1PYL A;  1RCL A;  2CX0 A;  4J8T A;  1AQZ A;  4N6N B;  5BU4 A;  3CC2 3;  1WQL B;  4NRE A;  1AY7 A;  2OTL 3;  1BGS A;  1B2S A;  1SPU A;  4EV5 A;  1YGE A;  1BNJ A;  2FXT A;  5IG0 A;  1JRQ A;  3G8Z A;  2F5M A;  1VQP 3;  1RNB A;  1O7H B;  4RNZ A;  1LOV A;  1OH0 A;  3HX8 A;  2INX A;  3EBY A;  4J5K A;  5BIR A;  3MG3 A;  4FMB A;  7STD A;  1OF5 B;  1QAK A;  2W2C A; 
#chains in the Genus database with same CATH homology
 1PY3 A;  1I2F A;  1RN1 A;  1YGW A;  4HOH A;  1BRJ A;  1BSB A;  1MGW A;  2BU4 A;  2C4B A;  1X1U A;  4GHO A;  2KF5 A;  1HZ1 A;  1UCI A;  1B20 A;  1B21 A;  1RN4 A;  1I0V A;  1GOV A;  1GMP A;  1BNG A;  1RHL A;  1LRA A;  3GSP A;  2KF3 A;  1BVI A;  1X1X A;  1FUS A;  1BNS A;  1BSA A;  1BRS A;  1RGH A;  7RNT A;  1RLS A;  1JBS A;  1RGC A;  1RMS A;  3AHS A;  1C54 A;  1UCK A;  1A2P A;  1R4Y A;  1BSD A;  1RNT A;  2RNT A;  4BIR A;  9RNT A;  2ZA4 A;  3D5G A;  5RNT A;  1X1Y A;  1BIR A;  1B2U A;  4GSP A;  1CH0 A;  1I3I A;  1LOY A;  4BU4 A;  1B27 A;  6GSP A;  6RNT A;  3AHW A;  3D5I A;  1BSE A;  2KAA A;  1SAR A;  1BRK A;  2F4Y A;  1RDS A;  4HAA A;  1GOU A;  1LOW A;  1BRI A;  1BNE A;  1YVS A;  2F5W A;  1I2G A;  1BOX A;  1TRP A;  1DE3 A;  5GSP A;  1RGG A;  3D4A A;  1RGF A;  1RGA A;  3SYU A;  3WR2 A;  3HOH A;  3KCH A;  1G02 A;  1UCJ A;  1DET A;  1RGK A;  1JBR A;  2AAE A;  1BNR A;  1LNI A;  1BUJ A;  1IYY A;  1GMR A;  1BAN A;  1TRQ A;  3RNT A;  1JBT A;  1BRH A;  1MGR A;  2KF4 A;  1BRG A;  1I70 A;  1I0X A;  2GSP A;  1GOY A;  1RGL A;  1RSN A;  1B2M A;  1HYF A;  1X1W A;  1RTU A;  3A5E A;  1FUT A;  1RGE A;  2BIR A;  1Q9E A;  1FYS A;  3URP A;  2F56 A;  1FZU A;  1UCL A;  1BU4 A;  3DH2 A;  1ZGX A;  1I2E A;  2AAD A;  1GMQ A;  3DGY A;  3Q3F A;  1RCK A;  2HOH A;  2RBI A;  1B2X A;  5HOH A;  3AGN A;  1GSP A;  1YNV X;  1I3F A;  7GSP A;  1I8V A;  1B3S A;  1B2Z A;  1PYL A;  1RCL A;  2KF6 A;  5BU4 A;  1AQZ A;  1AY7 A;  3WHO A;  1BGS A;  1BNI A;  3BU4 A;  8RNT A;  1B2S A;  1BRN L;  1BNJ A;  1BSC A;  2SAR A;  2F5M A;  4J5G A;  1RNB A;  1BNF A;  1LOV A;  1BAO A;  1T2I A;  3BIR A;  4RNT A;  1FW7 A;  4J5K A;  3AGO A;  5BIR A;  1TTO A;  1T2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...