1BNOA

Nmr solution structure of the n-terminal domain of dna polymerase beta, minimized average structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
87
structure length
87
Chain Sequence
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA
publication title Three-dimensional solution structure of the N-terminal domain of DNA polymerase beta and mapping of the ssDNA interaction interface.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Nucleotidyltransferase (dna-binding)
total genus 13
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1996-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1bnoA00
3JPRA 4GXJA 4KLTA 1DK3A 5J0SA 3ISDA 4UAYA 8ICVA 4DOCA 4R66A 8ICXA 5HHIA 4I2JA 4GXKA 5J2AA 1ZQTA 4PHEA 4RQ2A 1ZJMA 9ICLA 1ZQQA 4MFFA 4DO9A 7ICVA 5D4BA 7ICNA 4RT2A 4I2AA 4NM2A 4I2EA 5J0TA 1XSLA 1NZPA 4M0AA 9ICJA 4QZAA 5D49A 7ICJA 4KLEA 4KLDA 1ZQPA 4LVSA 7ICLA 4M04A 4KLQA 9ICPA 3JPPA 4UAWA 4KLJA 4RPZA 8ICQA 7ICMA 5J2BA 3RJFA 5J0PA 3AU2A 5J2FA 9ICVA 9ICBA 8ICBA 1BPZA 8ICIA 3MDCA 4YCXA 5J2DA 4I2HA 7ICFA 7ICGA 9ICQA 4RQ5A 4UBBA 2PFOA 9ICEA 1ZQIA 2PFPA 1JMSA 5IIMA 4JWMA 8ICSA 4QZ9A 8ICRA 1ZQBA 7ICUA 3V7KA 3ISBA 4M9NA 3UPQA 7ICEA 5J0YA 1ZQMA 3MBYA 5J0QA 8ICUA 2W9MA 1BNOA 3MDAA 3JPOA 4UB3A 3RH4A 2IHMA 4F5OA 4PHAA 4GXIA 4F5QA 3JPNA 3V7LA 4UB4A 4MFAA 1ZQSA 4QZFA 3B0XA 1ZQEA 5IIOA 4PGYA 4KLOA 5IIJA 3OGUA 1DK2A 1XSPA 4TUQA 3JPSA 5J2IA 4F5RA 7ICRA 4RPXA 2ISOA 4XUSA 4FO6A 1ZQDA 4KLMA 1HUZA 2BCRA 4RQ8A 1ZJNA 3JPTA 4NLNA 3UXOA 1BPYA 3UQ0A 5J29A 4MFCA 4NLZA 4R64A 1ZQRA 2BCQA 3V72A 5DB6A 3RJGA 1ZQGA 2GWSA 5DDYA 3B0YA 2BCVA 4KLGA 4K4GA 5J2GA 2FMPA 2PFNA 4YD1A 3HWTA 4Z6EA 4UAZA 4IQVA 4RQ4A 4O5EA 8ICYA 4NY8A 5DBAA 1ZQNA 2BPGA 4PHDA 4O9MA 9ICMA 8ICWA 4NXZA 1KEJA 3V7JA 3MGIA 5IIIA 5J2KA 4I2IA 1ZQJA 4IQWA 7ICIA 4JWNA 4LZGA 4TUPA 4KLLA 3RJEA 5D46A 3RH5A 9ICGA 2PXIA 8ICMA 8ICAA 3HW8A 4PGXA 9ICOA 4R63A 9ICCA 3TFSA 5CB1A 2FMSA 2ISPA 4K4IA 8ICOA 3RH6A 4I2CA 2PFQA 5TZVA 3PMLA 5J0RA 1ZQOA 8ICZA 5DKWA 9ICRA 4Z6FA 4I2BA 7ICSA 3MGHA 4I28A 4M9JA 1MQ3A 5IILA 9ICTA 1TV9A 3RJKA 3PMNA 1XSNA 7ICKA 3C2LA 9ICFA 4I29A 5IIKA 5BOMA 5J0OA 5IINA 4UB1A 2BPFA 8ICHA 4YMNA 9ICAA 4F5NA 3UXPA 4X5VA 1ZQLA 4QZ8A 4QZHA 9ICSA 4O5CA 4RQ7A 4QZGA 4I2FA 4LZDA 4RPYA 3JPQA 3AU6A 3C2KA 4IQTA 5J0WA 1MQ2A 1BPDA 3AUOA 4I27A 7ICOA 4UBCA 4QZEA 1ZQFA 9ICNA 4QZDA 4TUSA 8ICCA 3LK9A 1BNPA 5BOLA 3RJHA 3TFRA 4P2HA 4I2GA 4MF2A 5BPCA 7ICQA 8ICLA 9ICHA 4O5KA 4IQUA 5J2JA 4XA5A 4DOAA 3C5FA 1RZTA 4RQ0A 4QZCA 8ICJA 5DBCA 5DB7A 8ICNA 5HHHA 4NM1A 8ICTA 1BPXA 1ZQHA 5DB9A 4QZBA 4RQ6A 4NLKA 5J2CA 4MF8A 8ICFA 4RQ1A 3UQ2A 1TVAA 3C2MA 4Z6DA 1KDHA 8ICPA 4KLIA 4TURA 7ICTA 4M9GA 2KP7A 5J2EA 4Z6CA 5DBBA 4M9LA 3HX0A 1ZQAA 2BCUA 4DOBA 4K4HA 1ZQKA 4KLSA 8ICGA 5J0XA 4KLUA 2P66A 4RQ3A 7ICHA 3RJJA 1HUOA 8ICKA 5J0UA 5CWRA 8ICEA 4M47A 9ICWA 4RT3A 4YMMA 9ICXA 1BPEA 9ICUA 4QZIA 5DB8A 1ZQCA 4PPXA 9ICIA 3RJIA 2FMQA 4YN4A 3ISCA 4F5PA 4PHPA 5J2HA 4M2YA 4UB5A 4R65A 4UB2A 4KLFA 4KLHA 4PGQA 9ICKA 2BCSA 4YD2A 4I2DA 4M9HA 5EOZA 3GDXA 7ICPA 3PNCA 3C5GA 3UXNA 4YMOA 2I9GA 4PH5A
chains in the Genus database with same CATH superfamily
4US9A 3H4BA 4F2RA 4AYBC 1L6NA 1KBUA 2LYAA 5AIAA 3RBDA 3Q8PB 3PR4A 1RXVA 3OJUA 4DOCA 5KFYA 3IP4B 2QB0A 4DL4A 5JTIA 3LWLA 2BKEA 4ECXA 2AQ4A 5H2FU 5J8YC 4KX3A 3PW2A 5CA7A 2HHWA 3GIMA 1SZPA 4PHEA 2LMRA 1ZJMA 2K89A 2NRVA 2Q0ZX 1X66A 3BJYA 4I2AA 4NM2A 1NZPA 9ICJA 2ZIUB 4Y2VA 5KFLA 4LVSA 3QUCA 4DWIA 3E58A 5ALYA 2XIDA 4C4TA 4KLQA 2ZJ8A 2JH7A 1L3SA 2WAQF 1T8EA 2A3VA 4DQRA 3G6YA 5DGBA 4RNNA 1KTQA 3ETRA 4CF4A 3RJFA 5ALRA 5KT5A 1GO3F 1NKEA 2JMGA 4FBUA 4YG2A 3SAHA 4DSKA 3AU2A 4IR1A 5GTIU 3KFUF 4TQSA 4DQIA 2W9AA 1BPZA 4EENA 1QQ5A 4DL2A 5JUMA 2H3FA 3K75D 1FO4A 4Y2RA 4F4KA 4Y2PA 3QNMA 5AM0A 4NJ8A 3MR2A 2PFPA 1JMSA 2KICA 2KKPA 1SV0C 3OTQA 2YB4A 1RG6A 3ISBA 4M9NA 2EQYA 3UPQA 3N7PD 5J0YA 2ZIUA 3LWMA 3MBYA 3AEVA 3A0HU 1Y88A 3NUQA 3KTQA 3HILA 2YX8A 3H8WA 4DS4A 4UB3A 2LYBA 4F5OA 1KL9A 4UAUA 4UB4A 5KG1A 1TE2A 4MFAA 5EWGA 1JRPA 3ED5A 3I1YA 5IIOA 3WK6A 3CYMA 4YR2A 4ECWA 4DSFA 1N5XA 4TUQA 5J2IA 2WAQC 5ALNA 3M9OB 1ZQDA 2WF9A 2JR5A 1ZJNA 4NLNA 1TK5A 5AM2A 4OD0A 2IBKA 3OSNA 2UVRA 4BGDA 5KFXA 4B9UA 1HJPA 2FPMA 1FFUA 1KQQA 2ZUCA 4DSLA 3WK9A 1B0XA 3UQ0A 2O6KA 4C4RA 4C8KA 3RAQA 4MFCA 2P6UA 1LVHA 3OHAA 3IV6A 3B0YA 4J9NA 1PUZA 2W8LA 4DEZA 5J2GA 3FM9A 2VA3A 4YD1A 5G5GA 1BPBA 4RQ4A 2YMPA 2B0CA 2YB1A 1YZ6A 3DV9A 3KHGA 5DBAA 2ZJ5A 1U45A 1PVRA 2BPGA 4PHDA 5ALMA 2EZXA 4HYKA 2F3NA 4R8UB 1KEJA 3V7JA 1NK5A 1BGXT 5KFFA 1SWVA 1V38A 5J2KA 4LJXA 2QLTA 1ZQJA 1SWWA 4IQWA 7ICIA 4JWNA 3RJEA 5D46A 2EAPA 3H0LB 3EPGA 2PI4A 2KK0A 3IN5A 2ZIWA 3EW9A 4PGXA 2MU2A 5L1LA 5KFQA 1B43A 3HRDD 3M6ZA 5KFDA 2ISPA 4Q43A 5TZVA 5J0RA 2VJ4A 3MGHA 5JU5A 3F2CA 2F8LA 4DFJA 5AI8A 2KJ5A 3RTVA 4CGZA 3A0BU 2W04A 3RJKA 2DFLA 1UCVA 3G6XA 1Q3UA 3RR7A 2DKZA 4R8UA 4GC7A 1L3UA 3C2LA 3C28A 2NYVA 5KTQA 3H0MB 5L1JA 2CPRA 4O0IA 4Y2YA 3NVVA 1VDVA 5L1IA 1ZQ1C 4KTQA 4F5NA 4MEXA 4F91B 1SKWA 4KITB 3K1ZA 2Y9UA 4RQ7A 4I2FA 5GTHU 4UATA 1NK8A 4RU9A 3AU6A 3C2KA 5J0WA 2F44A 4EBDA 3AUOA 3RB4A 2ZIVB 7ICOA 2C2DA 3FYHA 1L7MA 4EBEA 4JV1A 4GLXA 8ICCA 2D3DA 2JGAA 3RJHA 3TFRA 3THVA 4P2HA 4I2GA 2XGPA 1KSPA 5BPCA 7ICQA 9ICHA 3L4PA 4O5KA 4IQUA 3L5KA 4C0ZA 1XNSA 4XA5A 2HMXA 2KVCA 1QSSA 4J9SA 5DB7A 5AKYA 4WJ3B 8ICNA 3GIKA 2V9WA 2ZUBA 1ZQHA 4YXJA 2WB1F 3QYPA 4FS1A 4MF8A 3ZDDA 8ICFA 3UQ2A 3C2MA 4FS2A 3ZDAA 4KLIA 1JXLA 1Z4OA 4M9GA 3FC4A 4CCHA 5L9XA 2KFZA 1N5WA 3HX0A 5KFTA 2DL0A 3KOOA 5AKXA 4QW9A 2ZIVA 2C2EA 3NVWA 2P66A 4U6PA 3RJJA 5HR6A 4JMUA 2E5SA 1ECWA 2AJQA 4OJPA 1PK3A 4DL5A 5CWRA 5EE0A 3HP6A 1XC9A 3QUBA 4YMMA 9ICXA 5HMMA 5AKKA 1VLBA 1NJYA 1NKBA 4Q44A 4QZIA 3IM1A 2HHXA 2Y0SF 2G09A 5KFMA 2ASJA 4OJLA 3QU7A 4PHPA 3LVVA 1DGSA 1N2XA 4R65A 4TQRA 2W7OA 4C8MA 5T14A 4PGQA 4BDPA 2H3IA 2IOHA 4PZNA 4J9LA 2AH5A 4XQ8A 1YT3A 2K8BB 1X6JA 5EOZA 3PY8A 4F4WA 2WB1C 5AK5A 3C5GA 4F4XA 3TQ1A 4ED8A 3RB0A 3KBBA 2I9GA 2VA2A 5KFVA 1ZQXA 1SL1A 2QARB 1O08A 1DK3A 3NVZA 3ISDA 1IIPA 4ELUA 2N1RA 1L7PA 3K4GA 2HBLA 2KMDA 4F8RA 4C7ZA 5KT7A 3PR5B 3SQIA 3F5AA 3M7DA 2HHSA 4RNOA 2CN1A 2AGPA 2XO7A 1L3TA 4BWJA 5ALOA 4MFFA 3V6KA 7ICVA 2KG5A 2H5XA 4YVZA 3ZDCA 4DQPA 4RT2A 1QTMA 1TAUA 1NI3A 3BQ2A 3K1RB 1A0PA 3BS7A 3SAFA 2P35A 1UT8A 4QZAA 4FZMA 1S5LU 5KFSA 1N61A 4Y2TA 3IRUA 2DWQA 3F53A 2KD1A 2UVUA 4QIWF 4PL1A 1A76A 4UAWA 2LI6A 1QQ7A 2JEJA 1D8BA 2AQ0A 7ICMA 4DF4A 2KZZA 5DLGA 5DQGA 4QWCA 3N7SC 2CRXA 1J2NA 1T7PA 4ECYA 1RDFA 8ICBA 5A0LA 2V4RA 8ICIA 2WFAA 5J2DA 7ICFA 3BZCA 4RQ5A 5AKHA 4O3PA 4BWMA 1C7YA 1QH9A 4B6JA 5KFIA 2HBMA 2VIXA 5EWFA 1NJZA 4JWMA 2GOLA 4QZ9A 8ICSA 1UHUA 3ONNA 5KFCA 5TISU 3V7KA 4E0DA 2AGOA 4AP9A 3DEEA 3U26A 5HR7A 1JI7A 3UMGA 5J0QA 8ICUA 2W9MA 1BNOA 3KKAC 4HAIA 3JPOA 1ZQWA 5KFUA 3HPOA 2K8AA 3GFKB 3IHQB 5ALKA 5KG3A 3V7LA 3MFHA 1UA1A 4J9KA 1PK1B 1ZQSA 5KG0A 3AMZA 3MR6A 3B0XA 3GILA 5DG7A 4PGYA 4KLOA 1ZD3A 3PW7A 4ED0A 1RM6C 4DSIA 1XSPA 4QIWC 3GQCA 2HSZA 2YMLA 3PVXA 1MN8A 1U9LA 4FO6A 4DFDA 2WHEA 1HUZA 3PSFA 1S0OA 2BCRA 4BX9C 4RQ8A 4UB8U 4F71A 3JPTA 1NK0A 3UXOA 2KZMA 1WYGA 1V97A 1EXNA 4JV0A 2K4HA 5J29A 1UT5A 1SXEA 4NLZA 2OH2A 1ZQRA 2W43A 2C28A 1Q3VA 2R8GA 3CW2C 3RJGA 2IA6A 1FIQA 2KIVA 3LYSA 3T79A 3PX6A 3BQ7A 2AXTU 2F1HA 3UM9A 4KLGA 2BHNA 1XO0A 2KZ3A 4K4GA 1TKDA 1N60A 2PFNA 3CP8A 1Z4NA 3HWTA 3FAHA 1PK1A 3ICXA 2G0AA 1FEZA 3DDHA 3HJEA 5ALTA 3PW4A 2UVWA 1ZQVA 2RRDA 3EUB2 1SGGA 2JEGA 2HBKA 3WKDA 2GLEA 2VKQA 8ICWA 1F5SA 2BQUA 2W9BB 1UQVA 3UMCA 1PVPA 2KJ8A 2NO4A 2E8MA 1S77D 1ZD5A 2A1JB 5ALLA 4LZGA 3RB6A 4ECUA 3RH5A 1QSYA 9ICGA 4DSEA 8ICMA 5KL8B 1ZQYA 2AGQA 9ICOA 5ALEA 4R63A 3AQFA 3TFSA 1RYUA 2PKEA 3WKBA 2NRZA 8ICOA 1X40A 2J6TA 5KAFU 2KKVA 4QWBA 2ASLA 3D6JA 4G3IA 1XWLA 2QB1A 5C5JA 9ICRA 2ZJAA 4Z6FA 1RPLA 2W54A 3N28A 3RAXA 1F44A 4B9VA 2JEIA 2BR0A 9ICTA 3PO5A 2YY6A 5AK3A 2OHFA 3PMNA 4KN4A 2W9BA 3RR8A 2IOFA 9ICFA 1KKXA 4O3QA 5DQHA 2UVVA 1DOQA 5J0OA 4DQQA 2XCPA 5KG5A 2A1JA 4MEYA 4IL6U 4QWEA 4UB1A 2BPFA 3ZDEA 5JRTA 1NK9A 1N63A 4YMNA 4EZ6A 2K4PA 3CNHA 3MR3A 2BGWA 2H3ZA 1KRPA 4FFDA 4QZ8A 3WKEA 2ZIWB 4RPYA 1Z00B 1IG6A 4JUZA 2FE9A 4QWDA 4IQTA 2HOFA 4I27A 3WKAA 2VJ5A 2A19A 3UMBA 3EYZA 5KAIU 2V4QA 3I76A 9ICNA 4JB3A 4QZDA 1A77A 4TUSA 4J9QA 1DRGA 2EDUA 5KFEA 4MF2A 4FZLA 5KFAA 5F9LA 3WKCA 3C5FA 2CXYA 3AQEA 4O3OA 8ICJA 1TAQA 5HHHA 4NM1A 2E1FA 8ICTA 4ZOHC 1X9XA 3SR6A 2HOIA 5J2CA 4MHVA 4C8OA 4ED7A 1X9SA 1KFTA 4NLGA 1TVAA 4CF3A 1KDHA 4M6WB 1QLNA 1Z00A 2KP7A 4P4MA 2K4EA 3C1YA 1KW4A 4EYIB 1XS9D 1JXEA 5F3XB 5ALVA 1ZQAA 3M8RA 2DF4B 4ED6A 4UB6U 4B9LA 5J0XA 4ELVA 4KLUA 3VC8A 3RBEA 4RQ3A 2XCAA 2W9CB 1O03A 4CRXA 5J0UA 3T5HA 8ICEA 4RT3A 1S76D 1QCKA 2LBOA 2RDJA 4OJ6A 1KFSA 2KV2A 2EZYA 5AKEA 1PVQA 2FLNA 2KTQA 1Z1BA 4PPXA 9ICIA 2Q4TA 4XRHA 4YN4A 3ISCA 2DUYA 4M2YA 2NRXA 2J6SA 5HMLA 1JN3A 4OJ5A 2F77X 3WK8A 5AKIA 4DL7A 2E1EA 1U48A 2BCSA 2ZIXB 3GV7B 3PSTA 4M9HA 4M6WA 1U49A 1K5OA 3T5JA 2KVSA 3GDXA 3GU3A 7ICPA 3QX7A 3PNCA 1ZQZA 5CHGA 3UXNA 4YMOA 4ECQA 3QEAZ 1Q46A 2PI5A 4GXJA 5J0SA 5ALGA 2HHQA 2W9CA 4UAYA 2HVIA 4NWIA 3G6VA 3BS5A 4DS5A 2HHTA 1ZETA 4R66A 2YTUA 3KHLA 8ICXA 5HHIA 3M1YA 3KZXA 1M6YA 2I6XA 4I2JA 2KE7A 5J2AA 4UASA 2ODGA 4RQ2A 9ICLA 3PSPA 1ZQQA 1TK8A 4DO9A 5D4BA 3TADA 2KHVA 4EELA 3SAGA 2LHTA 5J0TA 5ALXA 1XSLA 4M0AA 1L8LA 3T5LA 3AM9A 4KLEA 2ZIXA 7ICLA 3T3FA 1ZYQA 4M04A 2JHDA 2DBYA 2PMZF 4O3SA 1X6IA 4DFPA 4KLJA 4F3OA 4IRCA 3V6JA 5C0YA 8ICQA 5KT2A 2JRZA 3MFIA 4EZ9A 2M0NA 5ALWA 4IRDA 3QZ8A 1OXJA 5J2FA 2OXOA 4KX5A 4NL9A 3MDCA 1X2IA 4RQNA 7ICGA 4F50A 2H3VA 1ZRNA 9ICQA 1B4FA 2F1IA 4UBBA 5KFNA 2M9NA 2RDIA 3H8SA 3RB3A 2R8IA 1NNLA 9ICEA 5ALIA 5DDMA 8ICRA 2BZFA 1S8OA 3ZD8A 2WTFA 7ICUA 3ZI4A 2J6UA 1D9FA 4UW9A 1ZQMA 3MDAA 2IHMA 2KOBA 3RH4A 3QUTA 4F92B 2JXJA 4F5QA 1NJWA 4F4ZA 4IRKA 1ZQEA 4RZRA 3SYZA 5IIJA 4F72A 4QNLA 3GV5B 4GIBA 3OGUA 3NRWA 1DK2A 3J81j 3JPSA 2PMZC 3Q8KA 4F5RA 7ICRA 2ISOA 1WWVA 4A8EA 4KLMA 1Z3EB 5KG4A 3Q8RB 2MUTB 5EWEA 2C2RA 4P0PB 1JX4A 1RQLA 2KHQA 3GIJA 4J9RA 2DPJA 2DPIA 2XVTA 4FBTA 2HVHA 2JH1A 5E79U 2FLLA 3V72A 2F8KA 4ELTA 1ZQGA 2GWSA 2K4IA 2BCVA 2W3SA 4IC9A 3PX4A 2W03A 1U4BA 2FMPA 1KN5A 4EBCA 1SKSA 5AI6A 4UAZA 2Y0SC 5KT6A 4IQVA 2EAMA 2BPCA 2Y1JA 3HKZF 2QKQA 8ICYA 1RQNA 5AHXA 2JV3A 3SEIA 1ZQNA 4O9MA 1PZNA 4NXZA 3MGIA 5IIIA 5KFKA 4JV2A 5J8YA 4I2IA 2OM6A 1ZOLA 1OUQA 4KLLA 4B9SA 2MUTA 4P0PA 3RFAA 5EE3A 5B5EU 1AQ6A 1WCLA 5EE1A 4UARA 1YZ7A 1SXDA 1DXSA 3QZ7A 2FMSA 3PW5A 1HIWA 4K4IA 3KHHA 2ZUDA 3RH6A 4YXMA 2ES6A 3PMLA 1ZQOA 8ICZA 5DKWA 1TAMA 4YR0A 5KFZA 7ICSA 1L8OA 4ICAA 3BDPA 2ZG6A 4M9JA 3NS1A 2EZZA 1XO1A 1SL2A 1MQ3A 4Y2JA 2W55A 3QU5A 1TV9A 1XU4A 1D8LA 1XSNA 2E8NA 3BQ1A 2G5HB 3M9MB 4UQGA 2DQNB 4I29A 5IIKA 2NRTA 5BOMA 3CRXA 2E8PA 1C20A 3Q8MA 3HKZC 1RYSA 1X9WA 4Y2QA 4PZOA 4BUGA 2HHVA 4KMOB 3N4MB 5ALZA 1QSLA 3SI8A 3I28A 3N7RC 4Q45A 5ALJA 3WK5A 4ECRA 4RUAA 9ICAA 1QQ6A 4ZH4A 5AK6A 3IG8A 3RRGA 4ED1A 9ICSA 4DFMA 4DLGA 1SV0A 1WCNA 3PW0A 4O5CA 3D2SA 1HEKA 4QZGA 3SV3A 1MSWD 1N62A 2ESEA 4NV0A 3NVYA 1S97A 2R8KA 4OCZA 3GV8B 4J9MA 1MQ2A 1BPDA 4ED2A 4FE3A 4C8LA 4YR3A 1SKRA 4DL3A 4UBCA 3TAQA 1NOMA 2AU0A 1ZQFA 2I1QA 4CE6A 3VCBA 2HCFA 3LVWA 5AI5A 3LK9A 4Y2UA 1BNPA 4Y2XA 4C8NA 1COKA 3OJSA 4KMUA 4F2SA 3KHRA 1ED1A 1WWUA 3RRHA 4EYHB 8ICLA 5J2JA 4DOAA 4O3RA 3BQTA 2LKYA 4QZCA 4ECZA 5DBCA 4B9TA 1TK0A 5AKGA 1S10A 3B9JA 1BPXA 2RP5A 4RQ6A 2BQRA 3E0FA 4RQ1A 1KFDA 4US8A 4C7YA 4EX7A 4P0QB 7ICTA 3WK4A 5J2EA 1S0MA 5KFJA 3F5EA 1T3QA 2BCUA 4DOBA 4K4HA 5DGAA 2FDRA 2I5HA 7ICHA 5AM3A 1IXRA 4B9NA 5KT3A 1JALA 3MABA 1TFRA 2VA8A 5AM4A 4M47A 3C23A 9ICWA 4J9OA 3PX0A 2YN4A 4YP3A 4USAA 5KG6A 1BPEA 4GC6A 9ICUA 1SB3C 4O3NA 2RLTA 1X42A 2NRWA 3RJIA 2FMQA 2KEYA 5AI4A 2R8JA 5CP2A 4F5PA 5AM5A 4Y2SA 4UB5A 1H38A 2FPKA 4KLHA 2YQEA 3OSPA 3TAPA 2OCEA 5KFOA 4DLEA 4YD2A 4I2DA 4P0QA 3MR5A 5KNIA 3GZFA 1ZD2P 2EAOA 4RUCA 3KZIU 2KFNA 1KLNA 4PH5A 3H8JA 3NASA 3JPRA 2XY5A 4KLTA 2OEHA 3H8MA 3Q8SB 4Q8FA 4RNMA 2E3TA 3MGVA 8ICVA 5KL1B 1N48A 2WF8A 4ACOA 3F2DA 2JEFA 1NK7A 4GXKA 1ZQTA 1VJ5A 1T3NA 5AICA 2ASDA 3SV4A 2LM1A 3TACB 2K8CB 7ICNA 3SD7A 1COOA 2YMMA 2BDPA 5B66U 4I2EA 2F1JA 5ALHA 2R8HA 3SZ2A 4DF8A 5D49A 3NGDA 7ICJA 4KLDA 1ZQPA 1IM4A 1AROP 3R9KA 1T4GA 2W3RA 1MC8A 2EH9A 3PV8A 9ICPA 3JPPA 2C22A 1RXWA 2KSOB 3C21A 3N97B 4RPZA 2MA1A 4OJOA 5J2BA 2KN7A 2BQ3A 5J0PA 5CJ7A 2K60A 3ETLA 2IOFK 2W11A 2B21A 3GIIA 9ICVA 9ICBA 1Q8KA 2MRLA 4NLBA 4BXOB 1T94A 2NO5A 5ALDA 4YCXA 5KT4A 1LKYB 3M9NB 4I2HA 3BS5B 5KG2A 4GFJA 3PSIA 1RYRA 1ZD4A 3SMVA 2PFOA 1ZQIA 5ALUA 5ALFA 5DG9A 5IIMA 5AKLA 2DGZA 1ZQBA 2MSNA 2B6GA 1J2MA 1L5UA 7ICEA 4UAVA 4ED3A 1Z19A 2NV3A 3QEBZ 3PO4A 4PHAA 4C4SA 4GXIA 4JK1A 2KSOA 3JPNA 1N56A 1CEZA 4QZFA 1WG8A 5KFPA 3H40A 3C29A 1A6SA 3QU4A 1CUKA 4CDGA 2HW3A 3PZPA 1SZHA 1WUDA 1NZBA 2EANA 2ALZA 5KFRA 5CEHA 4RPXA 4XUSA 4BXOA 1LKYA 3TKAA 3BQ0A 2W7PA 1B22A 4EX6A 5AKZA 2GH1A 2H3QA 1URJA 1BPYA 2ZTEA 2E8OA 2RQ5A 4BJQA 2FI1A 4F4YA 4PJ0U 2FPLA 2HOQA 2ZTCA 3AN1A 4R64A 2XGQA 2BCQA 3SENA 1UPHA 5DB6A 5DDYA 1DGJA 5AM1A 5FP0A 3TARA 2AHOB 1V9PA 3M6KA 4Z6EA 1ZXIA 3EPIA 5F9NA 4O5EA 2HBJA 2WF5A 5DLFA 4NY8A 3BZKA 5ALQA 9ICMA 1S9FA 2Y1IA 5CR0A 2LPEA 2IHNA 2ZTDA 1LV5A 3F2BA 5KFHA 4PL2A 4F93B 4KN7A 3QXGA 2IMWP 5KFWA 4IS7A 4TUPA 2P6RA 3NTUA 4ECVA 2PXIA 2YMQA 5AIBA 3HW8A 8ICAA 2HDOA 5ALPA 3QU2A 1UA0A 1F0MA 9ICCA 2OYYA 3EWAA 4B9MA 3QU9A 2FJ6A 3ALRA 5CB1A 2W8KA 2WF7A 5KFBA 3ZDBA 2WF6A 1CRXA 4I2CA 2PFQA 3H7IA 1IV8A 4DL6A 2F2AB 1CI4A 1NJXA 1D9DA 4I2BA 3QUQA 1NK6A 2D6FC 4I28A 2R18A 4P4PA 4CNQA 1X9MA 1MA7A 3D2QA 5IILA 2FLPA 4DSJA 2JZBB 1OW5A 3RF9A 3OHBA 3WK7A 3LDAA 7ICKA 1JUDA 1LB2B 2GO7A 2DKXA 3S6JA 3H0RB 5EE9A 3Q8QB 3KD3A 1JROA 3TADC 2XY6A 2G08A 4DFKA 2Y9TA 3TANA 3HT3A 1D8YA 5IINA 8ICHA 3NRZA 3UXPA 1Z1VA 4X5VA 1ZQLA 4QJFB 4QZHA 2KNJA 4LZDA 2ZXIA 4U7CA 2LYHA 4EEKA 3JPQA 4QWAA 1V85A 3T5KA 3OPXA 5L1MA 5DG8A 3KKAA 4O3MA 4FZNA 4EEYA 2Z7JA 5AI9A 1L3VA 3O0FA 3ZD9A 4QZEA 3E2EA 5AK4A 2BDUA 2KJ9A 1U47A 4Q8EA 5HNKA 1SV4A 1FFVA 5BOLA 4J9PA 4NL9C 1ZQUA 2G06A 2JZBA 1SIJA 4P4OA 1ZRMA 2XC9A 1RZTA 1L7NA 4RQ0A 5AI0A 1P7DA 3ORYA 2A1AA 2OWOA 2RHFA 5DB9A 4QZBA 4NLKA 3AL0B 3H4DA 2VANA 3IG5A 4CF5A 5DQIA 3FDSA 4Z6DA 4AYBF 8ICPA 4TURA 3IDWA 3QE9Y 2QARA 4Z6CA 4IR9A 1JIHA 5DBBA 3EZ5A 4M9LA 3Q8LA 5CRXA 4J03A 1ZQKA 4KLSA 4G9BA 1SL0A 8ICGA 3L3FX 5HP4A 2G5IB 3WU2U 1HUOA 8ICKA 3D2NA 5G5HA 2KIWA 2QB0B 3C1ZA 1J97A 2L5YA 1NK4A 1NKCA 4QW8A 1K1QA 2MAXA 1K1SA 2ATLA 4YFKA 5DB8A 5ALSA 1ZQCA 4NLCA 3V6HA 3MC1A 2HHUA 2F76X 4RQMA 4ECSA 5KFGA 5J2HA 4ECTA 4UB2A 2D8CA 2LM4A 4DQSA 2XI9A 4KLFA 5K4LA 1S0NA 5KG7A 4OO1J 9ICKA 1L7OA 2XY7A 2HI0A 5L1KA 3TI0A 3M8SA 1S0VA 1BVSA 5AKJA 2G07A 4YQWA 4DCCA 4C80A 2XICA 2ZXHA
chains in the Genus database with same CATH topology
3JPRA 4GXJA 4KLTA 1DK3A 5J0SA 3ISDA 4UAYA 8ICVA 4DOCA 4R66A 8ICXA 5HHIA 4I2JA 4GXKA 5J2AA 1ZQTA 4PHEA 4RQ2A 1ZJMA 9ICLA 1ZQQA 4MFFA 4DO9A 7ICVA 5D4BA 7ICNA 4RT2A 4I2AA 4NM2A 4I2EA 5J0TA 1XSLA 1NZPA 4M0AA 9ICJA 4QZAA 5D49A 7ICJA 4KLEA 4KLDA 1ZQPA 4LVSA 7ICLA 4M04A 4KLQA 9ICPA 3JPPA 4UAWA 4KLJA 4RPZA 8ICQA 7ICMA 5J2BA 3RJFA 5J0PA 3AU2A 5J2FA 9ICVA 9ICBA 8ICBA 1BPZA 8ICIA 3MDCA 4YCXA 5J2DA 4I2HA 7ICFA 7ICGA 9ICQA 4RQ5A 4UBBA 2PFOA 9ICEA 1ZQIA 2PFPA 1JMSA 5IIMA 4JWMA 8ICSA 4QZ9A 8ICRA 1ZQBA 7ICUA 3V7KA 3ISBA 4M9NA 3UPQA 7ICEA 5J0YA 1ZQMA 3MBYA 5J0QA 8ICUA 2W9MA 1BNOA 3MDAA 3JPOA 4UB3A 3RH4A 2IHMA 4F5OA 4PHAA 4GXIA 4F5QA 3JPNA 3V7LA 4UB4A 4MFAA 1ZQSA 4QZFA 3B0XA 1ZQEA 5IIOA 4PGYA 4KLOA 5IIJA 3OGUA 1DK2A 1XSPA 4TUQA 3JPSA 5J2IA 4F5RA 7ICRA 4RPXA 2ISOA 4XUSA 4FO6A 1ZQDA 4KLMA 1HUZA 2BCRA 4RQ8A 1ZJNA 3JPTA 4NLNA 3UXOA 1BPYA 3UQ0A 5J29A 4MFCA 4NLZA 4R64A 1ZQRA 2BCQA 3V72A 5DB6A 3RJGA 1ZQGA 2GWSA 5DDYA 3B0YA 2BCVA 4KLGA 4K4GA 5J2GA 2FMPA 2PFNA 4YD1A 3HWTA 4Z6EA 4UAZA 4IQVA 4RQ4A 4O5EA 8ICYA 4NY8A 5DBAA 1ZQNA 2BPGA 4PHDA 4O9MA 9ICMA 8ICWA 4NXZA 1KEJA 3V7JA 3MGIA 5IIIA 5J2KA 4I2IA 1ZQJA 4IQWA 7ICIA 4JWNA 4LZGA 4TUPA 4KLLA 3RJEA 5D46A 3RH5A 9ICGA 2PXIA 8ICMA 8ICAA 3HW8A 4PGXA 9ICOA 4R63A 9ICCA 3TFSA 5CB1A 2FMSA 2ISPA 4K4IA 8ICOA 3RH6A 4I2CA 2PFQA 5TZVA 3PMLA 5J0RA 1ZQOA 8ICZA 5DKWA 9ICRA 4Z6FA 4I2BA 7ICSA 3MGHA 4I28A 4M9JA 1MQ3A 5IILA 9ICTA 1TV9A 3RJKA 3PMNA 1XSNA 7ICKA 3C2LA 9ICFA 4I29A 5IIKA 5BOMA 5J0OA 5IINA 4UB1A 2BPFA 8ICHA 4YMNA 9ICAA 4F5NA 3UXPA 4X5VA 1ZQLA 4QZ8A 4QZHA 9ICSA 4O5CA 4RQ7A 4QZGA 4I2FA 4LZDA 4RPYA 3JPQA 3AU6A 3C2KA 4IQTA 5J0WA 1MQ2A 1BPDA 3AUOA 4I27A 7ICOA 4UBCA 4QZEA 1ZQFA 9ICNA 4QZDA 4TUSA 8ICCA 3LK9A 1BNPA 5BOLA 3RJHA 3TFRA 4P2HA 4I2GA 4MF2A 5BPCA 7ICQA 8ICLA 9ICHA 4O5KA 4IQUA 5J2JA 4XA5A 4DOAA 3C5FA 1RZTA 4RQ0A 4QZCA 8ICJA 5DBCA 5DB7A 8ICNA 5HHHA 4NM1A 8ICTA 1BPXA 1ZQHA 5DB9A 4QZBA 4RQ6A 4NLKA 5J2CA 4MF8A 8ICFA 4RQ1A 3UQ2A 1TVAA 3C2MA 4Z6DA 1KDHA 8ICPA 4KLIA 4TURA 7ICTA 4M9GA 2KP7A 5J2EA 4Z6CA 5DBBA 4M9LA 3HX0A 1ZQAA 2BCUA 4DOBA 4K4HA 1ZQKA 4KLSA 8ICGA 5J0XA 4KLUA 2P66A 4RQ3A 7ICHA 3RJJA 1HUOA 8ICKA 5J0UA 5CWRA 8ICEA 4M47A 9ICWA 4RT3A 4YMMA 9ICXA 1BPEA 9ICUA 4QZIA 5DB8A 1ZQCA 4PPXA 9ICIA 3RJIA 2FMQA 4YN4A 3ISCA 4F5PA 4PHPA 5J2HA 4M2YA 4UB5A 4R65A 4UB2A 4KLFA 4KLHA 4PGQA 9ICKA 2BCSA 4YD2A 4I2DA 4M9HA 5EOZA 3GDXA 7ICPA 3PNCA 3C5GA 3UXNA 4YMOA 2I9GA 4PH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JPR A;  4GXJ A;  4KLT A;  1DK3 A;  5J0S A;  3ISD A;  4UAY A;  8ICV A;  4DOC A;  4R66 A;  8ICX A;  5HHI A;  4I2J A;  4GXK A;  5J2A A;  1ZQT A;  4PHE A;  4RQ2 A;  1ZJM A;  9ICL A;  1ZQQ A;  4MFF A;  4DO9 A;  7ICV A;  5D4B A;  7ICN A;  4RT2 A;  4I2A A;  4NM2 A;  4I2E A;  5J0T A;  1XSL A;  1NZP A;  4M0A A;  9ICJ A;  4QZA A;  5D49 A;  7ICJ A;  4KLE A;  4KLD A;  1ZQP A;  4LVS A;  7ICL A;  4M04 A;  4KLQ A;  9ICP A;  3JPP A;  4UAW A;  4KLJ A;  4RPZ A;  8ICQ A;  7ICM A;  5J2B A;  3RJF A;  5J0P A;  3AU2 A;  5J2F A;  9ICV A;  9ICB A;  8ICB A;  1BPZ A;  8ICI A;  3MDC A;  4YCX A;  5J2D A;  4I2H A;  7ICF A;  7ICG A;  9ICQ A;  4RQ5 A;  4UBB A;  2PFO A;  9ICE A;  1ZQI A;  2PFP A;  1JMS A;  5IIM A;  4JWM A;  8ICS A;  4QZ9 A;  8ICR A;  1ZQB A;  7ICU A;  3V7K A;  3ISB A;  4M9N A;  3UPQ A;  7ICE A;  5J0Y A;  1ZQM A;  3MBY A;  5J0Q A;  8ICU A;  2W9M A;  1BNO A;  3MDA A;  3JPO A;  4UB3 A;  3RH4 A;  2IHM A;  4F5O A;  4PHA A;  4GXI A;  4F5Q A;  3JPN A;  3V7L A;  4UB4 A;  4MFA A;  1ZQS A;  4QZF A;  3B0X A;  1ZQE A;  5IIO A;  4PGY A;  4KLO A;  5IIJ A;  3OGU A;  1DK2 A;  1XSP A;  4TUQ A;  3JPS A;  5J2I A;  4F5R A;  7ICR A;  4RPX A;  2ISO A;  4XUS A;  4FO6 A;  1ZQD A;  4KLM A;  1HUZ A;  2BCR A;  4RQ8 A;  1ZJN A;  3JPT A;  4NLN A;  3UXO A;  1BPY A;  3UQ0 A;  5J29 A;  4MFC A;  4NLZ A;  4R64 A;  1ZQR A;  2BCQ A;  3V72 A;  5DB6 A;  3RJG A;  1ZQG A;  2GWS A;  5DDY A;  3B0Y A;  2BCV A;  4KLG A;  4K4G A;  5J2G A;  2FMP A;  2PFN A;  4YD1 A;  3HWT A;  4Z6E A;  4UAZ A;  4IQV A;  4RQ4 A;  4O5E A;  8ICY A;  4NY8 A;  5DBA A;  1ZQN A;  2BPG A;  4PHD A;  4O9M A;  9ICM A;  8ICW A;  4NXZ A;  1KEJ A;  3V7J A;  3MGI A;  5III A;  5J2K A;  4I2I A;  1ZQJ A;  4IQW A;  7ICI A;  4JWN A;  4LZG A;  4TUP A;  4KLL A;  3RJE A;  5D46 A;  3RH5 A;  9ICG A;  2PXI A;  8ICM A;  8ICA A;  3HW8 A;  4PGX A;  9ICO A;  4R63 A;  9ICC A;  3TFS A;  5CB1 A;  2FMS A;  2ISP A;  4K4I A;  8ICO A;  3RH6 A;  4I2C A;  2PFQ A;  5TZV A;  3PML A;  5J0R A;  1ZQO A;  8ICZ A;  5DKW A;  9ICR A;  4Z6F A;  4I2B A;  7ICS A;  3MGH A;  4I28 A;  4M9J A;  1MQ3 A;  5IIL A;  9ICT A;  1TV9 A;  3RJK A;  3PMN A;  1XSN A;  7ICK A;  3C2L A;  9ICF A;  4I29 A;  5IIK A;  5BOM A;  5J0O A;  5IIN A;  4UB1 A;  2BPF A;  8ICH A;  4YMN A;  9ICA A;  4F5N A;  3UXP A;  4X5V A;  1ZQL A;  4QZ8 A;  4QZH A;  9ICS A;  4O5C A;  4RQ7 A;  4QZG A;  4I2F A;  4LZD A;  4RPY A;  3JPQ A;  3AU6 A;  3C2K A;  4IQT A;  5J0W A;  1MQ2 A;  1BPD A;  3AUO A;  4I27 A;  7ICO A;  4UBC A;  4QZE A;  1ZQF A;  9ICN A;  4QZD A;  4TUS A;  8ICC A;  3LK9 A;  1BNP A;  5BOL A;  3RJH A;  3TFR A;  4P2H A;  4I2G A;  4MF2 A;  5BPC A;  7ICQ A;  8ICL A;  9ICH A;  4O5K A;  4IQU A;  5J2J A;  4XA5 A;  4DOA A;  3C5F A;  1RZT A;  4RQ0 A;  4QZC A;  8ICJ A;  5DBC A;  5DB7 A;  8ICN A;  5HHH A;  4NM1 A;  8ICT A;  1BPX A;  1ZQH A;  5DB9 A;  4QZB A;  4RQ6 A;  4NLK A;  5J2C A;  4MF8 A;  8ICF A;  4RQ1 A;  3UQ2 A;  1TVA A;  3C2M A;  4Z6D A;  1KDH A;  8ICP A;  4KLI A;  4TUR A;  7ICT A;  4M9G A;  2KP7 A;  5J2E A;  4Z6C A;  5DBB A;  4M9L A;  3HX0 A;  1ZQA A;  2BCU A;  4DOB A;  4K4H A;  1ZQK A;  4KLS A;  8ICG A;  5J0X A;  4KLU A;  2P66 A;  4RQ3 A;  7ICH A;  3RJJ A;  1HUO A;  8ICK A;  5J0U A;  5CWR A;  8ICE A;  4M47 A;  9ICW A;  4RT3 A;  4YMM A;  9ICX A;  1BPE A;  9ICU A;  4QZI A;  5DB8 A;  1ZQC A;  4PPX A;  9ICI A;  3RJI A;  2FMQ A;  4YN4 A;  3ISC A;  4F5P A;  4PHP A;  5J2H A;  4M2Y A;  4UB5 A;  4R65 A;  4UB2 A;  4KLF A;  4KLH A;  4PGQ A;  9ICK A;  2BCS A;  4YD2 A;  4I2D A;  4M9H A;  5EOZ A;  3GDX A;  7ICP A;  3PNC A;  3C5G A;  3UXN A;  4YMO A;  2I9G A;  4PH5 A; 
#chains in the Genus database with same CATH topology
 4US9 A;  3H4B A;  4F2R A;  4AYB C;  1L6N A;  1KBU A;  2LYA A;  5AIA A;  3RBD A;  3Q8P B;  3PR4 A;  1RXV A;  3OJU A;  4DOC A;  5KFY A;  3IP4 B;  2QB0 A;  4DL4 A;  5JTI A;  3LWL A;  2BKE A;  4ECX A;  2AQ4 A;  5H2F U;  5J8Y C;  4KX3 A;  3PW2 A;  5CA7 A;  2HHW A;  3GIM A;  1SZP A;  4PHE A;  2LMR A;  1ZJM A;  2K89 A;  2NRV A;  2Q0Z X;  1X66 A;  3BJY A;  4I2A A;  4NM2 A;  1NZP A;  9ICJ A;  2ZIU B;  4Y2V A;  5KFL A;  4LVS A;  3QUC A;  4DWI A;  3E58 A;  5ALY A;  2XID A;  4C4T A;  4KLQ A;  2ZJ8 A;  2JH7 A;  1L3S A;  2WAQ F;  1T8E A;  2A3V A;  4DQR A;  3G6Y A;  5DGB A;  4RNN A;  1KTQ A;  3ETR A;  4CF4 A;  3RJF A;  5ALR A;  5KT5 A;  1GO3 F;  1NKE A;  2JMG A;  4FBU A;  4YG2 A;  3SAH A;  4DSK A;  3AU2 A;  4IR1 A;  5GTI U;  3KFU F;  4TQS A;  4DQI A;  2W9A A;  1BPZ A;  4EEN A;  1QQ5 A;  4DL2 A;  5JUM A;  2H3F A;  3K75 D;  1FO4 A;  4Y2R A;  4F4K A;  4Y2P A;  3QNM A;  5AM0 A;  4NJ8 A;  3MR2 A;  2PFP A;  1JMS A;  2KIC A;  2KKP A;  1SV0 C;  3OTQ A;  2YB4 A;  1RG6 A;  3ISB A;  4M9N A;  2EQY A;  3UPQ A;  3N7P D;  5J0Y A;  2ZIU A;  3LWM A;  3MBY A;  3AEV A;  3A0H U;  1Y88 A;  3NUQ A;  3KTQ A;  3HIL A;  2YX8 A;  3H8W A;  4DS4 A;  4UB3 A;  2LYB A;  4F5O A;  1KL9 A;  4UAU A;  4UB4 A;  5KG1 A;  1TE2 A;  4MFA A;  5EWG A;  1JRP A;  3ED5 A;  3I1Y A;  5IIO A;  3WK6 A;  3CYM A;  4YR2 A;  4ECW A;  4DSF A;  1N5X A;  4TUQ A;  5J2I A;  2WAQ C;  5ALN A;  3M9O B;  1ZQD A;  2WF9 A;  2JR5 A;  1ZJN A;  4NLN A;  1TK5 A;  5AM2 A;  4OD0 A;  2IBK A;  3OSN A;  2UVR A;  4BGD A;  5KFX A;  4B9U A;  1HJP A;  2FPM A;  1FFU A;  1KQQ A;  2ZUC A;  4DSL A;  3WK9 A;  1B0X A;  3UQ0 A;  2O6K A;  4C4R A;  4C8K A;  3RAQ A;  4MFC A;  2P6U A;  1LVH A;  3OHA A;  3IV6 A;  3B0Y A;  4J9N A;  1PUZ A;  2W8L A;  4DEZ A;  5J2G A;  3FM9 A;  2VA3 A;  4YD1 A;  5G5G A;  1BPB A;  4RQ4 A;  2YMP A;  2B0C A;  2YB1 A;  1YZ6 A;  3DV9 A;  3KHG A;  5DBA A;  2ZJ5 A;  1U45 A;  1PVR A;  2BPG A;  4PHD A;  5ALM A;  2EZX A;  4HYK A;  2F3N A;  4R8U B;  1KEJ A;  3V7J A;  1NK5 A;  1BGX T;  5KFF A;  1SWV A;  1V38 A;  5J2K A;  4LJX A;  2QLT A;  1ZQJ A;  1SWW A;  4IQW A;  7ICI A;  4JWN A;  3RJE A;  5D46 A;  2EAP A;  3H0L B;  3EPG A;  2PI4 A;  2KK0 A;  3IN5 A;  2ZIW A;  3EW9 A;  4PGX A;  2MU2 A;  5L1L A;  5KFQ A;  1B43 A;  3HRD D;  3M6Z A;  5KFD A;  2ISP A;  4Q43 A;  5TZV A;  5J0R A;  2VJ4 A;  3MGH A;  5JU5 A;  3F2C A;  2F8L A;  4DFJ A;  5AI8 A;  2KJ5 A;  3RTV A;  4CGZ A;  3A0B U;  2W04 A;  3RJK A;  2DFL A;  1UCV A;  3G6X A;  1Q3U A;  3RR7 A;  2DKZ A;  4R8U A;  4GC7 A;  1L3U A;  3C2L A;  3C28 A;  2NYV A;  5KTQ A;  3H0M B;  5L1J A;  2CPR A;  4O0I A;  4Y2Y A;  3NVV A;  1VDV A;  5L1I A;  1ZQ1 C;  4KTQ A;  4F5N A;  4MEX A;  4F91 B;  1SKW A;  4KIT B;  3K1Z A;  2Y9U A;  4RQ7 A;  4I2F A;  5GTH U;  4UAT A;  1NK8 A;  4RU9 A;  3AU6 A;  3C2K A;  5J0W A;  2F44 A;  4EBD A;  3AUO A;  3RB4 A;  2ZIV B;  7ICO A;  2C2D A;  3FYH A;  1L7M A;  4EBE A;  4JV1 A;  4GLX A;  8ICC A;  2D3D A;  2JGA A;  3RJH A;  3TFR A;  3THV A;  4P2H A;  4I2G A;  2XGP A;  1KSP A;  5BPC A;  7ICQ A;  9ICH A;  3L4P A;  4O5K A;  4IQU A;  3L5K A;  4C0Z A;  1XNS A;  4XA5 A;  2HMX A;  2KVC A;  1QSS A;  4J9S A;  5DB7 A;  5AKY A;  4WJ3 B;  8ICN A;  3GIK A;  2V9W A;  2ZUB A;  1ZQH A;  4YXJ A;  2WB1 F;  3QYP A;  4FS1 A;  4MF8 A;  3ZDD A;  8ICF A;  3UQ2 A;  3C2M A;  4FS2 A;  3ZDA A;  4KLI A;  1JXL A;  1Z4O A;  4M9G A;  3FC4 A;  4CCH A;  5L9X A;  2KFZ A;  1N5W A;  3HX0 A;  5KFT A;  2DL0 A;  3KOO A;  5AKX A;  4QW9 A;  2ZIV A;  2C2E A;  3NVW A;  2P66 A;  4U6P A;  3RJJ A;  5HR6 A;  4JMU A;  2E5S A;  1ECW A;  2AJQ A;  4OJP A;  1PK3 A;  4DL5 A;  5CWR A;  5EE0 A;  3HP6 A;  1XC9 A;  3QUB A;  4YMM A;  9ICX A;  5HMM A;  5AKK A;  1VLB A;  1NJY A;  1NKB A;  4Q44 A;  4QZI A;  3IM1 A;  2HHX A;  2Y0S F;  2G09 A;  5KFM A;  2ASJ A;  4OJL A;  3QU7 A;  4PHP A;  3LVV A;  1DGS A;  1N2X A;  4R65 A;  4TQR A;  2W7O A;  4C8M A;  5T14 A;  4PGQ A;  4BDP A;  2H3I A;  2IOH A;  4PZN A;  4J9L A;  2AH5 A;  4XQ8 A;  1YT3 A;  2K8B B;  1X6J A;  5EOZ A;  3PY8 A;  4F4W A;  2WB1 C;  5AK5 A;  3C5G A;  4F4X A;  3TQ1 A;  4ED8 A;  3RB0 A;  3KBB A;  2I9G A;  2VA2 A;  5KFV A;  1ZQX A;  1SL1 A;  2QAR B;  1O08 A;  1DK3 A;  3NVZ A;  3ISD A;  1IIP A;  4ELU A;  2N1R A;  1L7P A;  3K4G A;  2HBL A;  2KMD A;  4F8R A;  4C7Z A;  5KT7 A;  3PR5 B;  3SQI A;  3F5A A;  3M7D A;  2HHS A;  4RNO A;  2CN1 A;  2AGP A;  2XO7 A;  1L3T A;  4BWJ A;  5ALO A;  4MFF A;  3V6K A;  7ICV A;  2KG5 A;  2H5X A;  4YVZ A;  3ZDC A;  4DQP A;  4RT2 A;  1QTM A;  1TAU A;  1NI3 A;  3BQ2 A;  3K1R B;  1A0P A;  3BS7 A;  3SAF A;  2P35 A;  1UT8 A;  4QZA A;  4FZM A;  1S5L U;  5KFS A;  1N61 A;  4Y2T A;  3IRU A;  2DWQ A;  3F53 A;  2KD1 A;  2UVU A;  4QIW F;  4PL1 A;  1A76 A;  4UAW A;  2LI6 A;  1QQ7 A;  2JEJ A;  1D8B A;  2AQ0 A;  7ICM A;  4DF4 A;  2KZZ A;  5DLG A;  5DQG A;  4QWC A;  3N7S C;  2CRX A;  1J2N A;  1T7P A;  4ECY A;  1RDF A;  8ICB A;  5A0L A;  2V4R A;  8ICI A;  2WFA A;  5J2D A;  7ICF A;  3BZC A;  4RQ5 A;  5AKH A;  4O3P A;  4BWM A;  1C7Y A;  1QH9 A;  4B6J A;  5KFI A;  2HBM A;  2VIX A;  5EWF A;  1NJZ A;  4JWM A;  2GOL A;  4QZ9 A;  8ICS A;  1UHU A;  3ONN A;  5KFC A;  5TIS U;  3V7K A;  4E0D A;  2AGO A;  4AP9 A;  3DEE A;  3U26 A;  5HR7 A;  1JI7 A;  3UMG A;  5J0Q A;  8ICU A;  2W9M A;  1BNO A;  3KKA C;  4HAI A;  3JPO A;  1ZQW A;  5KFU A;  3HPO A;  2K8A A;  3GFK B;  3IHQ B;  5ALK A;  5KG3 A;  3V7L A;  3MFH A;  1UA1 A;  4J9K A;  1PK1 B;  1ZQS A;  5KG0 A;  3AMZ A;  3MR6 A;  3B0X A;  3GIL A;  5DG7 A;  4PGY A;  4KLO A;  1ZD3 A;  3PW7 A;  4ED0 A;  1RM6 C;  4DSI A;  1XSP A;  4QIW C;  3GQC A;  2HSZ A;  2YML A;  3PVX A;  1MN8 A;  1U9L A;  4FO6 A;  4DFD A;  2WHE A;  1HUZ A;  3PSF A;  1S0O A;  2BCR A;  4BX9 C;  4RQ8 A;  4UB8 U;  4F71 A;  3JPT A;  1NK0 A;  3UXO A;  2KZM A;  1WYG A;  1V97 A;  1EXN A;  4JV0 A;  2K4H A;  5J29 A;  1UT5 A;  1SXE A;  4NLZ A;  2OH2 A;  1ZQR A;  2W43 A;  2C28 A;  1Q3V A;  2R8G A;  3CW2 C;  3RJG A;  2IA6 A;  1FIQ A;  2KIV A;  3LYS A;  3T79 A;  3PX6 A;  3BQ7 A;  2AXT U;  2F1H A;  3UM9 A;  4KLG A;  2BHN A;  1XO0 A;  2KZ3 A;  4K4G A;  1TKD A;  1N60 A;  2PFN A;  3CP8 A;  1Z4N A;  3HWT A;  3FAH A;  1PK1 A;  3ICX A;  2G0A A;  1FEZ A;  3DDH A;  3HJE A;  5ALT A;  3PW4 A;  2UVW A;  1ZQV A;  2RRD A;  3EUB 2;  1SGG A;  2JEG A;  2HBK A;  3WKD A;  2GLE A;  2VKQ A;  8ICW A;  1F5S A;  2BQU A;  2W9B B;  1UQV A;  3UMC A;  1PVP A;  2KJ8 A;  2NO4 A;  2E8M A;  1S77 D;  1ZD5 A;  2A1J B;  5ALL A;  4LZG A;  3RB6 A;  4ECU A;  3RH5 A;  1QSY A;  9ICG A;  4DSE A;  8ICM A;  5KL8 B;  1ZQY A;  2AGQ A;  9ICO A;  5ALE A;  4R63 A;  3AQF A;  3TFS A;  1RYU A;  2PKE A;  3WKB A;  2NRZ A;  8ICO A;  1X40 A;  2J6T A;  5KAF U;  2KKV A;  4QWB A;  2ASL A;  3D6J A;  4G3I A;  1XWL A;  2QB1 A;  5C5J A;  9ICR A;  2ZJA A;  4Z6F A;  1RPL A;  2W54 A;  3N28 A;  3RAX A;  1F44 A;  4B9V A;  2JEI A;  2BR0 A;  9ICT A;  3PO5 A;  2YY6 A;  5AK3 A;  2OHF A;  3PMN A;  4KN4 A;  2W9B A;  3RR8 A;  2IOF A;  9ICF A;  1KKX A;  4O3Q A;  5DQH A;  2UVV A;  1DOQ A;  5J0O A;  4DQQ A;  2XCP A;  5KG5 A;  2A1J A;  4MEY A;  4IL6 U;  4QWE A;  4UB1 A;  2BPF A;  3ZDE A;  5JRT A;  1NK9 A;  1N63 A;  4YMN A;  4EZ6 A;  2K4P A;  3CNH A;  3MR3 A;  2BGW A;  2H3Z A;  1KRP A;  4FFD A;  4QZ8 A;  3WKE A;  2ZIW B;  4RPY A;  1Z00 B;  1IG6 A;  4JUZ A;  2FE9 A;  4QWD A;  4IQT A;  2HOF A;  4I27 A;  3WKA A;  2VJ5 A;  2A19 A;  3UMB A;  3EYZ A;  5KAI U;  2V4Q A;  3I76 A;  9ICN A;  4JB3 A;  4QZD A;  1A77 A;  4TUS A;  4J9Q A;  1DRG A;  2EDU A;  5KFE A;  4MF2 A;  4FZL A;  5KFA A;  5F9L A;  3WKC A;  3C5F A;  2CXY A;  3AQE A;  4O3O A;  8ICJ A;  1TAQ A;  5HHH A;  4NM1 A;  2E1F A;  8ICT A;  4ZOH C;  1X9X A;  3SR6 A;  2HOI A;  5J2C A;  4MHV A;  4C8O A;  4ED7 A;  1X9S A;  1KFT A;  4NLG A;  1TVA A;  4CF3 A;  1KDH A;  4M6W B;  1QLN A;  1Z00 A;  2KP7 A;  4P4M A;  2K4E A;  3C1Y A;  1KW4 A;  4EYI B;  1XS9 D;  1JXE A;  5F3X B;  5ALV A;  1ZQA A;  3M8R A;  2DF4 B;  4ED6 A;  4UB6 U;  4B9L A;  5J0X A;  4ELV A;  4KLU A;  3VC8 A;  3RBE A;  4RQ3 A;  2XCA A;  2W9C B;  1O03 A;  4CRX A;  5J0U A;  3T5H A;  8ICE A;  4RT3 A;  1S76 D;  1QCK A;  2LBO A;  2RDJ A;  4OJ6 A;  1KFS A;  2KV2 A;  2EZY A;  5AKE A;  1PVQ A;  2FLN A;  2KTQ A;  1Z1B A;  4PPX A;  9ICI A;  2Q4T A;  4XRH A;  4YN4 A;  3ISC A;  2DUY A;  4M2Y A;  2NRX A;  2J6S A;  5HML A;  1JN3 A;  4OJ5 A;  2F77 X;  3WK8 A;  5AKI A;  4DL7 A;  2E1E A;  1U48 A;  2BCS A;  2ZIX B;  3GV7 B;  3PST A;  4M9H A;  4M6W A;  1U49 A;  1K5O A;  3T5J A;  2KVS A;  3GDX A;  3GU3 A;  7ICP A;  3QX7 A;  3PNC A;  1ZQZ A;  5CHG A;  3UXN A;  4YMO A;  4ECQ A;  3QEA Z;  1Q46 A;  2PI5 A;  4GXJ A;  5J0S A;  5ALG A;  2HHQ A;  2W9C A;  4UAY A;  2HVI A;  4NWI A;  3G6V A;  3BS5 A;  4DS5 A;  2HHT A;  1ZET A;  4R66 A;  2YTU A;  3KHL A;  8ICX A;  5HHI A;  3M1Y A;  3KZX A;  1M6Y A;  2I6X A;  4I2J A;  2KE7 A;  5J2A A;  4UAS A;  2ODG A;  4RQ2 A;  9ICL A;  3PSP A;  1ZQQ A;  1TK8 A;  4DO9 A;  5D4B A;  3TAD A;  2KHV A;  4EEL A;  3SAG A;  2LHT A;  5J0T A;  5ALX A;  1XSL A;  4M0A A;  1L8L A;  3T5L A;  3AM9 A;  4KLE A;  2ZIX A;  7ICL A;  3T3F A;  1ZYQ A;  4M04 A;  2JHD A;  2DBY A;  2PMZ F;  4O3S A;  1X6I A;  4DFP A;  4KLJ A;  4F3O A;  4IRC A;  3V6J A;  5C0Y A;  8ICQ A;  5KT2 A;  2JRZ A;  3MFI A;  4EZ9 A;  2M0N A;  5ALW A;  4IRD A;  3QZ8 A;  1OXJ A;  5J2F A;  2OXO A;  4KX5 A;  4NL9 A;  3MDC A;  1X2I A;  4RQN A;  7ICG A;  4F50 A;  2H3V A;  1ZRN A;  9ICQ A;  1B4F A;  2F1I A;  4UBB A;  5KFN A;  2M9N A;  2RDI A;  3H8S A;  3RB3 A;  2R8I A;  1NNL A;  9ICE A;  5ALI A;  5DDM A;  8ICR A;  2BZF A;  1S8O A;  3ZD8 A;  2WTF A;  7ICU A;  3ZI4 A;  2J6U A;  1D9F A;  4UW9 A;  1ZQM A;  3MDA A;  2IHM A;  2KOB A;  3RH4 A;  3QUT A;  4F92 B;  2JXJ A;  4F5Q A;  1NJW A;  4F4Z A;  4IRK A;  1ZQE A;  4RZR A;  3SYZ A;  5IIJ A;  4F72 A;  4QNL A;  3GV5 B;  4GIB A;  3OGU A;  3NRW A;  1DK2 A;  3J81 j;  3JPS A;  2PMZ C;  3Q8K A;  4F5R A;  7ICR A;  2ISO A;  1WWV A;  4A8E A;  4KLM A;  1Z3E B;  5KG4 A;  3Q8R B;  2MUT B;  5EWE A;  2C2R A;  4P0P B;  1JX4 A;  1RQL A;  2KHQ A;  3GIJ A;  4J9R A;  2DPJ A;  2DPI A;  2XVT A;  4FBT A;  2HVH A;  2JH1 A;  5E79 U;  2FLL A;  3V72 A;  2F8K A;  4ELT A;  1ZQG A;  2GWS A;  2K4I A;  2BCV A;  2W3S A;  4IC9 A;  3PX4 A;  2W03 A;  1U4B A;  2FMP A;  1KN5 A;  4EBC A;  1SKS A;  5AI6 A;  4UAZ A;  2Y0S C;  5KT6 A;  4IQV A;  2EAM A;  2BPC A;  2Y1J A;  3HKZ F;  2QKQ A;  8ICY A;  1RQN A;  5AHX A;  2JV3 A;  3SEI A;  1ZQN A;  4O9M A;  1PZN A;  4NXZ A;  3MGI A;  5III A;  5KFK A;  4JV2 A;  5J8Y A;  4I2I A;  2OM6 A;  1ZOL A;  1OUQ A;  4KLL A;  4B9S A;  2MUT A;  4P0P A;  3RFA A;  5EE3 A;  5B5E U;  1AQ6 A;  1WCL A;  5EE1 A;  4UAR A;  1YZ7 A;  1SXD A;  1DXS A;  3QZ7 A;  2FMS A;  3PW5 A;  1HIW A;  4K4I A;  3KHH A;  2ZUD A;  3RH6 A;  4YXM A;  2ES6 A;  3PML A;  1ZQO A;  8ICZ A;  5DKW A;  1TAM A;  4YR0 A;  5KFZ A;  7ICS A;  1L8O A;  4ICA A;  3BDP A;  2ZG6 A;  4M9J A;  3NS1 A;  2EZZ A;  1XO1 A;  1SL2 A;  1MQ3 A;  4Y2J A;  2W55 A;  3QU5 A;  1TV9 A;  1XU4 A;  1D8L A;  1XSN A;  2E8N A;  3BQ1 A;  2G5H B;  3M9M B;  4UQG A;  2DQN B;  4I29 A;  5IIK A;  2NRT A;  5BOM A;  3CRX A;  2E8P A;  1C20 A;  3Q8M A;  3HKZ C;  1RYS A;  1X9W A;  4Y2Q A;  4PZO A;  4BUG A;  2HHV A;  4KMO B;  3N4M B;  5ALZ A;  1QSL A;  3SI8 A;  3I28 A;  3N7R C;  4Q45 A;  5ALJ A;  3WK5 A;  4ECR A;  4RUA A;  9ICA A;  1QQ6 A;  4ZH4 A;  5AK6 A;  3IG8 A;  3RRG A;  4ED1 A;  9ICS A;  4DFM A;  4DLG A;  1SV0 A;  1WCN A;  3PW0 A;  4O5C A;  3D2S A;  1HEK A;  4QZG A;  3SV3 A;  1MSW D;  1N62 A;  2ESE A;  4NV0 A;  3NVY A;  1S97 A;  2R8K A;  4OCZ A;  3GV8 B;  4J9M A;  1MQ2 A;  1BPD A;  4ED2 A;  4FE3 A;  4C8L A;  4YR3 A;  1SKR A;  4DL3 A;  4UBC A;  3TAQ A;  1NOM A;  2AU0 A;  1ZQF A;  2I1Q A;  4CE6 A;  3VCB A;  2HCF A;  3LVW A;  5AI5 A;  3LK9 A;  4Y2U A;  1BNP A;  4Y2X A;  4C8N A;  1COK A;  3OJS A;  4KMU A;  4F2S A;  3KHR A;  1ED1 A;  1WWU A;  3RRH A;  4EYH B;  8ICL A;  5J2J A;  4DOA A;  4O3R A;  3BQT A;  2LKY A;  4QZC A;  4ECZ A;  5DBC A;  4B9T A;  1TK0 A;  5AKG A;  1S10 A;  3B9J A;  1BPX A;  2RP5 A;  4RQ6 A;  2BQR A;  3E0F A;  4RQ1 A;  1KFD A;  4US8 A;  4C7Y A;  4EX7 A;  4P0Q B;  7ICT A;  3WK4 A;  5J2E A;  1S0M A;  5KFJ A;  3F5E A;  1T3Q A;  2BCU A;  4DOB A;  4K4H A;  5DGA A;  2FDR A;  2I5H A;  7ICH A;  5AM3 A;  1IXR A;  4B9N A;  5KT3 A;  1JAL A;  3MAB A;  1TFR A;  2VA8 A;  5AM4 A;  4M47 A;  3C23 A;  9ICW A;  4J9O A;  3PX0 A;  2YN4 A;  4YP3 A;  4USA A;  5KG6 A;  1BPE A;  4GC6 A;  9ICU A;  1SB3 C;  4O3N A;  2RLT A;  1X42 A;  2NRW A;  3RJI A;  2FMQ A;  2KEY A;  5AI4 A;  2R8J A;  5CP2 A;  4F5P A;  5AM5 A;  4Y2S A;  4UB5 A;  1H38 A;  2FPK A;  4KLH A;  2YQE A;  3OSP A;  3TAP A;  2OCE A;  5KFO A;  4DLE A;  4YD2 A;  4I2D A;  4P0Q A;  3MR5 A;  5KNI A;  3GZF A;  1ZD2 P;  2EAO A;  4RUC A;  3KZI U;  2KFN A;  1KLN A;  4PH5 A;  3H8J A;  3NAS A;  3JPR A;  2XY5 A;  4KLT A;  2OEH A;  3H8M A;  3Q8S B;  4Q8F A;  4RNM A;  2E3T A;  3MGV A;  8ICV A;  5KL1 B;  1N48 A;  2WF8 A;  4ACO A;  3F2D A;  2JEF A;  1NK7 A;  4GXK A;  1ZQT A;  1VJ5 A;  1T3N A;  5AIC A;  2ASD A;  3SV4 A;  2LM1 A;  3TAC B;  2K8C B;  7ICN A;  3SD7 A;  1COO A;  2YMM A;  2BDP A;  5B66 U;  4I2E A;  2F1J A;  5ALH A;  2R8H A;  3SZ2 A;  4DF8 A;  5D49 A;  3NGD A;  7ICJ A;  4KLD A;  1ZQP A;  1IM4 A;  1ARO P;  3R9K A;  1T4G A;  2W3R A;  1MC8 A;  2EH9 A;  3PV8 A;  9ICP A;  3JPP A;  2C22 A;  1RXW A;  2KSO B;  3C21 A;  3N97 B;  4RPZ A;  2MA1 A;  4OJO A;  5J2B A;  2KN7 A;  2BQ3 A;  5J0P A;  5CJ7 A;  2K60 A;  3ETL A;  2IOF K;  2W11 A;  2B21 A;  3GII A;  9ICV A;  9ICB A;  1Q8K A;  2MRL A;  4NLB A;  4BXO B;  1T94 A;  2NO5 A;  5ALD A;  4YCX A;  5KT4 A;  1LKY B;  3M9N B;  4I2H A;  3BS5 B;  5KG2 A;  4GFJ A;  3PSI A;  1RYR A;  1ZD4 A;  3SMV A;  2PFO A;  1ZQI A;  5ALU A;  5ALF A;  5DG9 A;  5IIM A;  5AKL A;  2DGZ A;  1ZQB A;  2MSN A;  2B6G A;  1J2M A;  1L5U A;  7ICE A;  4UAV A;  4ED3 A;  1Z19 A;  2NV3 A;  3QEB Z;  3PO4 A;  4PHA A;  4C4S A;  4GXI A;  4JK1 A;  2KSO A;  3JPN A;  1N56 A;  1CEZ A;  4QZF A;  1WG8 A;  5KFP A;  3H40 A;  3C29 A;  1A6S A;  3QU4 A;  1CUK A;  4CDG A;  2HW3 A;  3PZP A;  1SZH A;  1WUD A;  1NZB A;  2EAN A;  2ALZ A;  5KFR A;  5CEH A;  4RPX A;  4XUS A;  4BXO A;  1LKY A;  3TKA A;  3BQ0 A;  2W7P A;  1B22 A;  4EX6 A;  5AKZ A;  2GH1 A;  2H3Q A;  1URJ A;  1BPY A;  2ZTE A;  2E8O A;  2RQ5 A;  4BJQ A;  2FI1 A;  4F4Y A;  4PJ0 U;  2FPL A;  2HOQ A;  2ZTC A;  3AN1 A;  4R64 A;  2XGQ A;  2BCQ A;  3SEN A;  1UPH A;  5DB6 A;  5DDY A;  1DGJ A;  5AM1 A;  5FP0 A;  3TAR A;  2AHO B;  1V9P A;  3M6K A;  4Z6E A;  1ZXI A;  3EPI A;  5F9N A;  4O5E A;  2HBJ A;  2WF5 A;  5DLF A;  4NY8 A;  3BZK A;  5ALQ A;  9ICM A;  1S9F A;  2Y1I A;  5CR0 A;  2LPE A;  2IHN A;  2ZTD A;  1LV5 A;  3F2B A;  5KFH A;  4PL2 A;  4F93 B;  4KN7 A;  3QXG A;  2IMW P;  5KFW A;  4IS7 A;  4TUP A;  2P6R A;  3NTU A;  4ECV A;  2PXI A;  2YMQ A;  5AIB A;  3HW8 A;  8ICA A;  2HDO A;  5ALP A;  3QU2 A;  1UA0 A;  1F0M A;  9ICC A;  2OYY A;  3EWA A;  4B9M A;  3QU9 A;  2FJ6 A;  3ALR A;  5CB1 A;  2W8K A;  2WF7 A;  5KFB A;  3ZDB A;  2WF6 A;  1CRX A;  4I2C A;  2PFQ A;  3H7I A;  1IV8 A;  4DL6 A;  2F2A B;  1CI4 A;  1NJX A;  1D9D A;  4I2B A;  3QUQ A;  1NK6 A;  2D6F C;  4I28 A;  2R18 A;  4P4P A;  4CNQ A;  1X9M A;  1MA7 A;  3D2Q A;  5IIL A;  2FLP A;  4DSJ A;  2JZB B;  1OW5 A;  3RF9 A;  3OHB A;  3WK7 A;  3LDA A;  7ICK A;  1JUD A;  1LB2 B;  2GO7 A;  2DKX A;  3S6J A;  3H0R B;  5EE9 A;  3Q8Q B;  3KD3 A;  1JRO A;  3TAD C;  2XY6 A;  2G08 A;  4DFK A;  2Y9T A;  3TAN A;  3HT3 A;  1D8Y A;  5IIN A;  8ICH A;  3NRZ A;  3UXP A;  1Z1V A;  4X5V A;  1ZQL A;  4QJF B;  4QZH A;  2KNJ A;  4LZD A;  2ZXI A;  4U7C A;  2LYH A;  4EEK A;  3JPQ A;  4QWA A;  1V85 A;  3T5K A;  3OPX A;  5L1M A;  5DG8 A;  3KKA A;  4O3M A;  4FZN A;  4EEY A;  2Z7J A;  5AI9 A;  1L3V A;  3O0F A;  3ZD9 A;  4QZE A;  3E2E A;  5AK4 A;  2BDU A;  2KJ9 A;  1U47 A;  4Q8E A;  5HNK A;  1SV4 A;  1FFV A;  5BOL A;  4J9P A;  4NL9 C;  1ZQU A;  2G06 A;  2JZB A;  1SIJ A;  4P4O A;  1ZRM A;  2XC9 A;  1RZT A;  1L7N A;  4RQ0 A;  5AI0 A;  1P7D A;  3ORY A;  2A1A A;  2OWO A;  2RHF A;  5DB9 A;  4QZB A;  4NLK A;  3AL0 B;  3H4D A;  2VAN A;  3IG5 A;  4CF5 A;  5DQI A;  3FDS A;  4Z6D A;  4AYB F;  8ICP A;  4TUR A;  3IDW A;  3QE9 Y;  2QAR A;  4Z6C A;  4IR9 A;  1JIH A;  5DBB A;  3EZ5 A;  4M9L A;  3Q8L A;  5CRX A;  4J03 A;  1ZQK A;  4KLS A;  4G9B A;  1SL0 A;  8ICG A;  3L3F X;  5HP4 A;  2G5I B;  3WU2 U;  1HUO A;  8ICK A;  3D2N A;  5G5H A;  2KIW A;  2QB0 B;  3C1Z A;  1J97 A;  2L5Y A;  1NK4 A;  1NKC A;  4QW8 A;  1K1Q A;  2MAX A;  1K1S A;  2ATL A;  4YFK A;  5DB8 A;  5ALS A;  1ZQC A;  4NLC A;  3V6H A;  3MC1 A;  2HHU A;  2F76 X;  4RQM A;  4ECS A;  5KFG A;  5J2H A;  4ECT A;  4UB2 A;  2D8C A;  2LM4 A;  4DQS A;  2XI9 A;  4KLF A;  5K4L A;  1S0N A;  5KG7 A;  4OO1 J;  9ICK A;  1L7O A;  2XY7 A;  2HI0 A;  5L1K A;  3TI0 A;  3M8S A;  1S0V A;  1BVS A;  5AKJ A;  2G07 A;  4YQW A;  4DCC A;  4C80 A;  2XIC A;  2ZXH A; 
#chains in the Genus database with same CATH homology
 3JPR A;  4GXJ A;  4KLT A;  1DK3 A;  5J0S A;  3ISD A;  4UAY A;  8ICV A;  4DOC A;  4R66 A;  8ICX A;  5HHI A;  4I2J A;  4GXK A;  5J2A A;  1ZQT A;  4PHE A;  4RQ2 A;  1ZJM A;  9ICL A;  1ZQQ A;  4MFF A;  4DO9 A;  7ICV A;  5D4B A;  7ICN A;  4RT2 A;  4I2A A;  4NM2 A;  4I2E A;  5J0T A;  1XSL A;  1NZP A;  4M0A A;  9ICJ A;  4QZA A;  5D49 A;  7ICJ A;  4KLE A;  4KLD A;  1ZQP A;  4LVS A;  7ICL A;  4M04 A;  4KLQ A;  9ICP A;  3JPP A;  4UAW A;  4KLJ A;  4RPZ A;  8ICQ A;  7ICM A;  5J2B A;  3RJF A;  5J0P A;  3AU2 A;  5J2F A;  9ICV A;  9ICB A;  8ICB A;  1BPZ A;  8ICI A;  3MDC A;  4YCX A;  5J2D A;  4I2H A;  7ICF A;  7ICG A;  9ICQ A;  4RQ5 A;  4UBB A;  2PFO A;  9ICE A;  1ZQI A;  2PFP A;  1JMS A;  5IIM A;  4JWM A;  8ICS A;  4QZ9 A;  8ICR A;  1ZQB A;  7ICU A;  3V7K A;  3ISB A;  4M9N A;  3UPQ A;  7ICE A;  5J0Y A;  1ZQM A;  3MBY A;  5J0Q A;  8ICU A;  2W9M A;  1BNO A;  3MDA A;  3JPO A;  4UB3 A;  3RH4 A;  2IHM A;  4F5O A;  4PHA A;  4GXI A;  4F5Q A;  3JPN A;  3V7L A;  4UB4 A;  4MFA A;  1ZQS A;  4QZF A;  3B0X A;  1ZQE A;  5IIO A;  4PGY A;  4KLO A;  5IIJ A;  3OGU A;  1DK2 A;  1XSP A;  4TUQ A;  3JPS A;  5J2I A;  4F5R A;  7ICR A;  4RPX A;  2ISO A;  4XUS A;  4FO6 A;  1ZQD A;  4KLM A;  1HUZ A;  2BCR A;  4RQ8 A;  1ZJN A;  3JPT A;  4NLN A;  3UXO A;  1BPY A;  3UQ0 A;  5J29 A;  4MFC A;  4NLZ A;  4R64 A;  1ZQR A;  2BCQ A;  3V72 A;  5DB6 A;  3RJG A;  1ZQG A;  2GWS A;  5DDY A;  3B0Y A;  2BCV A;  4KLG A;  4K4G A;  5J2G A;  2FMP A;  2PFN A;  4YD1 A;  3HWT A;  4Z6E A;  4UAZ A;  4IQV A;  4RQ4 A;  4O5E A;  8ICY A;  4NY8 A;  5DBA A;  1ZQN A;  2BPG A;  4PHD A;  4O9M A;  9ICM A;  8ICW A;  4NXZ A;  1KEJ A;  3V7J A;  3MGI A;  5III A;  5J2K A;  4I2I A;  1ZQJ A;  4IQW A;  7ICI A;  4JWN A;  4LZG A;  4TUP A;  4KLL A;  3RJE A;  5D46 A;  3RH5 A;  9ICG A;  2PXI A;  8ICM A;  8ICA A;  3HW8 A;  4PGX A;  9ICO A;  4R63 A;  9ICC A;  3TFS A;  5CB1 A;  2FMS A;  2ISP A;  4K4I A;  8ICO A;  3RH6 A;  4I2C A;  2PFQ A;  5TZV A;  3PML A;  5J0R A;  1ZQO A;  8ICZ A;  5DKW A;  9ICR A;  4Z6F A;  4I2B A;  7ICS A;  3MGH A;  4I28 A;  4M9J A;  1MQ3 A;  5IIL A;  9ICT A;  1TV9 A;  3RJK A;  3PMN A;  1XSN A;  7ICK A;  3C2L A;  9ICF A;  4I29 A;  5IIK A;  5BOM A;  5J0O A;  5IIN A;  4UB1 A;  2BPF A;  8ICH A;  4YMN A;  9ICA A;  4F5N A;  3UXP A;  4X5V A;  1ZQL A;  4QZ8 A;  4QZH A;  9ICS A;  4O5C A;  4RQ7 A;  4QZG A;  4I2F A;  4LZD A;  4RPY A;  3JPQ A;  3AU6 A;  3C2K A;  4IQT A;  5J0W A;  1MQ2 A;  1BPD A;  3AUO A;  4I27 A;  7ICO A;  4UBC A;  4QZE A;  1ZQF A;  9ICN A;  4QZD A;  4TUS A;  8ICC A;  3LK9 A;  1BNP A;  5BOL A;  3RJH A;  3TFR A;  4P2H A;  4I2G A;  4MF2 A;  5BPC A;  7ICQ A;  8ICL A;  9ICH A;  4O5K A;  4IQU A;  5J2J A;  4XA5 A;  4DOA A;  3C5F A;  1RZT A;  4RQ0 A;  4QZC A;  8ICJ A;  5DBC A;  5DB7 A;  8ICN A;  5HHH A;  4NM1 A;  8ICT A;  1BPX A;  1ZQH A;  5DB9 A;  4QZB A;  4RQ6 A;  4NLK A;  5J2C A;  4MF8 A;  8ICF A;  4RQ1 A;  3UQ2 A;  1TVA A;  3C2M A;  4Z6D A;  1KDH A;  8ICP A;  4KLI A;  4TUR A;  7ICT A;  4M9G A;  2KP7 A;  5J2E A;  4Z6C A;  5DBB A;  4M9L A;  3HX0 A;  1ZQA A;  2BCU A;  4DOB A;  4K4H A;  1ZQK A;  4KLS A;  8ICG A;  5J0X A;  4KLU A;  2P66 A;  4RQ3 A;  7ICH A;  3RJJ A;  1HUO A;  8ICK A;  5J0U A;  5CWR A;  8ICE A;  4M47 A;  9ICW A;  4RT3 A;  4YMM A;  9ICX A;  1BPE A;  9ICU A;  4QZI A;  5DB8 A;  1ZQC A;  4PPX A;  9ICI A;  3RJI A;  2FMQ A;  4YN4 A;  3ISC A;  4F5P A;  4PHP A;  5J2H A;  4M2Y A;  4UB5 A;  4R65 A;  4UB2 A;  4KLF A;  4KLH A;  4PGQ A;  9ICK A;  2BCS A;  4YD2 A;  4I2D A;  4M9H A;  5EOZ A;  3GDX A;  7ICP A;  3PNC A;  3C5G A;  3UXN A;  4YMO A;  2I9G A;  4PH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...