1BNOA

Nmr solution structure of the n-terminal domain of dna polymerase beta, minimized average structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
87
structure length
87
Chain Sequence
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional solution structure of the N-terminal domain of DNA polymerase beta and mapping of the ssDNA interaction interface.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Nucleotidyltransferase (dna-binding)
molecule keywords DNA POLYMERASE BETA
total genus 13
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1996-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1bnoA00
5J0RA 4TURA 3B0YA 8ICXA 7ICUA 5IIIA 1ZQDA 3HW8A 5D49A 1TVAA 4GXIA 7ICGA 4YD2A 7ICQA 4O9MA 4FO6A 4KLSA 7ICLA 4K4IA 2GWSA 8ICBA 1XSPA 4NLZA 9ICHA 4PGYA 4TUQA 2ISPA 9ICNA 7ICEA 4Z6DA 8ICTA 4NXZA 5J0QA 4UB4A 5J0WA 4QZAA 1ZJMA 4I29A 4DOCA 3PNCA 9ICMA 4YN4A 4LZDA 8ICKA 2BCRA 5J2DA 3MGIA 9ICOA 7ICTA 2FMPA 3TFRA 1ZQTA 4MFCA 2BCVA 3C2MA 4RQ7A 1ZQEA 4IQUA 3HX0A 1MQ2A 2BCUA 4I2FA 4KLLA 4I2AA 5IIMA 1RZTA 3JPNA 9ICJA 1ZJNA 3RH6A 4I2DA 5IIKA 4KLTA 7ICNA 5DBCA 4I2GA 1KDHA 4UB3A 1DK3A 5D4BA 1ZQBA 9ICKA 3UXPA 1XSNA 5J2BA 1KEJA 1BPDA 4QZIA 3RJEA 4YMNA 4R65A 1ZQNA 7ICFA 1ZQOA 4I2BA 4LVSA 4YMOA 4M0AA 4RQ8A 3ISDA 4DOBA 5J2IA 4I2JA 1TV9A 3OGUA 2PFOA 3ISCA 4KLQA 1ZQKA 4IQWA 1ZQIA 4KLUA 3JPTA 4RPXA 3AU2A 4UAWA 7ICMA 5DBBA 3C5FA 4NM2A 1ZQRA 1BPZA 4PPXA 4UBBA 5IIJA 4R63A 5J2AA 3V7JA 3ISBA 1ZQFA 9ICXA 5BPCA 4MFAA 4QZCA 2PXIA 3JPQA 9ICWA 3RJHA 4K4HA 3JPSA 2P66A 4F5PA 2FMSA 4KLFA 5J2JA 4RQ0A 4PHDA 4M9GA 9ICCA 8ICPA 4M2YA 5DB9A 4UB5A 1ZQPA 4UB1A 5DBAA 4KLIA 4QZFA 1DK2A 4PHPA 4NLNA 5DDYA 3AU6A 4M9HA 4LZGA 4RT2A 9ICBA 9ICEA 4F5QA 4XUSA 5CWRA 4KLJA 3MDAA 9ICUA 7ICRA 4XA5A 4NLKA 1ZQGA 5BOMA 4NY8A 1BPYA 3AUOA 7ICHA 4K4GA 4IQTA 4YD1A 5J2CA 4F5OA 5J0PA 8ICNA 7ICPA 1ZQMA 4QZBA 4QZ9A 4GXKA 3GDXA 9ICTA 8ICFA 3RJIA 1BPEA 3PMNA 3HWTA 5J0XA 8ICIA 8ICGA 4RQ6A 3RJGA 4O5KA 3C2KA 3JPRA 3RJJA 4R66A 9ICIA 8ICVA 5BOLA 3RJFA 3B0XA 2PFQA 5J2EA 5J2FA 4QZEA 4I27A 3RH5A 3UXNA 1MQ3A 8ICLA 4I2IA 5HHHA 1HUZA 4PHAA 8ICCA 5DB6A 4UB2A 3C5GA 8ICWA 5IINA 4I28A 7ICKA 9ICAA 4Z6FA 1XSLA 2I9GA 3JPOA 4KLEA 9ICFA 5IIOA 4RQ2A 8ICEA 8ICAA 4PGXA 1HUOA 4YCXA 4MF2A 5HHIA 8ICJA 3RJKA 3UPQA 5DB8A 2BPGA 5J0TA 4DO9A 1ZQJA 9ICGA 5IILA 2KP7A 1ZQLA 4QZHA 4KLOA 4I2CA 8ICOA 1ZQCA 4P2HA 1ZQSA 4RT3A 4TUSA 7ICIA 3MDCA 9ICSA 2BCSA 2BPFA 5CB1A 4M9JA 8ICRA 5J29A 4RQ4A 4KLMA 3V7LA 4RPZA 4QZDA 4JWMA 3C2LA 7ICJA 2ISOA 4MF8A 3V72A 1NZPA 3PMLA 5TZVA 7ICSA 4R64A 1BNOA 3TFSA 4UAYA 1ZQQA 3MBYA 4M04A 4YMMA 9ICPA 1ZQAA 4RQ3A 4I2EA 5D46A 4QZGA 4PGQA 9ICRA 9ICQA 5J2KA 5J0SA 3UQ0A 4M47A 2IHMA 4M9LA 3UQ2A 4MFFA 4F5NA 4RPYA 4PHEA 5J2HA 8ICQA 3UXOA 5J0UA 4O5CA 9ICLA 1BNPA 8ICUA 4RQ1A 4TUPA 5DB7A 1JMSA 4IQVA 7ICVA 4O5EA 4QZ8A 4PH5A 2W9MA 2FMQA 5EOZA 2BCQA 4M9NA 8ICSA 3V7KA 4JWNA 7ICOA 4DOAA 8ICMA 4UBCA 5J0OA 4UAZA 4I2HA 2PFPA 3LK9A 8ICHA 9ICVA 4F5RA 4KLGA 3RH4A 5J0YA 4GXJA 8ICYA 4NM1A 5DKWA 2PFNA 4RQ5A 1ZQHA 4KLDA 8ICZA 1BPXA 4KLHA 4Z6CA 5J2GA 4Z6EA 3MGHA 4X5VA 3JPPA
chains in the Genus database with same CATH superfamily
1C7YA 2YB1A 4ED7A 8ICXA 1UPHA 3KHLA 2BR0A 3HW8A 5KFCA 1AQ6A 2HSZA 2Q4TA 1NJYA 5DLFA 1L7MA 5KG1A 7ICLA 2DUYA 3ETRA 3M8RA 4R8UA 1TK8A 8ICBA 1Y88A 4PGYA 4TUQA 2DKXA 1WUDA 2BGWA 1X9XA 9ICNA 5KFSA 4Z6DA 5ALPA 8ICTA 4M6WB 4DSJA 2MUTA 5KFDA 5HR6A 3V6HA 3PV8A 5CR0A 5AI8A 3BQ7A 4YN4A 1IIPA 4BXOA 3M6ZA 2G0AA 5L1MA 4AP9A 4IL6U 2GOLA 2JZBB 1QH9A 4DQQA 2DFLA 4J9MA 2BCVA 3C2MA 4ELVA 5KFPA 3HX0A 4I2FA 4KLLA 2JMGA 4RU9A 1ZJNA 1QSLA 2ES6A 4DEZA 1FIQA 4U6PA 2KEYA 5DBCA 3EW9A 4I2GA 3IG5A 3KTQA 4UB3A 1D8BA 5D4BA 4OJOA 5AKLA 2IA6A 1BPDA 2RDJA 5AM1A 5ALGA 4YMNA 1RG6A 1L5UA 4DS5A 1S0OA 4O3RA 2YMMA 4YMOA 4RQ8A 5C0YA 2IOFK 5J2IA 4I2JA 3OGUA 2A19A 3ISCA 4DLEA 4DSKA 1ZQKA 2VA2A 2ZJ8A 4RUAA 1JUDA 2GO7A 4RPXA 4EBDA 3EYZA 4CGZA 4UAWA 2BQ3A 1UCVA 2HW3A 7ICMA 5AM3A 2G08A 2HOFA 5KT3A 2K89A 3NASA 4JV2A 2L5YA 2C2RA 5KAFU 3H40A 4NM2A 3M1YA 1ZQRA 3BQ0A 1BPZA 2B0CA 3F2BA 1NZBA 1OUQA 2O6KA 3RF9A 2HOIA 3IDWA 3RRHA 3V7JA 5B66U 5KFFA 2RLTA 1JI7A 4O3NA 2AGOA 1EXNA 3PX6A 2H5XA 5BPCA 3TKAA 1NJXA 2WAQC 2KFZA 5L1IA 3RJHA 4K4HA 2FDRA 2P66A 1ZQXA 2F1IA 4DS4A 2R8KA 2G5HB 9ICCA 5ALDA 2R8IA 5HP4A 3L5KA 4UB5A 1MSWD 1ZQPA 1JROA 4B9VA 2EDUA 4QW8A 3GILA 3G6XA 4EZ6A 3TI0A 4QZFA 3ED5A 4FZLA 4PHPA 5DDYA 3AU6A 1CRXA 5KT4A 9ICBA 4KLJA 3MDAA 9ICUA 1TAQA 4EELA 1B0XA 2OM6A 4UAUA 2GLEA 3BS5B 3G6YA 1SWVA 4MEYA 4NY8A 3PSFA 3AUOA 2NYVA 5CA7A 4K4GA 4P4MA 4JV1A 1IXRA 2BDUA 2W7OA 4F5OA 3QEAZ 2W9BB 3SD7A 4IRDA 3SEIA 8ICNA 1JN3A 4CDGA 1KKXA 3AQFA 4Y2UA 4J9OA 4GXKA 2ZTCA 4PL1A 1L3UA 3HKZF 2KHQA 3QXGA 3J81j 1A76A 9ICTA 1BGXT 4CF3A 1PUZA 2JEJA 3Q8KA 1L7PA 3PMNA 2W43A 5EE0A 3EPGA 4O5KA 3PSTA 5KTQA 5KFTA 3ZDEA 2MAXA 1JX4A 3SAHA 5KFHA 3B0XA 2PFQA 5J2EA 4OCZA 4US9A 2QKQA 2DL0A 2RP5A 5KG4A 8ICLA 2H3IA 3FAHA 4PHAA 8ICCA 1L3TA 2HVIA 4F4WA 7ICKA 1XSLA 1DRGA 5AI4A 2W55A 2N1RA 5CHGA 2J6SA 8ICAA 4PGXA 1HUOA 1JALA 3MFHA 1J2NA 2W03A 3RJKA 4CNQA 5DB8A 5J0TA 4DO9A 1XO1A 3I76A 1V85A 9ICGA 1NKEA 3NRZA 2AGQA 2UVVA 4F2RA 2OHFA 4MHVA 1NKCA 4KLOA 2KKPA 1XO0A 3TADA 3PZPA 8ICOA 5C5JA 1UA0A 4C4SA 4O3PA 5AM2A 2KSOB 2KIVA 5ALUA 4US8A 2ZIVB 4RT3A 4TUSA 4YQWA 3MDCA 4TQRA 2BCSA 2BPFA 5J29A 1D8LA 4RQ4A 3LDAA 5KT7A 4KLMA 2EQYA 3SV4A 4QZDA 2JH1A 4G3IA 2XGPA 1NZPA 1RPLA 4IR9A 2ZIUA 4R64A 1NJWA 4UAYA 1QQ6A 4YMMA 1RYRA 4IRCA 2IMWP 1GO3F 3ZI4A 1Z00A 4RQ3A 2F8KA 1L7NA 3QU9A 1KBUA 2G5IB 1FFVA 4GC6A 5EE9A 4PGQA 3KOOA 4O3OA 5J8YC 1CUKA 2PMZF 5KNIA 4IS7A 4R8UB 2C2DA 4O3SA 1RDFA 1LVHA 1RXWA 4J03A 1BPBA 1FO4A 3MFIA 1T94A 2ZUBA 2HHVA 5DG8A 5K4LA 4OO1J 1RXVA 2BPCA 1NI3A 3RFAA 4Q45A 3H7IA 5J0UA 4KMOB 4KN7A 4C4TA 4TUPA 2VJ4A 5ALJA 2JGAA 2CPRA 5KAIU 1SIJA 3PW2A 5EOZA 5KFMA 4C7ZA 2QARA 4I2HA 4ECVA 3IP4B 1S8OA 5J0YA 3D2QA 3KHHA 2PFNA 1PK3A 1PK1B 4B9TA 3UM9A 3K1ZA 3C28A 3MABA 3M7DA 4Z6EA 3MGHA 5AI9A 2YTUA 3QNMA 5KL8B 5KFEA 2EAMA 3B0YA 3MR3A 1D9DA 2JEGA 2J6TA 4Y2XA 4BJQA 5D49A 1B4FA 7ICQA 3Q8SB 3T79A 5J8YA 2VA8A 4FO6A 4O9MA 5AKEA 4K4IA 4NLZA 4P0QA 2ISPA 1T8EA 1S0MA 2JEIA 2R8JA 4Q8EA 4DF4A 1U9LA 5J0QA 3SR6A 5KG5A 2ZG6A 5AKHA 2IHNA 3PX4A 5DGAA 3IV6A 4JK1A 2ALZA 2H3FA 2EZXA 9ICOA 3KZIU 3RB3A 2FMPA 1ECWA 4J9LA 5KFIA 4Y2SA 2K4HA 2P6RA 2ESEA 1MC8A 4MFCA 4RQ7A 1K1QA 1ZQEA 4RNNA 1V97A 2A3VA 1SKRA 1NK7A 1RYSA 5IIMA 4B6JA 5HR7A 2MUTB 1RZTA 5KG3A 1IG6A 4QWCA 2YMQA 2F8LA 4NL9A 3D2NA 1ZD4A 3CW2C 3BQ1A 4DQPA 7ICNA 1KDHA 1DK3A 1TE2A 2HBJA 4J9KA 3WK5A 1B22A 2ZIWB 2ODGA 2K4PA 1KEJA 5AHXA 5F9NA 4ED8A 4QW9A 2KV2A 2HHQA 2H3QA 4ED1A 7ICFA 1UHUA 4I2BA 2QB0B 1PVQA 3OTQA 1WYGA 4QWAA 1COKA 1TV9A 2RRDA 2PFOA 3AMZA 3H8WA 2V9WA 4KLQA 1ZQIA 4DSLA 2A1JA 4KLUA 4FS2A 5AM5A 3H4BA 3JPTA 5AI6A 3AU2A 1NOMA 2NRTA 3QU2A 3GV7B 2AH5A 1KL9A 1V38A 4P4OA 4CRXA 5DBBA 3RAXA 2WAQF 1U45A 4PPXA 2VA3A 1YT3A 1U48A 4BWJA 3G6VA 4R63A 4BXOB 4DL7A 2BKEA 5J2AA 2NRXA 2JHDA 3RAQA 1UQVA 2W3RA 1ZQFA 2QARB 2PXIA 2JXJA 4JB3A 4DF8A 4F92B 5FP0A 4ECUA 2W8KA 9ICWA 4DL2A 4ELTA 3JPSA 1SV0A 4KLFA 3EPIA 4M9GA 3WKAA 4M2YA 5DB9A 1NJZA 3PW0A 1S76D 1P7DA 1MN8A 1X6IA 3R9KA 2ASJA 4UB1A 4PJ0U 2XY6A 3BQ2A 1DK2A 1HEKA 4NLNA 1ZD3A 4M9HA 2NRZA 4LZGA 2ZIXB 1ZETA 1KFDA 4C7YA 3PO5A 9ICEA 4XUSA 2GH1A 5CWRA 3HT3A 2ZIVA 4UATA 1WG8A 2LKYA 5HMMA 3Q8RB 1ZQGA 2ZTEA 2XC9A 3OJSA 3THVA 3T5HA 2WTFA 4CF4A 5BOMA 1BPYA 1ZD2P 2XVTA 3ICXA 4YD1A 2A1AA 2LI6A 2K8CB 4ED3A 4QIWF 4UAVA 3RB6A 1SZPA 1KRPA 2KJ5A 2I5HA 2ASLA 4P4PA 2FLLA 7ICPA 5KFQA 4C80A 4OJLA 4QZ9A 2OXOA 3GDXA 1O08A 4B9MA 3RJIA 3BZKA 4F50A 3C2KA 4DFPA 3Q8MA 4DLGA 1O03A 3JPRA 2FPKA 4R66A 8ICVA 2W9BA 1SV0C 3ETLA 3A0HU 5B5EU 5JTIA 5KFYA 5J2FA 4YG2A 2W8LA 4ZOHC 3RH5A 1TFRA 4J9NA 2W04A 1HUZA 5AK5A 4DFKA 3OSPA 3K4GA 3Q8QB 2E5SA 4PL2A 4Z6FA 4KLEA 4C8OA 4DQRA 9ICFA 4EEYA 2LMRA 5KFUA 5KFJA 5IIOA 3BQTA 5HHIA 1A6SA 3UPQA 1TAMA 2QLTA 1DOQA 2W7PA 2KNJA 1N63A 1RQLA 5KG2A 2KP7A 3LWMA 4DFMA 2YB4A 4F4XA 5AICA 4EBEA 3M9MB 1IV8A 5KFNA 1SKSA 1F0MA 1ZQSA 4O3QA 7ICIA 3V6KA 3H8SA 1QQ7A 5CB1A 4M9JA 2K4EA 2NV3A 5AI5A 3PR4A 3T5KA 1WCLA 4JWMA 4Q44A 1JIHA 3FDSA 4MF8A 4NV0A 3PMLA 1X2IA 5TZVA 3RB4A 1BNOA 4RNOA 4Y2VA 2HHUA 2BZFA 1K5OA 1ZQQA 9ICPA 3C1ZA 3BDPA 1OW5A 4P0PB 5AKJA 4P0QB 2EZZA 1CI4A 2F44A 2KVCA 5CP2A 2LM4A 5TISU 4FS1A 2G09A 4C8NA 5KG6A 2FI1A 4DSFA 3ZDAA 2WF7A 1ZQUA 3FYHA 4KTQA 3NGDA 1DGSA 4FE3A 2ZTDA 2IBKA 9ICQA 4DQIA 1NNLA 3D6JA 3UQ0A 1ZRNA 1LB2B 4BDPA 1TAUA 3TQ1A 3UQ2A 4MFFA 5AKKA 2AU0A 2CXYA 1SL2A 4UQGA 4UASA 9ICLA 2P6UA 4ACOA 3E0FA 2NRWA 5DB7A 3KKAA 4IQVA 1UT8A 2KTQA 1QQ5A 5DQIA 2DBYA 2KVSA 2AXTU 5AKIA 5KT5A 2FMQA 2BCQA 4M9NA 4KN4A 4ECTA 3SV3A 7ICOA 5KFAA 4UBCA 3GIJA 2PFPA 1X66A 3NVZA 3LK9A 3D2SA 8ICHA 1COOA 1SXDA 2YN4A 3VC8A 4F5RA 4GXJA 3QZ7A 8ICYA 5KFLA 2XY7A 4NM1A 1ZQHA 3MR5A 1TK5A 2W9AA 8ICZA 2ASDA 5G5GA 2KD1A 5AK6A 4KLHA 4WJ3B 3T3FA 4F4YA 1Z1BA 3RTVA 2ZIWA 4X5VA 2BPGA 1KLNA 3WK7A 3CNHA 5L1KA 2KJ9A 7ICUA 1A77A 2WB1F 1ZQDA 2DF4B 5ALZA 5T14A 5L1JA 2HBMA 1L6NA 3F5AA 1Q46A 3NS1A 7ICGA 4YD2A 2OWOA 1SL1A 5DQGA 4EYIB 5ALWA 1X42A 4KLSA 4YP3A 2XCPA 4PZNA 2C28A 4ECRA 1S0VA 2HDOA 2KMDA 3SENA 2DWQA 5ALHA 3K75D 4E0DA 7ICEA 4F4ZA 4YFKA 3N7RC 2AJQA 2DQNB 4UB4A 4O3MA 1ZJMA 2E8NA 3PNCA 5KFZA 4LZDA 3RRGA 5ALXA 5J2DA 1KTQA 2G07A 2KG5A 2KK0A 4NLCA 5HNKA 2JV3A 2KZ3A 5G5HA 5GTIU 4YXJA 4DSEA 1S9FA 4FZMA 1ZQTA 1QLNA 1T4GA 3FC4A 1XNSA 4B9UA 2KIWA 4IQUA 1RYUA 1MQ2A 2BCUA 2VKQA 2K8AA 4I2AA 4OD0A 3JPNA 2XICA 2PI4A 3GQCA 2FJ6A 3RH6A 4F2SA 2E1FA 4B9LA 3S6JA 2OEHA 1KN5A 3UXPA 1XSNA 1ZOLA 5J2BA 2B6GA 3AM9A 3QU7A 3TACB 4R65A 1ZQNA 1URJA 2PKEA 2FLPA 1F44A 1ZQOA 4LVSA 4M0AA 4Q43A 4DOBA 4USAA 2WF5A 1XU4A 4QWDA 3QEBZ 3SI8A 2ZJAA 4Y2PA 2XIDA 1ZQZA 5KFWA 1MA7A 5KT2A 1S10A 2K4IA 4HAIA 4NWIA 2D8CA 4AYBC 4F91B 4UW9A 1N5WA 3TANA 4UBBA 5IIJA 2P35A 3PVXA 2HHSA 2ZIXA 4CCHA 3ISBA 2K60A 1SL0A 3PR5B 1D9FA 9ICXA 2NRVA 2Y1JA 4QZCA 3LVVA 3RBDA 4OJ6A 2I1QA 4NJ8A 3N7SC 5EWGA 4GC7A 3N97B 2M0NA 4PHDA 5KG7A 5ALNA 1NK0A 3I1YA 3SQIA 1NK9A 3PW4A 3F2DA 4KLIA 1QSSA 2VANA 2LM1A 3KZXA 3DEEA 4DFJA 4U7CA 4DL5A 4RT2A 5H2FU 5EWFA 4NLBA 4RQNA 3HKZC 5KFKA 7ICRA 2W9CA 3KKAC 2UVUA 2FE9A 5AKYA 2LPEA 1J2MA 5ALFA 1U47A 3I28A 1BVSA 4BWMA 4DL6A 3QX7A 5AKZA 7ICHA 2EAOA 4CE6A 1YZ7A 5ALEA 5J2CA 2HMXA 1S5LU 3HJEA 5AKGA 5J0PA 2WFAA 2LBOA 5KFXA 1NK5A 3QU4A 2FPMA 4Y2TA 2DKZA 3PO4A 4JV0A 4YR0A 8ICFA 3IN5A 2KOBA 4YR3A 2E1EA 3IRUA 3F2CA 2JZBA 5J0XA 2A1JB 1ED1A 2W3SA 3ONNA 4RQMA 8ICGA 4RQ6A 3RJGA 2I6XA 3BS7A 2KN7A 2G06A 5AM4A 1WCNA 1N61A 1N48A 1CEZA 9ICIA 1L8OA 5BOLA 4ECSA 1V9PA 2OCEA 1Z4NA 4NL9C 1FEZA 3IG8A 4QZEA 3WU2U 3UXNA 1MQ3A 4I2IA 3SYZA 4XQ8A 5DB6A 5DDMA 4OJPA 3A0BU 4UB2A 3C5GA 2FLNA 8ICWA 3BZCA 5IINA 4I28A 9ICAA 1X40A 3JPOA 2KKVA 2K8BB 3L4PA 2XI9A 4RQ2A 2IOHA 3C1YA 5L1LA 4MF2A 2H3ZA 5ALTA 2KICA 3NVVA 2IOFA 1ZQJA 3HRDD 5IILA 4QZHA 4EX6A 1ZQCA 5JUMA 4P2HA 1XWLA 5ALRA 3RB0A 1Z3EB 4J9QA 2C2EA 5ALKA 5AIBA 8ICRA 1A0PA 2PMZC 1U4BA 2M9NA 3V7LA 3C2LA 2ISOA 1XS9D 3V72A 4EZ9A 5KT6A 2Q0ZX 4KMUA 3TFSA 3SZ2A 2R8GA 2XGQA 2ZXIA 4IR1A 2NO4A 3NTUA 3ZDBA 1ZRMA 3HP6A 2YY6A 3OJUA 2Y0SF 5CEHA 1JXEA 5D46A 3GU3A 3KHRA 3K1RB 2HHTA 2V4QA 3QZ8A 2LYAA 3H8MA 2W54A 2F3NA 1UA1A 2QB0A 1Q3UA 4FBUA 4ED0A 3N28A 4C0ZA 2W9CB 2HBKA 4M47A 2IHMA 4F93B 4M9LA 1T7PA 3PSIA 4RPYA 5J2HA 8ICQA 2WB1C 1LKYA 2MA1A 3UXOA 4KX5A 1BNPA 4ECWA 4RQ1A 3WK4A 5ALLA 3MR6A 7ICVA 3E58A 4QZ8A 5JRTA 4PH5A 2W9MA 2EANA 4C4RA 4FFDA 8ICSA 1SGGA 2KE7A 1L7OA 3HPOA 3F5EA 5KFOA 3GIKA 3AL0B 3EZ5A 9ICVA 3CP8A 5AK3A 3UMBA 3OPXA 1ZQYA 5ALQA 5KL1B 3KFUF 5F9LA 2NO5A 2BQUA 3WKDA 5DKWA 4RQ5A 5F3XB 3NVWA 5AK4A 3QUQA 2D3DA 1BPXA 4Z6CA 2KZZA 5J2GA 1VDVA 2OH2A 3M8SA 1RM6C 3H4DA 5DG9A 4KLTA 3UMCA 5J0RA 4TURA 4ECXA 3DDHA 5IIIA 2Y9TA 3MGVA 1ZYQA 4DL4A 1TVAA 4GXIA 1ZQWA 4Q8FA 2ZUCA 3T5LA 2RHFA 2CN1A 1ZQVA 1PVRA 3LVWA 4UB6U 3PSPA 2GWSA 2DGZA 2B21A 1XSPA 9ICHA 2R8HA 3LWLA 1X9MA 3EUB2 5E79U 1X6JA 4YVZA 4EEKA 4GLXA 3TADC 4NXZA 5J0WA 4QZAA 2BHNA 2WF9A 4I29A 4DOCA 5DQHA 9ICMA 8ICKA 4NLGA 1Z19A 3L3FX 3B9JA 2BCRA 3KBBA 3MGIA 7ICTA 1L3VA 4G9BA 1Q8KA 4A8EA 3TFRA 3HILA 3DV9A 1HIWA 3M6KA 1OXJA 1TK0A 3E2EA 1FFUA 3NRWA 3SMVA 3RBEA 3BJYA 4F4KA 2UVRA 4ED6A 3SAFA 2HVHA 1IM4A 3GIMA 4AYBF 4QJFB 9ICJA 1Z00B 2MU2A 1DGJA 1NK8A 3Q8LA 3GV8B 1J97A 5AM0A 4I2DA 5IIKA 2F77X 3F53A 1SWWA 3WK8A 3VCBA 3PX0A 1S97A 1ZQBA 1KFTA 3MR2A 9ICKA 2RQ5A 2W11A 3T5JA 2AGPA 4QZIA 1KSPA 3RJEA 1ZXIA 5ALYA 5AKXA 2MRLA 2Y9UA 3ISDA 4C8LA 1AROP 1UT5A 1WWVA 3AEVA 1NK6A 1L8LA 4BGDA 3RR8A 4IQWA 4DQSA 3PY8A 4JMUA 1M6YA 1ZQ1C 2MSNA 2YX8A 3Q8PB 4UB8U 3C5FA 1KW4A 3PW5A 2FPLA 4ED2A 3TAQA 5KG0A 1S0NA 2AHOB 5EWEA 1Z4OA 2AQ4A 4IC9A 5ALMA 4BX9C 1SB3C 3M9OB 2Z7JA 4GFJA 4F8RA 2V4RA 4MFAA 1PZNA 2E8OA 1KFSA 4FZNA 2LYHA 4DCCA 3JPQA 3TARA 4P0PA 3MC1A 4F5PA 4M6WA 2FMSA 2H3VA 3GFKB 5J2JA 4RQ0A 2EAPA 1T3QA 1F5SA 8ICPA 5A0LA 2RDIA 1PK1A 1SKWA 4B9SA 2WHEA 4QNLA 5DBAA 2E8PA 1TKDA 5CRXA 3M9NB 2XY5A 4F3OA 1S77D 1YZ6A 5L9XA 1Q3VA 3TAPA 4KITB 1SXEA 2KZMA 3LYSA 3CYMA 2F76X 3C21A 4KX3A 4MEXA 4F5QA 2YMLA 4EBCA 4XA5A 4NLKA 4ELUA 3H8JA 1RQNA 4QWBA 2ATLA 3H0RB 4RUCA 4QIWC 2HBLA 2R18A 2XCAA 2VIXA 4IQTA 4UARA 4PZOA 3C23A 3OHAA 2EH9A 3IM1A 4F72A 3KHGA 1HJPA 5ALSA 2KSOA 5EE1A 1QSYA 1WWUA 4XRHA 3V6JA 1KQQA 1ZQMA 4QZBA 2BQRA 1N62A 1H38A 4ECZA 3QYPA 4RZRA 2ZXHA 2JR5A 2Y0SC 1BPEA 3RR7A 5EE3A 1XC9A 3HWTA 2JRZA 8ICIA 3FM9A 2EZYA 3QUBA 5AI0A 1JXLA 4ECQA 4EYHB 4C8MA 3RJJA 3C29A 5DLGA 3QE9Y 4LJXA 3RJFA 3NVYA 5GTHU 4O0IA 2UVWA 4GIBA 4I27A 3QUTA 4Y2RA 1N5XA 2LYBA 1D8YA 5HHHA 2F1JA 2JH7A 4Y2QA 1PVPA 4DSIA 4F71A 2OYYA 3ZDCA 3GZFA 2I9GA 5AIAA 2KFNA 4YXMA 5HMLA 8ICEA 3OHBA 4YCXA 8ICJA 3WKBA 3BS5A 3GIIA 1LKYB 2LHTA 1SZHA 3GV5B 2ZUDA 3N7PD 4Y2JA 2ZJ5A 1ZQLA 5JU5A 4DWIA 2WF6A 2BDPA 4I2CA 4YR2A 5KFBA 5KFGA 3QU5A 2DPJA 1N60A 3QUCA 1NK4A 2F1HA 1JRPA 1B43A 4ZH4A 2KHVA 3EWAA 4DFDA 2KJ8A 9ICSA 1U49A 4BUGA 4J9PA 1SV4A 4RPZA 3AQEA 7ICJA 4QWEA 1DXSA 2PI5A 7ICSA 3ORYA 2DPIA 3N4MB 3WKCA 3MBYA 4RNMA 4EX7A 4M04A 1VLBA 4HYKA 1QCKA 5KFRA 1ZQAA 3CRXA 1NKBA 5DGBA 4I2EA 3O0FA 3IHQB 5CJ7A 5ALVA 4QZGA 1T3NA 1QTMA 2CRXA 2YMPA 9ICRA 1X9WA 4Y2YA 5J2KA 3ZDDA 1N2XA 5J0SA 2ZIUB 3ZD9A 3OSNA 3WK6A 2J6UA 2Y1IA 1Z1VA 2HI0A 5KFVA 5DG7A 4JUZA 1LV5A 3ZD8A 4F5NA 4ECYA 2AQ0A 2HOQA 1K1SA 3AN1A 4PHEA 2WF8A 4O5CA 2HHWA 8ICUA 1JMSA 2D6FC 2HHXA 4ICAA 4J9SA 4O5EA 2VJ5A 4C8KA 2E3TA 3ALRA 4OJ5A 4J9RA 1N56A 4FBTA 2QB1A 4IRKA 2YQEA 3V7KA 3SAGA 2F2AB 4JWNA 2E8MA 1ZD5A 4DOAA 3U26A 4DL3A 3WKEA 8ICMA 1L3SA 5J0OA 4UAZA 3KD3A 3NUQA 3UMGA 2XO7A 4EENA 4KLGA 2HCFA 3RH4A 5ALIA 3H0MB 3PW7A 4KLDA 3WK9A 4TQSA 1C20A 5ALOA 3H0LB 2JEFA 4B9NA 4CF5A 1X9SA 2C22A 3JPPA 1VJ5A
chains in the Genus database with same CATH topology
5J0RA 4TURA 3B0YA 8ICXA 7ICUA 5IIIA 1ZQDA 3HW8A 5D49A 1TVAA 4GXIA 7ICGA 4YD2A 7ICQA 4O9MA 4FO6A 4KLSA 7ICLA 4K4IA 2GWSA 8ICBA 1XSPA 4NLZA 9ICHA 4PGYA 4TUQA 2ISPA 9ICNA 7ICEA 4Z6DA 8ICTA 4NXZA 5J0QA 4UB4A 5J0WA 4QZAA 1ZJMA 4I29A 4DOCA 3PNCA 9ICMA 4YN4A 4LZDA 8ICKA 2BCRA 5J2DA 3MGIA 9ICOA 7ICTA 2FMPA 3TFRA 1ZQTA 4MFCA 2BCVA 3C2MA 4RQ7A 1ZQEA 4IQUA 3HX0A 1MQ2A 2BCUA 4I2FA 4KLLA 4I2AA 5IIMA 1RZTA 3JPNA 9ICJA 1ZJNA 3RH6A 4I2DA 5IIKA 4KLTA 7ICNA 5DBCA 4I2GA 1KDHA 4UB3A 1DK3A 5D4BA 1ZQBA 9ICKA 3UXPA 1XSNA 5J2BA 1KEJA 1BPDA 4QZIA 3RJEA 4YMNA 4R65A 1ZQNA 7ICFA 1ZQOA 4I2BA 4LVSA 4YMOA 4M0AA 4RQ8A 3ISDA 4DOBA 5J2IA 4I2JA 1TV9A 3OGUA 2PFOA 3ISCA 4KLQA 1ZQKA 4IQWA 1ZQIA 4KLUA 3JPTA 4RPXA 3AU2A 4UAWA 7ICMA 5DBBA 3C5FA 4NM2A 1ZQRA 1BPZA 4PPXA 4UBBA 5IIJA 4R63A 5J2AA 3V7JA 3ISBA 1ZQFA 9ICXA 5BPCA 4MFAA 4QZCA 2PXIA 3JPQA 9ICWA 3RJHA 4K4HA 3JPSA 2P66A 4F5PA 2FMSA 4KLFA 5J2JA 4RQ0A 4PHDA 4M9GA 9ICCA 8ICPA 4M2YA 5DB9A 4UB5A 1ZQPA 4UB1A 5DBAA 4KLIA 4QZFA 1DK2A 4PHPA 4NLNA 5DDYA 3AU6A 4M9HA 4LZGA 4RT2A 9ICBA 9ICEA 4F5QA 4XUSA 5CWRA 4KLJA 3MDAA 9ICUA 7ICRA 4XA5A 4NLKA 1ZQGA 5BOMA 4NY8A 1BPYA 3AUOA 7ICHA 4K4GA 4IQTA 4YD1A 5J2CA 4F5OA 5J0PA 8ICNA 7ICPA 1ZQMA 4QZBA 4QZ9A 4GXKA 3GDXA 9ICTA 8ICFA 3RJIA 1BPEA 3PMNA 3HWTA 5J0XA 8ICIA 8ICGA 4RQ6A 3RJGA 4O5KA 3C2KA 3JPRA 3RJJA 4R66A 9ICIA 8ICVA 5BOLA 3RJFA 3B0XA 2PFQA 5J2EA 5J2FA 4QZEA 4I27A 3RH5A 3UXNA 1MQ3A 8ICLA 4I2IA 5HHHA 1HUZA 4PHAA 8ICCA 5DB6A 4UB2A 3C5GA 8ICWA 5IINA 4I28A 7ICKA 9ICAA 4Z6FA 1XSLA 2I9GA 3JPOA 4KLEA 9ICFA 5IIOA 4RQ2A 8ICEA 8ICAA 4PGXA 1HUOA 4YCXA 4MF2A 5HHIA 8ICJA 3RJKA 3UPQA 5DB8A 2BPGA 5J0TA 4DO9A 1ZQJA 9ICGA 5IILA 2KP7A 1ZQLA 4QZHA 4KLOA 4I2CA 8ICOA 1ZQCA 4P2HA 1ZQSA 4RT3A 4TUSA 7ICIA 3MDCA 9ICSA 2BCSA 2BPFA 5CB1A 4M9JA 8ICRA 5J29A 4RQ4A 4KLMA 3V7LA 4RPZA 4QZDA 4JWMA 3C2LA 7ICJA 2ISOA 4MF8A 3V72A 1NZPA 3PMLA 5TZVA 7ICSA 4R64A 1BNOA 3TFSA 4UAYA 1ZQQA 3MBYA 4M04A 4YMMA 9ICPA 1ZQAA 4RQ3A 4I2EA 5D46A 4QZGA 4PGQA 9ICRA 9ICQA 5J2KA 5J0SA 3UQ0A 4M47A 2IHMA 4M9LA 3UQ2A 4MFFA 4F5NA 4RPYA 4PHEA 5J2HA 8ICQA 3UXOA 5J0UA 4O5CA 9ICLA 1BNPA 8ICUA 4RQ1A 4TUPA 5DB7A 1JMSA 4IQVA 7ICVA 4O5EA 4QZ8A 4PH5A 2W9MA 2FMQA 5EOZA 2BCQA 4M9NA 8ICSA 3V7KA 4JWNA 7ICOA 4DOAA 8ICMA 4UBCA 5J0OA 4UAZA 4I2HA 2PFPA 3LK9A 8ICHA 9ICVA 4F5RA 4KLGA 3RH4A 5J0YA 4GXJA 8ICYA 4NM1A 5DKWA 2PFNA 4RQ5A 1ZQHA 4KLDA 8ICZA 1BPXA 4KLHA 4Z6CA 5J2GA 4Z6EA 3MGHA 4X5VA 3JPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J0R A;  4TUR A;  3B0Y A;  8ICX A;  7ICU A;  5III A;  1ZQD A;  3HW8 A;  5D49 A;  1TVA A;  4GXI A;  7ICG A;  4YD2 A;  7ICQ A;  4O9M A;  4FO6 A;  4KLS A;  7ICL A;  4K4I A;  2GWS A;  8ICB A;  1XSP A;  4NLZ A;  9ICH A;  4PGY A;  4TUQ A;  2ISP A;  9ICN A;  7ICE A;  4Z6D A;  8ICT A;  4NXZ A;  5J0Q A;  4UB4 A;  5J0W A;  4QZA A;  1ZJM A;  4I29 A;  4DOC A;  3PNC A;  9ICM A;  4YN4 A;  4LZD A;  8ICK A;  2BCR A;  5J2D A;  3MGI A;  9ICO A;  7ICT A;  2FMP A;  3TFR A;  1ZQT A;  4MFC A;  2BCV A;  3C2M A;  4RQ7 A;  1ZQE A;  4IQU A;  3HX0 A;  1MQ2 A;  2BCU A;  4I2F A;  4KLL A;  4I2A A;  5IIM A;  1RZT A;  3JPN A;  9ICJ A;  1ZJN A;  3RH6 A;  4I2D A;  5IIK A;  4KLT A;  7ICN A;  5DBC A;  4I2G A;  1KDH A;  4UB3 A;  1DK3 A;  5D4B A;  1ZQB A;  9ICK A;  3UXP A;  1XSN A;  5J2B A;  1KEJ A;  1BPD A;  4QZI A;  3RJE A;  4YMN A;  4R65 A;  1ZQN A;  7ICF A;  1ZQO A;  4I2B A;  4LVS A;  4YMO A;  4M0A A;  4RQ8 A;  3ISD A;  4DOB A;  5J2I A;  4I2J A;  1TV9 A;  3OGU A;  2PFO A;  3ISC A;  4KLQ A;  1ZQK A;  4IQW A;  1ZQI A;  4KLU A;  3JPT A;  4RPX A;  3AU2 A;  4UAW A;  7ICM A;  5DBB A;  3C5F A;  4NM2 A;  1ZQR A;  1BPZ A;  4PPX A;  4UBB A;  5IIJ A;  4R63 A;  5J2A A;  3V7J A;  3ISB A;  1ZQF A;  9ICX A;  5BPC A;  4MFA A;  4QZC A;  2PXI A;  3JPQ A;  9ICW A;  3RJH A;  4K4H A;  3JPS A;  2P66 A;  4F5P A;  2FMS A;  4KLF A;  5J2J A;  4RQ0 A;  4PHD A;  4M9G A;  9ICC A;  8ICP A;  4M2Y A;  5DB9 A;  4UB5 A;  1ZQP A;  4UB1 A;  5DBA A;  4KLI A;  4QZF A;  1DK2 A;  4PHP A;  4NLN A;  5DDY A;  3AU6 A;  4M9H A;  4LZG A;  4RT2 A;  9ICB A;  9ICE A;  4F5Q A;  4XUS A;  5CWR A;  4KLJ A;  3MDA A;  9ICU A;  7ICR A;  4XA5 A;  4NLK A;  1ZQG A;  5BOM A;  4NY8 A;  1BPY A;  3AUO A;  7ICH A;  4K4G A;  4IQT A;  4YD1 A;  5J2C A;  4F5O A;  5J0P A;  8ICN A;  7ICP A;  1ZQM A;  4QZB A;  4QZ9 A;  4GXK A;  3GDX A;  9ICT A;  8ICF A;  3RJI A;  1BPE A;  3PMN A;  3HWT A;  5J0X A;  8ICI A;  8ICG A;  4RQ6 A;  3RJG A;  4O5K A;  3C2K A;  3JPR A;  3RJJ A;  4R66 A;  9ICI A;  8ICV A;  5BOL A;  3RJF A;  3B0X A;  2PFQ A;  5J2E A;  5J2F A;  4QZE A;  4I27 A;  3RH5 A;  3UXN A;  1MQ3 A;  8ICL A;  4I2I A;  5HHH A;  1HUZ A;  4PHA A;  8ICC A;  5DB6 A;  4UB2 A;  3C5G A;  8ICW A;  5IIN A;  4I28 A;  7ICK A;  9ICA A;  4Z6F A;  1XSL A;  2I9G A;  3JPO A;  4KLE A;  9ICF A;  5IIO A;  4RQ2 A;  8ICE A;  8ICA A;  4PGX A;  1HUO A;  4YCX A;  4MF2 A;  5HHI A;  8ICJ A;  3RJK A;  3UPQ A;  5DB8 A;  2BPG A;  5J0T A;  4DO9 A;  1ZQJ A;  9ICG A;  5IIL A;  2KP7 A;  1ZQL A;  4QZH A;  4KLO A;  4I2C A;  8ICO A;  1ZQC A;  4P2H A;  1ZQS A;  4RT3 A;  4TUS A;  7ICI A;  3MDC A;  9ICS A;  2BCS A;  2BPF A;  5CB1 A;  4M9J A;  8ICR A;  5J29 A;  4RQ4 A;  4KLM A;  3V7L A;  4RPZ A;  4QZD A;  4JWM A;  3C2L A;  7ICJ A;  2ISO A;  4MF8 A;  3V72 A;  1NZP A;  3PML A;  5TZV A;  7ICS A;  4R64 A;  1BNO A;  3TFS A;  4UAY A;  1ZQQ A;  3MBY A;  4M04 A;  4YMM A;  9ICP A;  1ZQA A;  4RQ3 A;  4I2E A;  5D46 A;  4QZG A;  4PGQ A;  9ICR A;  9ICQ A;  5J2K A;  5J0S A;  3UQ0 A;  4M47 A;  2IHM A;  4M9L A;  3UQ2 A;  4MFF A;  4F5N A;  4RPY A;  4PHE A;  5J2H A;  8ICQ A;  3UXO A;  5J0U A;  4O5C A;  9ICL A;  1BNP A;  8ICU A;  4RQ1 A;  4TUP A;  5DB7 A;  1JMS A;  4IQV A;  7ICV A;  4O5E A;  4QZ8 A;  4PH5 A;  2W9M A;  2FMQ A;  5EOZ A;  2BCQ A;  4M9N A;  8ICS A;  3V7K A;  4JWN A;  7ICO A;  4DOA A;  8ICM A;  4UBC A;  5J0O A;  4UAZ A;  4I2H A;  2PFP A;  3LK9 A;  8ICH A;  9ICV A;  4F5R A;  4KLG A;  3RH4 A;  5J0Y A;  4GXJ A;  8ICY A;  4NM1 A;  5DKW A;  2PFN A;  4RQ5 A;  1ZQH A;  4KLD A;  8ICZ A;  1BPX A;  4KLH A;  4Z6C A;  5J2G A;  4Z6E A;  3MGH A;  4X5V A;  3JPP A; 
#chains in the Genus database with same CATH topology
 1C7Y A;  2YB1 A;  4ED7 A;  8ICX A;  1UPH A;  3KHL A;  2BR0 A;  3HW8 A;  5KFC A;  1AQ6 A;  2HSZ A;  2Q4T A;  1NJY A;  5DLF A;  1L7M A;  5KG1 A;  7ICL A;  2DUY A;  3ETR A;  3M8R A;  4R8U A;  1TK8 A;  8ICB A;  1Y88 A;  4PGY A;  4TUQ A;  2DKX A;  1WUD A;  2BGW A;  1X9X A;  9ICN A;  5KFS A;  4Z6D A;  5ALP A;  8ICT A;  4M6W B;  4DSJ A;  2MUT A;  5KFD A;  5HR6 A;  3V6H A;  3PV8 A;  5CR0 A;  5AI8 A;  3BQ7 A;  4YN4 A;  1IIP A;  4BXO A;  3M6Z A;  2G0A A;  5L1M A;  4AP9 A;  4IL6 U;  2GOL A;  2JZB B;  1QH9 A;  4DQQ A;  2DFL A;  4J9M A;  2BCV A;  3C2M A;  4ELV A;  5KFP A;  3HX0 A;  4I2F A;  4KLL A;  2JMG A;  4RU9 A;  1ZJN A;  1QSL A;  2ES6 A;  4DEZ A;  1FIQ A;  4U6P A;  2KEY A;  5DBC A;  3EW9 A;  4I2G A;  3IG5 A;  3KTQ A;  4UB3 A;  1D8B A;  5D4B A;  4OJO A;  5AKL A;  2IA6 A;  1BPD A;  2RDJ A;  5AM1 A;  5ALG A;  4YMN A;  1RG6 A;  1L5U A;  4DS5 A;  1S0O A;  4O3R A;  2YMM A;  4YMO A;  4RQ8 A;  5C0Y A;  2IOF K;  5J2I A;  4I2J A;  3OGU A;  2A19 A;  3ISC A;  4DLE A;  4DSK A;  1ZQK A;  2VA2 A;  2ZJ8 A;  4RUA A;  1JUD A;  2GO7 A;  4RPX A;  4EBD A;  3EYZ A;  4CGZ A;  4UAW A;  2BQ3 A;  1UCV A;  2HW3 A;  7ICM A;  5AM3 A;  2G08 A;  2HOF A;  5KT3 A;  2K89 A;  3NAS A;  4JV2 A;  2L5Y A;  2C2R A;  5KAF U;  3H40 A;  4NM2 A;  3M1Y A;  1ZQR A;  3BQ0 A;  1BPZ A;  2B0C A;  3F2B A;  1NZB A;  1OUQ A;  2O6K A;  3RF9 A;  2HOI A;  3IDW A;  3RRH A;  3V7J A;  5B66 U;  5KFF A;  2RLT A;  1JI7 A;  4O3N A;  2AGO A;  1EXN A;  3PX6 A;  2H5X A;  5BPC A;  3TKA A;  1NJX A;  2WAQ C;  2KFZ A;  5L1I A;  3RJH A;  4K4H A;  2FDR A;  2P66 A;  1ZQX A;  2F1I A;  4DS4 A;  2R8K A;  2G5H B;  9ICC A;  5ALD A;  2R8I A;  5HP4 A;  3L5K A;  4UB5 A;  1MSW D;  1ZQP A;  1JRO A;  4B9V A;  2EDU A;  4QW8 A;  3GIL A;  3G6X A;  4EZ6 A;  3TI0 A;  4QZF A;  3ED5 A;  4FZL A;  4PHP A;  5DDY A;  3AU6 A;  1CRX A;  5KT4 A;  9ICB A;  4KLJ A;  3MDA A;  9ICU A;  1TAQ A;  4EEL A;  1B0X A;  2OM6 A;  4UAU A;  2GLE A;  3BS5 B;  3G6Y A;  1SWV A;  4MEY A;  4NY8 A;  3PSF A;  3AUO A;  2NYV A;  5CA7 A;  4K4G A;  4P4M A;  4JV1 A;  1IXR A;  2BDU A;  2W7O A;  4F5O A;  3QEA Z;  2W9B B;  3SD7 A;  4IRD A;  3SEI A;  8ICN A;  1JN3 A;  4CDG A;  1KKX A;  3AQF A;  4Y2U A;  4J9O A;  4GXK A;  2ZTC A;  4PL1 A;  1L3U A;  3HKZ F;  2KHQ A;  3QXG A;  3J81 j;  1A76 A;  9ICT A;  1BGX T;  4CF3 A;  1PUZ A;  2JEJ A;  3Q8K A;  1L7P A;  3PMN A;  2W43 A;  5EE0 A;  3EPG A;  4O5K A;  3PST A;  5KTQ A;  5KFT A;  3ZDE A;  2MAX A;  1JX4 A;  3SAH A;  5KFH A;  3B0X A;  2PFQ A;  5J2E A;  4OCZ A;  4US9 A;  2QKQ A;  2DL0 A;  2RP5 A;  5KG4 A;  8ICL A;  2H3I A;  3FAH A;  4PHA A;  8ICC A;  1L3T A;  2HVI A;  4F4W A;  7ICK A;  1XSL A;  1DRG A;  5AI4 A;  2W55 A;  2N1R A;  5CHG A;  2J6S A;  8ICA A;  4PGX A;  1HUO A;  1JAL A;  3MFH A;  1J2N A;  2W03 A;  3RJK A;  4CNQ A;  5DB8 A;  5J0T A;  4DO9 A;  1XO1 A;  3I76 A;  1V85 A;  9ICG A;  1NKE A;  3NRZ A;  2AGQ A;  2UVV A;  4F2R A;  2OHF A;  4MHV A;  1NKC A;  4KLO A;  2KKP A;  1XO0 A;  3TAD A;  3PZP A;  8ICO A;  5C5J A;  1UA0 A;  4C4S A;  4O3P A;  5AM2 A;  2KSO B;  2KIV A;  5ALU A;  4US8 A;  2ZIV B;  4RT3 A;  4TUS A;  4YQW A;  3MDC A;  4TQR A;  2BCS A;  2BPF A;  5J29 A;  1D8L A;  4RQ4 A;  3LDA A;  5KT7 A;  4KLM A;  2EQY A;  3SV4 A;  4QZD A;  2JH1 A;  4G3I A;  2XGP A;  1NZP A;  1RPL A;  4IR9 A;  2ZIU A;  4R64 A;  1NJW A;  4UAY A;  1QQ6 A;  4YMM A;  1RYR A;  4IRC A;  2IMW P;  1GO3 F;  3ZI4 A;  1Z00 A;  4RQ3 A;  2F8K A;  1L7N A;  3QU9 A;  1KBU A;  2G5I B;  1FFV A;  4GC6 A;  5EE9 A;  4PGQ A;  3KOO A;  4O3O A;  5J8Y C;  1CUK A;  2PMZ F;  5KNI A;  4IS7 A;  4R8U B;  2C2D A;  4O3S A;  1RDF A;  1LVH A;  1RXW A;  4J03 A;  1BPB A;  1FO4 A;  3MFI A;  1T94 A;  2ZUB A;  2HHV A;  5DG8 A;  5K4L A;  4OO1 J;  1RXV A;  2BPC A;  1NI3 A;  3RFA A;  4Q45 A;  3H7I A;  5J0U A;  4KMO B;  4KN7 A;  4C4T A;  4TUP A;  2VJ4 A;  5ALJ A;  2JGA A;  2CPR A;  5KAI U;  1SIJ A;  3PW2 A;  5EOZ A;  5KFM A;  4C7Z A;  2QAR A;  4I2H A;  4ECV A;  3IP4 B;  1S8O A;  5J0Y A;  3D2Q A;  3KHH A;  2PFN A;  1PK3 A;  1PK1 B;  4B9T A;  3UM9 A;  3K1Z A;  3C28 A;  3MAB A;  3M7D A;  4Z6E A;  3MGH A;  5AI9 A;  2YTU A;  3QNM A;  5KL8 B;  5KFE A;  2EAM A;  3B0Y A;  3MR3 A;  1D9D A;  2JEG A;  2J6T A;  4Y2X A;  4BJQ A;  5D49 A;  1B4F A;  7ICQ A;  3Q8S B;  3T79 A;  5J8Y A;  2VA8 A;  4FO6 A;  4O9M A;  5AKE A;  4K4I A;  4NLZ A;  4P0Q A;  2ISP A;  1T8E A;  1S0M A;  2JEI A;  2R8J A;  4Q8E A;  4DF4 A;  1U9L A;  5J0Q A;  3SR6 A;  5KG5 A;  2ZG6 A;  5AKH A;  2IHN A;  3PX4 A;  5DGA A;  3IV6 A;  4JK1 A;  2ALZ A;  2H3F A;  2EZX A;  9ICO A;  3KZI U;  3RB3 A;  2FMP A;  1ECW A;  4J9L A;  5KFI A;  4Y2S A;  2K4H A;  2P6R A;  2ESE A;  1MC8 A;  4MFC A;  4RQ7 A;  1K1Q A;  1ZQE A;  4RNN A;  1V97 A;  2A3V A;  1SKR A;  1NK7 A;  1RYS A;  5IIM A;  4B6J A;  5HR7 A;  2MUT B;  1RZT A;  5KG3 A;  1IG6 A;  4QWC A;  2YMQ A;  2F8L A;  4NL9 A;  3D2N A;  1ZD4 A;  3CW2 C;  3BQ1 A;  4DQP A;  7ICN A;  1KDH A;  1DK3 A;  1TE2 A;  2HBJ A;  4J9K A;  3WK5 A;  1B22 A;  2ZIW B;  2ODG A;  2K4P A;  1KEJ A;  5AHX A;  5F9N A;  4ED8 A;  4QW9 A;  2KV2 A;  2HHQ A;  2H3Q A;  4ED1 A;  7ICF A;  1UHU A;  4I2B A;  2QB0 B;  1PVQ A;  3OTQ A;  1WYG A;  4QWA A;  1COK A;  1TV9 A;  2RRD A;  2PFO A;  3AMZ A;  3H8W A;  2V9W A;  4KLQ A;  1ZQI A;  4DSL A;  2A1J A;  4KLU A;  4FS2 A;  5AM5 A;  3H4B A;  3JPT A;  5AI6 A;  3AU2 A;  1NOM A;  2NRT A;  3QU2 A;  3GV7 B;  2AH5 A;  1KL9 A;  1V38 A;  4P4O A;  4CRX A;  5DBB A;  3RAX A;  2WAQ F;  1U45 A;  4PPX A;  2VA3 A;  1YT3 A;  1U48 A;  4BWJ A;  3G6V A;  4R63 A;  4BXO B;  4DL7 A;  2BKE A;  5J2A A;  2NRX A;  2JHD A;  3RAQ A;  1UQV A;  2W3R A;  1ZQF A;  2QAR B;  2PXI A;  2JXJ A;  4JB3 A;  4DF8 A;  4F92 B;  5FP0 A;  4ECU A;  2W8K A;  9ICW A;  4DL2 A;  4ELT A;  3JPS A;  1SV0 A;  4KLF A;  3EPI A;  4M9G A;  3WKA A;  4M2Y A;  5DB9 A;  1NJZ A;  3PW0 A;  1S76 D;  1P7D A;  1MN8 A;  1X6I A;  3R9K A;  2ASJ A;  4UB1 A;  4PJ0 U;  2XY6 A;  3BQ2 A;  1DK2 A;  1HEK A;  4NLN A;  1ZD3 A;  4M9H A;  2NRZ A;  4LZG A;  2ZIX B;  1ZET A;  1KFD A;  4C7Y A;  3PO5 A;  9ICE A;  4XUS A;  2GH1 A;  5CWR A;  3HT3 A;  2ZIV A;  4UAT A;  1WG8 A;  2LKY A;  5HMM A;  3Q8R B;  1ZQG A;  2ZTE A;  2XC9 A;  3OJS A;  3THV A;  3T5H A;  2WTF A;  4CF4 A;  5BOM A;  1BPY A;  1ZD2 P;  2XVT A;  3ICX A;  4YD1 A;  2A1A A;  2LI6 A;  2K8C B;  4ED3 A;  4QIW F;  4UAV A;  3RB6 A;  1SZP A;  1KRP A;  2KJ5 A;  2I5H A;  2ASL A;  4P4P A;  2FLL A;  7ICP A;  5KFQ A;  4C80 A;  4OJL A;  4QZ9 A;  2OXO A;  3GDX A;  1O08 A;  4B9M A;  3RJI A;  3BZK A;  4F50 A;  3C2K A;  4DFP A;  3Q8M A;  4DLG A;  1O03 A;  3JPR A;  2FPK A;  4R66 A;  8ICV A;  2W9B A;  1SV0 C;  3ETL A;  3A0H U;  5B5E U;  5JTI A;  5KFY A;  5J2F A;  4YG2 A;  2W8L A;  4ZOH C;  3RH5 A;  1TFR A;  4J9N A;  2W04 A;  1HUZ A;  5AK5 A;  4DFK A;  3OSP A;  3K4G A;  3Q8Q B;  2E5S A;  4PL2 A;  4Z6F A;  4KLE A;  4C8O A;  4DQR A;  9ICF A;  4EEY A;  2LMR A;  5KFU A;  5KFJ A;  5IIO A;  3BQT A;  5HHI A;  1A6S A;  3UPQ A;  1TAM A;  2QLT A;  1DOQ A;  2W7P A;  2KNJ A;  1N63 A;  1RQL A;  5KG2 A;  2KP7 A;  3LWM A;  4DFM A;  2YB4 A;  4F4X A;  5AIC A;  4EBE A;  3M9M B;  1IV8 A;  5KFN A;  1SKS A;  1F0M A;  1ZQS A;  4O3Q A;  7ICI A;  3V6K A;  3H8S A;  1QQ7 A;  5CB1 A;  4M9J A;  2K4E A;  2NV3 A;  5AI5 A;  3PR4 A;  3T5K A;  1WCL A;  4JWM A;  4Q44 A;  1JIH A;  3FDS A;  4MF8 A;  4NV0 A;  3PML A;  1X2I A;  5TZV A;  3RB4 A;  1BNO A;  4RNO A;  4Y2V A;  2HHU A;  2BZF A;  1K5O A;  1ZQQ A;  9ICP A;  3C1Z A;  3BDP A;  1OW5 A;  4P0P B;  5AKJ A;  4P0Q B;  2EZZ A;  1CI4 A;  2F44 A;  2KVC A;  5CP2 A;  2LM4 A;  5TIS U;  4FS1 A;  2G09 A;  4C8N A;  5KG6 A;  2FI1 A;  4DSF A;  3ZDA A;  2WF7 A;  1ZQU A;  3FYH A;  4KTQ A;  3NGD A;  1DGS A;  4FE3 A;  2ZTD A;  2IBK A;  9ICQ A;  4DQI A;  1NNL A;  3D6J A;  3UQ0 A;  1ZRN A;  1LB2 B;  4BDP A;  1TAU A;  3TQ1 A;  3UQ2 A;  4MFF A;  5AKK A;  2AU0 A;  2CXY A;  1SL2 A;  4UQG A;  4UAS A;  9ICL A;  2P6U A;  4ACO A;  3E0F A;  2NRW A;  5DB7 A;  3KKA A;  4IQV A;  1UT8 A;  2KTQ A;  1QQ5 A;  5DQI A;  2DBY A;  2KVS A;  2AXT U;  5AKI A;  5KT5 A;  2FMQ A;  2BCQ A;  4M9N A;  4KN4 A;  4ECT A;  3SV3 A;  7ICO A;  5KFA A;  4UBC A;  3GIJ A;  2PFP A;  1X66 A;  3NVZ A;  3LK9 A;  3D2S A;  8ICH A;  1COO A;  1SXD A;  2YN4 A;  3VC8 A;  4F5R A;  4GXJ A;  3QZ7 A;  8ICY A;  5KFL A;  2XY7 A;  4NM1 A;  1ZQH A;  3MR5 A;  1TK5 A;  2W9A A;  8ICZ A;  2ASD A;  5G5G A;  2KD1 A;  5AK6 A;  4KLH A;  4WJ3 B;  3T3F A;  4F4Y A;  1Z1B A;  3RTV A;  2ZIW A;  4X5V A;  2BPG A;  1KLN A;  3WK7 A;  3CNH A;  5L1K A;  2KJ9 A;  7ICU A;  1A77 A;  2WB1 F;  1ZQD A;  2DF4 B;  5ALZ A;  5T14 A;  5L1J A;  2HBM A;  1L6N A;  3F5A A;  1Q46 A;  3NS1 A;  7ICG A;  4YD2 A;  2OWO A;  1SL1 A;  5DQG A;  4EYI B;  5ALW A;  1X42 A;  4KLS A;  4YP3 A;  2XCP A;  4PZN A;  2C28 A;  4ECR A;  1S0V A;  2HDO A;  2KMD A;  3SEN A;  2DWQ A;  5ALH A;  3K75 D;  4E0D A;  7ICE A;  4F4Z A;  4YFK A;  3N7R C;  2AJQ A;  2DQN B;  4UB4 A;  4O3M A;  1ZJM A;  2E8N A;  3PNC A;  5KFZ A;  4LZD A;  3RRG A;  5ALX A;  5J2D A;  1KTQ A;  2G07 A;  2KG5 A;  2KK0 A;  4NLC A;  5HNK A;  2JV3 A;  2KZ3 A;  5G5H A;  5GTI U;  4YXJ A;  4DSE A;  1S9F A;  4FZM A;  1ZQT A;  1QLN A;  1T4G A;  3FC4 A;  1XNS A;  4B9U A;  2KIW A;  4IQU A;  1RYU A;  1MQ2 A;  2BCU A;  2VKQ A;  2K8A A;  4I2A A;  4OD0 A;  3JPN A;  2XIC A;  2PI4 A;  3GQC A;  2FJ6 A;  3RH6 A;  4F2S A;  2E1F A;  4B9L A;  3S6J A;  2OEH A;  1KN5 A;  3UXP A;  1XSN A;  1ZOL A;  5J2B A;  2B6G A;  3AM9 A;  3QU7 A;  3TAC B;  4R65 A;  1ZQN A;  1URJ A;  2PKE A;  2FLP A;  1F44 A;  1ZQO A;  4LVS A;  4M0A A;  4Q43 A;  4DOB A;  4USA A;  2WF5 A;  1XU4 A;  4QWD A;  3QEB Z;  3SI8 A;  2ZJA A;  4Y2P A;  2XID A;  1ZQZ A;  5KFW A;  1MA7 A;  5KT2 A;  1S10 A;  2K4I A;  4HAI A;  4NWI A;  2D8C A;  4AYB C;  4F91 B;  4UW9 A;  1N5W A;  3TAN A;  4UBB A;  5IIJ A;  2P35 A;  3PVX A;  2HHS A;  2ZIX A;  4CCH A;  3ISB A;  2K60 A;  1SL0 A;  3PR5 B;  1D9F A;  9ICX A;  2NRV A;  2Y1J A;  4QZC A;  3LVV A;  3RBD A;  4OJ6 A;  2I1Q A;  4NJ8 A;  3N7S C;  5EWG A;  4GC7 A;  3N97 B;  2M0N A;  4PHD A;  5KG7 A;  5ALN A;  1NK0 A;  3I1Y A;  3SQI A;  1NK9 A;  3PW4 A;  3F2D A;  4KLI A;  1QSS A;  2VAN A;  2LM1 A;  3KZX A;  3DEE A;  4DFJ A;  4U7C A;  4DL5 A;  4RT2 A;  5H2F U;  5EWF A;  4NLB A;  4RQN A;  3HKZ C;  5KFK A;  7ICR A;  2W9C A;  3KKA C;  2UVU A;  2FE9 A;  5AKY A;  2LPE A;  1J2M A;  5ALF A;  1U47 A;  3I28 A;  1BVS A;  4BWM A;  4DL6 A;  3QX7 A;  5AKZ A;  7ICH A;  2EAO A;  4CE6 A;  1YZ7 A;  5ALE A;  5J2C A;  2HMX A;  1S5L U;  3HJE A;  5AKG A;  5J0P A;  2WFA A;  2LBO A;  5KFX A;  1NK5 A;  3QU4 A;  2FPM A;  4Y2T A;  2DKZ A;  3PO4 A;  4JV0 A;  4YR0 A;  8ICF A;  3IN5 A;  2KOB A;  4YR3 A;  2E1E A;  3IRU A;  3F2C A;  2JZB A;  5J0X A;  2A1J B;  1ED1 A;  2W3S A;  3ONN A;  4RQM A;  8ICG A;  4RQ6 A;  3RJG A;  2I6X A;  3BS7 A;  2KN7 A;  2G06 A;  5AM4 A;  1WCN A;  1N61 A;  1N48 A;  1CEZ A;  9ICI A;  1L8O A;  5BOL A;  4ECS A;  1V9P A;  2OCE A;  1Z4N A;  4NL9 C;  1FEZ A;  3IG8 A;  4QZE A;  3WU2 U;  3UXN A;  1MQ3 A;  4I2I A;  3SYZ A;  4XQ8 A;  5DB6 A;  5DDM A;  4OJP A;  3A0B U;  4UB2 A;  3C5G A;  2FLN A;  8ICW A;  3BZC A;  5IIN A;  4I28 A;  9ICA A;  1X40 A;  3JPO A;  2KKV A;  2K8B B;  3L4P A;  2XI9 A;  4RQ2 A;  2IOH A;  3C1Y A;  5L1L A;  4MF2 A;  2H3Z A;  5ALT A;  2KIC A;  3NVV A;  2IOF A;  1ZQJ A;  3HRD D;  5IIL A;  4QZH A;  4EX6 A;  1ZQC A;  5JUM A;  4P2H A;  1XWL A;  5ALR A;  3RB0 A;  1Z3E B;  4J9Q A;  2C2E A;  5ALK A;  5AIB A;  8ICR A;  1A0P A;  2PMZ C;  1U4B A;  2M9N A;  3V7L A;  3C2L A;  2ISO A;  1XS9 D;  3V72 A;  4EZ9 A;  5KT6 A;  2Q0Z X;  4KMU A;  3TFS A;  3SZ2 A;  2R8G A;  2XGQ A;  2ZXI A;  4IR1 A;  2NO4 A;  3NTU A;  3ZDB A;  1ZRM A;  3HP6 A;  2YY6 A;  3OJU A;  2Y0S F;  5CEH A;  1JXE A;  5D46 A;  3GU3 A;  3KHR A;  3K1R B;  2HHT A;  2V4Q A;  3QZ8 A;  2LYA A;  3H8M A;  2W54 A;  2F3N A;  1UA1 A;  2QB0 A;  1Q3U A;  4FBU A;  4ED0 A;  3N28 A;  4C0Z A;  2W9C B;  2HBK A;  4M47 A;  2IHM A;  4F93 B;  4M9L A;  1T7P A;  3PSI A;  4RPY A;  5J2H A;  8ICQ A;  2WB1 C;  1LKY A;  2MA1 A;  3UXO A;  4KX5 A;  1BNP A;  4ECW A;  4RQ1 A;  3WK4 A;  5ALL A;  3MR6 A;  7ICV A;  3E58 A;  4QZ8 A;  5JRT A;  4PH5 A;  2W9M A;  2EAN A;  4C4R A;  4FFD A;  8ICS A;  1SGG A;  2KE7 A;  1L7O A;  3HPO A;  3F5E A;  5KFO A;  3GIK A;  3AL0 B;  3EZ5 A;  9ICV A;  3CP8 A;  5AK3 A;  3UMB A;  3OPX A;  1ZQY A;  5ALQ A;  5KL1 B;  3KFU F;  5F9L A;  2NO5 A;  2BQU A;  3WKD A;  5DKW A;  4RQ5 A;  5F3X B;  3NVW A;  5AK4 A;  3QUQ A;  2D3D A;  1BPX A;  4Z6C A;  2KZZ A;  5J2G A;  1VDV A;  2OH2 A;  3M8S A;  1RM6 C;  3H4D A;  5DG9 A;  4KLT A;  3UMC A;  5J0R A;  4TUR A;  4ECX A;  3DDH A;  5III A;  2Y9T A;  3MGV A;  1ZYQ A;  4DL4 A;  1TVA A;  4GXI A;  1ZQW A;  4Q8F A;  2ZUC A;  3T5L A;  2RHF A;  2CN1 A;  1ZQV A;  1PVR A;  3LVW A;  4UB6 U;  3PSP A;  2GWS A;  2DGZ A;  2B21 A;  1XSP A;  9ICH A;  2R8H A;  3LWL A;  1X9M A;  3EUB 2;  5E79 U;  1X6J A;  4YVZ A;  4EEK A;  4GLX A;  3TAD C;  4NXZ A;  5J0W A;  4QZA A;  2BHN A;  2WF9 A;  4I29 A;  4DOC A;  5DQH A;  9ICM A;  8ICK A;  4NLG A;  1Z19 A;  3L3F X;  3B9J A;  2BCR A;  3KBB A;  3MGI A;  7ICT A;  1L3V A;  4G9B A;  1Q8K A;  4A8E A;  3TFR A;  3HIL A;  3DV9 A;  1HIW A;  3M6K A;  1OXJ A;  1TK0 A;  3E2E A;  1FFU A;  3NRW A;  3SMV A;  3RBE A;  3BJY A;  4F4K A;  2UVR A;  4ED6 A;  3SAF A;  2HVH A;  1IM4 A;  3GIM A;  4AYB F;  4QJF B;  9ICJ A;  1Z00 B;  2MU2 A;  1DGJ A;  1NK8 A;  3Q8L A;  3GV8 B;  1J97 A;  5AM0 A;  4I2D A;  5IIK A;  2F77 X;  3F53 A;  1SWW A;  3WK8 A;  3VCB A;  3PX0 A;  1S97 A;  1ZQB A;  1KFT A;  3MR2 A;  9ICK A;  2RQ5 A;  2W11 A;  3T5J A;  2AGP A;  4QZI A;  1KSP A;  3RJE A;  1ZXI A;  5ALY A;  5AKX A;  2MRL A;  2Y9U A;  3ISD A;  4C8L A;  1ARO P;  1UT5 A;  1WWV A;  3AEV A;  1NK6 A;  1L8L A;  4BGD A;  3RR8 A;  4IQW A;  4DQS A;  3PY8 A;  4JMU A;  1M6Y A;  1ZQ1 C;  2MSN A;  2YX8 A;  3Q8P B;  4UB8 U;  3C5F A;  1KW4 A;  3PW5 A;  2FPL A;  4ED2 A;  3TAQ A;  5KG0 A;  1S0N A;  2AHO B;  5EWE A;  1Z4O A;  2AQ4 A;  4IC9 A;  5ALM A;  4BX9 C;  1SB3 C;  3M9O B;  2Z7J A;  4GFJ A;  4F8R A;  2V4R A;  4MFA A;  1PZN A;  2E8O A;  1KFS A;  4FZN A;  2LYH A;  4DCC A;  3JPQ A;  3TAR A;  4P0P A;  3MC1 A;  4F5P A;  4M6W A;  2FMS A;  2H3V A;  3GFK B;  5J2J A;  4RQ0 A;  2EAP A;  1T3Q A;  1F5S A;  8ICP A;  5A0L A;  2RDI A;  1PK1 A;  1SKW A;  4B9S A;  2WHE A;  4QNL A;  5DBA A;  2E8P A;  1TKD A;  5CRX A;  3M9N B;  2XY5 A;  4F3O A;  1S77 D;  1YZ6 A;  5L9X A;  1Q3V A;  3TAP A;  4KIT B;  1SXE A;  2KZM A;  3LYS A;  3CYM A;  2F76 X;  3C21 A;  4KX3 A;  4MEX A;  4F5Q A;  2YML A;  4EBC A;  4XA5 A;  4NLK A;  4ELU A;  3H8J A;  1RQN A;  4QWB A;  2ATL A;  3H0R B;  4RUC A;  4QIW C;  2HBL A;  2R18 A;  2XCA A;  2VIX A;  4IQT A;  4UAR A;  4PZO A;  3C23 A;  3OHA A;  2EH9 A;  3IM1 A;  4F72 A;  3KHG A;  1HJP A;  5ALS A;  2KSO A;  5EE1 A;  1QSY A;  1WWU A;  4XRH A;  3V6J A;  1KQQ A;  1ZQM A;  4QZB A;  2BQR A;  1N62 A;  1H38 A;  4ECZ A;  3QYP A;  4RZR A;  2ZXH A;  2JR5 A;  2Y0S C;  1BPE A;  3RR7 A;  5EE3 A;  1XC9 A;  3HWT A;  2JRZ A;  8ICI A;  3FM9 A;  2EZY A;  3QUB A;  5AI0 A;  1JXL A;  4ECQ A;  4EYH B;  4C8M A;  3RJJ A;  3C29 A;  5DLG A;  3QE9 Y;  4LJX A;  3RJF A;  3NVY A;  5GTH U;  4O0I A;  2UVW A;  4GIB A;  4I27 A;  3QUT A;  4Y2R A;  1N5X A;  2LYB A;  1D8Y A;  5HHH A;  2F1J A;  2JH7 A;  4Y2Q A;  1PVP A;  4DSI A;  4F71 A;  2OYY A;  3ZDC A;  3GZF A;  2I9G A;  5AIA A;  2KFN A;  4YXM A;  5HML A;  8ICE A;  3OHB A;  4YCX A;  8ICJ A;  3WKB A;  3BS5 A;  3GII A;  1LKY B;  2LHT A;  1SZH A;  3GV5 B;  2ZUD A;  3N7P D;  4Y2J A;  2ZJ5 A;  1ZQL A;  5JU5 A;  4DWI A;  2WF6 A;  2BDP A;  4I2C A;  4YR2 A;  5KFB A;  5KFG A;  3QU5 A;  2DPJ A;  1N60 A;  3QUC A;  1NK4 A;  2F1H A;  1JRP A;  1B43 A;  4ZH4 A;  2KHV A;  3EWA A;  4DFD A;  2KJ8 A;  9ICS A;  1U49 A;  4BUG A;  4J9P A;  1SV4 A;  4RPZ A;  3AQE A;  7ICJ A;  4QWE A;  1DXS A;  2PI5 A;  7ICS A;  3ORY A;  2DPI A;  3N4M B;  3WKC A;  3MBY A;  4RNM A;  4EX7 A;  4M04 A;  1VLB A;  4HYK A;  1QCK A;  5KFR A;  1ZQA A;  3CRX A;  1NKB A;  5DGB A;  4I2E A;  3O0F A;  3IHQ B;  5CJ7 A;  5ALV A;  4QZG A;  1T3N A;  1QTM A;  2CRX A;  2YMP A;  9ICR A;  1X9W A;  4Y2Y A;  5J2K A;  3ZDD A;  1N2X A;  5J0S A;  2ZIU B;  3ZD9 A;  3OSN A;  3WK6 A;  2J6U A;  2Y1I A;  1Z1V A;  2HI0 A;  5KFV A;  5DG7 A;  4JUZ A;  1LV5 A;  3ZD8 A;  4F5N A;  4ECY A;  2AQ0 A;  2HOQ A;  1K1S A;  3AN1 A;  4PHE A;  2WF8 A;  4O5C A;  2HHW A;  8ICU A;  1JMS A;  2D6F C;  2HHX A;  4ICA A;  4J9S A;  4O5E A;  2VJ5 A;  4C8K A;  2E3T A;  3ALR A;  4OJ5 A;  4J9R A;  1N56 A;  4FBT A;  2QB1 A;  4IRK A;  2YQE A;  3V7K A;  3SAG A;  2F2A B;  4JWN A;  2E8M A;  1ZD5 A;  4DOA A;  3U26 A;  4DL3 A;  3WKE A;  8ICM A;  1L3S A;  5J0O A;  4UAZ A;  3KD3 A;  3NUQ A;  3UMG A;  2XO7 A;  4EEN A;  4KLG A;  2HCF A;  3RH4 A;  5ALI A;  3H0M B;  3PW7 A;  4KLD A;  3WK9 A;  4TQS A;  1C20 A;  5ALO A;  3H0L B;  2JEF A;  4B9N A;  4CF5 A;  1X9S A;  2C22 A;  3JPP A;  1VJ5 A; 
#chains in the Genus database with same CATH homology
 5J0R A;  4TUR A;  3B0Y A;  8ICX A;  7ICU A;  5III A;  1ZQD A;  3HW8 A;  5D49 A;  1TVA A;  4GXI A;  7ICG A;  4YD2 A;  7ICQ A;  4O9M A;  4FO6 A;  4KLS A;  7ICL A;  4K4I A;  2GWS A;  8ICB A;  1XSP A;  4NLZ A;  9ICH A;  4PGY A;  4TUQ A;  2ISP A;  9ICN A;  7ICE A;  4Z6D A;  8ICT A;  4NXZ A;  5J0Q A;  4UB4 A;  5J0W A;  4QZA A;  1ZJM A;  4I29 A;  4DOC A;  3PNC A;  9ICM A;  4YN4 A;  4LZD A;  8ICK A;  2BCR A;  5J2D A;  3MGI A;  9ICO A;  7ICT A;  2FMP A;  3TFR A;  1ZQT A;  4MFC A;  2BCV A;  3C2M A;  4RQ7 A;  1ZQE A;  4IQU A;  3HX0 A;  1MQ2 A;  2BCU A;  4I2F A;  4KLL A;  4I2A A;  5IIM A;  1RZT A;  3JPN A;  9ICJ A;  1ZJN A;  3RH6 A;  4I2D A;  5IIK A;  4KLT A;  7ICN A;  5DBC A;  4I2G A;  1KDH A;  4UB3 A;  1DK3 A;  5D4B A;  1ZQB A;  9ICK A;  3UXP A;  1XSN A;  5J2B A;  1KEJ A;  1BPD A;  4QZI A;  3RJE A;  4YMN A;  4R65 A;  1ZQN A;  7ICF A;  1ZQO A;  4I2B A;  4LVS A;  4YMO A;  4M0A A;  4RQ8 A;  3ISD A;  4DOB A;  5J2I A;  4I2J A;  1TV9 A;  3OGU A;  2PFO A;  3ISC A;  4KLQ A;  1ZQK A;  4IQW A;  1ZQI A;  4KLU A;  3JPT A;  4RPX A;  3AU2 A;  4UAW A;  7ICM A;  5DBB A;  3C5F A;  4NM2 A;  1ZQR A;  1BPZ A;  4PPX A;  4UBB A;  5IIJ A;  4R63 A;  5J2A A;  3V7J A;  3ISB A;  1ZQF A;  9ICX A;  5BPC A;  4MFA A;  4QZC A;  2PXI A;  3JPQ A;  9ICW A;  3RJH A;  4K4H A;  3JPS A;  2P66 A;  4F5P A;  2FMS A;  4KLF A;  5J2J A;  4RQ0 A;  4PHD A;  4M9G A;  9ICC A;  8ICP A;  4M2Y A;  5DB9 A;  4UB5 A;  1ZQP A;  4UB1 A;  5DBA A;  4KLI A;  4QZF A;  1DK2 A;  4PHP A;  4NLN A;  5DDY A;  3AU6 A;  4M9H A;  4LZG A;  4RT2 A;  9ICB A;  9ICE A;  4F5Q A;  4XUS A;  5CWR A;  4KLJ A;  3MDA A;  9ICU A;  7ICR A;  4XA5 A;  4NLK A;  1ZQG A;  5BOM A;  4NY8 A;  1BPY A;  3AUO A;  7ICH A;  4K4G A;  4IQT A;  4YD1 A;  5J2C A;  4F5O A;  5J0P A;  8ICN A;  7ICP A;  1ZQM A;  4QZB A;  4QZ9 A;  4GXK A;  3GDX A;  9ICT A;  8ICF A;  3RJI A;  1BPE A;  3PMN A;  3HWT A;  5J0X A;  8ICI A;  8ICG A;  4RQ6 A;  3RJG A;  4O5K A;  3C2K A;  3JPR A;  3RJJ A;  4R66 A;  9ICI A;  8ICV A;  5BOL A;  3RJF A;  3B0X A;  2PFQ A;  5J2E A;  5J2F A;  4QZE A;  4I27 A;  3RH5 A;  3UXN A;  1MQ3 A;  8ICL A;  4I2I A;  5HHH A;  1HUZ A;  4PHA A;  8ICC A;  5DB6 A;  4UB2 A;  3C5G A;  8ICW A;  5IIN A;  4I28 A;  7ICK A;  9ICA A;  4Z6F A;  1XSL A;  2I9G A;  3JPO A;  4KLE A;  9ICF A;  5IIO A;  4RQ2 A;  8ICE A;  8ICA A;  4PGX A;  1HUO A;  4YCX A;  4MF2 A;  5HHI A;  8ICJ A;  3RJK A;  3UPQ A;  5DB8 A;  2BPG A;  5J0T A;  4DO9 A;  1ZQJ A;  9ICG A;  5IIL A;  2KP7 A;  1ZQL A;  4QZH A;  4KLO A;  4I2C A;  8ICO A;  1ZQC A;  4P2H A;  1ZQS A;  4RT3 A;  4TUS A;  7ICI A;  3MDC A;  9ICS A;  2BCS A;  2BPF A;  5CB1 A;  4M9J A;  8ICR A;  5J29 A;  4RQ4 A;  4KLM A;  3V7L A;  4RPZ A;  4QZD A;  4JWM A;  3C2L A;  7ICJ A;  2ISO A;  4MF8 A;  3V72 A;  1NZP A;  3PML A;  5TZV A;  7ICS A;  4R64 A;  1BNO A;  3TFS A;  4UAY A;  1ZQQ A;  3MBY A;  4M04 A;  4YMM A;  9ICP A;  1ZQA A;  4RQ3 A;  4I2E A;  5D46 A;  4QZG A;  4PGQ A;  9ICR A;  9ICQ A;  5J2K A;  5J0S A;  3UQ0 A;  4M47 A;  2IHM A;  4M9L A;  3UQ2 A;  4MFF A;  4F5N A;  4RPY A;  4PHE A;  5J2H A;  8ICQ A;  3UXO A;  5J0U A;  4O5C A;  9ICL A;  1BNP A;  8ICU A;  4RQ1 A;  4TUP A;  5DB7 A;  1JMS A;  4IQV A;  7ICV A;  4O5E A;  4QZ8 A;  4PH5 A;  2W9M A;  2FMQ A;  5EOZ A;  2BCQ A;  4M9N A;  8ICS A;  3V7K A;  4JWN A;  7ICO A;  4DOA A;  8ICM A;  4UBC A;  5J0O A;  4UAZ A;  4I2H A;  2PFP A;  3LK9 A;  8ICH A;  9ICV A;  4F5R A;  4KLG A;  3RH4 A;  5J0Y A;  4GXJ A;  8ICY A;  4NM1 A;  5DKW A;  2PFN A;  4RQ5 A;  1ZQH A;  4KLD A;  8ICZ A;  1BPX A;  4KLH A;  4Z6C A;  5J2G A;  4Z6E A;  3MGH A;  4X5V A;  3JPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...