1BNOA

Nmr solution structure of the n-terminal domain of dna polymerase beta, minimized average structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
87
structure length
87
Chain Sequence
b'MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA
publication title Three-dimensional solution structure of the N-terminal domain of DNA polymerase beta and mapping of the ssDNA interaction interface.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Nucleotidyltransferase (dna-binding)
total genus 13
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1996-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1bnoA00
4IQVA 4UB3A 3B0YA 3JPOA 1MQ3A 8ICHA 9ICLA 9ICHA 7ICTA 4KLUA 1XSLA 4QZDA 4UB2A 4K4GA 4R64A 4M9LA 1BPXA 2PFNA 4RPXA 4JWMA 8ICUA 4QZCA 4NXZA 9ICRA 5J2EA 4I27A 5EOZA 4PHDA 1ZQDA 7ICGA 4GXJA 3UQ0A 3JPSA 4YMMA 3RJFA 3RH4A 4TUPA 8ICKA 3JPRA 5IIIA 3RJJA 9ICJA 7ICLA 3ISBA 4RQ5A 8ICRA 3C2MA 4M0AA 5DB9A 4UB4A 5J29A 4QZAA 4NLKA 4F5RA 5J0TA 4NM2A 1ZQMA 9ICNA 1ZQKA 8ICBA 9ICGA 5IILA 4I2CA 5J2GA 3MDAA 4MFFA 4PHEA 9ICBA 4PPXA 5CWRA 4RQ1A 9ICSA 4IQUA 3C5GA 3AU6A 1DK3A 4M47A 4KLEA 3RH6A 2P66A 3V7LA 4TUSA 4GXKA 8ICTA 5IIJA 4I2BA 5BOMA 4PGXA 9ICVA 3RJHA 4QZHA 4UB5A 4DOBA 3C2LA 4Z6CA 3V7KA 3UXOA 2BCSA 4QZFA 4NM1A 4KLOA 4R65A 5DB8A 3HW8A 4F5QA 4O5KA 4I2DA 1XSPA 4R66A 4KLMA 4RQ3A 7ICPA 5J0YA 4QZ8A 5TZVA 3OGUA 4I29A 4M9JA 4YMOA 4I2EA 3MBYA 8ICAA 3UQ2A 4NLNA 3UXNA 1ZQRA 5DDYA 4PHPA 8ICVA 4YN4A 4DO9A 4KLIA 4NY8A 3JPNA 2FMSA 7ICRA 4YCXA 5J0UA 4I2FA 5D46A 8ICGA 4RQ2A 1XSNA 1ZJMA 4LVSA 7ICUA 4UB1A 4UAZA 9ICUA 2BCUA 8ICEA 9ICWA 1BNOA 5DB6A 4PHAA 1BPDA 3ISCA 1TVAA 4RQ6A 4F5PA 4PGQA 9ICOA 3PMLA 1NZPA 4I28A 1ZQSA 1KEJA 4KLSA 5DB7A 4RQ8A 4F5OA 2W9MA 1BPZA 1ZQLA 3TFSA 3B0XA 5J0RA 2BCQA 2FMQA 7ICQA 4F5NA 4MFAA 4PH5A 3V7JA 1ZQIA 1ZQGA 9ICKA 5HHHA 5J2JA 8ICXA 9ICPA 5J2KA 2ISOA 4DOCA 1ZQTA 4KLDA 4LZGA 2KP7A 3MGHA 4QZIA 2PXIA 3TFRA 8ICZA 2PFOA 1ZQEA 8ICPA 7ICKA 5J2AA 1BPYA 8ICNA 4QZBA 4KLFA 5BPCA 1ZQBA 4M2YA 4IQTA 4O9MA 8ICSA 2PFQA 3AU2A 4MFCA 2PFPA 7ICSA 4I2JA 5J0OA 4RQ0A 5CB1A 4TUQA 4DOAA 3UPQA 4MF8A 5DKWA 4JWNA 1ZJNA 3C2KA 4LZDA 5DBCA 9ICMA 1ZQQA 8ICWA 4PGYA 4YMNA 5J2DA 7ICIA 8ICMA 3PNCA 4KLHA 4KLLA 4RPZA 8ICCA 1DK2A 4Z6DA 4R63A 9ICTA 5J0SA 5J0XA 5IIOA 1ZQFA 5J0WA 4M9NA 9ICAA 1ZQOA 4I2HA 1TV9A 4RT3A 4QZGA 4RT2A 9ICFA 1HUOA 5D4BA 4I2IA 3RJEA 4I2GA 1HUZA 3HWTA 4O5CA 4XUSA 3V72A 1BNPA 3RJGA 4M9HA 4TURA 5J2BA 3HX0A 1RZTA 3RJKA 8ICLA 2BCVA 5J2FA 5J2IA 3C5FA 3RH5A 5J2CA 4K4HA 3RJIA 4MF2A 4UBCA 1JMSA 4M9GA 4UAYA 3MDCA 4I2AA 5J0PA 4KLJA 4M04A 7ICFA 2ISPA 2I9GA 3MGIA 8ICYA 3PMNA 5HHIA 4P2HA 7ICEA 4IQWA 8ICFA 2FMPA 1ZQCA 3LK9A 4XA5A 9ICCA 1ZQPA 4KLGA 2GWSA 8ICQA 2BCRA 3UXPA 4Z6FA 2BPGA 2BPFA 4YD2A 9ICQA 5BOLA 5DBAA 4K4IA 4UBBA 8ICOA 1ZQNA 4RQ7A 4X5VA 7ICNA 4RPYA 3JPQA 5IINA 5J2HA 4GXIA 7ICOA 3ISDA 1ZQHA 3GDXA 4QZEA 4FO6A 1MQ2A 8ICIA 4KLTA 4YD1A 7ICVA 1ZQAA 4RQ4A 7ICMA 2IHMA 9ICEA 7ICHA 1BPEA 8ICJA 1KDHA 4O5EA 7ICJA 3AUOA 1ZQJA 5D49A 3JPPA 4KLQA 4Z6EA 4UAWA 5IIKA 9ICXA 5DBBA 5IIMA 4NLZA 5J0QA 4QZ9A 3JPTA 9ICIA
chains in the Genus database with same CATH superfamily
4F2RA 4ED6A 2JZBA 4RUAA 2YB4A 2OWOA 3CP8A 4HYKA 5AKLA 4C8OA 4JV2A 1A77A 3JPOA 1RPLA 1URJA 2W04A 1F0MA 2I1QA 1ED1A 2ZIUA 4KLUA 4KMUA 5KG4A 2Q0ZX 3F2BA 2XC9A 2BGWA 1C20A 2W9CA 3QYPA 1S8OA 4RPXA 4FFDA 1RXVA 4JWMA 3LYSA 3C1ZA 3E2EA 3MGVA 3NGDA 2GOLA 3RB0A 4ECZA 2Z7JA 2H5XA 1QSSA 2IOFK 1Z19A 2KTQA 3KHLA 4TUPA 3JPRA 2DQNB 3RJJA 7ICLA 1NJXA 2B0CA 3WK8A 2KJ8A 1YT3A 1TK8A 4UB4A 4QZAA 4F5RA 5DG9A 5KT2A 2P6RA 2KICA 9ICGA 5J2GA 3SYZA 5AM0A 2KNJA 4ECXA 4YG2A 1NK5A 4QWEA 4F8RA 2W7PA 1A76A 4IQUA 1ZD5A 3AU6A 4DF4A 4KLEA 3QZ7A 3RH6A 2K8CB 4IS7A 4BXOB 2ODGA 1A6SA 4PGXA 4HAIA 3WK7A 3BJYA 3H8JA 1TKDA 3BQ0A 2DPIA 1X2IA 1NKCA 1IXRA 4DOBA 4JV0A 4Z6CA 3C2LA 3M6KA 3V7KA 3SR6A 1NJWA 4XQ8A 2W7OA 4NM1A 2BPCA 3K75D 4R65A 3PX4A 2M9NA 2CN1A 3IDWA 3TAQA 5KAFU 4O5KA 4QWBA 4DL3A 1XSPA 2E5SA 4KLMA 3L4PA 4RQ3A 4ECYA 2W55A 7ICPA 2EZXA 5DQGA 2VA3A 3IM1A 3OGUA 4AP9A 4DL5A 3L3FX 1ZETA 8ICAA 1JROA 1L3VA 3EYZA 1KRPA 3UQ2A 5ALNA 4NLNA 1L8LA 2KK0A 4USAA 8ICVA 1COOA 2FMSA 2WF6A 5J0UA 3AQEA 5KFAA 4NLCA 3ZD9A 4RQ2A 4F71A 4KITB 2XY6A 2IHNA 2DWQA 1ZJMA 3TACB 7ICUA 1ZRNA 1PZNA 5A0LA 5DB6A 1S0VA 3A0HU 3BDPA 2DL0A 4PZNA 3PW5A 4CF5A 5KG3A 1RM6C 2K4PA 2AQ4A 3WK4A 2ZJAA 3PMLA 4B9NA 1NZPA 1B22A 1ZQSA 4KLSA 5DB7A 4RQ8A 4FS2A 3TFSA 2VJ4A 2K4EA 3RRHA 3B0XA 3MR2A 1XNSA 3EW9A 2FMQA 4MFAA 2I6XA 1A0PA 5F9LA 5KFDA 4DSIA 3F2DA 1Z00A 2W9AA 1KLNA 2HSZA 2KHQA 5ALMA 4F91B 3PVXA 4ED3A 2EDUA 4TQSA 4B9UA 3H7IA 2BDPA 2CPRA 5DLGA 4CRXA 1S77D 1U49A 2R8IA 4F4ZA 2PFOA 1ZD3A 1ZQEA 3PX0A 2PKEA 1QCKA 5KT6A 1UA0A 8ICPA 4F4WA 4IL6U 5AIBA 5J2AA 1ZQUA 2KIWA 2A1JA 8ICNA 3IHQB 4BDPA 3TADC 2PI4A 3ZDBA 5KL1B 4O9MA 2G09A 4GC6A 1ZQVA 7ICSA 5KFBA 3ED5A 5J0OA 2HVHA 2YMPA 4ECTA 3F5EA 3RR8A 3Q8PB 2VA8A 4TUQA 2G5HB 2C28A 5ALOA 4QIWF 1IIPA 4ZH4A 2W8KA 4IR9A 1RXWA 2F77X 1ZJNA 3C2KA 4MEXA 1RYSA 4PGYA 5J2DA 5KTQA 4UAUA 4KLLA 1ZRMA 3SENA 3MABA 4Z6DA 1K1QA 4OJ5A 1CRXA 1S0MA 3B9JA 4J03A 4U6PA 5ALRA 1ZQOA 1MA7A 4I2HA 1TV9A 2MRLA 4CF4A 4RT3A 4DQQA 1T94A 4G9BA 5D4BA 4O3SA 2J6UA 2H3QA 1P7DA 2IBKA 1HUZA 1FFUA 3KOOA 3PW0A 4AYBF 2WAQF 4XUSA 3V72A 3H8MA 1X6IA 5KT4A 2EH9A 3ZD8A 4J9LA 4FS1A 2ZTDA 3SQIA 2AH5A 1K1SA 3KHRA 3PSFA 1Z3EB 2OXOA 4AYBC 4F4YA 3RJIA 1T3NA 4UBCA 1JMSA 2G06A 2W54A 4QW9A 4R8UA 1FIQA 5AHXA 1HEKA 3NVZA 4P2HA 3WKDA 1D9FA 1KFTA 3THVA 3QEAZ 4QWCA 2FMPA 4CCHA 5JTIA 3LK9A 1ZQCA 4XA5A 9ICCA 2JEJA 2W9BA 4Y2VA 1N60A 2K4IA 1RQLA 2L5YA 2KJ5A 9ICQA 1MC8A 1AQ6A 3MR3A 5DBAA 3FAHA 4K4IA 1WCNA 2CRXA 1SL0A 3BZKA 3Q8KA 4CNQA 4DS4A 7ICNA 4RPYA 1N5WA 5J2HA 3OJSA 3ISDA 1Z1BA 1B43A 5ALDA 3NTUA 3Q8SB 2CXYA 3GDXA 4QZEA 2XIDA 1LV5A 1D9DA 8ICIA 2KIVA 7ICVA 4GC7A 5ALUA 2ZIVA 4ECVA 4FE3A 1XC9A 2RHFA 4US9A 7ICHA 3SAGA 2ZIXB 3AMZA 2KSOB 2RDIA 3C29A 4O3RA 3M7DA 1WCLA 4YXJA 3GIJA 1MN8A 2LYHA 4EELA 3JPPA 4KLQA 4UAWA 4NV0A 2NO4A 1OW5A 4P4OA 2W43A 2ASJA 4QJFB 4ECSA 2K4HA 1RYRA 4Y2UA 3PSPA 3N4MB 5AKKA 4ZOHC 2LYAA 2H3ZA 2Y1IA 4IQVA 2FPLA 4Y2TA 4UB3A 2XCAA 9ICLA 9ICHA 3SI8A 1DGJA 5EWGA 1TAMA 7ICTA 5AKHA 5DGAA 4QZDA 4PL2A 1JI7A 4EX6A 5J8YC 5ALGA 2ZJ8A 2DFLA 1BPXA 3PO4A 3SD7A 1NK8A 1MSWD 1TAQA 5AK4A 4F3OA 4ELUA 4NXZA 5J2EA 3V6HA 1N5XA 1LKYB 5AI0A 7ICGA 3D2QA 2E8MA 4B6JA 3UQ0A 4YMMA 3RJFA 3RH4A 1J2NA 4QW8A 4B9TA 4C7YA 1WYGA 4KMOB 3PZPA 2NRVA 2FE9A 5EWFA 2HBLA 5DB9A 3WKAA 3LVVA 2MUTB 4C4SA 4BWJA 1ZQWA 5DG8A 1VJ5A 2LPEA 5AI8A 2EAMA 9ICNA 3GFKB 3FDSA 5EE0A 3OJUA 2QB0B 4QWDA 4J9MA 2B21A 9ICBA 5CWRA 9ICSA 3C5GA 1SKRA 2G5IB 3RB4A 2VJ5A 4M47A 4EX7A 1S97A 4DWIA 4ED0A 4B9VA 4TUSA 2D6FC 2BZFA 4I2BA 3WU2U 1IM4A 4C4RA 5KFZA 9ICVA 5KFPA 3KZXA 3PX6A 5AIAA 1JRPA 3UXOA 4J9PA 5GTIU 4F4KA 2C2DA 4BUGA 5DB8A 4Q45A 3NVVA 1Q3UA 1ZQ1C 5F9NA 1SGGA 3SV4A 3TQ1A 2R18A 2V4RA 4DL4A 5AI4A 2G08A 2KE7A 2OM6A 5KFKA 2ATLA 5J0YA 4QZ8A 3GILA 2HW3A 5TZVA 4DSKA 4M9JA 3RR7A 2JRZA 5EE3A 4EEKA 1SL1A 5DDYA 4PHPA 1PVQA 2NRXA 1Z1VA 5KG2A 4KLIA 4DO9A 5AM1A 1NK9A 7ICRA 3N7PD 2C2RA 2ZIWA 3VCBA 3GZFA 1T3QA 1TE2A 4OJ6A 1C7YA 1B0XA 4M6WA 2HHTA 2H3IA 2IOFA 1BNOA 4DLEA 4PHAA 2F76X 4RQ6A 4F5PA 4PGQA 5CR0A 2VIXA 5KFHA 1O03A 4BWMA 1XO0A 4OO1J 5L1LA 4F5OA 2W9MA 1V9PA 1BPZA 4F2SA 1SKSA 1JN3A 4P0PA 4RZRA 4BJQA 1S76D 2VANA 2BCQA 2HHXA 2E1EA 2A1AA 5H2FU 2JH7A 1ZQIA 2JR5A 9ICKA 2ZG6A 3MFHA 4IRKA 1TK5A 4C8MA 2QB1A 1QQ7A 4OJLA 2EAOA 2JHDA 5J2KA 2ISOA 1UCVA 3M1YA 2KZ3A 5JUMA 1ZQTA 4CE6A 3UMBA 1DOQA 4KLDA 3QU9A 2KP7A 3DDHA 1KFSA 5F3XB 3MGHA 5L1IA 4MHVA 2EANA 5CA7A 2FI1A 1N48A 3NS1A 4E0DA 3TKAA 4RNMA 3WK6A 1Q8KA 3QEBZ 1SIJA 5AK5A 1KFDA 1V85A 2KVCA 2HOIA 1BPYA 4QZBA 2IOHA 2BR0A 2JMGA 5BPCA 2ASLA 1ZQBA 4IQTA 8ICSA 1X66A 5KFCA 2HI0A 1U9LA 5AI6A 1LVHA 5G5HA 3QX7A 2NRZA 2E1FA 2K8AA 4I2JA 2G0AA 5KFSA 3RB6A 4EYHB 1K5OA 1KTQA 2A19A 4DSJA 1KQQA 4DOAA 5KNIA 2ALZA 2EZYA 4OJPA 2XY7A 4MF8A 4RUCA 1NJYA 1U4BA 1ZOLA 2LYBA 4IR1A 3RB3A 8ICMA 3CNHA 3EWAA 3DV9A 4RPZA 1DK2A 4Y2JA 9ICTA 2HMXA 1XWLA 5IIOA 1YZ6A 3HILA 1L7PA 1QSYA 4Y2QA 2OEHA 4M9NA 9ICAA 2J6SA 1IG6A 3QUTA 1N62A 4QZGA 2KVSA 1PVRA 3QU5A 1S0OA 1HUOA 2KOBA 1T7PA 4I2IA 1Z4NA 5L1KA 3HWTA 3BQTA 4O5CA 5AK3A 3RF9A 3RJGA 1BNPA 2HHWA 2HHQA 2KJ9A 3RRGA 2HHSA 8ICLA 2BCVA 4O0IA 3H8WA 3MFIA 5HMMA 3V6KA 2MSNA 3WK5A 4IRCA 4BXOA 1JIHA 4RQMA 2G07A 4M04A 2BDUA 4M9GA 3QUQA 3MDCA 5J0PA 3L5KA 2ISPA 2F2AB 3PW2A 1B4FA 1H38A 7ICEA 3TADA 5KFMA 1UQVA 8ICFA 2DGZA 3F5AA 1J2MA 3K1ZA 2UVRA 1NK4A 2YMQA 8ICQA 3K4GA 2P35A 2N1RA 4KX5A 3WKBA 2V9WA 3IN5A 3HP6A 3OHAA 1D8BA 1N63A 1Y88A 4XRHA 2GH1A 3CRXA 4UBBA 3FC4A 4NLBA 4X5VA 1IV8A 5IINA 2FPMA 4ECRA 4Y2RA 4ECWA 1ZQHA 5DG7A 2K8BB 5B66U 4CDGA 3UMCA 4R8UB 2ZTEA 1Q46A 2UVUA 3IRUA 4DF8A 4Q43A 1RDFA 4P4PA 1ZQAA 1FEZA 4RQ4A 7ICMA 2UVWA 9ICEA 1BPEA 2W9BB 3E0FA 5CJ7A 2NRTA 2HDOA 3GU3A 2YX8A 4Z6EA 1JXLA 5IIKA 2F1JA 1S5LU 2MU2A 5J0QA 2KHVA 1NNLA 4QZ9A 1ZD2P 2AGPA 3C1YA 2D3DA 1L3UA 5KT3A 1N2XA 3QNMA 5FP0A 3BS5B 5KFLA 2AJQA 1F5SA 1CEZA 8ICHA 3B0YA 1U45A 2KKVA 1KSPA 3KKAC 5KFVA 3J81j 4TQRA 3OPXA 3PW4A 4UAVA 3E58A 4UB2A 4K4GA 1CI4A 4R64A 3EPIA 4B9MA 2RLTA 4M9LA 4DL7A 3MR5A 2PFNA 4EZ9A 3M9NB 1SV0C 2QARA 4QZCA 4C0ZA 1X42A 4I27A 5KL8B 5EOZA 4PHDA 1ZQDA 5ALKA 2YQEA 2R8GA 5ALYA 4EBEA 1X9XA 2WTFA 9ICJA 2HBKA 1TK0A 3C2MA 4M0AA 3MC1A 4Y2XA 5J29A 4NLKA 5J0TA 4NM2A 1ZQMA 4YP3A 1PK1B 1ZQKA 2ESEA 3ZDEA 2ZUBA 1L7NA 5IILA 4GLXA 3PY8A 4MFFA 4Y2SA 1DGSA 4OJOA 4U7CA 4RQ1A 3PR5B 5ALVA 1DK3A 1JXEA 5AKGA 1QSLA 3V7LA 1CUKA 2ASDA 2KD1A 4CGZA 1SXEA 5IIJA 5BOMA 1ZYQA 4EBCA 4J9KA 3RJHA 4J9NA 4DCCA 4UB5A 3TI0A 5ALIA 3RAXA 3QXGA 4QZFA 1XS9D 4KLOA 2HHVA 4NWIA 5KFJA 3HPOA 3Q8LA 4UB8U 4QWAA 3FYHA 3WKEA 5KFXA 2H3VA 3ZDCA 3HW8A 4F5QA 2HBMA 2Y9TA 4RU9A 3GIIA 1KBUA 2W3RA 5AKEA 4I29A 4EEYA 2VKQA 2YN4A 4Y2YA 3MBYA 5L9XA 2BQUA 5J8YA 2BHNA 2JEGA 3UXNA 5ALZA 1D8YA 3JPNA 4OD0A 5AKIA 4DSLA 5D46A 4PL1A 8ICGA 4DL2A 2PMZC 4FBTA 1KL9A 2LBOA 5KFIA 1FO4A 3AM9A 1UT8A 3GV8B 2BCUA 8ICEA 3KTQA 1BPDA 3IV6A 1UHUA 4KTQA 9ICOA 4F93B 3I76A 5KFNA 3KHHA 4I28A 1KEJA 4F92B 4ELVA 5AM5A 3M8RA 3Q8RB 2XI9A 3IP4B 5KT5A 2HOQA 7ICQA 4F5NA 1SB3C 2KEYA 4P0QB 2E8PA 3OHBA 3V7JA 4UARA 2IA6A 2DKXA 4YXMA 2JZBB 5HHHA 2GO7A 5J2JA 4DSFA 8ICXA 9ICPA 4DOCA 1S0NA 3SAFA 1GO3F 1BPBA 2R8JA 1J97A 1X6JA 3QU2A 4QZIA 2ZIUB 4DS5A 5AICA 2DUYA 2OCEA 3TFRA 8ICZA 3CW2C 4ED2A 3MR6A 2ZIXA 2W9CB 1NOMA 4JK1A 3ETRA 5AM2A 1X9SA 4FZLA 5AKZA 3PSIA 2KZMA 3IG5A 4JB3A 5KFQA 4JMUA 1SKWA 4BX9C 4M2YA 1SWVA 4Y2PA 2KMDA 2ZUCA 4GFJA 2PFPA 2K89A 5G5GA 3SAHA 3QU7A 3BQ2A 3K1RB 4RQ0A 3ALRA 3R9KA 3ORYA 1L3SA 2R8HA 4UB6U 3A0BU 2NO5A 3UPQA 5DKWA 3BQ1A 1YZ7A 4C80A 4JWNA 1RYUA 1QQ5A 1NKBA 9ICMA 1ZQQA 8ICWA 5KFRA 3D2NA 7ICIA 5HNKA 3QUCA 4KLHA 2H3FA 5HR6A 1LKYA 8ICCA 3WKCA 2KKPA 3C23A 2FLLA 4R63A 2P6UA 4NL9C 1ZQFA 2AGOA 2ZUDA 1U48A 1M6YA 3NRZA 3AQFA 5J0WA 3BZCA 4GIBA 3ZI4A 3OTQA 1SL2A 2QKQA 3N7RC 4DQPA 2NYVA 2KV2A 5DQHA 2FJ6A 2I5HA 3D6JA 3IG8A 4DLGA 4RT2A 4C7ZA 2MUTA 1NK6A 3KD3A 1PK3A 4I2GA 5KFFA 5AKXA 1EXNA 3F53A 1NI3A 2QB0A 5KFGA 3U26A 2AXTU 3C21A 4TURA 5ALEA 3HX0A 5ALHA 2E8OA 2E3TA 3RAQA 2IMWP 5J2FA 3M9OB 4ED7A 5KFOA 3N97B 3RH5A 5J2CA 3H4BA 4K4HA 4MF2A 2O6KA 4I2AA 3T5KA 4YR3A 3M9MB 4NLGA 1KKXA 1TFRA 2F8KA 3PSTA 3PMNA 4F72A 4J9SA 1VDVA 4Q8EA 2K60A 2AGQA 3QE9Y 2KFNA 2DF4B 3M8SA 1KN5A 2DBYA 4Z6FA 3GIMA 2BPFA 3T5HA 4FZNA 2Y1JA 1X9MA 2XCPA 1KW4A 4ACOA 5C5JA 1WUDA 2LI6A 5DLFA 4DFPA 8ICOA 3I28A 4RQ7A 5KFWA 3JPQA 4ED1A 2F1IA 7ICOA 1Z00B 3HKZF 3BQ7A 3HT3A 2HBJA 3CYMA 3O0FA 4EENA 4FO6A 1MQ2A 4KLTA 4YD1A 2F44A 4O3OA 5ALFA 3PV8A 5KG0A 2WB1F 3TARA 2JH1A 3HKZC 2WFAA 3OSPA 3GIKA 1KDHA 3OSNA 7ICJA 3AUOA 3LWMA 5D49A 1S10A 2E8NA 2A1JB 2DKZA 3T79A 1NZBA 2NV3A 3Q8MA 2WB1C 5DBBA 5AM3A 4NLZA 3V6JA 2Y9UA 4NJ8A 2KN7A 2C22A 3JPTA 2ZJ5A 9ICRA 2LKYA 2FLPA 2MAXA 4DFKA 1L3TA 5KAIU 4US8A 3EUB2 5HMLA 5EE1A 1MQ3A 2WF5A 2B6GA 5CP2A 3DEEA 5KG5A 2W03A 1XSLA 1COKA 2A3VA 4JV1A 3GV5B 2GLEA 4C8KA 5E79U 2JEIA 8ICUA 1WWUA 3ONNA 4O3QA 2W11A 1ZD4A 4DFMA 3SMVA 5L1JA 3AN1A 4IRDA 3QU4A 4GXJA 5ALPA 1BGXT 3JPSA 2HOFA 4DQRA 8ICKA 4Q44A 1X40A 1L7OA 5IIIA 2RDJA 1DRGA 3HJEA 4FZMA 1OUQA 5C0YA 5DDMA 3ISBA 4RQ5A 8ICRA 1TAUA 4BGDA 4DQSA 2YB1A 3T5LA 1QLNA 1OXJA 5K4LA 2D8CA 5KG7A 1L7MA 8ICBA 3ETLA 3Q8QB 1JUDA 5AK6A 4I2CA 3MDAA 4ECQA 4PHEA 4PPXA 4WJ3B 5GTHU 3GV7B 2P66A 4P4MA 2ZTCA 4KN7A 2QARB 4GXKA 8ICTA 2F3NA 5CHGA 4Q8FA 2EZZA 2JV3A 3G6VA 2HCFA 4ED8A 4QZHA 1NJZA 1SZHA 2BCSA 5ALTA 3FM9A 5AKJA 3C28A 5KFUA 3EZ5A 4I2DA 4R66A 3SZ2A 2BQ3A 3KKAA 3H40A 4DL6A 4O3MA 3LWLA 5L1MA 1Z4OA 3ZDDA 4YMOA 4G3IA 3F2CA 4I2EA 4B9LA 1S9FA 1AROP 4DEZA 3TAPA 1ZQRA 5KFYA 4QIWC 4YN4A 4FBUA 4NY8A 1SV0A 1DXSA 5CEHA 4EYIB 5HP4A 4YCXA 3EPGA 4I2FA 5JU5A 2Y0SF 4KX3A 1XSNA 1WWVA 3NVYA 4LVSA 4UB1A 4UAZA 5KT7A 9ICUA 1L8OA 4UQGA 9ICWA 3NRWA 4CF3A 4C8LA 3ISCA 1TVAA 2WHEA 2ZIVB 2XY5A 2ES6A 3LVWA 1Q3VA 1O08A 4UASA 2FLNA 4JUZA 2Y0SC 2LM4A 2QLTA 3KZIU 1ZQXA 1ZQLA 2RQ5A 5ALXA 5J0RA 1UPHA 4C8NA 3GQCA 2LMRA 4PH5A 4EZ6A 1ZQGA 2BQRA 1ECWA 4IC9A 1SXDA 2R8KA 3S6JA 3G6YA 3PR4A 2WAQC 5CRXA 4YVZA 1FFVA 2ZXIA 4RNNA 4YR2A 3N28A 2XGPA 2HVIA 4LZGA 3VC8A 1UT5A 2PXIA 4QNLA 5DGBA 2KG5A 1JX4A 1N61A 3H4DA 2AU0A 1ZXIA 5ALSA 4YFKA 1SWWA 3SV3A 1QTMA 2VA2A 1NKEA 3QUBA 3WK9A 2AHOB 2PI5A 1RQNA 7ICKA 4ICAA 5AKYA 1BVSA 3I1YA 5ALLA 4KLFA 4OCZA 3ICXA 1D8LA 3ZDAA 1F44A 2PFQA 4O3NA 5EWEA 2LHTA 3AU2A 3KFUF 3T3FA 2UVVA 4MFCA 2OHFA 3BS5A 2OYYA 2KZZA 5ALJA 3QZ8A 4YQWA 3H8SA 2M0NA 5ALWA 3NUQA 2J6TA 5CB1A 2FDRA 3AL0B 2Q4TA 3RTVA 2DPJA 4DFJA 1X9WA 4LZDA 3KHGA 3UMGA 5DBCA 4YMNA 2PMZF 4O3PA 2RRDA 3NVWA 3PNCA 5JRTA 1T8EA 2HHUA 3SEIA 3NASA 2BKEA 3RBDA 1HIWA 5J0SA 3BS7A 4RQNA 5J0XA 2F1HA 2OH2A 2JGAA 5AI9A 1QQ6A 1N56A 2C2EA 1T4GA 2YTUA 5HR7A 1ZQZA 1QH9A 2RP5A 4UW9A 2YY6A 5KFTA 1XO1A 1UA1A 4MEYA 2WF9A 9ICFA 2LM1A 3RJEA 1PK1A 1XU4A 5TISU 1L6NA 3TANA 2JXJA 4KN4A 3AEVA 3G6XA 4M9HA 4F4XA 2WF7A 3PW7A 4YR0A 4RNOA 5J2BA 1RZTA 5T14A 3RJKA 1V38A 3H0MB 2YMMA 2XICA 1L5UA 5J2IA 1U47A 1JALA 4J9QA 3T5JA 3C5FA 1HJPA 3UM9A 2NRWA 2JEFA 4UAYA 4KLJA 7ICFA 2I9GA 3MGIA 3H0RB 2ZIWB 3RBEA 1NK7A 8ICYA 5KG1A 5HHIA 4F50A 4IQWA 2WF8A 4M6WB 1VLBA 1SZPA 1ZQYA 2EQYA 4LJXA 3H0LB 1ZQPA 4KLGA 5KFEA 2KSOA 4PZOA 2GWSA 2BCRA 3UXPA 2V4QA 2MA1A 4A8EA 1PVPA 2BPGA 4C4TA 4YD2A 5AM4A 4DSEA 2W3SA 2ZXHA 3N7SC 5EE9A 4B9SA 5BOLA 4P0PB 1V97A 3PO5A 4EBDA 5ALQA 3HRDD 1PUZA 1ZQNA 5DQIA 4DQIA 5B5EU 2XVTA 4GXIA 2XO7A 2YMLA 5KG6A 1LB2B 4J9RA 1RG6A 3RFAA 2KFZA 2FPKA 4NL9A 1SV4A 2W8LA 1NK0A 4ELTA 3LDAA 2XGQA 5AI5A 2IHMA 1WG8A 4UATA 3D2SA 4DFDA 8ICJA 4O5EA 2F8LA 1ZQJA 9ICXA 3KBBA 4ECUA 3M6ZA 2EAPA 5IIMA 4P0QA 2AQ0A 4PJ0U 9ICIA 4J9OA
chains in the Genus database with same CATH topology
4IQVA 4UB3A 3B0YA 3JPOA 1MQ3A 8ICHA 9ICLA 9ICHA 7ICTA 4KLUA 1XSLA 4QZDA 4UB2A 4K4GA 4R64A 4M9LA 1BPXA 2PFNA 4RPXA 4JWMA 8ICUA 4QZCA 4NXZA 9ICRA 5J2EA 4I27A 5EOZA 4PHDA 1ZQDA 7ICGA 4GXJA 3UQ0A 3JPSA 4YMMA 3RJFA 3RH4A 4TUPA 8ICKA 3JPRA 5IIIA 3RJJA 9ICJA 7ICLA 3ISBA 4RQ5A 8ICRA 3C2MA 4M0AA 5DB9A 4UB4A 5J29A 4QZAA 4NLKA 4F5RA 5J0TA 4NM2A 1ZQMA 9ICNA 1ZQKA 8ICBA 9ICGA 5IILA 4I2CA 5J2GA 3MDAA 4MFFA 4PHEA 9ICBA 4PPXA 5CWRA 4RQ1A 9ICSA 4IQUA 3C5GA 3AU6A 1DK3A 4M47A 4KLEA 3RH6A 2P66A 3V7LA 4TUSA 4GXKA 8ICTA 5IIJA 4I2BA 5BOMA 4PGXA 9ICVA 3RJHA 4QZHA 4UB5A 4DOBA 3C2LA 4Z6CA 3V7KA 3UXOA 2BCSA 4QZFA 4NM1A 4KLOA 4R65A 5DB8A 3HW8A 4F5QA 4O5KA 4I2DA 1XSPA 4R66A 4KLMA 4RQ3A 7ICPA 5J0YA 4QZ8A 5TZVA 3OGUA 4I29A 4M9JA 4YMOA 4I2EA 3MBYA 8ICAA 3UQ2A 4NLNA 3UXNA 1ZQRA 5DDYA 4PHPA 8ICVA 4YN4A 4DO9A 4KLIA 4NY8A 3JPNA 2FMSA 7ICRA 4YCXA 5J0UA 4I2FA 5D46A 8ICGA 4RQ2A 1XSNA 1ZJMA 4LVSA 7ICUA 4UB1A 4UAZA 9ICUA 2BCUA 8ICEA 9ICWA 1BNOA 5DB6A 4PHAA 1BPDA 3ISCA 1TVAA 4RQ6A 4F5PA 4PGQA 9ICOA 3PMLA 1NZPA 4I28A 1ZQSA 1KEJA 4KLSA 5DB7A 4RQ8A 4F5OA 2W9MA 1BPZA 1ZQLA 3TFSA 3B0XA 5J0RA 2BCQA 2FMQA 7ICQA 4F5NA 4MFAA 4PH5A 3V7JA 1ZQIA 1ZQGA 9ICKA 5HHHA 5J2JA 8ICXA 9ICPA 5J2KA 2ISOA 4DOCA 1ZQTA 4KLDA 4LZGA 2KP7A 3MGHA 4QZIA 2PXIA 3TFRA 8ICZA 2PFOA 1ZQEA 8ICPA 7ICKA 5J2AA 1BPYA 8ICNA 4QZBA 4KLFA 5BPCA 1ZQBA 4M2YA 4IQTA 4O9MA 8ICSA 2PFQA 3AU2A 4MFCA 2PFPA 7ICSA 4I2JA 5J0OA 4RQ0A 5CB1A 4TUQA 4DOAA 3UPQA 4MF8A 5DKWA 4JWNA 1ZJNA 3C2KA 4LZDA 5DBCA 9ICMA 1ZQQA 8ICWA 4PGYA 4YMNA 5J2DA 7ICIA 8ICMA 3PNCA 4KLHA 4KLLA 4RPZA 8ICCA 1DK2A 4Z6DA 4R63A 9ICTA 5J0SA 5J0XA 5IIOA 1ZQFA 5J0WA 4M9NA 9ICAA 1ZQOA 4I2HA 1TV9A 4RT3A 4QZGA 4RT2A 9ICFA 1HUOA 5D4BA 4I2IA 3RJEA 4I2GA 1HUZA 3HWTA 4O5CA 4XUSA 3V72A 1BNPA 3RJGA 4M9HA 4TURA 5J2BA 3HX0A 1RZTA 3RJKA 8ICLA 2BCVA 5J2FA 5J2IA 3C5FA 3RH5A 5J2CA 4K4HA 3RJIA 4MF2A 4UBCA 1JMSA 4M9GA 4UAYA 3MDCA 4I2AA 5J0PA 4KLJA 4M04A 7ICFA 2ISPA 2I9GA 3MGIA 8ICYA 3PMNA 5HHIA 4P2HA 7ICEA 4IQWA 8ICFA 2FMPA 1ZQCA 3LK9A 4XA5A 9ICCA 1ZQPA 4KLGA 2GWSA 8ICQA 2BCRA 3UXPA 4Z6FA 2BPGA 2BPFA 4YD2A 9ICQA 5BOLA 5DBAA 4K4IA 4UBBA 8ICOA 1ZQNA 4RQ7A 4X5VA 7ICNA 4RPYA 3JPQA 5IINA 5J2HA 4GXIA 7ICOA 3ISDA 1ZQHA 3GDXA 4QZEA 4FO6A 1MQ2A 8ICIA 4KLTA 4YD1A 7ICVA 1ZQAA 4RQ4A 7ICMA 2IHMA 9ICEA 7ICHA 1BPEA 8ICJA 1KDHA 4O5EA 7ICJA 3AUOA 1ZQJA 5D49A 3JPPA 4KLQA 4Z6EA 4UAWA 5IIKA 9ICXA 5DBBA 5IIMA 4NLZA 5J0QA 4QZ9A 3JPTA 9ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQV A;  4UB3 A;  3B0Y A;  3JPO A;  1MQ3 A;  8ICH A;  9ICL A;  9ICH A;  7ICT A;  4KLU A;  1XSL A;  4QZD A;  4UB2 A;  4K4G A;  4R64 A;  4M9L A;  1BPX A;  2PFN A;  4RPX A;  4JWM A;  8ICU A;  4QZC A;  4NXZ A;  9ICR A;  5J2E A;  4I27 A;  5EOZ A;  4PHD A;  1ZQD A;  7ICG A;  4GXJ A;  3UQ0 A;  3JPS A;  4YMM A;  3RJF A;  3RH4 A;  4TUP A;  8ICK A;  3JPR A;  5III A;  3RJJ A;  9ICJ A;  7ICL A;  3ISB A;  4RQ5 A;  8ICR A;  3C2M A;  4M0A A;  5DB9 A;  4UB4 A;  5J29 A;  4QZA A;  4NLK A;  4F5R A;  5J0T A;  4NM2 A;  1ZQM A;  9ICN A;  1ZQK A;  8ICB A;  9ICG A;  5IIL A;  4I2C A;  5J2G A;  3MDA A;  4MFF A;  4PHE A;  9ICB A;  4PPX A;  5CWR A;  4RQ1 A;  9ICS A;  4IQU A;  3C5G A;  3AU6 A;  1DK3 A;  4M47 A;  4KLE A;  3RH6 A;  2P66 A;  3V7L A;  4TUS A;  4GXK A;  8ICT A;  5IIJ A;  4I2B A;  5BOM A;  4PGX A;  9ICV A;  3RJH A;  4QZH A;  4UB5 A;  4DOB A;  3C2L A;  4Z6C A;  3V7K A;  3UXO A;  2BCS A;  4QZF A;  4NM1 A;  4KLO A;  4R65 A;  5DB8 A;  3HW8 A;  4F5Q A;  4O5K A;  4I2D A;  1XSP A;  4R66 A;  4KLM A;  4RQ3 A;  7ICP A;  5J0Y A;  4QZ8 A;  5TZV A;  3OGU A;  4I29 A;  4M9J A;  4YMO A;  4I2E A;  3MBY A;  8ICA A;  3UQ2 A;  4NLN A;  3UXN A;  1ZQR A;  5DDY A;  4PHP A;  8ICV A;  4YN4 A;  4DO9 A;  4KLI A;  4NY8 A;  3JPN A;  2FMS A;  7ICR A;  4YCX A;  5J0U A;  4I2F A;  5D46 A;  8ICG A;  4RQ2 A;  1XSN A;  1ZJM A;  4LVS A;  7ICU A;  4UB1 A;  4UAZ A;  9ICU A;  2BCU A;  8ICE A;  9ICW A;  1BNO A;  5DB6 A;  4PHA A;  1BPD A;  3ISC A;  1TVA A;  4RQ6 A;  4F5P A;  4PGQ A;  9ICO A;  3PML A;  1NZP A;  4I28 A;  1ZQS A;  1KEJ A;  4KLS A;  5DB7 A;  4RQ8 A;  4F5O A;  2W9M A;  1BPZ A;  1ZQL A;  3TFS A;  3B0X A;  5J0R A;  2BCQ A;  2FMQ A;  7ICQ A;  4F5N A;  4MFA A;  4PH5 A;  3V7J A;  1ZQI A;  1ZQG A;  9ICK A;  5HHH A;  5J2J A;  8ICX A;  9ICP A;  5J2K A;  2ISO A;  4DOC A;  1ZQT A;  4KLD A;  4LZG A;  2KP7 A;  3MGH A;  4QZI A;  2PXI A;  3TFR A;  8ICZ A;  2PFO A;  1ZQE A;  8ICP A;  7ICK A;  5J2A A;  1BPY A;  8ICN A;  4QZB A;  4KLF A;  5BPC A;  1ZQB A;  4M2Y A;  4IQT A;  4O9M A;  8ICS A;  2PFQ A;  3AU2 A;  4MFC A;  2PFP A;  7ICS A;  4I2J A;  5J0O A;  4RQ0 A;  5CB1 A;  4TUQ A;  4DOA A;  3UPQ A;  4MF8 A;  5DKW A;  4JWN A;  1ZJN A;  3C2K A;  4LZD A;  5DBC A;  9ICM A;  1ZQQ A;  8ICW A;  4PGY A;  4YMN A;  5J2D A;  7ICI A;  8ICM A;  3PNC A;  4KLH A;  4KLL A;  4RPZ A;  8ICC A;  1DK2 A;  4Z6D A;  4R63 A;  9ICT A;  5J0S A;  5J0X A;  5IIO A;  1ZQF A;  5J0W A;  4M9N A;  9ICA A;  1ZQO A;  4I2H A;  1TV9 A;  4RT3 A;  4QZG A;  4RT2 A;  9ICF A;  1HUO A;  5D4B A;  4I2I A;  3RJE A;  4I2G A;  1HUZ A;  3HWT A;  4O5C A;  4XUS A;  3V72 A;  1BNP A;  3RJG A;  4M9H A;  4TUR A;  5J2B A;  3HX0 A;  1RZT A;  3RJK A;  8ICL A;  2BCV A;  5J2F A;  5J2I A;  3C5F A;  3RH5 A;  5J2C A;  4K4H A;  3RJI A;  4MF2 A;  4UBC A;  1JMS A;  4M9G A;  4UAY A;  3MDC A;  4I2A A;  5J0P A;  4KLJ A;  4M04 A;  7ICF A;  2ISP A;  2I9G A;  3MGI A;  8ICY A;  3PMN A;  5HHI A;  4P2H A;  7ICE A;  4IQW A;  8ICF A;  2FMP A;  1ZQC A;  3LK9 A;  4XA5 A;  9ICC A;  1ZQP A;  4KLG A;  2GWS A;  8ICQ A;  2BCR A;  3UXP A;  4Z6F A;  2BPG A;  2BPF A;  4YD2 A;  9ICQ A;  5BOL A;  5DBA A;  4K4I A;  4UBB A;  8ICO A;  1ZQN A;  4RQ7 A;  4X5V A;  7ICN A;  4RPY A;  3JPQ A;  5IIN A;  5J2H A;  4GXI A;  7ICO A;  3ISD A;  1ZQH A;  3GDX A;  4QZE A;  4FO6 A;  1MQ2 A;  8ICI A;  4KLT A;  4YD1 A;  7ICV A;  1ZQA A;  4RQ4 A;  7ICM A;  2IHM A;  9ICE A;  7ICH A;  1BPE A;  8ICJ A;  1KDH A;  4O5E A;  7ICJ A;  3AUO A;  1ZQJ A;  5D49 A;  3JPP A;  4KLQ A;  4Z6E A;  4UAW A;  5IIK A;  9ICX A;  5DBB A;  5IIM A;  4NLZ A;  5J0Q A;  4QZ9 A;  3JPT A;  9ICI A; 
#chains in the Genus database with same CATH topology
 4F2R A;  4ED6 A;  2JZB A;  4RUA A;  2YB4 A;  2OWO A;  3CP8 A;  4HYK A;  5AKL A;  4C8O A;  4JV2 A;  1A77 A;  3JPO A;  1RPL A;  1URJ A;  2W04 A;  1F0M A;  2I1Q A;  1ED1 A;  2ZIU A;  4KLU A;  4KMU A;  5KG4 A;  2Q0Z X;  3F2B A;  2XC9 A;  2BGW A;  1C20 A;  2W9C A;  3QYP A;  1S8O A;  4RPX A;  4FFD A;  1RXV A;  4JWM A;  3LYS A;  3C1Z A;  3E2E A;  3MGV A;  3NGD A;  2GOL A;  3RB0 A;  4ECZ A;  2Z7J A;  2H5X A;  1QSS A;  2IOF K;  1Z19 A;  2KTQ A;  3KHL A;  4TUP A;  3JPR A;  2DQN B;  3RJJ A;  7ICL A;  1NJX A;  2B0C A;  3WK8 A;  2KJ8 A;  1YT3 A;  1TK8 A;  4UB4 A;  4QZA A;  4F5R A;  5DG9 A;  5KT2 A;  2P6R A;  2KIC A;  9ICG A;  5J2G A;  3SYZ A;  5AM0 A;  2KNJ A;  4ECX A;  4YG2 A;  1NK5 A;  4QWE A;  4F8R A;  2W7P A;  1A76 A;  4IQU A;  1ZD5 A;  3AU6 A;  4DF4 A;  4KLE A;  3QZ7 A;  3RH6 A;  2K8C B;  4IS7 A;  4BXO B;  2ODG A;  1A6S A;  4PGX A;  4HAI A;  3WK7 A;  3BJY A;  3H8J A;  1TKD A;  3BQ0 A;  2DPI A;  1X2I A;  1NKC A;  1IXR A;  4DOB A;  4JV0 A;  4Z6C A;  3C2L A;  3M6K A;  3V7K A;  3SR6 A;  1NJW A;  4XQ8 A;  2W7O A;  4NM1 A;  2BPC A;  3K75 D;  4R65 A;  3PX4 A;  2M9N A;  2CN1 A;  3IDW A;  3TAQ A;  5KAF U;  4O5K A;  4QWB A;  4DL3 A;  1XSP A;  2E5S A;  4KLM A;  3L4P A;  4RQ3 A;  4ECY A;  2W55 A;  7ICP A;  2EZX A;  5DQG A;  2VA3 A;  3IM1 A;  3OGU A;  4AP9 A;  4DL5 A;  3L3F X;  1ZET A;  8ICA A;  1JRO A;  1L3V A;  3EYZ A;  1KRP A;  3UQ2 A;  5ALN A;  4NLN A;  1L8L A;  2KK0 A;  4USA A;  8ICV A;  1COO A;  2FMS A;  2WF6 A;  5J0U A;  3AQE A;  5KFA A;  4NLC A;  3ZD9 A;  4RQ2 A;  4F71 A;  4KIT B;  2XY6 A;  2IHN A;  2DWQ A;  1ZJM A;  3TAC B;  7ICU A;  1ZRN A;  1PZN A;  5A0L A;  5DB6 A;  1S0V A;  3A0H U;  3BDP A;  2DL0 A;  4PZN A;  3PW5 A;  4CF5 A;  5KG3 A;  1RM6 C;  2K4P A;  2AQ4 A;  3WK4 A;  2ZJA A;  3PML A;  4B9N A;  1NZP A;  1B22 A;  1ZQS A;  4KLS A;  5DB7 A;  4RQ8 A;  4FS2 A;  3TFS A;  2VJ4 A;  2K4E A;  3RRH A;  3B0X A;  3MR2 A;  1XNS A;  3EW9 A;  2FMQ A;  4MFA A;  2I6X A;  1A0P A;  5F9L A;  5KFD A;  4DSI A;  3F2D A;  1Z00 A;  2W9A A;  1KLN A;  2HSZ A;  2KHQ A;  5ALM A;  4F91 B;  3PVX A;  4ED3 A;  2EDU A;  4TQS A;  4B9U A;  3H7I A;  2BDP A;  2CPR A;  5DLG A;  4CRX A;  1S77 D;  1U49 A;  2R8I A;  4F4Z A;  2PFO A;  1ZD3 A;  1ZQE A;  3PX0 A;  2PKE A;  1QCK A;  5KT6 A;  1UA0 A;  8ICP A;  4F4W A;  4IL6 U;  5AIB A;  5J2A A;  1ZQU A;  2KIW A;  2A1J A;  8ICN A;  3IHQ B;  4BDP A;  3TAD C;  2PI4 A;  3ZDB A;  5KL1 B;  4O9M A;  2G09 A;  4GC6 A;  1ZQV A;  7ICS A;  5KFB A;  3ED5 A;  5J0O A;  2HVH A;  2YMP A;  4ECT A;  3F5E A;  3RR8 A;  3Q8P B;  2VA8 A;  4TUQ A;  2G5H B;  2C28 A;  5ALO A;  4QIW F;  1IIP A;  4ZH4 A;  2W8K A;  4IR9 A;  1RXW A;  2F77 X;  1ZJN A;  3C2K A;  4MEX A;  1RYS A;  4PGY A;  5J2D A;  5KTQ A;  4UAU A;  4KLL A;  1ZRM A;  3SEN A;  3MAB A;  4Z6D A;  1K1Q A;  4OJ5 A;  1CRX A;  1S0M A;  3B9J A;  4J03 A;  4U6P A;  5ALR A;  1ZQO A;  1MA7 A;  4I2H A;  1TV9 A;  2MRL A;  4CF4 A;  4RT3 A;  4DQQ A;  1T94 A;  4G9B A;  5D4B A;  4O3S A;  2J6U A;  2H3Q A;  1P7D A;  2IBK A;  1HUZ A;  1FFU A;  3KOO A;  3PW0 A;  4AYB F;  2WAQ F;  4XUS A;  3V72 A;  3H8M A;  1X6I A;  5KT4 A;  2EH9 A;  3ZD8 A;  4J9L A;  4FS1 A;  2ZTD A;  3SQI A;  2AH5 A;  1K1S A;  3KHR A;  3PSF A;  1Z3E B;  2OXO A;  4AYB C;  4F4Y A;  3RJI A;  1T3N A;  4UBC A;  1JMS A;  2G06 A;  2W54 A;  4QW9 A;  4R8U A;  1FIQ A;  5AHX A;  1HEK A;  3NVZ A;  4P2H A;  3WKD A;  1D9F A;  1KFT A;  3THV A;  3QEA Z;  4QWC A;  2FMP A;  4CCH A;  5JTI A;  3LK9 A;  1ZQC A;  4XA5 A;  9ICC A;  2JEJ A;  2W9B A;  4Y2V A;  1N60 A;  2K4I A;  1RQL A;  2L5Y A;  2KJ5 A;  9ICQ A;  1MC8 A;  1AQ6 A;  3MR3 A;  5DBA A;  3FAH A;  4K4I A;  1WCN A;  2CRX A;  1SL0 A;  3BZK A;  3Q8K A;  4CNQ A;  4DS4 A;  7ICN A;  4RPY A;  1N5W A;  5J2H A;  3OJS A;  3ISD A;  1Z1B A;  1B43 A;  5ALD A;  3NTU A;  3Q8S B;  2CXY A;  3GDX A;  4QZE A;  2XID A;  1LV5 A;  1D9D A;  8ICI A;  2KIV A;  7ICV A;  4GC7 A;  5ALU A;  2ZIV A;  4ECV A;  4FE3 A;  1XC9 A;  2RHF A;  4US9 A;  7ICH A;  3SAG A;  2ZIX B;  3AMZ A;  2KSO B;  2RDI A;  3C29 A;  4O3R A;  3M7D A;  1WCL A;  4YXJ A;  3GIJ A;  1MN8 A;  2LYH A;  4EEL A;  3JPP A;  4KLQ A;  4UAW A;  4NV0 A;  2NO4 A;  1OW5 A;  4P4O A;  2W43 A;  2ASJ A;  4QJF B;  4ECS A;  2K4H A;  1RYR A;  4Y2U A;  3PSP A;  3N4M B;  5AKK A;  4ZOH C;  2LYA A;  2H3Z A;  2Y1I A;  4IQV A;  2FPL A;  4Y2T A;  4UB3 A;  2XCA A;  9ICL A;  9ICH A;  3SI8 A;  1DGJ A;  5EWG A;  1TAM A;  7ICT A;  5AKH A;  5DGA A;  4QZD A;  4PL2 A;  1JI7 A;  4EX6 A;  5J8Y C;  5ALG A;  2ZJ8 A;  2DFL A;  1BPX A;  3PO4 A;  3SD7 A;  1NK8 A;  1MSW D;  1TAQ A;  5AK4 A;  4F3O A;  4ELU A;  4NXZ A;  5J2E A;  3V6H A;  1N5X A;  1LKY B;  5AI0 A;  7ICG A;  3D2Q A;  2E8M A;  4B6J A;  3UQ0 A;  4YMM A;  3RJF A;  3RH4 A;  1J2N A;  4QW8 A;  4B9T A;  4C7Y A;  1WYG A;  4KMO B;  3PZP A;  2NRV A;  2FE9 A;  5EWF A;  2HBL A;  5DB9 A;  3WKA A;  3LVV A;  2MUT B;  4C4S A;  4BWJ A;  1ZQW A;  5DG8 A;  1VJ5 A;  2LPE A;  5AI8 A;  2EAM A;  9ICN A;  3GFK B;  3FDS A;  5EE0 A;  3OJU A;  2QB0 B;  4QWD A;  4J9M A;  2B21 A;  9ICB A;  5CWR A;  9ICS A;  3C5G A;  1SKR A;  2G5I B;  3RB4 A;  2VJ5 A;  4M47 A;  4EX7 A;  1S97 A;  4DWI A;  4ED0 A;  4B9V A;  4TUS A;  2D6F C;  2BZF A;  4I2B A;  3WU2 U;  1IM4 A;  4C4R A;  5KFZ A;  9ICV A;  5KFP A;  3KZX A;  3PX6 A;  5AIA A;  1JRP A;  3UXO A;  4J9P A;  5GTI U;  4F4K A;  2C2D A;  4BUG A;  5DB8 A;  4Q45 A;  3NVV A;  1Q3U A;  1ZQ1 C;  5F9N A;  1SGG A;  3SV4 A;  3TQ1 A;  2R18 A;  2V4R A;  4DL4 A;  5AI4 A;  2G08 A;  2KE7 A;  2OM6 A;  5KFK A;  2ATL A;  5J0Y A;  4QZ8 A;  3GIL A;  2HW3 A;  5TZV A;  4DSK A;  4M9J A;  3RR7 A;  2JRZ A;  5EE3 A;  4EEK A;  1SL1 A;  5DDY A;  4PHP A;  1PVQ A;  2NRX A;  1Z1V A;  5KG2 A;  4KLI A;  4DO9 A;  5AM1 A;  1NK9 A;  7ICR A;  3N7P D;  2C2R A;  2ZIW A;  3VCB A;  3GZF A;  1T3Q A;  1TE2 A;  4OJ6 A;  1C7Y A;  1B0X A;  4M6W A;  2HHT A;  2H3I A;  2IOF A;  1BNO A;  4DLE A;  4PHA A;  2F76 X;  4RQ6 A;  4F5P A;  4PGQ A;  5CR0 A;  2VIX A;  5KFH A;  1O03 A;  4BWM A;  1XO0 A;  4OO1 J;  5L1L A;  4F5O A;  2W9M A;  1V9P A;  1BPZ A;  4F2S A;  1SKS A;  1JN3 A;  4P0P A;  4RZR A;  4BJQ A;  1S76 D;  2VAN A;  2BCQ A;  2HHX A;  2E1E A;  2A1A A;  5H2F U;  2JH7 A;  1ZQI A;  2JR5 A;  9ICK A;  2ZG6 A;  3MFH A;  4IRK A;  1TK5 A;  4C8M A;  2QB1 A;  1QQ7 A;  4OJL A;  2EAO A;  2JHD A;  5J2K A;  2ISO A;  1UCV A;  3M1Y A;  2KZ3 A;  5JUM A;  1ZQT A;  4CE6 A;  3UMB A;  1DOQ A;  4KLD A;  3QU9 A;  2KP7 A;  3DDH A;  1KFS A;  5F3X B;  3MGH A;  5L1I A;  4MHV A;  2EAN A;  5CA7 A;  2FI1 A;  1N48 A;  3NS1 A;  4E0D A;  3TKA A;  4RNM A;  3WK6 A;  1Q8K A;  3QEB Z;  1SIJ A;  5AK5 A;  1KFD A;  1V85 A;  2KVC A;  2HOI A;  1BPY A;  4QZB A;  2IOH A;  2BR0 A;  2JMG A;  5BPC A;  2ASL A;  1ZQB A;  4IQT A;  8ICS A;  1X66 A;  5KFC A;  2HI0 A;  1U9L A;  5AI6 A;  1LVH A;  5G5H A;  3QX7 A;  2NRZ A;  2E1F A;  2K8A A;  4I2J A;  2G0A A;  5KFS A;  3RB6 A;  4EYH B;  1K5O A;  1KTQ A;  2A19 A;  4DSJ A;  1KQQ A;  4DOA A;  5KNI A;  2ALZ A;  2EZY A;  4OJP A;  2XY7 A;  4MF8 A;  4RUC A;  1NJY A;  1U4B A;  1ZOL A;  2LYB A;  4IR1 A;  3RB3 A;  8ICM A;  3CNH A;  3EWA A;  3DV9 A;  4RPZ A;  1DK2 A;  4Y2J A;  9ICT A;  2HMX A;  1XWL A;  5IIO A;  1YZ6 A;  3HIL A;  1L7P A;  1QSY A;  4Y2Q A;  2OEH A;  4M9N A;  9ICA A;  2J6S A;  1IG6 A;  3QUT A;  1N62 A;  4QZG A;  2KVS A;  1PVR A;  3QU5 A;  1S0O A;  1HUO A;  2KOB A;  1T7P A;  4I2I A;  1Z4N A;  5L1K A;  3HWT A;  3BQT A;  4O5C A;  5AK3 A;  3RF9 A;  3RJG A;  1BNP A;  2HHW A;  2HHQ A;  2KJ9 A;  3RRG A;  2HHS A;  8ICL A;  2BCV A;  4O0I A;  3H8W A;  3MFI A;  5HMM A;  3V6K A;  2MSN A;  3WK5 A;  4IRC A;  4BXO A;  1JIH A;  4RQM A;  2G07 A;  4M04 A;  2BDU A;  4M9G A;  3QUQ A;  3MDC A;  5J0P A;  3L5K A;  2ISP A;  2F2A B;  3PW2 A;  1B4F A;  1H38 A;  7ICE A;  3TAD A;  5KFM A;  1UQV A;  8ICF A;  2DGZ A;  3F5A A;  1J2M A;  3K1Z A;  2UVR A;  1NK4 A;  2YMQ A;  8ICQ A;  3K4G A;  2P35 A;  2N1R A;  4KX5 A;  3WKB A;  2V9W A;  3IN5 A;  3HP6 A;  3OHA A;  1D8B A;  1N63 A;  1Y88 A;  4XRH A;  2GH1 A;  3CRX A;  4UBB A;  3FC4 A;  4NLB A;  4X5V A;  1IV8 A;  5IIN A;  2FPM A;  4ECR A;  4Y2R A;  4ECW A;  1ZQH A;  5DG7 A;  2K8B B;  5B66 U;  4CDG A;  3UMC A;  4R8U B;  2ZTE A;  1Q46 A;  2UVU A;  3IRU A;  4DF8 A;  4Q43 A;  1RDF A;  4P4P A;  1ZQA A;  1FEZ A;  4RQ4 A;  7ICM A;  2UVW A;  9ICE A;  1BPE A;  2W9B B;  3E0F A;  5CJ7 A;  2NRT A;  2HDO A;  3GU3 A;  2YX8 A;  4Z6E A;  1JXL A;  5IIK A;  2F1J A;  1S5L U;  2MU2 A;  5J0Q A;  2KHV A;  1NNL A;  4QZ9 A;  1ZD2 P;  2AGP A;  3C1Y A;  2D3D A;  1L3U A;  5KT3 A;  1N2X A;  3QNM A;  5FP0 A;  3BS5 B;  5KFL A;  2AJQ A;  1F5S A;  1CEZ A;  8ICH A;  3B0Y A;  1U45 A;  2KKV A;  1KSP A;  3KKA C;  5KFV A;  3J81 j;  4TQR A;  3OPX A;  3PW4 A;  4UAV A;  3E58 A;  4UB2 A;  4K4G A;  1CI4 A;  4R64 A;  3EPI A;  4B9M A;  2RLT A;  4M9L A;  4DL7 A;  3MR5 A;  2PFN A;  4EZ9 A;  3M9N B;  1SV0 C;  2QAR A;  4QZC A;  4C0Z A;  1X42 A;  4I27 A;  5KL8 B;  5EOZ A;  4PHD A;  1ZQD A;  5ALK A;  2YQE A;  2R8G A;  5ALY A;  4EBE A;  1X9X A;  2WTF A;  9ICJ A;  2HBK A;  1TK0 A;  3C2M A;  4M0A A;  3MC1 A;  4Y2X A;  5J29 A;  4NLK A;  5J0T A;  4NM2 A;  1ZQM A;  4YP3 A;  1PK1 B;  1ZQK A;  2ESE A;  3ZDE A;  2ZUB A;  1L7N A;  5IIL A;  4GLX A;  3PY8 A;  4MFF A;  4Y2S A;  1DGS A;  4OJO A;  4U7C A;  4RQ1 A;  3PR5 B;  5ALV A;  1DK3 A;  1JXE A;  5AKG A;  1QSL A;  3V7L A;  1CUK A;  2ASD A;  2KD1 A;  4CGZ A;  1SXE A;  5IIJ A;  5BOM A;  1ZYQ A;  4EBC A;  4J9K A;  3RJH A;  4J9N A;  4DCC A;  4UB5 A;  3TI0 A;  5ALI A;  3RAX A;  3QXG A;  4QZF A;  1XS9 D;  4KLO A;  2HHV A;  4NWI A;  5KFJ A;  3HPO A;  3Q8L A;  4UB8 U;  4QWA A;  3FYH A;  3WKE A;  5KFX A;  2H3V A;  3ZDC A;  3HW8 A;  4F5Q A;  2HBM A;  2Y9T A;  4RU9 A;  3GII A;  1KBU A;  2W3R A;  5AKE A;  4I29 A;  4EEY A;  2VKQ A;  2YN4 A;  4Y2Y A;  3MBY A;  5L9X A;  2BQU A;  5J8Y A;  2BHN A;  2JEG A;  3UXN A;  5ALZ A;  1D8Y A;  3JPN A;  4OD0 A;  5AKI A;  4DSL A;  5D46 A;  4PL1 A;  8ICG A;  4DL2 A;  2PMZ C;  4FBT A;  1KL9 A;  2LBO A;  5KFI A;  1FO4 A;  3AM9 A;  1UT8 A;  3GV8 B;  2BCU A;  8ICE A;  3KTQ A;  1BPD A;  3IV6 A;  1UHU A;  4KTQ A;  9ICO A;  4F93 B;  3I76 A;  5KFN A;  3KHH A;  4I28 A;  1KEJ A;  4F92 B;  4ELV A;  5AM5 A;  3M8R A;  3Q8R B;  2XI9 A;  3IP4 B;  5KT5 A;  2HOQ A;  7ICQ A;  4F5N A;  1SB3 C;  2KEY A;  4P0Q B;  2E8P A;  3OHB A;  3V7J A;  4UAR A;  2IA6 A;  2DKX A;  4YXM A;  2JZB B;  5HHH A;  2GO7 A;  5J2J A;  4DSF A;  8ICX A;  9ICP A;  4DOC A;  1S0N A;  3SAF A;  1GO3 F;  1BPB A;  2R8J A;  1J97 A;  1X6J A;  3QU2 A;  4QZI A;  2ZIU B;  4DS5 A;  5AIC A;  2DUY A;  2OCE A;  3TFR A;  8ICZ A;  3CW2 C;  4ED2 A;  3MR6 A;  2ZIX A;  2W9C B;  1NOM A;  4JK1 A;  3ETR A;  5AM2 A;  1X9S A;  4FZL A;  5AKZ A;  3PSI A;  2KZM A;  3IG5 A;  4JB3 A;  5KFQ A;  4JMU A;  1SKW A;  4BX9 C;  4M2Y A;  1SWV A;  4Y2P A;  2KMD A;  2ZUC A;  4GFJ A;  2PFP A;  2K89 A;  5G5G A;  3SAH A;  3QU7 A;  3BQ2 A;  3K1R B;  4RQ0 A;  3ALR A;  3R9K A;  3ORY A;  1L3S A;  2R8H A;  4UB6 U;  3A0B U;  2NO5 A;  3UPQ A;  5DKW A;  3BQ1 A;  1YZ7 A;  4C80 A;  4JWN A;  1RYU A;  1QQ5 A;  1NKB A;  9ICM A;  1ZQQ A;  8ICW A;  5KFR A;  3D2N A;  7ICI A;  5HNK A;  3QUC A;  4KLH A;  2H3F A;  5HR6 A;  1LKY A;  8ICC A;  3WKC A;  2KKP A;  3C23 A;  2FLL A;  4R63 A;  2P6U A;  4NL9 C;  1ZQF A;  2AGO A;  2ZUD A;  1U48 A;  1M6Y A;  3NRZ A;  3AQF A;  5J0W A;  3BZC A;  4GIB A;  3ZI4 A;  3OTQ A;  1SL2 A;  2QKQ A;  3N7R C;  4DQP A;  2NYV A;  2KV2 A;  5DQH A;  2FJ6 A;  2I5H A;  3D6J A;  3IG8 A;  4DLG A;  4RT2 A;  4C7Z A;  2MUT A;  1NK6 A;  3KD3 A;  1PK3 A;  4I2G A;  5KFF A;  5AKX A;  1EXN A;  3F53 A;  1NI3 A;  2QB0 A;  5KFG A;  3U26 A;  2AXT U;  3C21 A;  4TUR A;  5ALE A;  3HX0 A;  5ALH A;  2E8O A;  2E3T A;  3RAQ A;  2IMW P;  5J2F A;  3M9O B;  4ED7 A;  5KFO A;  3N97 B;  3RH5 A;  5J2C A;  3H4B A;  4K4H A;  4MF2 A;  2O6K A;  4I2A A;  3T5K A;  4YR3 A;  3M9M B;  4NLG A;  1KKX A;  1TFR A;  2F8K A;  3PST A;  3PMN A;  4F72 A;  4J9S A;  1VDV A;  4Q8E A;  2K60 A;  2AGQ A;  3QE9 Y;  2KFN A;  2DF4 B;  3M8S A;  1KN5 A;  2DBY A;  4Z6F A;  3GIM A;  2BPF A;  3T5H A;  4FZN A;  2Y1J A;  1X9M A;  2XCP A;  1KW4 A;  4ACO A;  5C5J A;  1WUD A;  2LI6 A;  5DLF A;  4DFP A;  8ICO A;  3I28 A;  4RQ7 A;  5KFW A;  3JPQ A;  4ED1 A;  2F1I A;  7ICO A;  1Z00 B;  3HKZ F;  3BQ7 A;  3HT3 A;  2HBJ A;  3CYM A;  3O0F A;  4EEN A;  4FO6 A;  1MQ2 A;  4KLT A;  4YD1 A;  2F44 A;  4O3O A;  5ALF A;  3PV8 A;  5KG0 A;  2WB1 F;  3TAR A;  2JH1 A;  3HKZ C;  2WFA A;  3OSP A;  3GIK A;  1KDH A;  3OSN A;  7ICJ A;  3AUO A;  3LWM A;  5D49 A;  1S10 A;  2E8N A;  2A1J B;  2DKZ A;  3T79 A;  1NZB A;  2NV3 A;  3Q8M A;  2WB1 C;  5DBB A;  5AM3 A;  4NLZ A;  3V6J A;  2Y9U A;  4NJ8 A;  2KN7 A;  2C22 A;  3JPT A;  2ZJ5 A;  9ICR A;  2LKY A;  2FLP A;  2MAX A;  4DFK A;  1L3T A;  5KAI U;  4US8 A;  3EUB 2;  5HML A;  5EE1 A;  1MQ3 A;  2WF5 A;  2B6G A;  5CP2 A;  3DEE A;  5KG5 A;  2W03 A;  1XSL A;  1COK A;  2A3V A;  4JV1 A;  3GV5 B;  2GLE A;  4C8K A;  5E79 U;  2JEI A;  8ICU A;  1WWU A;  3ONN A;  4O3Q A;  2W11 A;  1ZD4 A;  4DFM A;  3SMV A;  5L1J A;  3AN1 A;  4IRD A;  3QU4 A;  4GXJ A;  5ALP A;  1BGX T;  3JPS A;  2HOF A;  4DQR A;  8ICK A;  4Q44 A;  1X40 A;  1L7O A;  5III A;  2RDJ A;  1DRG A;  3HJE A;  4FZM A;  1OUQ A;  5C0Y A;  5DDM A;  3ISB A;  4RQ5 A;  8ICR A;  1TAU A;  4BGD A;  4DQS A;  2YB1 A;  3T5L A;  1QLN A;  1OXJ A;  5K4L A;  2D8C A;  5KG7 A;  1L7M A;  8ICB A;  3ETL A;  3Q8Q B;  1JUD A;  5AK6 A;  4I2C A;  3MDA A;  4ECQ A;  4PHE A;  4PPX A;  4WJ3 B;  5GTH U;  3GV7 B;  2P66 A;  4P4M A;  2ZTC A;  4KN7 A;  2QAR B;  4GXK A;  8ICT A;  2F3N A;  5CHG A;  4Q8F A;  2EZZ A;  2JV3 A;  3G6V A;  2HCF A;  4ED8 A;  4QZH A;  1NJZ A;  1SZH A;  2BCS A;  5ALT A;  3FM9 A;  5AKJ A;  3C28 A;  5KFU A;  3EZ5 A;  4I2D A;  4R66 A;  3SZ2 A;  2BQ3 A;  3KKA A;  3H40 A;  4DL6 A;  4O3M A;  3LWL A;  5L1M A;  1Z4O A;  3ZDD A;  4YMO A;  4G3I A;  3F2C A;  4I2E A;  4B9L A;  1S9F A;  1ARO P;  4DEZ A;  3TAP A;  1ZQR A;  5KFY A;  4QIW C;  4YN4 A;  4FBU A;  4NY8 A;  1SV0 A;  1DXS A;  5CEH A;  4EYI B;  5HP4 A;  4YCX A;  3EPG A;  4I2F A;  5JU5 A;  2Y0S F;  4KX3 A;  1XSN A;  1WWV A;  3NVY A;  4LVS A;  4UB1 A;  4UAZ A;  5KT7 A;  9ICU A;  1L8O A;  4UQG A;  9ICW A;  3NRW A;  4CF3 A;  4C8L A;  3ISC A;  1TVA A;  2WHE A;  2ZIV B;  2XY5 A;  2ES6 A;  3LVW A;  1Q3V A;  1O08 A;  4UAS A;  2FLN A;  4JUZ A;  2Y0S C;  2LM4 A;  2QLT A;  3KZI U;  1ZQX A;  1ZQL A;  2RQ5 A;  5ALX A;  5J0R A;  1UPH A;  4C8N A;  3GQC A;  2LMR A;  4PH5 A;  4EZ6 A;  1ZQG A;  2BQR A;  1ECW A;  4IC9 A;  1SXD A;  2R8K A;  3S6J A;  3G6Y A;  3PR4 A;  2WAQ C;  5CRX A;  4YVZ A;  1FFV A;  2ZXI A;  4RNN A;  4YR2 A;  3N28 A;  2XGP A;  2HVI A;  4LZG A;  3VC8 A;  1UT5 A;  2PXI A;  4QNL A;  5DGB A;  2KG5 A;  1JX4 A;  1N61 A;  3H4D A;  2AU0 A;  1ZXI A;  5ALS A;  4YFK A;  1SWW A;  3SV3 A;  1QTM A;  2VA2 A;  1NKE A;  3QUB A;  3WK9 A;  2AHO B;  2PI5 A;  1RQN A;  7ICK A;  4ICA A;  5AKY A;  1BVS A;  3I1Y A;  5ALL A;  4KLF A;  4OCZ A;  3ICX A;  1D8L A;  3ZDA A;  1F44 A;  2PFQ A;  4O3N A;  5EWE A;  2LHT A;  3AU2 A;  3KFU F;  3T3F A;  2UVV A;  4MFC A;  2OHF A;  3BS5 A;  2OYY A;  2KZZ A;  5ALJ A;  3QZ8 A;  4YQW A;  3H8S A;  2M0N A;  5ALW A;  3NUQ A;  2J6T A;  5CB1 A;  2FDR A;  3AL0 B;  2Q4T A;  3RTV A;  2DPJ A;  4DFJ A;  1X9W A;  4LZD A;  3KHG A;  3UMG A;  5DBC A;  4YMN A;  2PMZ F;  4O3P A;  2RRD A;  3NVW A;  3PNC A;  5JRT A;  1T8E A;  2HHU A;  3SEI A;  3NAS A;  2BKE A;  3RBD A;  1HIW A;  5J0S A;  3BS7 A;  4RQN A;  5J0X A;  2F1H A;  2OH2 A;  2JGA A;  5AI9 A;  1QQ6 A;  1N56 A;  2C2E A;  1T4G A;  2YTU A;  5HR7 A;  1ZQZ A;  1QH9 A;  2RP5 A;  4UW9 A;  2YY6 A;  5KFT A;  1XO1 A;  1UA1 A;  4MEY A;  2WF9 A;  9ICF A;  2LM1 A;  3RJE A;  1PK1 A;  1XU4 A;  5TIS U;  1L6N A;  3TAN A;  2JXJ A;  4KN4 A;  3AEV A;  3G6X A;  4M9H A;  4F4X A;  2WF7 A;  3PW7 A;  4YR0 A;  4RNO A;  5J2B A;  1RZT A;  5T14 A;  3RJK A;  1V38 A;  3H0M B;  2YMM A;  2XIC A;  1L5U A;  5J2I A;  1U47 A;  1JAL A;  4J9Q A;  3T5J A;  3C5F A;  1HJP A;  3UM9 A;  2NRW A;  2JEF A;  4UAY A;  4KLJ A;  7ICF A;  2I9G A;  3MGI A;  3H0R B;  2ZIW B;  3RBE A;  1NK7 A;  8ICY A;  5KG1 A;  5HHI A;  4F50 A;  4IQW A;  2WF8 A;  4M6W B;  1VLB A;  1SZP A;  1ZQY A;  2EQY A;  4LJX A;  3H0L B;  1ZQP A;  4KLG A;  5KFE A;  2KSO A;  4PZO A;  2GWS A;  2BCR A;  3UXP A;  2V4Q A;  2MA1 A;  4A8E A;  1PVP A;  2BPG A;  4C4T A;  4YD2 A;  5AM4 A;  4DSE A;  2W3S A;  2ZXH A;  3N7S C;  5EE9 A;  4B9S A;  5BOL A;  4P0P B;  1V97 A;  3PO5 A;  4EBD A;  5ALQ A;  3HRD D;  1PUZ A;  1ZQN A;  5DQI A;  4DQI A;  5B5E U;  2XVT A;  4GXI A;  2XO7 A;  2YML A;  5KG6 A;  1LB2 B;  4J9R A;  1RG6 A;  3RFA A;  2KFZ A;  2FPK A;  4NL9 A;  1SV4 A;  2W8L A;  1NK0 A;  4ELT A;  3LDA A;  2XGQ A;  5AI5 A;  2IHM A;  1WG8 A;  4UAT A;  3D2S A;  4DFD A;  8ICJ A;  4O5E A;  2F8L A;  1ZQJ A;  9ICX A;  3KBB A;  4ECU A;  3M6Z A;  2EAP A;  5IIM A;  4P0Q A;  2AQ0 A;  4PJ0 U;  9ICI A;  4J9O A; 
#chains in the Genus database with same CATH homology
 4IQV A;  4UB3 A;  3B0Y A;  3JPO A;  1MQ3 A;  8ICH A;  9ICL A;  9ICH A;  7ICT A;  4KLU A;  1XSL A;  4QZD A;  4UB2 A;  4K4G A;  4R64 A;  4M9L A;  1BPX A;  2PFN A;  4RPX A;  4JWM A;  8ICU A;  4QZC A;  4NXZ A;  9ICR A;  5J2E A;  4I27 A;  5EOZ A;  4PHD A;  1ZQD A;  7ICG A;  4GXJ A;  3UQ0 A;  3JPS A;  4YMM A;  3RJF A;  3RH4 A;  4TUP A;  8ICK A;  3JPR A;  5III A;  3RJJ A;  9ICJ A;  7ICL A;  3ISB A;  4RQ5 A;  8ICR A;  3C2M A;  4M0A A;  5DB9 A;  4UB4 A;  5J29 A;  4QZA A;  4NLK A;  4F5R A;  5J0T A;  4NM2 A;  1ZQM A;  9ICN A;  1ZQK A;  8ICB A;  9ICG A;  5IIL A;  4I2C A;  5J2G A;  3MDA A;  4MFF A;  4PHE A;  9ICB A;  4PPX A;  5CWR A;  4RQ1 A;  9ICS A;  4IQU A;  3C5G A;  3AU6 A;  1DK3 A;  4M47 A;  4KLE A;  3RH6 A;  2P66 A;  3V7L A;  4TUS A;  4GXK A;  8ICT A;  5IIJ A;  4I2B A;  5BOM A;  4PGX A;  9ICV A;  3RJH A;  4QZH A;  4UB5 A;  4DOB A;  3C2L A;  4Z6C A;  3V7K A;  3UXO A;  2BCS A;  4QZF A;  4NM1 A;  4KLO A;  4R65 A;  5DB8 A;  3HW8 A;  4F5Q A;  4O5K A;  4I2D A;  1XSP A;  4R66 A;  4KLM A;  4RQ3 A;  7ICP A;  5J0Y A;  4QZ8 A;  5TZV A;  3OGU A;  4I29 A;  4M9J A;  4YMO A;  4I2E A;  3MBY A;  8ICA A;  3UQ2 A;  4NLN A;  3UXN A;  1ZQR A;  5DDY A;  4PHP A;  8ICV A;  4YN4 A;  4DO9 A;  4KLI A;  4NY8 A;  3JPN A;  2FMS A;  7ICR A;  4YCX A;  5J0U A;  4I2F A;  5D46 A;  8ICG A;  4RQ2 A;  1XSN A;  1ZJM A;  4LVS A;  7ICU A;  4UB1 A;  4UAZ A;  9ICU A;  2BCU A;  8ICE A;  9ICW A;  1BNO A;  5DB6 A;  4PHA A;  1BPD A;  3ISC A;  1TVA A;  4RQ6 A;  4F5P A;  4PGQ A;  9ICO A;  3PML A;  1NZP A;  4I28 A;  1ZQS A;  1KEJ A;  4KLS A;  5DB7 A;  4RQ8 A;  4F5O A;  2W9M A;  1BPZ A;  1ZQL A;  3TFS A;  3B0X A;  5J0R A;  2BCQ A;  2FMQ A;  7ICQ A;  4F5N A;  4MFA A;  4PH5 A;  3V7J A;  1ZQI A;  1ZQG A;  9ICK A;  5HHH A;  5J2J A;  8ICX A;  9ICP A;  5J2K A;  2ISO A;  4DOC A;  1ZQT A;  4KLD A;  4LZG A;  2KP7 A;  3MGH A;  4QZI A;  2PXI A;  3TFR A;  8ICZ A;  2PFO A;  1ZQE A;  8ICP A;  7ICK A;  5J2A A;  1BPY A;  8ICN A;  4QZB A;  4KLF A;  5BPC A;  1ZQB A;  4M2Y A;  4IQT A;  4O9M A;  8ICS A;  2PFQ A;  3AU2 A;  4MFC A;  2PFP A;  7ICS A;  4I2J A;  5J0O A;  4RQ0 A;  5CB1 A;  4TUQ A;  4DOA A;  3UPQ A;  4MF8 A;  5DKW A;  4JWN A;  1ZJN A;  3C2K A;  4LZD A;  5DBC A;  9ICM A;  1ZQQ A;  8ICW A;  4PGY A;  4YMN A;  5J2D A;  7ICI A;  8ICM A;  3PNC A;  4KLH A;  4KLL A;  4RPZ A;  8ICC A;  1DK2 A;  4Z6D A;  4R63 A;  9ICT A;  5J0S A;  5J0X A;  5IIO A;  1ZQF A;  5J0W A;  4M9N A;  9ICA A;  1ZQO A;  4I2H A;  1TV9 A;  4RT3 A;  4QZG A;  4RT2 A;  9ICF A;  1HUO A;  5D4B A;  4I2I A;  3RJE A;  4I2G A;  1HUZ A;  3HWT A;  4O5C A;  4XUS A;  3V72 A;  1BNP A;  3RJG A;  4M9H A;  4TUR A;  5J2B A;  3HX0 A;  1RZT A;  3RJK A;  8ICL A;  2BCV A;  5J2F A;  5J2I A;  3C5F A;  3RH5 A;  5J2C A;  4K4H A;  3RJI A;  4MF2 A;  4UBC A;  1JMS A;  4M9G A;  4UAY A;  3MDC A;  4I2A A;  5J0P A;  4KLJ A;  4M04 A;  7ICF A;  2ISP A;  2I9G A;  3MGI A;  8ICY A;  3PMN A;  5HHI A;  4P2H A;  7ICE A;  4IQW A;  8ICF A;  2FMP A;  1ZQC A;  3LK9 A;  4XA5 A;  9ICC A;  1ZQP A;  4KLG A;  2GWS A;  8ICQ A;  2BCR A;  3UXP A;  4Z6F A;  2BPG A;  2BPF A;  4YD2 A;  9ICQ A;  5BOL A;  5DBA A;  4K4I A;  4UBB A;  8ICO A;  1ZQN A;  4RQ7 A;  4X5V A;  7ICN A;  4RPY A;  3JPQ A;  5IIN A;  5J2H A;  4GXI A;  7ICO A;  3ISD A;  1ZQH A;  3GDX A;  4QZE A;  4FO6 A;  1MQ2 A;  8ICI A;  4KLT A;  4YD1 A;  7ICV A;  1ZQA A;  4RQ4 A;  7ICM A;  2IHM A;  9ICE A;  7ICH A;  1BPE A;  8ICJ A;  1KDH A;  4O5E A;  7ICJ A;  3AUO A;  1ZQJ A;  5D49 A;  3JPP A;  4KLQ A;  4Z6E A;  4UAW A;  5IIK A;  9ICX A;  5DBB A;  5IIM A;  4NLZ A;  5J0Q A;  4QZ9 A;  3JPT A;  9ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...