1BNOA

Nmr solution structure of the n-terminal domain of dna polymerase beta, minimized average structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
87
structure length
87
Chain Sequence
b'MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA
publication title Three-dimensional solution structure of the N-terminal domain of DNA polymerase beta and mapping of the ssDNA interaction interface.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Nucleotidyltransferase (dna-binding)
total genus 13
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1996-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1bnoA00
4M47A 9ICNA 4QZFA 3UXNA 7ICGA 1TVAA 4RT3A 9ICJA 3MDCA 4NY8A 4PGYA 5D49A 4I2JA 5J2IA 3HW8A 1BPZA 4KLIA 4MFAA 1KDHA 4M04A 5BOMA 8ICCA 4YMOA 9ICTA 4Z6EA 1KEJA 8ICQA 1BNPA 8ICKA 4RQ7A 3V7JA 5J2FA 3RJEA 1ZQNA 1BPXA 4QZCA 4NLKA 3MDAA 5HHIA 4FO6A 4NLZA 4PHEA 4PGXA 4PGQA 5D46A 1ZQHA 3JPQA 1ZQSA 4JWNA 5IIKA 3PMLA 4MFCA 8ICZA 5IIMA 7ICJA 5J2GA 9ICSA 5DBAA 2BCVA 1JMSA 3TFRA 4RPZA 5DBBA 3LK9A 1ZJNA 5J0QA 7ICHA 9ICMA 3RJKA 7ICRA 4I2AA 7ICUA 4KLOA 2PFNA 1ZQAA 4TURA 5DB9A 4YN4A 4NM2A 4RQ1A 2BPFA 4KLUA 9ICKA 9ICQA 1ZQFA 1XSNA 8ICVA 1ZQOA 4GXJA 1BPDA 4DO9A 4K4IA 5D4BA 4UBBA 2FMQA 4MFFA 3RH5A 1TV9A 4TUSA 8ICJA 1XSPA 4PPXA 5DB6A 5DB7A 4UBCA 4I2IA 3JPSA 7ICLA 8ICIA 7ICNA 5J0XA 4UB5A 7ICSA 3B0YA 4RQ3A 4NXZA 4F5QA 1ZQDA 4TUPA 3HWTA 5BOLA 4F5OA 5J2AA 4KLTA 5J2HA 3UXPA 4UAZA 1ZQKA 4IQTA 5IILA 1ZQBA 3AU2A 8ICXA 4RQ2A 4P2HA 7ICEA 4R63A 4Z6DA 3ISDA 4QZ9A 4QZBA 5J2JA 5J0OA 9ICHA 4R64A 4I2GA 4UAYA 5J0RA 4KLEA 4I2DA 5J2EA 3MGHA 2ISPA 2PXIA 1ZQMA 4M9NA 3JPNA 4QZHA 2PFQA 4LVSA 1MQ3A 5TZVA 1DK3A 4KLJA 3OGUA 1HUOA 5J29A 9ICGA 2BCSA 7ICTA 1BNOA 3AU6A 4KLFA 3GDXA 3V7KA 8ICHA 7ICFA 4YMMA 7ICMA 5CWRA 4RT2A 5CB1A 3JPRA 9ICFA 4RPYA 3RH4A 4K4HA 4YCXA 4O9MA 4Z6FA 4X5VA 4O5EA 3RJFA 4DOBA 3C5FA 3JPTA 4I2FA 1ZQPA 8ICAA 4I28A 3UQ0A 3ISBA 4PH5A 1BPEA 3ISCA 4KLMA 4F5RA 5IIIA 4RQ4A 3RH6A 3RJHA 7ICQA 5J0YA 2BCQA 4RQ0A 4GXKA 1ZQLA 3RJGA 2PFPA 4M0AA 5BPCA 9ICLA 4YMNA 7ICVA 5J0WA 4KLQA 3HX0A 4F5PA 1ZQTA 9ICAA 9ICVA 2IHMA 8ICFA 7ICPA 4I2EA 4F5NA 4DOAA 5IIOA 4I27A 5J0UA 4IQWA 8ICBA 8ICTA 4RQ8A 4PHAA 5J2CA 3RJIA 4DOCA 1ZQGA 3B0XA 3UXOA 4O5CA 7ICOA 5HHHA 7ICIA 1RZTA 4Z6CA 4RQ6A 5J0TA 3C2LA 4LZGA 2BPGA 1ZQEA 3PNCA 8ICWA 5DKWA 4PHPA 4YD2A 1BPYA 4R65A 3JPOA 8ICNA 4UB4A 9ICWA 4IQVA 3PMNA 3MGIA 5IINA 4KLDA 4UB2A 3TFSA 4M9GA 9ICUA 3C2KA 4QZDA 2I9GA 4O5KA 2FMPA 4MF2A 3V72A 3RJJA 4NLNA 8ICYA 4QZAA 4M2YA 1ZJMA 4KLLA 8ICRA 5EOZA 9ICIA 9ICEA 8ICPA 2ISOA 4MF8A 3C5GA 1MQ2A 5DBCA 3JPPA 4KLHA 9ICPA 3UQ2A 1HUZA 1ZQRA 4R66A 5DB8A 1DK2A 2W9MA 1ZQQA 4QZIA 9ICOA 4YD1A 4M9HA 4M9LA 1ZQIA 2PFOA 7ICKA 4KLGA 3MBYA 3V7LA 4M9JA 4K4GA 2KP7A 9ICRA 3C2MA 4I2HA 3UPQA 5J0PA 2P66A 3AUOA 9ICXA 9ICBA 8ICOA 5J2BA 4I2CA 5IIJA 4UB1A 4LZDA 4JWMA 4XUSA 5J0SA 4I29A 1XSLA 4QZGA 4XA5A 4KLSA 4QZ8A 2FMSA 4RPXA 4QZEA 4UAWA 4I2BA 4PHDA 5J2DA 2BCRA 2BCUA 8ICGA 4NM1A 8ICMA 8ICEA 8ICUA 8ICLA 4TUQA 1ZQCA 1ZQJA 4RQ5A 8ICSA 4UB3A 4GXIA 4IQUA 2GWSA 5DDYA 1NZPA 5J2KA 9ICCA
chains in the Genus database with same CATH superfamily
3OPXA 3PSTA 4M47A 2MUTA 2K8BB 5AKXA 1F44A 7ICGA 2KZZA 4DSKA 2AQ0A 2DPJA 9ICJA 1YZ6A 2H5XA 4NY8A 1OXJA 3Q8KA 3V6KA 4CNQA 4F92B 2QARB 2HHUA 3HW8A 1U4BA 4M04A 3SR6A 1N60A 4YMOA 5CJ7A 1ZRNA 2ZIUA 4Z6EA 3MGVA 2EAMA 1UT5A 4J9NA 2L5YA 3GIKA 3MABA 1SXEA 4RQ7A 4M6WB 3R9KA 5ALDA 4JV1A 2DKZA 4CF4A 4QZCA 3F5EA 2KJ8A 3MDAA 3UM9A 5KFNA 3EPGA 2F2AB 3MC1A 1SKRA 2EANA 1U47A 5HMLA 3O0FA 4DFDA 5EE1A 2FJ6A 2ZUBA 2DFLA 3PO4A 1D8YA 4YG2A 3DEEA 4BGDA 4OCZA 3GV8B 5DBAA 2JHDA 2BCVA 4B9MA 4RPZA 1DOQA 3LK9A 4DWIA 1XU4A 5KG4A 4I2AA 4O3NA 3GZFA 4G9BA 1PK1B 4ED8A 1WG8A 3J81j 2WF5A 3PW7A 5L1JA 4KN7A 5AKGA 3M9NB 3H4BA 8ICVA 3BQ1A 4GXJA 1BPDA 3D2NA 5D4BA 4UBBA 3F2DA 2FMQA 3BZKA 3QUTA 1F5SA 2QKQA 2BDUA 2QB0B 1TV9A 4Q45A 4TUSA 5KFOA 3KHGA 1RYRA 4PPXA 5DB7A 7ICLA 3JPSA 4NLBA 3H4DA 2A19A 7ICNA 5TISU 2KICA 2XCPA 5KG0A 4EELA 3B0YA 4PZNA 4RQ3A 4F5QA 1ZQYA 3ZD9A 3SI8A 5KFZA 4EBDA 3TARA 1UT8A 2PMZC 4DSFA 5ALHA 2RDIA 5J2AA 4ECZA 4KLTA 3RRHA 2ZTDA 1TK8A 3UXPA 2FPMA 4F4XA 4IQTA 4DQSA 3M8SA 4KTQA 5G5HA 2GLEA 3BQ7A 1TK0A 1K1SA 2VJ4A 1NI3A 7ICEA 4TQRA 2K8AA 2H3ZA 5FP0A 3EZ5A 1S77D 1A6SA 4QZBA 5J2JA 4NWIA 3HT3A 4RNMA 4R64A 2LM1A 1D9DA 4Y2RA 3TANA 1RDFA 4DL4A 1ZQMA 3JPNA 2PFQA 4LVSA 4J9OA 3H8MA 5TZVA 1JXEA 4UB8U 3ETRA 2W3SA 3RTVA 3WKBA 4KLJA 3RFAA 4ELUA 1HUOA 2E8PA 2W7OA 9ICGA 2KG5A 4QWBA 4DSEA 1BNOA 1L7MA 4DLGA 3UMBA 3IM1A 2CRXA 1PVQA 2F1IA 5AI4A 3M6ZA 3CRXA 4GC7A 3GDXA 2WB1C 3L3FX 4YMMA 3SV3A 5CB1A 3C29A 1S97A 4YCXA 3NASA 1CUKA 2NRVA 4PL2A 2YMPA 1KRPA 4Z6FA 3L5KA 3OTQA 5KFAA 4B9TA 3F2BA 3K1RB 4DOBA 2V4RA 3JPTA 2WAQC 4J9MA 2A1JA 8ICAA 5ALEA 3A0BU 4PH5A 5KFFA 2YB4A 3RH6A 4R8UB 3NS1A 5J0YA 5C5JA 4B6JA 4ECTA 1FFVA 3RJGA 1SV4A 4DL6A 2KIWA 9ICLA 2ZJAA 2P6RA 4F5PA 2FPLA 1ED1A 2RQ5A 3PSIA 5JU5A 1S0MA 4UASA 3KBBA 4JUZA 8ICBA 5KFSA 4AP9A 4PHAA 5AM5A 2EZXA 2KVCA 2KZ3A 4OJLA 4DOCA 5HP4A 3B0XA 3RB6A 7ICOA 3V6JA 3AEVA 2ASDA 4O3OA 4US8A 1KLNA 3LVVA 3C2LA 2BPGA 2IMWP 1ZQEA 5KFVA 2K4HA 2FLLA 2AGQA 4F4WA 3SV4A 1B0XA 4DS5A 2C2RA 4OD0A 3NGDA 2QB1A 2F76X 5ALXA 4R65A 3AM9A 3GIMA 1X9SA 1URJA 2ZIXB 3QU2A 4UB2A 4DQIA 3HRDD 4B9UA 3QZ7A 4EX6A 9ICUA 1KSPA 5EWGA 4J9RA 3ZDCA 5F9NA 2LHTA 2HVHA 3RF9A 2I9GA 3KD3A 4O5KA 2ALZA 4G3IA 4YR3A 5DQGA 4NLNA 3RB0A 8ICYA 4FE3A 2JZBA 4RZRA 2Z7JA 4FS1A 1KFDA 4OJ6A 4KLLA 5ALYA 5E79U 1QTMA 3BS5A 3ZDEA 2KFNA 2KHVA 5L1MA 3I76A 1V85A 1D8BA 5KT4A 4ECWA 4ELVA 3RB4A 3MR2A 1HJPA 4KLHA 1S8OA 3OSNA 1RQNA 5KG1A 1Q3VA 2HHVA 2WFAA 1HUZA 2HOFA 5AM0A 4R66A 1VDVA 2DUYA 1QQ5A 1JIHA 1T8EA 3TKAA 1DK2A 1ZQQA 1HEKA 4M9HA 1L5UA 4P0PA 2EAPA 4M9LA 5KFGA 3MBYA 2W9AA 3ZI4A 4EBCA 2KP7A 9ICRA 3PO5A 5KAIU 2P66A 3AUOA 3WU2U 5KFQA 5KFEA 1O03A 5J0SA 3ONNA 2JEIA 4XA5A 4QZEA 3QU7A 4PHDA 2BQUA 3M9MB 3PX6A 1ZQXA 2BCRA 1M6YA 1OUQA 1Q3UA 4TUQA 5DQIA 1FO4A 1TAUA 1NK9A 1ZQJA 1O08A 2H3FA 1KL9A 2XC9A 2HHSA 2C28A 4RQ5A 3IRUA 1ZD4A 1ZD5A 2Q0ZX 2HCFA 9ICNA 4QZFA 4ED6A 4OJPA 1CI4A 1LB2B 2VIXA 4IR1A 1L3UA 3MDCA 4I2JA 3B9JA 4DF8A 2HBKA 4Q43A 4RNNA 5BOMA 3RRGA 2P6UA 3MFHA 1KW4A 2AU0A 8ICQA 4QWDA 8ICKA 2JEJA 3M8RA 2ATLA 3SENA 2W43A 2YQEA 5ALQA 2KSOB 5JRTA 1XC9A 4DS4A 2KKPA 1BPXA 1CEZA 4F4YA 5EE3A 4FO6A 3M9OB 4PHEA 4F3OA 4PGXA 3SMVA 5D46A 5AM4A 2E1FA 1ZQWA 2ZG6A 3EW9A 2PKEA 3Q8PB 3DDHA 2FPKA 5IIMA 3G6YA 1J2MA 1WYGA 3GILA 1RYSA 1NJWA 5J2GA 2LYHA 2ZIWA 3RAXA 3H7IA 2JRZA 5KFWA 1RQLA 1RYUA 3TFRA 5KFLA 3WK4A 1ZJNA 5J0QA 2ZIVB 1L3SA 7ICHA 3RJKA 2ASJA 1UCVA 7ICRA 2KD1A 4F72A 2LMRA 5AI5A 1DGJA 2PFNA 4RQNA 2WTFA 4TURA 4F4ZA 1ZD2P 4YR2A 2WF7A 2OH2A 5DB9A 4KLUA 9ICQA 3MR6A 5J8YA 4JB3A 4DO9A 3LWLA 4K4IA 2XY7A 4Q8EA 3GFKB 4DF4A 4MFFA 3RH5A 4Q8FA 5KNIA 2K4IA 3TAPA 2AGPA 2OYYA 3MR3A 2HOIA 2NRWA 2AHOB 2Y1IA 4DQPA 5DB6A 4UBCA 1NK5A 2NO4A 2JH7A 5T14A 4J9KA 2LYBA 4P4PA 4PL1A 8ICIA 2JH1A 5J0XA 2VA3A 3NRWA 4J03A 1ZOLA 3WKAA 4Y2SA 3RAQA 5ALKA 4RQMA 1ZQ1C 1BPBA 2R8IA 2E3TA 2MAXA 1KN5A 3HWTA 3BQTA 3AMZA 2WF8A 5BOLA 3WK8A 5AKEA 4F5OA 1JI7A 2D6FC 5AI0A 1BGXT 2NRZA 2M9NA 1N5WA 4C4RA 3Q8RB 2E8OA 5KT7A 3CYMA 2VA2A 2I1QA 8ICXA 4P0QA 4R63A 2CN1A 3M1YA 4BJQA 4QZ9A 3TAQA 4B9LA 2BPCA 4TQSA 2NV3A 2XIDA 9ICHA 2DGZA 2M0NA 2Y9UA 2HHXA 3MGHA 2PXIA 4QZHA 2B21A 2K89A 1U48A 3C1ZA 4CE6A 3QE9Y 1DK3A 3QU9A 3RR8A 2EDUA 4C4TA 3OGUA 2F77X 3ZD8A 1JN3A 2K4EA 2KKVA 4EX7A 5ALGA 2VA8A 2PI5A 5L1LA 2ESEA 1JALA 3H0LB 2ASLA 5ALMA 3ALRA 3FAHA 1Q46A 7ICFA 7ICMA 4RPYA 1MN8A 5KG2A 1QCKA 1RG6A 1NJZA 1MA7A 3AQFA 1SZHA 1T3QA 3DV9A 1RM6C 5A0LA 1PVRA 3RJFA 5AK3A 2W7PA 2LYAA 4O3QA 2MUTB 2MSNA 1ZQPA 3SQIA 4I28A 1ZQUA 3BQ0A 1FIQA 1NKEA 1CRXA 3BZCA 3UQ0A 3ISBA 3T5JA 3ISCA 4KLMA 5IIIA 1SL2A 4C8OA 4J9PA 1PK3A 7ICQA 1COKA 2ZTCA 3PZPA 4C8MA 4DL7A 2PMZF 4M0AA 4YMNA 2ZIUB 2JR5A 5J0WA 4U7CA 3QNMA 3HX0A 1RPLA 3IP4B 9ICAA 2IHMA 3EYZA 4F5NA 5KFXA 3QX7A 3RB3A 2ZJ8A 3ED5A 2DL0A 5J0UA 4JMUA 5L9XA 8ICTA 1NNLA 2IHNA 2F8LA 5J2CA 1ZQGA 1T4GA 4BWMA 4O5CA 3H8SA 5AKYA 2JEGA 5AI6A 3QUCA 1UA1A 4F93B 2B0CA 4RQ6A 5J0TA 4LZGA 2JEFA 4UQGA 5HR6A 2EH9A 2KN7A 2AH5A 1A0PA 1IV8A 1SL0A 2RHFA 4ED0A 3H0RB 5ALUA 4DSJA 1IXRA 1L3VA 3NVZA 3FYHA 1Z3EB 5AIBA 5IINA 2WB1F 4RUAA 1U45A 4UW9A 2HW3A 4M9GA 2BR0A 2OM6A 2Y1JA 5DGAA 4DSLA 1A76A 2WF6A 4QZDA 2HDOA 2NO5A 2W9CA 3PSFA 3D2SA 3EPIA 2IOFK 3V72A 2WAQF 2XY5A 1KTQA 4ECXA 3RJJA 3SAGA 4QZAA 2FDRA 4IR9A 5KT2A 1RXVA 5KFUA 8ICRA 2A3VA 5EOZA 3LYSA 4NLGA 3WKCA 2OEHA 1RXWA 9ICEA 2R8KA 3WKEA 2KJ5A 1T7PA 3H40A 4MF8A 2IOFA 3JPPA 1B43A 3HILA 9ICPA 5AHXA 3IG5A 1ZQRA 2KNJA 4ACOA 3T5HA 1SV0A 3ZDBA 5DB8A 2E8NA 5ALNA 3PSPA 5F9LA 1ECWA 1LKYA 5KT6A 2KFZA 3V7LA 4KX3A 3SAHA 2W8KA 1KFSA 4MEYA 1YZ7A 4U6PA 3PW0A 3C2MA 4I2HA 3ICXA 4F8RA 5J0PA 4Y2PA 5KL1B 1Q8KA 4UARA 5KFYA 4BUGA 4I2CA 1QSLA 4JWMA 4XUSA 2E5SA 2OCEA 3RBDA 4QZGA 4QZ8A 2G06A 3KHRA 2F3NA 1D8LA 5AKLA 4I2BA 5KT3A 3IV6A 1ZETA 5AI8A 2RDJA 8ICLA 1H38A 4IS7A 4P4MA 1ZQCA 2KTQA 2G0AA 1EXNA 4ED2A 4GXIA 2GWSA 2C2EA 5ALWA 2KIVA 4BXOA 9ICCA 3SEIA 2HBLA 3BQ2A 1Z00A 4UAUA 2AJQA 3PW2A 3OJUA 3TADA 4IC9A 4PGYA 4B9VA 1JROA 2OHFA 3V6HA 1WCLA 1BPZA 4KLIA 4MFAA 5KTQA 4YP3A 1KDHA 3PX0A 8ICCA 5EWFA 4MHVA 1S0OA 2A1JB 5HMMA 2A1AA 4CF5A 1QSYA 2YY6A 4DFMA 4Y2QA 3S6JA 5KG5A 4O3RA 3V7JA 2ODGA 5J2FA 4QJFB 5AKZA 2HHWA 1X40A 3AN1A 4FZNA 1IG6A 1ZD3A 4NLKA 4A8EA 2W9BA 3QXGA 4HYKA 4EEYA 4DL3A 5HHIA 3NVWA 4PGQA 1ZQHA 3JPQA 4KMOB 2LI6A 5B66U 1QQ6A 4NL9A 4EZ9A 4MFCA 1F0MA 5DQHA 1AROP 4GC6A 1WWVA 1QQ7A 2BZFA 7ICJA 3QEAZ 3E58A 9ICSA 3N28A 5KFPA 4ED7A 2ZXHA 1TKDA 5DBBA 1TK5A 2Q4TA 5AKIA 3HJEA 9ICMA 3I28A 1N62A 5GTIU 7ICUA 1NKCA 4EBEA 4QIWC 1ZQAA 2CPRA 2FLPA 2MU2A 2RLTA 2KV2A 3K1ZA 4GLXA 4YN4A 4RQ1A 9ICKA 4QW8A 1SIJA 2LKYA 3KHLA 3HP6A 3FC4A 4ECSA 3WK7A 3RR7A 1FEZA 3QU5A 2XO7A 5AM1A 2VANA 2K8CB 1VJ5A 8ICJA 2LM4A 1XSPA 2W3RA 1JRPA 3KFUF 2W8LA 4I2IA 5DLGA 3PY8A 1OW5A 1S0VA 3GV5B 2V9WA 5KG3A 1SGGA 4IRCA 3TI0A 1SKWA 4WJ3B 2AXTU 5DGBA 2Y0SC 4UB5A 7ICSA 2W03A 4JV0A 2JZBB 2JMGA 2XCAA 4CCHA 2YMMA 2JXJA 3BS5B 3VC8A 2YMQA 3LWMA 2MA1A 5J2HA 4UAZA 2AQ4A 1ZQKA 1S76D 1S9FA 3C21A 3AU2A 3Q8QB 4XQ8A 4RQ2A 4P2HA 4Z6DA 2ZUCA 4B9SA 5J0OA 3IDWA 2R18A 2XI9A 1SKSA 4Y2JA 4I2GA 1IM4A 4P0PB 2R8HA 5DDMA 4I2DA 4J9SA 3ORYA 2ISPA 2N1RA 2MRLA 5AICA 4QWEA 5ALVA 1MQ3A 4J9LA 4LJXA 4O3SA 3SYZA 4MEXA 2F44A 2G5IB 3HKZC 4BX9C 2HOQA 1TAMA 7ICTA 3AU6A 5KFMA 2HSZA 5HR7A 3C1YA 3KKAA 3RBEA 4KLFA 1NK4A 2NRTA 1NK6A 3M6KA 3V7KA 8ICHA 3NVVA 5KG7A 5ALFA 4Y2XA 5CWRA 1S0NA 5CR0A 3JPRA 2EZYA 2KJ9A 4CGZA 3RH4A 4K4HA 1ZQZA 1BVSA 2QARA 4CF3A 4FZLA 4C7ZA 4O5EA 1NJXA 4AYBC 2XVTA 2YTUA 5F3XB 4ZOHC 2RP5A 1C7YA 1XO0A 3KTQA 1PVPA 2BCQA 4YQWA 2PFPA 2KE7A 2QLTA 3QYPA 7ICVA 3OSPA 1J97A 3GIIA 4KLQA 4C80A 8ICFA 4Y2TA 2I5HA 5AK6A 2F8KA 3KKAC 5ALOA 1ZRMA 1QSSA 2FI1A 3KOOA 3QUQA 2O6KA 4PZOA 3BJYA 4IQWA 2KZMA 3Q8LA 3OHAA 4DFPA 3UXOA 4EYHB 2GH1A 4EYIB 4OJ5A 2OXOA 2XGQA 4FS2A 2FE9A 5KFIA 1PK1A 1XNSA 2ZIWB 4CRXA 8ICWA 5J8YC 3FM9A 3TQ1A 3CNHA 4RNOA 2VJ5A 3KZXA 2UVRA 2LBOA 5DKWA 2D8CA 4PHPA 3A0HU 5DLFA 5ALPA 1NK8A 1BPYA 3JPOA 3GQCA 2G08A 9ICWA 3PMNA 3N7SC 2QB0A 3MGIA 3QEBZ 1LV5A 5AKKA 5EWEA 5AK4A 4DFJA 3D6JA 5ALSA 4ECQA 4MF2A 5AK5A 3QZ8A 2DF4B 3M7DA 3GV7B 1MC8A 4DCCA 1ZQVA 4UAVA 4M2YA 2E1EA 4PJ0U 2H3VA 1L7PA 4XRHA 2HI0A 3THVA 3BS7A 1LVHA 9ICIA 3SZ2A 3G6XA 3ZDAA 2JGAA 1WCNA 3IN5A 5C0YA 4OO1J 5K4LA 4ICAA 8ICPA 3C5GA 5DBCA 3PVXA 1AQ6A 3UQ2A 4FFDA 1Z4OA 1SL1A 4QZIA 3C23A 1N5XA 9ICOA 4YD1A 2XGPA 4Y2YA 1XO1A 7ICKA 1SWWA 4US9A 1KBUA 1WUDA 4M9JA 4K4GA 3LDAA 4YXMA 2EZZA 3CW2C 3FDSA 3UPQA 1NOMA 4DL2A 4IL6U 5ALZA 4P0QB 1TAQA 1SZPA 5AKHA 4BWJA 1JX4A 9ICXA 8ICOA 2VKQA 2IOHA 2J6TA 2P35A 4UB1A 2G09A 1L3TA 4I29A 3H8WA 2YB1A 4KLSA 1NKBA 4RPXA 4UAWA 5J2DA 2K4PA 2K60A 1XWLA 8ICGA 4NM1A 8ICEA 3G6VA 5L1IA 5H2FU 3E2EA 4C7YA 4NV0A 4UB3A 4F2SA 4IQUA 4USAA 4ECRA 5EE9A 5DDYA 1SB3C 1NZPA 5J2KA 1V38A 3UXNA 3C28A 5KL8B 5KAFU 1TVAA 3SD7A 4RT3A 5AKJA 4RU9A 2DWQA 1S5LU 5D49A 4F91B 3N4MB 3NRZA 5J2IA 4R8UA 4DEZA 4C8LA 3T79A 9ICTA 5ALJA 2UVVA 1KEJA 1BNPA 2E8MA 4C4SA 3N7RC 1UPHA 3UMGA 3RJEA 1KFTA 1Z1VA 1XS9D 3PX4A 5DG9A 1ZQNA 3IG8A 3T5KA 3KHHA 4ED3A 4NLZA 3OJSA 4NLCA 5JTIA 2HBMA 1ZQSA 4JWNA 5IIKA 4UATA 1X9WA 3F53A 3PMLA 2ES6A 8ICZA 3I1YA 4Y2UA 3PR4A 1QH9A 2UVWA 2WHEA 4E0DA 2H3QA 4EENA 2KK0A 1NK0A 1MSWD 2RRDA 1JMSA 3U26A 2HMXA 4P4OA 5G5GA 2IBKA 2ZIXA 3D2QA 4JK1A 1X2IA 1Z1BA 4KLOA 5KFRA 2W11A 5KG6A 2V4QA 4NM2A 2BPFA 1ZQFA 1XSNA 3PR5B 4KX5A 1SWVA 1ZQOA 3GIJA 2R8GA 1ZXIA 2KMDA 1V9PA 3L4PA 2DKXA 3AL0B 2HHTA 3GU3A 1S10A 3H0MB 3AQEA 3F5AA 2W9CB 2F1JA 2BKEA 1SV0C 4NXZA 5CRXA 5AIAA 5L1KA 1NJYA 1C20A 1ZQDA 4TUPA 4CDGA 4HAIA 2ZXIA 4ELTA 3WK5A 3ETLA 1N63A 2KHQA 5CP2A 4ECVA 4QWCA 1V97A 5IILA 1ZQBA 1NZBA 2YN4A 5DG7A 2FLNA 3Q8SB 1D9FA 5JUMA 1P7DA 2XY6A 3ISDA 4KMUA 1L8LA 4F71A 1J2NA 1TE2A 1L7OA 4DSIA 3QUBA 1LKYB 4J9QA 2HHQA 4O0IA 2W04A 2YMLA 5CEHA 2WF9A 4UAYA 5J0RA 4KLEA 5J2EA 3PV8A 1X6JA 1DXSA 5KT5A 4M9NA 1VLBA 4F4KA 4C8KA 4FBUA 1JUDA 1COOA 2R8JA 1UA0A 5J29A 4UB6U 2HVIA 1DGSA 4QIWF 3K75D 2BCSA 3TACB 4C0ZA 2HBJA 4FZMA 1L7NA 2EQYA 1Z4NA 3E0FA 2NRXA 4FBTA 1WWUA 3K4GA 3TADC 3IHQB 5AI9A 4RT2A 9ICFA 5ALRA 4O9MA 1ZYQA 4NJ8A 1U9LA 4X5VA 3C5FA 4ECUA 4BXOB 1QLNA 4F50A 4I2FA 5ALIA 4QW9A 5HNKA 3F2CA 3VCBA 2GO7A 5ALTA 3PW4A 2Y9TA 1X42A 1X66A 1Z00B 1BPEA 2Y0SF 4F5RA 2BQRA 2KSOA 4JV2A 4RQ4A 1Z19A 2AGOA 1JXLA 4DQQA 1T94A 1UHUA 3RJHA 4EZ6A 2KEYA 4RQ0A 4GXKA 1ZQLA 2EAOA 5KFCA 1TFRA 3N7PD 3OHBA 5BPCA 4ZH4A 4F2RA 4NL9C 2F1HA 1ZQTA 9ICVA 4C8NA 4QWAA 5KFJA 1N2XA 7ICPA 4I2EA 5ALLA 2IA6A 3KZIU 4BDPA 4DOAA 5B5EU 5IIOA 3CP8A 1L8OA 2LPEA 2BGWA 4I27A 2W9BB 2H3IA 4RQ8A 3WK6A 3RJIA 1Y88A 1T3NA 1K1QA 2B6GA 5DG8A 1X9XA 2ZIVA 1N61A 5HHHA 4ED1A 4O3MA 7ICIA 1RZTA 2DQNB 4Z6CA 2NYVA 2G5HB 4IRDA 1PUZA 2GOLA 4DL5A 5CHGA 3PNCA 3EUB2 5AM2A 1X9MA 1DRGA 3HKZF 5CA7A 5KFKA 2BDPA 2OWOA 4B9NA 2JV3A 4YD2A 2C22A 3LVWA 8ICNA 5KFTA 4UB4A 1IIPA 4IQVA 4ECYA 4GIBA 3EWAA 1PZNA 4KLDA 1UQVA 1N48A 4YXJA 3PW5A 2W54A 2ZTEA 2DBYA 5EE0A 1FFUA 3TFSA 4RUCA 1X6IA 1K5OA 1NK7A 3C2KA 3WK9A 4QNLA 4AYBF 2FMPA 2G07A 2KOBA 4YVZA 1ZJMA 3NTUA 1A77A 2PI4A 2KVSA 3Q8MA 2ISOA 2I6XA 1MQ2A 4OJOA 4KITB 3T5LA 2DPIA 1N56A 2W55A 4Q44A 2J6SA 4GFJA 2D3DA 4YR0A 4O3PA 3H8JA 2C2DA 3NVYA 2W9MA 1KQQA 4M6WA 1KKXA 4DQRA 3WKDA 5KFDA 4DFKA 3MFIA 1ZQIA 2PFOA 1L6NA 4YFKA 2ZJ5A 4KLGA 3T3FA 2J6UA 3N97B 3NUQA 3ZDDA 3HPOA 2XICA 1GO3F 3QU4A 4Y2VA 4DLEA 9ICBA 2BQ3A 2BHNA 5J2BA 5IIJA 5KFHA 4IRKA 3UMCA 4LZDA 5GTHU 5KFBA 1SXDA 4KN4A 2CXYA 1XSLA 5AM3A 2FMSA 3SAFA 3BDPA 2YX8A 2UVUA 2BCUA 4EEKA 8ICMA 1B4FA 8ICUA 1U49A 1HIWA 2ZUDA 8ICSA 1B22A 1YT3A 3MR5A
chains in the Genus database with same CATH topology
4M47A 9ICNA 4QZFA 3UXNA 7ICGA 1TVAA 4RT3A 9ICJA 3MDCA 4NY8A 4PGYA 5D49A 4I2JA 5J2IA 3HW8A 1BPZA 4KLIA 4MFAA 1KDHA 4M04A 5BOMA 8ICCA 4YMOA 9ICTA 4Z6EA 1KEJA 8ICQA 1BNPA 8ICKA 4RQ7A 3V7JA 5J2FA 3RJEA 1ZQNA 1BPXA 4QZCA 4NLKA 3MDAA 5HHIA 4FO6A 4NLZA 4PHEA 4PGXA 4PGQA 5D46A 1ZQHA 3JPQA 1ZQSA 4JWNA 5IIKA 3PMLA 4MFCA 8ICZA 5IIMA 7ICJA 5J2GA 9ICSA 5DBAA 2BCVA 1JMSA 3TFRA 4RPZA 5DBBA 3LK9A 1ZJNA 5J0QA 7ICHA 9ICMA 3RJKA 7ICRA 4I2AA 7ICUA 4KLOA 2PFNA 1ZQAA 4TURA 5DB9A 4YN4A 4NM2A 4RQ1A 2BPFA 4KLUA 9ICKA 9ICQA 1ZQFA 1XSNA 8ICVA 1ZQOA 4GXJA 1BPDA 4DO9A 4K4IA 5D4BA 4UBBA 2FMQA 4MFFA 3RH5A 1TV9A 4TUSA 8ICJA 1XSPA 4PPXA 5DB6A 5DB7A 4UBCA 4I2IA 3JPSA 7ICLA 8ICIA 7ICNA 5J0XA 4UB5A 7ICSA 3B0YA 4RQ3A 4NXZA 4F5QA 1ZQDA 4TUPA 3HWTA 5BOLA 4F5OA 5J2AA 4KLTA 5J2HA 3UXPA 4UAZA 1ZQKA 4IQTA 5IILA 1ZQBA 3AU2A 8ICXA 4RQ2A 4P2HA 7ICEA 4R63A 4Z6DA 3ISDA 4QZ9A 4QZBA 5J2JA 5J0OA 9ICHA 4R64A 4I2GA 4UAYA 5J0RA 4KLEA 4I2DA 5J2EA 3MGHA 2ISPA 2PXIA 1ZQMA 4M9NA 3JPNA 4QZHA 2PFQA 4LVSA 1MQ3A 5TZVA 1DK3A 4KLJA 3OGUA 1HUOA 5J29A 9ICGA 2BCSA 7ICTA 1BNOA 3AU6A 4KLFA 3GDXA 3V7KA 8ICHA 7ICFA 4YMMA 7ICMA 5CWRA 4RT2A 5CB1A 3JPRA 9ICFA 4RPYA 3RH4A 4K4HA 4YCXA 4O9MA 4Z6FA 4X5VA 4O5EA 3RJFA 4DOBA 3C5FA 3JPTA 4I2FA 1ZQPA 8ICAA 4I28A 3UQ0A 3ISBA 4PH5A 1BPEA 3ISCA 4KLMA 4F5RA 5IIIA 4RQ4A 3RH6A 3RJHA 7ICQA 5J0YA 2BCQA 4RQ0A 4GXKA 1ZQLA 3RJGA 2PFPA 4M0AA 5BPCA 9ICLA 4YMNA 7ICVA 5J0WA 4KLQA 3HX0A 4F5PA 1ZQTA 9ICAA 9ICVA 2IHMA 8ICFA 7ICPA 4I2EA 4F5NA 4DOAA 5IIOA 4I27A 5J0UA 4IQWA 8ICBA 8ICTA 4RQ8A 4PHAA 5J2CA 3RJIA 4DOCA 1ZQGA 3B0XA 3UXOA 4O5CA 7ICOA 5HHHA 7ICIA 1RZTA 4Z6CA 4RQ6A 5J0TA 3C2LA 4LZGA 2BPGA 1ZQEA 3PNCA 8ICWA 5DKWA 4PHPA 4YD2A 1BPYA 4R65A 3JPOA 8ICNA 4UB4A 9ICWA 4IQVA 3PMNA 3MGIA 5IINA 4KLDA 4UB2A 3TFSA 4M9GA 9ICUA 3C2KA 4QZDA 2I9GA 4O5KA 2FMPA 4MF2A 3V72A 3RJJA 4NLNA 8ICYA 4QZAA 4M2YA 1ZJMA 4KLLA 8ICRA 5EOZA 9ICIA 9ICEA 8ICPA 2ISOA 4MF8A 3C5GA 1MQ2A 5DBCA 3JPPA 4KLHA 9ICPA 3UQ2A 1HUZA 1ZQRA 4R66A 5DB8A 1DK2A 2W9MA 1ZQQA 4QZIA 9ICOA 4YD1A 4M9HA 4M9LA 1ZQIA 2PFOA 7ICKA 4KLGA 3MBYA 3V7LA 4M9JA 4K4GA 2KP7A 9ICRA 3C2MA 4I2HA 3UPQA 5J0PA 2P66A 3AUOA 9ICXA 9ICBA 8ICOA 5J2BA 4I2CA 5IIJA 4UB1A 4LZDA 4JWMA 4XUSA 5J0SA 4I29A 1XSLA 4QZGA 4XA5A 4KLSA 4QZ8A 2FMSA 4RPXA 4QZEA 4UAWA 4I2BA 4PHDA 5J2DA 2BCRA 2BCUA 8ICGA 4NM1A 8ICMA 8ICEA 8ICUA 8ICLA 4TUQA 1ZQCA 1ZQJA 4RQ5A 8ICSA 4UB3A 4GXIA 4IQUA 2GWSA 5DDYA 1NZPA 5J2KA 9ICCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M47 A;  9ICN A;  4QZF A;  3UXN A;  7ICG A;  1TVA A;  4RT3 A;  9ICJ A;  3MDC A;  4NY8 A;  4PGY A;  5D49 A;  4I2J A;  5J2I A;  3HW8 A;  1BPZ A;  4KLI A;  4MFA A;  1KDH A;  4M04 A;  5BOM A;  8ICC A;  4YMO A;  9ICT A;  4Z6E A;  1KEJ A;  8ICQ A;  1BNP A;  8ICK A;  4RQ7 A;  3V7J A;  5J2F A;  3RJE A;  1ZQN A;  1BPX A;  4QZC A;  4NLK A;  3MDA A;  5HHI A;  4FO6 A;  4NLZ A;  4PHE A;  4PGX A;  4PGQ A;  5D46 A;  1ZQH A;  3JPQ A;  1ZQS A;  4JWN A;  5IIK A;  3PML A;  4MFC A;  8ICZ A;  5IIM A;  7ICJ A;  5J2G A;  9ICS A;  5DBA A;  2BCV A;  1JMS A;  3TFR A;  4RPZ A;  5DBB A;  3LK9 A;  1ZJN A;  5J0Q A;  7ICH A;  9ICM A;  3RJK A;  7ICR A;  4I2A A;  7ICU A;  4KLO A;  2PFN A;  1ZQA A;  4TUR A;  5DB9 A;  4YN4 A;  4NM2 A;  4RQ1 A;  2BPF A;  4KLU A;  9ICK A;  9ICQ A;  1ZQF A;  1XSN A;  8ICV A;  1ZQO A;  4GXJ A;  1BPD A;  4DO9 A;  4K4I A;  5D4B A;  4UBB A;  2FMQ A;  4MFF A;  3RH5 A;  1TV9 A;  4TUS A;  8ICJ A;  1XSP A;  4PPX A;  5DB6 A;  5DB7 A;  4UBC A;  4I2I A;  3JPS A;  7ICL A;  8ICI A;  7ICN A;  5J0X A;  4UB5 A;  7ICS A;  3B0Y A;  4RQ3 A;  4NXZ A;  4F5Q A;  1ZQD A;  4TUP A;  3HWT A;  5BOL A;  4F5O A;  5J2A A;  4KLT A;  5J2H A;  3UXP A;  4UAZ A;  1ZQK A;  4IQT A;  5IIL A;  1ZQB A;  3AU2 A;  8ICX A;  4RQ2 A;  4P2H A;  7ICE A;  4R63 A;  4Z6D A;  3ISD A;  4QZ9 A;  4QZB A;  5J2J A;  5J0O A;  9ICH A;  4R64 A;  4I2G A;  4UAY A;  5J0R A;  4KLE A;  4I2D A;  5J2E A;  3MGH A;  2ISP A;  2PXI A;  1ZQM A;  4M9N A;  3JPN A;  4QZH A;  2PFQ A;  4LVS A;  1MQ3 A;  5TZV A;  1DK3 A;  4KLJ A;  3OGU A;  1HUO A;  5J29 A;  9ICG A;  2BCS A;  7ICT A;  1BNO A;  3AU6 A;  4KLF A;  3GDX A;  3V7K A;  8ICH A;  7ICF A;  4YMM A;  7ICM A;  5CWR A;  4RT2 A;  5CB1 A;  3JPR A;  9ICF A;  4RPY A;  3RH4 A;  4K4H A;  4YCX A;  4O9M A;  4Z6F A;  4X5V A;  4O5E A;  3RJF A;  4DOB A;  3C5F A;  3JPT A;  4I2F A;  1ZQP A;  8ICA A;  4I28 A;  3UQ0 A;  3ISB A;  4PH5 A;  1BPE A;  3ISC A;  4KLM A;  4F5R A;  5III A;  4RQ4 A;  3RH6 A;  3RJH A;  7ICQ A;  5J0Y A;  2BCQ A;  4RQ0 A;  4GXK A;  1ZQL A;  3RJG A;  2PFP A;  4M0A A;  5BPC A;  9ICL A;  4YMN A;  7ICV A;  5J0W A;  4KLQ A;  3HX0 A;  4F5P A;  1ZQT A;  9ICA A;  9ICV A;  2IHM A;  8ICF A;  7ICP A;  4I2E A;  4F5N A;  4DOA A;  5IIO A;  4I27 A;  5J0U A;  4IQW A;  8ICB A;  8ICT A;  4RQ8 A;  4PHA A;  5J2C A;  3RJI A;  4DOC A;  1ZQG A;  3B0X A;  3UXO A;  4O5C A;  7ICO A;  5HHH A;  7ICI A;  1RZT A;  4Z6C A;  4RQ6 A;  5J0T A;  3C2L A;  4LZG A;  2BPG A;  1ZQE A;  3PNC A;  8ICW A;  5DKW A;  4PHP A;  4YD2 A;  1BPY A;  4R65 A;  3JPO A;  8ICN A;  4UB4 A;  9ICW A;  4IQV A;  3PMN A;  3MGI A;  5IIN A;  4KLD A;  4UB2 A;  3TFS A;  4M9G A;  9ICU A;  3C2K A;  4QZD A;  2I9G A;  4O5K A;  2FMP A;  4MF2 A;  3V72 A;  3RJJ A;  4NLN A;  8ICY A;  4QZA A;  4M2Y A;  1ZJM A;  4KLL A;  8ICR A;  5EOZ A;  9ICI A;  9ICE A;  8ICP A;  2ISO A;  4MF8 A;  3C5G A;  1MQ2 A;  5DBC A;  3JPP A;  4KLH A;  9ICP A;  3UQ2 A;  1HUZ A;  1ZQR A;  4R66 A;  5DB8 A;  1DK2 A;  2W9M A;  1ZQQ A;  4QZI A;  9ICO A;  4YD1 A;  4M9H A;  4M9L A;  1ZQI A;  2PFO A;  7ICK A;  4KLG A;  3MBY A;  3V7L A;  4M9J A;  4K4G A;  2KP7 A;  9ICR A;  3C2M A;  4I2H A;  3UPQ A;  5J0P A;  2P66 A;  3AUO A;  9ICX A;  9ICB A;  8ICO A;  5J2B A;  4I2C A;  5IIJ A;  4UB1 A;  4LZD A;  4JWM A;  4XUS A;  5J0S A;  4I29 A;  1XSL A;  4QZG A;  4XA5 A;  4KLS A;  4QZ8 A;  2FMS A;  4RPX A;  4QZE A;  4UAW A;  4I2B A;  4PHD A;  5J2D A;  2BCR A;  2BCU A;  8ICG A;  4NM1 A;  8ICM A;  8ICE A;  8ICU A;  8ICL A;  4TUQ A;  1ZQC A;  1ZQJ A;  4RQ5 A;  8ICS A;  4UB3 A;  4GXI A;  4IQU A;  2GWS A;  5DDY A;  1NZP A;  5J2K A;  9ICC A; 
#chains in the Genus database with same CATH topology
 3OPX A;  3PST A;  4M47 A;  2MUT A;  2K8B B;  5AKX A;  1F44 A;  7ICG A;  2KZZ A;  4DSK A;  2AQ0 A;  2DPJ A;  9ICJ A;  1YZ6 A;  2H5X A;  4NY8 A;  1OXJ A;  3Q8K A;  3V6K A;  4CNQ A;  4F92 B;  2QAR B;  2HHU A;  3HW8 A;  1U4B A;  4M04 A;  3SR6 A;  1N60 A;  4YMO A;  5CJ7 A;  1ZRN A;  2ZIU A;  4Z6E A;  3MGV A;  2EAM A;  1UT5 A;  4J9N A;  2L5Y A;  3GIK A;  3MAB A;  1SXE A;  4RQ7 A;  4M6W B;  3R9K A;  5ALD A;  4JV1 A;  2DKZ A;  4CF4 A;  4QZC A;  3F5E A;  2KJ8 A;  3MDA A;  3UM9 A;  5KFN A;  3EPG A;  2F2A B;  3MC1 A;  1SKR A;  2EAN A;  1U47 A;  5HML A;  3O0F A;  4DFD A;  5EE1 A;  2FJ6 A;  2ZUB A;  2DFL A;  3PO4 A;  1D8Y A;  4YG2 A;  3DEE A;  4BGD A;  4OCZ A;  3GV8 B;  5DBA A;  2JHD A;  2BCV A;  4B9M A;  4RPZ A;  1DOQ A;  3LK9 A;  4DWI A;  1XU4 A;  5KG4 A;  4I2A A;  4O3N A;  3GZF A;  4G9B A;  1PK1 B;  4ED8 A;  1WG8 A;  3J81 j;  2WF5 A;  3PW7 A;  5L1J A;  4KN7 A;  5AKG A;  3M9N B;  3H4B A;  8ICV A;  3BQ1 A;  4GXJ A;  1BPD A;  3D2N A;  5D4B A;  4UBB A;  3F2D A;  2FMQ A;  3BZK A;  3QUT A;  1F5S A;  2QKQ A;  2BDU A;  2QB0 B;  1TV9 A;  4Q45 A;  4TUS A;  5KFO A;  3KHG A;  1RYR A;  4PPX A;  5DB7 A;  7ICL A;  3JPS A;  4NLB A;  3H4D A;  2A19 A;  7ICN A;  5TIS U;  2KIC A;  2XCP A;  5KG0 A;  4EEL A;  3B0Y A;  4PZN A;  4RQ3 A;  4F5Q A;  1ZQY A;  3ZD9 A;  3SI8 A;  5KFZ A;  4EBD A;  3TAR A;  1UT8 A;  2PMZ C;  4DSF A;  5ALH A;  2RDI A;  5J2A A;  4ECZ A;  4KLT A;  3RRH A;  2ZTD A;  1TK8 A;  3UXP A;  2FPM A;  4F4X A;  4IQT A;  4DQS A;  3M8S A;  4KTQ A;  5G5H A;  2GLE A;  3BQ7 A;  1TK0 A;  1K1S A;  2VJ4 A;  1NI3 A;  7ICE A;  4TQR A;  2K8A A;  2H3Z A;  5FP0 A;  3EZ5 A;  1S77 D;  1A6S A;  4QZB A;  5J2J A;  4NWI A;  3HT3 A;  4RNM A;  4R64 A;  2LM1 A;  1D9D A;  4Y2R A;  3TAN A;  1RDF A;  4DL4 A;  1ZQM A;  3JPN A;  2PFQ A;  4LVS A;  4J9O A;  3H8M A;  5TZV A;  1JXE A;  4UB8 U;  3ETR A;  2W3S A;  3RTV A;  3WKB A;  4KLJ A;  3RFA A;  4ELU A;  1HUO A;  2E8P A;  2W7O A;  9ICG A;  2KG5 A;  4QWB A;  4DSE A;  1BNO A;  1L7M A;  4DLG A;  3UMB A;  3IM1 A;  2CRX A;  1PVQ A;  2F1I A;  5AI4 A;  3M6Z A;  3CRX A;  4GC7 A;  3GDX A;  2WB1 C;  3L3F X;  4YMM A;  3SV3 A;  5CB1 A;  3C29 A;  1S97 A;  4YCX A;  3NAS A;  1CUK A;  2NRV A;  4PL2 A;  2YMP A;  1KRP A;  4Z6F A;  3L5K A;  3OTQ A;  5KFA A;  4B9T A;  3F2B A;  3K1R B;  4DOB A;  2V4R A;  3JPT A;  2WAQ C;  4J9M A;  2A1J A;  8ICA A;  5ALE A;  3A0B U;  4PH5 A;  5KFF A;  2YB4 A;  3RH6 A;  4R8U B;  3NS1 A;  5J0Y A;  5C5J A;  4B6J A;  4ECT A;  1FFV A;  3RJG A;  1SV4 A;  4DL6 A;  2KIW A;  9ICL A;  2ZJA A;  2P6R A;  4F5P A;  2FPL A;  1ED1 A;  2RQ5 A;  3PSI A;  5JU5 A;  1S0M A;  4UAS A;  3KBB A;  4JUZ A;  8ICB A;  5KFS A;  4AP9 A;  4PHA A;  5AM5 A;  2EZX A;  2KVC A;  2KZ3 A;  4OJL A;  4DOC A;  5HP4 A;  3B0X A;  3RB6 A;  7ICO A;  3V6J A;  3AEV A;  2ASD A;  4O3O A;  4US8 A;  1KLN A;  3LVV A;  3C2L A;  2BPG A;  2IMW P;  1ZQE A;  5KFV A;  2K4H A;  2FLL A;  2AGQ A;  4F4W A;  3SV4 A;  1B0X A;  4DS5 A;  2C2R A;  4OD0 A;  3NGD A;  2QB1 A;  2F76 X;  5ALX A;  4R65 A;  3AM9 A;  3GIM A;  1X9S A;  1URJ A;  2ZIX B;  3QU2 A;  4UB2 A;  4DQI A;  3HRD D;  4B9U A;  3QZ7 A;  4EX6 A;  9ICU A;  1KSP A;  5EWG A;  4J9R A;  3ZDC A;  5F9N A;  2LHT A;  2HVH A;  3RF9 A;  2I9G A;  3KD3 A;  4O5K A;  2ALZ A;  4G3I A;  4YR3 A;  5DQG A;  4NLN A;  3RB0 A;  8ICY A;  4FE3 A;  2JZB A;  4RZR A;  2Z7J A;  4FS1 A;  1KFD A;  4OJ6 A;  4KLL A;  5ALY A;  5E79 U;  1QTM A;  3BS5 A;  3ZDE A;  2KFN A;  2KHV A;  5L1M A;  3I76 A;  1V85 A;  1D8B A;  5KT4 A;  4ECW A;  4ELV A;  3RB4 A;  3MR2 A;  1HJP A;  4KLH A;  1S8O A;  3OSN A;  1RQN A;  5KG1 A;  1Q3V A;  2HHV A;  2WFA A;  1HUZ A;  2HOF A;  5AM0 A;  4R66 A;  1VDV A;  2DUY A;  1QQ5 A;  1JIH A;  1T8E A;  3TKA A;  1DK2 A;  1ZQQ A;  1HEK A;  4M9H A;  1L5U A;  4P0P A;  2EAP A;  4M9L A;  5KFG A;  3MBY A;  2W9A A;  3ZI4 A;  4EBC A;  2KP7 A;  9ICR A;  3PO5 A;  5KAI U;  2P66 A;  3AUO A;  3WU2 U;  5KFQ A;  5KFE A;  1O03 A;  5J0S A;  3ONN A;  2JEI A;  4XA5 A;  4QZE A;  3QU7 A;  4PHD A;  2BQU A;  3M9M B;  3PX6 A;  1ZQX A;  2BCR A;  1M6Y A;  1OUQ A;  1Q3U A;  4TUQ A;  5DQI A;  1FO4 A;  1TAU A;  1NK9 A;  1ZQJ A;  1O08 A;  2H3F A;  1KL9 A;  2XC9 A;  2HHS A;  2C28 A;  4RQ5 A;  3IRU A;  1ZD4 A;  1ZD5 A;  2Q0Z X;  2HCF A;  9ICN A;  4QZF A;  4ED6 A;  4OJP A;  1CI4 A;  1LB2 B;  2VIX A;  4IR1 A;  1L3U A;  3MDC A;  4I2J A;  3B9J A;  4DF8 A;  2HBK A;  4Q43 A;  4RNN A;  5BOM A;  3RRG A;  2P6U A;  3MFH A;  1KW4 A;  2AU0 A;  8ICQ A;  4QWD A;  8ICK A;  2JEJ A;  3M8R A;  2ATL A;  3SEN A;  2W43 A;  2YQE A;  5ALQ A;  2KSO B;  5JRT A;  1XC9 A;  4DS4 A;  2KKP A;  1BPX A;  1CEZ A;  4F4Y A;  5EE3 A;  4FO6 A;  3M9O B;  4PHE A;  4F3O A;  4PGX A;  3SMV A;  5D46 A;  5AM4 A;  2E1F A;  1ZQW A;  2ZG6 A;  3EW9 A;  2PKE A;  3Q8P B;  3DDH A;  2FPK A;  5IIM A;  3G6Y A;  1J2M A;  1WYG A;  3GIL A;  1RYS A;  1NJW A;  5J2G A;  2LYH A;  2ZIW A;  3RAX A;  3H7I A;  2JRZ A;  5KFW A;  1RQL A;  1RYU A;  3TFR A;  5KFL A;  3WK4 A;  1ZJN A;  5J0Q A;  2ZIV B;  1L3S A;  7ICH A;  3RJK A;  2ASJ A;  1UCV A;  7ICR A;  2KD1 A;  4F72 A;  2LMR A;  5AI5 A;  1DGJ A;  2PFN A;  4RQN A;  2WTF A;  4TUR A;  4F4Z A;  1ZD2 P;  4YR2 A;  2WF7 A;  2OH2 A;  5DB9 A;  4KLU A;  9ICQ A;  3MR6 A;  5J8Y A;  4JB3 A;  4DO9 A;  3LWL A;  4K4I A;  2XY7 A;  4Q8E A;  3GFK B;  4DF4 A;  4MFF A;  3RH5 A;  4Q8F A;  5KNI A;  2K4I A;  3TAP A;  2AGP A;  2OYY A;  3MR3 A;  2HOI A;  2NRW A;  2AHO B;  2Y1I A;  4DQP A;  5DB6 A;  4UBC A;  1NK5 A;  2NO4 A;  2JH7 A;  5T14 A;  4J9K A;  2LYB A;  4P4P A;  4PL1 A;  8ICI A;  2JH1 A;  5J0X A;  2VA3 A;  3NRW A;  4J03 A;  1ZOL A;  3WKA A;  4Y2S A;  3RAQ A;  5ALK A;  4RQM A;  1ZQ1 C;  1BPB A;  2R8I A;  2E3T A;  2MAX A;  1KN5 A;  3HWT A;  3BQT A;  3AMZ A;  2WF8 A;  5BOL A;  3WK8 A;  5AKE A;  4F5O A;  1JI7 A;  2D6F C;  5AI0 A;  1BGX T;  2NRZ A;  2M9N A;  1N5W A;  4C4R A;  3Q8R B;  2E8O A;  5KT7 A;  3CYM A;  2VA2 A;  2I1Q A;  8ICX A;  4P0Q A;  4R63 A;  2CN1 A;  3M1Y A;  4BJQ A;  4QZ9 A;  3TAQ A;  4B9L A;  2BPC A;  4TQS A;  2NV3 A;  2XID A;  9ICH A;  2DGZ A;  2M0N A;  2Y9U A;  2HHX A;  3MGH A;  2PXI A;  4QZH A;  2B21 A;  2K89 A;  1U48 A;  3C1Z A;  4CE6 A;  3QE9 Y;  1DK3 A;  3QU9 A;  3RR8 A;  2EDU A;  4C4T A;  3OGU A;  2F77 X;  3ZD8 A;  1JN3 A;  2K4E A;  2KKV A;  4EX7 A;  5ALG A;  2VA8 A;  2PI5 A;  5L1L A;  2ESE A;  1JAL A;  3H0L B;  2ASL A;  5ALM A;  3ALR A;  3FAH A;  1Q46 A;  7ICF A;  7ICM A;  4RPY A;  1MN8 A;  5KG2 A;  1QCK A;  1RG6 A;  1NJZ A;  1MA7 A;  3AQF A;  1SZH A;  1T3Q A;  3DV9 A;  1RM6 C;  5A0L A;  1PVR A;  3RJF A;  5AK3 A;  2W7P A;  2LYA A;  4O3Q A;  2MUT B;  2MSN A;  1ZQP A;  3SQI A;  4I28 A;  1ZQU A;  3BQ0 A;  1FIQ A;  1NKE A;  1CRX A;  3BZC A;  3UQ0 A;  3ISB A;  3T5J A;  3ISC A;  4KLM A;  5III A;  1SL2 A;  4C8O A;  4J9P A;  1PK3 A;  7ICQ A;  1COK A;  2ZTC A;  3PZP A;  4C8M A;  4DL7 A;  2PMZ F;  4M0A A;  4YMN A;  2ZIU B;  2JR5 A;  5J0W A;  4U7C A;  3QNM A;  3HX0 A;  1RPL A;  3IP4 B;  9ICA A;  2IHM A;  3EYZ A;  4F5N A;  5KFX A;  3QX7 A;  3RB3 A;  2ZJ8 A;  3ED5 A;  2DL0 A;  5J0U A;  4JMU A;  5L9X A;  8ICT A;  1NNL A;  2IHN A;  2F8L A;  5J2C A;  1ZQG A;  1T4G A;  4BWM A;  4O5C A;  3H8S A;  5AKY A;  2JEG A;  5AI6 A;  3QUC A;  1UA1 A;  4F93 B;  2B0C A;  4RQ6 A;  5J0T A;  4LZG A;  2JEF A;  4UQG A;  5HR6 A;  2EH9 A;  2KN7 A;  2AH5 A;  1A0P A;  1IV8 A;  1SL0 A;  2RHF A;  4ED0 A;  3H0R B;  5ALU A;  4DSJ A;  1IXR A;  1L3V A;  3NVZ A;  3FYH A;  1Z3E B;  5AIB A;  5IIN A;  2WB1 F;  4RUA A;  1U45 A;  4UW9 A;  2HW3 A;  4M9G A;  2BR0 A;  2OM6 A;  2Y1J A;  5DGA A;  4DSL A;  1A76 A;  2WF6 A;  4QZD A;  2HDO A;  2NO5 A;  2W9C A;  3PSF A;  3D2S A;  3EPI A;  2IOF K;  3V72 A;  2WAQ F;  2XY5 A;  1KTQ A;  4ECX A;  3RJJ A;  3SAG A;  4QZA A;  2FDR A;  4IR9 A;  5KT2 A;  1RXV A;  5KFU A;  8ICR A;  2A3V A;  5EOZ A;  3LYS A;  4NLG A;  3WKC A;  2OEH A;  1RXW A;  9ICE A;  2R8K A;  3WKE A;  2KJ5 A;  1T7P A;  3H40 A;  4MF8 A;  2IOF A;  3JPP A;  1B43 A;  3HIL A;  9ICP A;  5AHX A;  3IG5 A;  1ZQR A;  2KNJ A;  4ACO A;  3T5H A;  1SV0 A;  3ZDB A;  5DB8 A;  2E8N A;  5ALN A;  3PSP A;  5F9L A;  1ECW A;  1LKY A;  5KT6 A;  2KFZ A;  3V7L A;  4KX3 A;  3SAH A;  2W8K A;  1KFS A;  4MEY A;  1YZ7 A;  4U6P A;  3PW0 A;  3C2M A;  4I2H A;  3ICX A;  4F8R A;  5J0P A;  4Y2P A;  5KL1 B;  1Q8K A;  4UAR A;  5KFY A;  4BUG A;  4I2C A;  1QSL A;  4JWM A;  4XUS A;  2E5S A;  2OCE A;  3RBD A;  4QZG A;  4QZ8 A;  2G06 A;  3KHR A;  2F3N A;  1D8L A;  5AKL A;  4I2B A;  5KT3 A;  3IV6 A;  1ZET A;  5AI8 A;  2RDJ A;  8ICL A;  1H38 A;  4IS7 A;  4P4M A;  1ZQC A;  2KTQ A;  2G0A A;  1EXN A;  4ED2 A;  4GXI A;  2GWS A;  2C2E A;  5ALW A;  2KIV A;  4BXO A;  9ICC A;  3SEI A;  2HBL A;  3BQ2 A;  1Z00 A;  4UAU A;  2AJQ A;  3PW2 A;  3OJU A;  3TAD A;  4IC9 A;  4PGY A;  4B9V A;  1JRO A;  2OHF A;  3V6H A;  1WCL A;  1BPZ A;  4KLI A;  4MFA A;  5KTQ A;  4YP3 A;  1KDH A;  3PX0 A;  8ICC A;  5EWF A;  4MHV A;  1S0O A;  2A1J B;  5HMM A;  2A1A A;  4CF5 A;  1QSY A;  2YY6 A;  4DFM A;  4Y2Q A;  3S6J A;  5KG5 A;  4O3R A;  3V7J A;  2ODG A;  5J2F A;  4QJF B;  5AKZ A;  2HHW A;  1X40 A;  3AN1 A;  4FZN A;  1IG6 A;  1ZD3 A;  4NLK A;  4A8E A;  2W9B A;  3QXG A;  4HYK A;  4EEY A;  4DL3 A;  5HHI A;  3NVW A;  4PGQ A;  1ZQH A;  3JPQ A;  4KMO B;  2LI6 A;  5B66 U;  1QQ6 A;  4NL9 A;  4EZ9 A;  4MFC A;  1F0M A;  5DQH A;  1ARO P;  4GC6 A;  1WWV A;  1QQ7 A;  2BZF A;  7ICJ A;  3QEA Z;  3E58 A;  9ICS A;  3N28 A;  5KFP A;  4ED7 A;  2ZXH A;  1TKD A;  5DBB A;  1TK5 A;  2Q4T A;  5AKI A;  3HJE A;  9ICM A;  3I28 A;  1N62 A;  5GTI U;  7ICU A;  1NKC A;  4EBE A;  4QIW C;  1ZQA A;  2CPR A;  2FLP A;  2MU2 A;  2RLT A;  2KV2 A;  3K1Z A;  4GLX A;  4YN4 A;  4RQ1 A;  9ICK A;  4QW8 A;  1SIJ A;  2LKY A;  3KHL A;  3HP6 A;  3FC4 A;  4ECS A;  3WK7 A;  3RR7 A;  1FEZ A;  3QU5 A;  2XO7 A;  5AM1 A;  2VAN A;  2K8C B;  1VJ5 A;  8ICJ A;  2LM4 A;  1XSP A;  2W3R A;  1JRP A;  3KFU F;  2W8L A;  4I2I A;  5DLG A;  3PY8 A;  1OW5 A;  1S0V A;  3GV5 B;  2V9W A;  5KG3 A;  1SGG A;  4IRC A;  3TI0 A;  1SKW A;  4WJ3 B;  2AXT U;  5DGB A;  2Y0S C;  4UB5 A;  7ICS A;  2W03 A;  4JV0 A;  2JZB B;  2JMG A;  2XCA A;  4CCH A;  2YMM A;  2JXJ A;  3BS5 B;  3VC8 A;  2YMQ A;  3LWM A;  2MA1 A;  5J2H A;  4UAZ A;  2AQ4 A;  1ZQK A;  1S76 D;  1S9F A;  3C21 A;  3AU2 A;  3Q8Q B;  4XQ8 A;  4RQ2 A;  4P2H A;  4Z6D A;  2ZUC A;  4B9S A;  5J0O A;  3IDW A;  2R18 A;  2XI9 A;  1SKS A;  4Y2J A;  4I2G A;  1IM4 A;  4P0P B;  2R8H A;  5DDM A;  4I2D A;  4J9S A;  3ORY A;  2ISP A;  2N1R A;  2MRL A;  5AIC A;  4QWE A;  5ALV A;  1MQ3 A;  4J9L A;  4LJX A;  4O3S A;  3SYZ A;  4MEX A;  2F44 A;  2G5I B;  3HKZ C;  4BX9 C;  2HOQ A;  1TAM A;  7ICT A;  3AU6 A;  5KFM A;  2HSZ A;  5HR7 A;  3C1Y A;  3KKA A;  3RBE A;  4KLF A;  1NK4 A;  2NRT A;  1NK6 A;  3M6K A;  3V7K A;  8ICH A;  3NVV A;  5KG7 A;  5ALF A;  4Y2X A;  5CWR A;  1S0N A;  5CR0 A;  3JPR A;  2EZY A;  2KJ9 A;  4CGZ A;  3RH4 A;  4K4H A;  1ZQZ A;  1BVS A;  2QAR A;  4CF3 A;  4FZL A;  4C7Z A;  4O5E A;  1NJX A;  4AYB C;  2XVT A;  2YTU A;  5F3X B;  4ZOH C;  2RP5 A;  1C7Y A;  1XO0 A;  3KTQ A;  1PVP A;  2BCQ A;  4YQW A;  2PFP A;  2KE7 A;  2QLT A;  3QYP A;  7ICV A;  3OSP A;  1J97 A;  3GII A;  4KLQ A;  4C80 A;  8ICF A;  4Y2T A;  2I5H A;  5AK6 A;  2F8K A;  3KKA C;  5ALO A;  1ZRM A;  1QSS A;  2FI1 A;  3KOO A;  3QUQ A;  2O6K A;  4PZO A;  3BJY A;  4IQW A;  2KZM A;  3Q8L A;  3OHA A;  4DFP A;  3UXO A;  4EYH B;  2GH1 A;  4EYI B;  4OJ5 A;  2OXO A;  2XGQ A;  4FS2 A;  2FE9 A;  5KFI A;  1PK1 A;  1XNS A;  2ZIW B;  4CRX A;  8ICW A;  5J8Y C;  3FM9 A;  3TQ1 A;  3CNH A;  4RNO A;  2VJ5 A;  3KZX A;  2UVR A;  2LBO A;  5DKW A;  2D8C A;  4PHP A;  3A0H U;  5DLF A;  5ALP A;  1NK8 A;  1BPY A;  3JPO A;  3GQC A;  2G08 A;  9ICW A;  3PMN A;  3N7S C;  2QB0 A;  3MGI A;  3QEB Z;  1LV5 A;  5AKK A;  5EWE A;  5AK4 A;  4DFJ A;  3D6J A;  5ALS A;  4ECQ A;  4MF2 A;  5AK5 A;  3QZ8 A;  2DF4 B;  3M7D A;  3GV7 B;  1MC8 A;  4DCC A;  1ZQV A;  4UAV A;  4M2Y A;  2E1E A;  4PJ0 U;  2H3V A;  1L7P A;  4XRH A;  2HI0 A;  3THV A;  3BS7 A;  1LVH A;  9ICI A;  3SZ2 A;  3G6X A;  3ZDA A;  2JGA A;  1WCN A;  3IN5 A;  5C0Y A;  4OO1 J;  5K4L A;  4ICA A;  8ICP A;  3C5G A;  5DBC A;  3PVX A;  1AQ6 A;  3UQ2 A;  4FFD A;  1Z4O A;  1SL1 A;  4QZI A;  3C23 A;  1N5X A;  9ICO A;  4YD1 A;  2XGP A;  4Y2Y A;  1XO1 A;  7ICK A;  1SWW A;  4US9 A;  1KBU A;  1WUD A;  4M9J A;  4K4G A;  3LDA A;  4YXM A;  2EZZ A;  3CW2 C;  3FDS A;  3UPQ A;  1NOM A;  4DL2 A;  4IL6 U;  5ALZ A;  4P0Q B;  1TAQ A;  1SZP A;  5AKH A;  4BWJ A;  1JX4 A;  9ICX A;  8ICO A;  2VKQ A;  2IOH A;  2J6T A;  2P35 A;  4UB1 A;  2G09 A;  1L3T A;  4I29 A;  3H8W A;  2YB1 A;  4KLS A;  1NKB A;  4RPX A;  4UAW A;  5J2D A;  2K4P A;  2K60 A;  1XWL A;  8ICG A;  4NM1 A;  8ICE A;  3G6V A;  5L1I A;  5H2F U;  3E2E A;  4C7Y A;  4NV0 A;  4UB3 A;  4F2S A;  4IQU A;  4USA A;  4ECR A;  5EE9 A;  5DDY A;  1SB3 C;  1NZP A;  5J2K A;  1V38 A;  3UXN A;  3C28 A;  5KL8 B;  5KAF U;  1TVA A;  3SD7 A;  4RT3 A;  5AKJ A;  4RU9 A;  2DWQ A;  1S5L U;  5D49 A;  4F91 B;  3N4M B;  3NRZ A;  5J2I A;  4R8U A;  4DEZ A;  4C8L A;  3T79 A;  9ICT A;  5ALJ A;  2UVV A;  1KEJ A;  1BNP A;  2E8M A;  4C4S A;  3N7R C;  1UPH A;  3UMG A;  3RJE A;  1KFT A;  1Z1V A;  1XS9 D;  3PX4 A;  5DG9 A;  1ZQN A;  3IG8 A;  3T5K A;  3KHH A;  4ED3 A;  4NLZ A;  3OJS A;  4NLC A;  5JTI A;  2HBM A;  1ZQS A;  4JWN A;  5IIK A;  4UAT A;  1X9W A;  3F53 A;  3PML A;  2ES6 A;  8ICZ A;  3I1Y A;  4Y2U A;  3PR4 A;  1QH9 A;  2UVW A;  2WHE A;  4E0D A;  2H3Q A;  4EEN A;  2KK0 A;  1NK0 A;  1MSW D;  2RRD A;  1JMS A;  3U26 A;  2HMX A;  4P4O A;  5G5G A;  2IBK A;  2ZIX A;  3D2Q A;  4JK1 A;  1X2I A;  1Z1B A;  4KLO A;  5KFR A;  2W11 A;  5KG6 A;  2V4Q A;  4NM2 A;  2BPF A;  1ZQF A;  1XSN A;  3PR5 B;  4KX5 A;  1SWV A;  1ZQO A;  3GIJ A;  2R8G A;  1ZXI A;  2KMD A;  1V9P A;  3L4P A;  2DKX A;  3AL0 B;  2HHT A;  3GU3 A;  1S10 A;  3H0M B;  3AQE A;  3F5A A;  2W9C B;  2F1J A;  2BKE A;  1SV0 C;  4NXZ A;  5CRX A;  5AIA A;  5L1K A;  1NJY A;  1C20 A;  1ZQD A;  4TUP A;  4CDG A;  4HAI A;  2ZXI A;  4ELT A;  3WK5 A;  3ETL A;  1N63 A;  2KHQ A;  5CP2 A;  4ECV A;  4QWC A;  1V97 A;  5IIL A;  1ZQB A;  1NZB A;  2YN4 A;  5DG7 A;  2FLN A;  3Q8S B;  1D9F A;  5JUM A;  1P7D A;  2XY6 A;  3ISD A;  4KMU A;  1L8L A;  4F71 A;  1J2N A;  1TE2 A;  1L7O A;  4DSI A;  3QUB A;  1LKY B;  4J9Q A;  2HHQ A;  4O0I A;  2W04 A;  2YML A;  5CEH A;  2WF9 A;  4UAY A;  5J0R A;  4KLE A;  5J2E A;  3PV8 A;  1X6J A;  1DXS A;  5KT5 A;  4M9N A;  1VLB A;  4F4K A;  4C8K A;  4FBU A;  1JUD A;  1COO A;  2R8J A;  1UA0 A;  5J29 A;  4UB6 U;  2HVI A;  1DGS A;  4QIW F;  3K75 D;  2BCS A;  3TAC B;  4C0Z A;  2HBJ A;  4FZM A;  1L7N A;  2EQY A;  1Z4N A;  3E0F A;  2NRX A;  4FBT A;  1WWU A;  3K4G A;  3TAD C;  3IHQ B;  5AI9 A;  4RT2 A;  9ICF A;  5ALR A;  4O9M A;  1ZYQ A;  4NJ8 A;  1U9L A;  4X5V A;  3C5F A;  4ECU A;  4BXO B;  1QLN A;  4F50 A;  4I2F A;  5ALI A;  4QW9 A;  5HNK A;  3F2C A;  3VCB A;  2GO7 A;  5ALT A;  3PW4 A;  2Y9T A;  1X42 A;  1X66 A;  1Z00 B;  1BPE A;  2Y0S F;  4F5R A;  2BQR A;  2KSO A;  4JV2 A;  4RQ4 A;  1Z19 A;  2AGO A;  1JXL A;  4DQQ A;  1T94 A;  1UHU A;  3RJH A;  4EZ6 A;  2KEY A;  4RQ0 A;  4GXK A;  1ZQL A;  2EAO A;  5KFC A;  1TFR A;  3N7P D;  3OHB A;  5BPC A;  4ZH4 A;  4F2R A;  4NL9 C;  2F1H A;  1ZQT A;  9ICV A;  4C8N A;  4QWA A;  5KFJ A;  1N2X A;  7ICP A;  4I2E A;  5ALL A;  2IA6 A;  3KZI U;  4BDP A;  4DOA A;  5B5E U;  5IIO A;  3CP8 A;  1L8O A;  2LPE A;  2BGW A;  4I27 A;  2W9B B;  2H3I A;  4RQ8 A;  3WK6 A;  3RJI A;  1Y88 A;  1T3N A;  1K1Q A;  2B6G A;  5DG8 A;  1X9X A;  2ZIV A;  1N61 A;  5HHH A;  4ED1 A;  4O3M A;  7ICI A;  1RZT A;  2DQN B;  4Z6C A;  2NYV A;  2G5H B;  4IRD A;  1PUZ A;  2GOL A;  4DL5 A;  5CHG A;  3PNC A;  3EUB 2;  5AM2 A;  1X9M A;  1DRG A;  3HKZ F;  5CA7 A;  5KFK A;  2BDP A;  2OWO A;  4B9N A;  2JV3 A;  4YD2 A;  2C22 A;  3LVW A;  8ICN A;  5KFT A;  4UB4 A;  1IIP A;  4IQV A;  4ECY A;  4GIB A;  3EWA A;  1PZN A;  4KLD A;  1UQV A;  1N48 A;  4YXJ A;  3PW5 A;  2W54 A;  2ZTE A;  2DBY A;  5EE0 A;  1FFU A;  3TFS A;  4RUC A;  1X6I A;  1K5O A;  1NK7 A;  3C2K A;  3WK9 A;  4QNL A;  4AYB F;  2FMP A;  2G07 A;  2KOB A;  4YVZ A;  1ZJM A;  3NTU A;  1A77 A;  2PI4 A;  2KVS A;  3Q8M A;  2ISO A;  2I6X A;  1MQ2 A;  4OJO A;  4KIT B;  3T5L A;  2DPI A;  1N56 A;  2W55 A;  4Q44 A;  2J6S A;  4GFJ A;  2D3D A;  4YR0 A;  4O3P A;  3H8J A;  2C2D A;  3NVY A;  2W9M A;  1KQQ A;  4M6W A;  1KKX A;  4DQR A;  3WKD A;  5KFD A;  4DFK A;  3MFI A;  1ZQI A;  2PFO A;  1L6N A;  4YFK A;  2ZJ5 A;  4KLG A;  3T3F A;  2J6U A;  3N97 B;  3NUQ A;  3ZDD A;  3HPO A;  2XIC A;  1GO3 F;  3QU4 A;  4Y2V A;  4DLE A;  9ICB A;  2BQ3 A;  2BHN A;  5J2B A;  5IIJ A;  5KFH A;  4IRK A;  3UMC A;  4LZD A;  5GTH U;  5KFB A;  1SXD A;  4KN4 A;  2CXY A;  1XSL A;  5AM3 A;  2FMS A;  3SAF A;  3BDP A;  2YX8 A;  2UVU A;  2BCU A;  4EEK A;  8ICM A;  1B4F A;  8ICU A;  1U49 A;  1HIW A;  2ZUD A;  8ICS A;  1B22 A;  1YT3 A;  3MR5 A; 
#chains in the Genus database with same CATH homology
 4M47 A;  9ICN A;  4QZF A;  3UXN A;  7ICG A;  1TVA A;  4RT3 A;  9ICJ A;  3MDC A;  4NY8 A;  4PGY A;  5D49 A;  4I2J A;  5J2I A;  3HW8 A;  1BPZ A;  4KLI A;  4MFA A;  1KDH A;  4M04 A;  5BOM A;  8ICC A;  4YMO A;  9ICT A;  4Z6E A;  1KEJ A;  8ICQ A;  1BNP A;  8ICK A;  4RQ7 A;  3V7J A;  5J2F A;  3RJE A;  1ZQN A;  1BPX A;  4QZC A;  4NLK A;  3MDA A;  5HHI A;  4FO6 A;  4NLZ A;  4PHE A;  4PGX A;  4PGQ A;  5D46 A;  1ZQH A;  3JPQ A;  1ZQS A;  4JWN A;  5IIK A;  3PML A;  4MFC A;  8ICZ A;  5IIM A;  7ICJ A;  5J2G A;  9ICS A;  5DBA A;  2BCV A;  1JMS A;  3TFR A;  4RPZ A;  5DBB A;  3LK9 A;  1ZJN A;  5J0Q A;  7ICH A;  9ICM A;  3RJK A;  7ICR A;  4I2A A;  7ICU A;  4KLO A;  2PFN A;  1ZQA A;  4TUR A;  5DB9 A;  4YN4 A;  4NM2 A;  4RQ1 A;  2BPF A;  4KLU A;  9ICK A;  9ICQ A;  1ZQF A;  1XSN A;  8ICV A;  1ZQO A;  4GXJ A;  1BPD A;  4DO9 A;  4K4I A;  5D4B A;  4UBB A;  2FMQ A;  4MFF A;  3RH5 A;  1TV9 A;  4TUS A;  8ICJ A;  1XSP A;  4PPX A;  5DB6 A;  5DB7 A;  4UBC A;  4I2I A;  3JPS A;  7ICL A;  8ICI A;  7ICN A;  5J0X A;  4UB5 A;  7ICS A;  3B0Y A;  4RQ3 A;  4NXZ A;  4F5Q A;  1ZQD A;  4TUP A;  3HWT A;  5BOL A;  4F5O A;  5J2A A;  4KLT A;  5J2H A;  3UXP A;  4UAZ A;  1ZQK A;  4IQT A;  5IIL A;  1ZQB A;  3AU2 A;  8ICX A;  4RQ2 A;  4P2H A;  7ICE A;  4R63 A;  4Z6D A;  3ISD A;  4QZ9 A;  4QZB A;  5J2J A;  5J0O A;  9ICH A;  4R64 A;  4I2G A;  4UAY A;  5J0R A;  4KLE A;  4I2D A;  5J2E A;  3MGH A;  2ISP A;  2PXI A;  1ZQM A;  4M9N A;  3JPN A;  4QZH A;  2PFQ A;  4LVS A;  1MQ3 A;  5TZV A;  1DK3 A;  4KLJ A;  3OGU A;  1HUO A;  5J29 A;  9ICG A;  2BCS A;  7ICT A;  1BNO A;  3AU6 A;  4KLF A;  3GDX A;  3V7K A;  8ICH A;  7ICF A;  4YMM A;  7ICM A;  5CWR A;  4RT2 A;  5CB1 A;  3JPR A;  9ICF A;  4RPY A;  3RH4 A;  4K4H A;  4YCX A;  4O9M A;  4Z6F A;  4X5V A;  4O5E A;  3RJF A;  4DOB A;  3C5F A;  3JPT A;  4I2F A;  1ZQP A;  8ICA A;  4I28 A;  3UQ0 A;  3ISB A;  4PH5 A;  1BPE A;  3ISC A;  4KLM A;  4F5R A;  5III A;  4RQ4 A;  3RH6 A;  3RJH A;  7ICQ A;  5J0Y A;  2BCQ A;  4RQ0 A;  4GXK A;  1ZQL A;  3RJG A;  2PFP A;  4M0A A;  5BPC A;  9ICL A;  4YMN A;  7ICV A;  5J0W A;  4KLQ A;  3HX0 A;  4F5P A;  1ZQT A;  9ICA A;  9ICV A;  2IHM A;  8ICF A;  7ICP A;  4I2E A;  4F5N A;  4DOA A;  5IIO A;  4I27 A;  5J0U A;  4IQW A;  8ICB A;  8ICT A;  4RQ8 A;  4PHA A;  5J2C A;  3RJI A;  4DOC A;  1ZQG A;  3B0X A;  3UXO A;  4O5C A;  7ICO A;  5HHH A;  7ICI A;  1RZT A;  4Z6C A;  4RQ6 A;  5J0T A;  3C2L A;  4LZG A;  2BPG A;  1ZQE A;  3PNC A;  8ICW A;  5DKW A;  4PHP A;  4YD2 A;  1BPY A;  4R65 A;  3JPO A;  8ICN A;  4UB4 A;  9ICW A;  4IQV A;  3PMN A;  3MGI A;  5IIN A;  4KLD A;  4UB2 A;  3TFS A;  4M9G A;  9ICU A;  3C2K A;  4QZD A;  2I9G A;  4O5K A;  2FMP A;  4MF2 A;  3V72 A;  3RJJ A;  4NLN A;  8ICY A;  4QZA A;  4M2Y A;  1ZJM A;  4KLL A;  8ICR A;  5EOZ A;  9ICI A;  9ICE A;  8ICP A;  2ISO A;  4MF8 A;  3C5G A;  1MQ2 A;  5DBC A;  3JPP A;  4KLH A;  9ICP A;  3UQ2 A;  1HUZ A;  1ZQR A;  4R66 A;  5DB8 A;  1DK2 A;  2W9M A;  1ZQQ A;  4QZI A;  9ICO A;  4YD1 A;  4M9H A;  4M9L A;  1ZQI A;  2PFO A;  7ICK A;  4KLG A;  3MBY A;  3V7L A;  4M9J A;  4K4G A;  2KP7 A;  9ICR A;  3C2M A;  4I2H A;  3UPQ A;  5J0P A;  2P66 A;  3AUO A;  9ICX A;  9ICB A;  8ICO A;  5J2B A;  4I2C A;  5IIJ A;  4UB1 A;  4LZD A;  4JWM A;  4XUS A;  5J0S A;  4I29 A;  1XSL A;  4QZG A;  4XA5 A;  4KLS A;  4QZ8 A;  2FMS A;  4RPX A;  4QZE A;  4UAW A;  4I2B A;  4PHD A;  5J2D A;  2BCR A;  2BCU A;  8ICG A;  4NM1 A;  8ICM A;  8ICE A;  8ICU A;  8ICL A;  4TUQ A;  1ZQC A;  1ZQJ A;  4RQ5 A;  8ICS A;  4UB3 A;  4GXI A;  4IQU A;  2GWS A;  5DDY A;  1NZP A;  5J2K A;  9ICC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...