1BOGA

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-homologous peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
b'DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGTASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY (CB 4-1)
molecule tags Complex (antibody/peptide)
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1998-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogA01
1JI1A 5JXAL 1IM3B 3QRGH 4Z77A 2NY2C 3C2AL 3MRNA 4FFYL 1LK3L 2QR0B 2NY0D 3Q6GL 4DGVL 3AAZA 5C9JB 4LDOB 1IC5L 1PW3A 2Y9RT 1KTLB 3GHBH 1K5NB 1DDHB 1SYSB 3WFHB 4LCUB 2BVOB 4B50A 1OP5H 5JXEA 4PRNB 5BS0E 1KACB 5T1LB 1C7TA 4Q2ZA 4H88L 2GHWB 4LSVL 4OSUH 1OAKH 3OG6B 3OL2A 5E8OB 3QR2A 1A1NA 1C1EL 4DKAA 1NCNA 2AJXL 3P9LB 3LKRB 3KPNA 5D7LD 2XWTA 5IQ7H 4DJMA 3KYMB 4UINL 2G9HB 1CDCA 1A9EB 4ZTPH 2MTPA 4P2RB 5I1GH 2Y6SD 4EVNA 5BZWB 3TBSB 1KOAA 1P5UA 4LKCB 1VFUA 5GGRA 2X7LB 2XPGA 3JUYA 4LEXH 3K8LA 5E56A 2NY7L 3O3UN 4OLUH 4D0DA 1I7TA 2ESVE 4M48H 4U6VL 5KVDL 2P5EB 2VXTL 4LIQH 5EZIL 3IFNL 3CGTA 1HH9B 2K3TA 1AXSA 4U4BA 1S8DB 3HAEG 3FCTB 4NZJA 5FKPB 5B4MC 2X6MA 1E4KA 2FL5B 5EU4A 2J8OA 2NTFB 5F1OB 5D9SB 3NPZB 2V2TA 4LVOB 5CJ5A 2ESVA 1MELA 4HX1A 2A6KA 3QCUH 1ZV5A 4QYOA 4U6YB 3TVMD 4NNYA 2DYPD 4E41A 4M8QA 3HE7B 4MAYD 1CGSH 1R3IH 5KZCD 3MTRA 2FECI 4FQJH 4JFXB 4JY4A 1RD6A 3DNKA 5ENWB 1OVZA 2XY1A 3HHRB 4WJ5A 3BOVA 5FKPA 4Z0BL 4L5FL 1I8LA 5F7LB 2Q6WB 5EU4B 2X4OA 5FGRA 3OKLA 4OIIL 3EDEA 2NTFA 5D96B 5DUBA 3VFGH 1D9KA 2CK0H 3IETA 3MV9E 4XP6H 5H94B 4LSTL 3VFVA 4O5LH 4R7DB 2IAMC 3JV6B 4QTHA 4DW2L 2XOTA 3JTTB 4L9DA 3BZFB 2BVEA 5GSVB 2C3XA 3S35L 4AL8H 1FIGH 3O9WB 5HYEA 8FABA 2F5BH 3RTQC 4P0DA 4J1UB 5EUKA 2H3NB 1OWWA 5ILTL 3OG4B 4HEPG 4FNLL 2VDML 2NY1B 1FDLH 3PWVA 4QTIH 1U8HB 1A7RH 1UEYA 5IOPB 3QEQA 3MBEC 2XWBB 3RVUC 4FQ2H 2MPAH 4YNYB 4M00A 2EDNA 4WFEE 2V9QA 5EU7C 2GSGA 3FO2B 1ZLWH 4X80L 2ED7A 3NACL 1E28B 3PQYB 2ZUWA 2UY6A 3CFKB 3SHSA 4NRXB 1DANU 5J4MA 4K55A 1FVEA 4J4PD 3G6JA 2EE3A 4XVSL 5FOBA 2XNAA 3MC0A 4G6MH 2AV1A 2XG4A 5DI8A 4WFHD 5IQ9A 4M9OA 3MRMB 4HF5L 1P1ZA 5GGVH 5GHWL 3PUCA 3PWVB 6FABL 3V7MA 3G5XB 1TETH 1BFTA 1N59B 2AV7B 4WFFD 1K3ZA 3JBG7 4XBPA 4CVZA 4WU5A 4OLZH 4YIQB 1F02I 4GW1A 3T0DA 3TIDB 4HG4K 4JG1L 3BIAX 3D18B 5H37H 3R8BB 4Z7UE 5BV7H 5HPMB 1AHWB 2BNQD 2WQ8A 3OXSB 4P3CH 3RGVA 3VMNA 3FT2A 4YBLB 4O4YL 1FVEB 4E42A 3IDIA 1MJ8H 2D7OA 1ZA3B 3MV01 3QDHA 1CTNA 3T0BA 2AV1B 2VAAA 5I73B 4N1CA 3U4EA 1CGTA 1I7UB 3V5HA 4H1LG 1R5VB 1PQZB 1JMXA 5BO1L 2ZCKH 2UY7A 5C0RL 1AD9A 1NGZB 1BFVH 4ZOBA 1CZ8H 2AQ1A 1HI6B 3G6JF 3ZSSA 4OUUA 4F15B 2KUTA 4MLSA 4ENED 4EEEA 3CZFA 2DDQL 2OTUA 3BEWA 4JFFB 1G9NL 2ZUQC 4HAGA 5HHPA 3MYJB 5K9QI 2XZCL 1IGTB 4MXWH 4LLWA 1JPFB 2YD2A 3C5JB 4OLYH 4P46B 2N7BA 1AIFB 3QPQD 3ELAT 5FA3B 1NCAH 4ODSL 4ZTOL 3VFOB 3GSXA 5SWZA 2CR3A 4BZ2H 3OKDA 2A83B 4QF1B 2BVUA 4JRXD 3D85A 4JG1H 1T04B 1C08B 5IROC 1KC5H 3P4LA 3VG0L 2AQ3A 4N0FA 5D2LB 5HYQA 4G8GE 2EDJA 5HDQL 4XPHL 3WFZA 3BEWB 4JFFA 1YEKH 3IRPX 5IR1A 2WAHA 4C4KO 3TJEL 1CF8L 1HZHL 3LIZH 4LLWB 4KI1A 3ARFC 1HYRC 4S1DD 2VXQH 3WNOA 1O7VA 2HKHH 2XFXA 3KJ4C 1Q94B 3QHFH 3L7FB 4P2OD 4GW4B 4P2QD 1HH6A 2WBJD 4ZUSA 4Q6IB 4LHJB 3ZE1E 4NCC2 5FUOH 4GRLB 3B2UC 4JFOB 2EIDA 2APFA 4MSWB 2RAMA 5DD1H 5TE4H 5HGBA 3S9DB 1J86A 2CKBL 4N0FB 1L7IH 3H9SA 3QHTC 3B9DA 4CMMA 3OZ9H 2JK5A 3R06B 1FNAA 2ZG2A 4FXGA 1P7QB 4PRAB 3S3SA 1V7ML 4F2MA 3EYOA 3HFMH 4PJFE 3QUKA 2ZUQB 1Q94A 2HVJA 3ET9F 3OF6D 1CGWA 4C54A 3VD4A 1NEZA 4KROC 3T1WA 4Q6IA 3C9NA 4F15C 2C3WA 3VGAC 3SCMD 2NXZD 4Y5VB 4JO3L 1XGPA 4L3ED 1NBYA 4H8WL 5EU5A 2RHEA 4R4BA 1SHMA 1BVKA 1QSFE 1V3MA 3MJ7A 3ARPA 1U58B 4PYHA 1E6OL 3TWCL 1NFIA 4C83B 3PABB 6FABH 1PBYA 4PJ8A 2BVPA 4WRLA 3WKMH 3BP7B 4DTGL 3VGGA 3QI9D 5CWSB 2F54B 2YWZA 2JCCF 1G1YA 1R24B 3AU1A 4XVUC 3PG2A 4U2ZA 5IW6A 3FFCE 4OQ1A 2FIKB 2DOCA 4ESKA 5F9OL 3L5IA 2ERJB 1MAML 4GQ9H 4UOW0 4F9LA 4M1GL 3ZT6A 5TFSH 1BD2A 4F7EA 1RIUH 4NIKB 5I18L 3DMMC 1WF5A 5CGYD 4JZOA 1OCWH 2IWGA 4FQ1L 3PL6A 1XGPB 3TCLA 2N4IA 4ZFOB 3ZTNH 2Z31A 4XCYA 1T1XA 3O6LH 2VH5H 4KC3B 1VACA 1NBVL 4M43L 5ETUA 5DD0H 5IVOA 2WWMC 1V7NH 4U3CA 3U0TA 3UYOD 3BIKA 4JM2D 4HIHA 4NCC1 4XPGL 4HKZB 5C0BA 2AKRA 1CXHA 5EZIH 1ZLVH 5EIQA 2DJSA 1S5HB 2ZPKL 3JV0A 5J1TC 3RY6A 1ZOXA 4RMVA 5DJXA 25C8L 2FRGP 3RDTB 5JHDE 4LSTH 1YMHA 4R26H 4R90L 1E4XL 3ORJA 4EBQH 3IKCA 5ANMB 2BZDA 1BF2A 3QUMB 1CFNA 3I02A 3SGJA 1B4JH 3GSNL 1D5ZB 1J8HB 3PWPD 1UQSB 1U8KA 4PJXF 3CXHK 3KGRA 1MCHA 1U3JA 1MHEB 4KV5E 3LRHA 4GRLC 4RZCA 2H26B 1AI1L 5I8CA 4CVWA 1RULL 5D2NB 3MROB 2NZ9D 2PYFA 4V1DB 4ISVB 1OPGH 1QFWL 1I3UA 4M5ZH 1W8NA 3FO1A 1ZGLP 1RK1A 3MRGB 5KN5B 3CFCH 3I6KA 2E9BA 1AP2A 1CLOL 3T4YB 2IADA 3ZKNC 3VGBA 1AGEA 4ODBD 2DIAA 1ZHKA 4UIKH 4KV5F 4PFEA 1R3LA 3BH8B 4JG0L 5TGBA 2J8UF 2X4PB 4U1NA 1KSRA 1EMTL 1JZ8A 1T20A 4QWWC 5KJRL 1NC2A 1CU4H 4YHZH 5FHBL 4YDKH 4GAJL 3O2VH 1VFBA 3B8YA 2VC2L 4LDLB 4P3DA 4XNUL 2EDYA 1OGAE 4RFEA 2CMRH 1YYLH 3L9RB 1YN6A 3VFNA 5D1XD 1DQLL 4K8RL 2Z4QB 3AM8A 3O6KH 4KRNA 2AJVH 2CLZA 2Z8VC 4GBXB 4BUHA 4UDUA 5F8RC 1CFTB 3BGMA 2NX5B 4KTDL 4ODWA 4DWHA 3RWHB 1IKNA 3HS0A 1AGCA 4GG6E 1FZMA 3BWUC 1T83C 1CXFA 1N64H 2YHGA 5SWSB 5TGBB 5J6GA 1DVFB 1FFPA 3BWAA 3E3QC 3WIFA 3D85D 3QULB 4MS8D 3PWUB 3AB0C 2J4WL 3P11H 4RFEB 4F58L 2J8UE 1FZOB 4TSBH 1F11B 1YN6B 1I8LC 1WBZA 3WE6A 4LLVA 3K46A 3QDJE 5ESVB 4JLRA 3U46B 5ISZE 4GBXA 4U1IB 3SCMA 3RIFK 5C07A 4KZEH 4ETQA 3UAJD 4IMKC 1WWWX 3TO2A 1MFEH 3B9AA 3UO1L 1TQBB 5DJ2B 5EN2B 3CMGA 3N06B 5CSZA 3HZMB 2CK2A 4LCCA 5GS2D 4PJ7F 3FQUA 3GI8L 4ZAKA 2G60H 4C56A 5T3XE 1JYWA 4I4WA 1NDGA 1ADQA 5DK3A 3PWUA 2GYSA 1YEHH 3MLZL 1M05A 5EG6C 3MQIA 4LASH 5I1JL 2X4QA 4PJFA 1KCKA 1QSFD 1FE8H 1QD0A 3B9KB 3SDAB 4L3EE 5DS8B 3VXPB 1JHLH 2XQBH 4IRSC 1AJ7L 1UKTA 5JPMA 1OPGL 1WJ3A 3BEVB 3UJIH 1JWSA 1T1WB 5DJAB 5F9WB 4S1RH 2RCSH 2G5RA 4JRWA 1J1OH 1IKNC 3WHXA 5FA4A 4DUVA 3RZCC 3X13A 1Z9LA 3A67H 4HXBH 5KTEL 1KN2L 1JF6A 4YGAB 3FQUB 5MEOB 2Y5EA 4MNQA 4BK4A 3UDWC 5HDLA 4JM2A 1G7HA 5C2UB 3MBEB 2CRMA 3MXVL 1IM9B 4M4RA 3DYPA 4Q9CA 1S7RB 3QFJA 3T0ED 4FRWA 3SDAA 3CFIC 2A73A 2NY4D 1DQLH 2H1PL 1KC5L 3A0OA 1LO0L 3VD9A 3MV11 3P9MB 2NY6D 1J11A 3GGWA 1YNKH 5D5MA 3RX8A 3UTQA 2QQKL 1JNNL 4KUCD 3TJEH 3OAZK 5CEZD 3GMOB 2EE2A 3OKEB 1YQVL 5F3BB 4NQCE 3CFCL 4U1KA 5HHQA 1FGNL 3HB3C 1MH5B 43CAA 3FT3A 1CGXA 1RURH 2CRIA 4LFHD 1YN7A 5IVXE 1FG2A 3QQ3A 1MCFA 1D6VH 4WI6A 2V7HB 1S7SB 1NCCH 2VLKD 3T2PA 1CICC 3TZVA 1J5OH 2B4CC 5IWLC 1RFDL 2RB8A 1R5WB 1ACYH 2JB6B 3HZVB 5BO1H 1DVFD 4V1DD 5GJSL 3VXSE 5JQ6H 2R0WH 4QHUB 5ISZB 1G6RB 2A38A 1BX2B 3HA0A 5I8KL 4LSRL 4JVPA 4HJGB 2HJLA 1E6OH 3V5KB 2BVTA 3GMOA 4LVOC 1GAFH 3NCCB 2J6EH 3RX5A 4MNGE 3Q2CA 4V1DE 3PE9A 1VFOA 5J06A 3OQ3B 2DI9A 5K9OB 1JP5A 1A6VL 4MHHI 3H8NA 1WZLA 3P40A 1OM3H 2I25N 3FOLA 4IRJB 3ARGC 2YOCA 3K1DA 4PUBH 4BH7A 1CD0A 5DQDL 1GJIA 1OAYH 5F7EH 5L9DH 2P1YA 4Y5XB 1YY9C 3NPSB 5KSAA 2A1WL 2Q8BL 3LPWA 1NANH 1EEYB 2H2SD 3QJHB 2EIZA 5D1XC 1F13A 5DGQA 3BDYL 3NTCL 2C1OB 2O5ZL 3ZMRA 3KPTA 2P7TA 2XXMB 4K23H 4XVSH 4RIRB 4PRPA 3PP4L 3SGEI 2IH3B 2XT1B 2GCYA 3LRGA 1HKLH 5TQ2L 1UCBL 1ZS8A 4MAYB 5C07D 4I48A 3B2UD 4DEPC 4NN6B 4PJDB 1CL7L 3MRQA 1A0QH 3DVNA 4Y5XA 1A2YA 4O00A 3RUGA 1UENA 4NKMA 4DN4L 2IAMB 1G0XA 3ARTA 3C08L 4L4VD 1INDL 4JANA 5EZOH 4XXDB 4XZUB 3AREB 2ZSVA 2NY2B 2YD5A 3SKJH 5HGAA 2JCCA 4APQB 1JFQH 4RMSA 4P9HL 4UU9B 5TE6L 5CZXC 5E9DB 1OM3L 3S35H 1RI8A 1S7TB 4HS6A 1IGML 1MNUH 1XGUA 5CEZH 1T89A 1ZS8B 2YA0A 1TZGL 3TT3H 2XYCA 3RVUD 4X4MA 3QO0B 1ZANL 2F53B 4KK5D 4CGTA 5MHSE 4YDVB 1CK0H 1Q9OA 2GY5A 5CJXC 1LD9A 4D9QD 3KLAB 4IMLB 5KSAC 1ACYL 4ETYA 2IQ9H 4GG6F 4R7NA 3DYOA 1NCBL 3WNNA 2DBLH 1OGAA 4JZNA 1UEMA 3VFSB 4LRNH 1J1OL 1U3HC 3MLVL 5FF6B 2D0GA 1NBZA 3EOTH 5D70H 3UJIL 2RBLA 4UU9A 4LP5A 4AEIL 4C56D 3KPLB 3IKKA 2EDWA 4OCRL 2VZ3A 1IM9D 1EO7A 5DJDB 1LO2L 1IM3A 1GGIL 1EO8H 4JREC 4QXGH 3ULSB 4DKDC 5EBLB 3O2DH 1NC4A 1ED3B 4LU5L 3Q6FB 4Y8AA 1EVUA 1JNJA 2HT4D 4RDQG 3WNLA 3RZCB 4RAUB 2ADJB 2I9TA 4XBEH 3KXFB 4HUMB 5BRZE 1ZA6B 5CBEA 5GQBA 3VDAA 2COQA 3MV8E 5AWNL 1EEQA 2ZUSA 4LSUH 1J0YA 4GBXD 4MD5A 3DO7B 4TPRL 3KPNB 1NAKL 4PBVC 3RWDB 1K4DB 3BKYL 3TIEA 2G9HA 3GRWL 1F4XH 3AS2A 4WWKD 4I5BA 1EEZA 2VE6B 2MQ3A 1UB6A 3IYLW 3K4AA 4JFEB 3A6CH 1FYTB 5GGVL 5BRZB 5IQ7L 5JHLH 1MFNA 3MLRL 1EIBA 4RMTA 5JORB 3MV8B 3I75A 2HFGH 2Q20A 3P73B 1T0NA 4Z7UA 4N5UA 2C7UA 4WV1C 2ADJA 2I9TB 5AZEL 3MLXH 3VFTB 1SJHA 1VENA 2ESVD 1HH9A 3TO4C 3TH2T 4ZUWB 2VLLB 1L9MA 1VGKA 3GSWA 3CIQA 3ULVH 3S37X 1BZ9A 4JKMA 3C60D 3D25A 2WIIB 4XMPH 1OAXL 4R2GD 1HIML 5D2LF 2A2QT 3W9EA 4XHJC 4XMLL 3VFPA 3S7GA 4P23A 4L9LC 4IRZL 1F45A 5ID0B 3MLYH 2VC2H 3GMMB 5IKCA 1N3NB 3KAAA 1DFBL 4OF7A 3HE7A 4UV7L 4PV8A 4FQXB 4POZC 3S5LA 2ZZUT 4NWUH 1F58L 4AIZB 3SDCC 2XN9E 1SJHB 1RMFL 3ETBF 5C0BE 1XGQA 1Z2KA 3WL9A 1PKOA 3QG6B 2CLVB 1KN4L 4ODTH 2FO4B 3D25B 1CFBA 4QT5A 2ZOLA 2OXGA 4LNRB 3CC5A 1AGDB 1TZIA 1CT8A 5FHAH 5D8JH 4OLWL 4MA8H 2WIMA 3HMXH 4OAWB 3BVNA 3K2UL 1JPTL 1LO5B 3O9WA 2R2CA 3VA6A 4DEPB 2Z91A 5SWZD 4LSDA 3THMH 4LEOA 4HC1A 2H3NA 1FO0A 4H26A 2DWEA 1U8NB 3RPIA 5HI5D 1I85A 1PY4A 2G5BA 2ZNWA 3AY4A 1XEDA 4YBQC 1CDJA 1XGQB 3LN4A 4LOUC 1C5BL 1BBJB 1ZHLA 2DQTH 4KMTH 4JGMA 2VDMH 5F9AC 4AMKL 1RU9H 1CLZL 3FZUC 3OTTA 3CFBB 1FQ9C 5E99L 4NM4L 3B43A 4G3YH 4M4PA 3FFCD 5JO5B 2F15A 3CFKA 1RHHA 2FYYB 1WCQA 4RMRA 3FZUD 4FQLL 2FGWH 5DI8B 3ILQC 4JFXA 4JY4B 1B0RA 1O0VA 1N5YL 4ODVL 2DWEB 1OAZH 4G6FB 4X6CF 4NKQB 1QRNA 3NOIA 1OT2A 4GFTB 2FJHA 5F7DB 5KVEH 3OKLB 5DD3L 1URLA 3DRTA 5B3JF 4TSAL 3NMEA 4RMUA 5IT2L 1UZ6E 1DR9A 2XKNA 5D8JL 4ODXB 3PV6B 1BF8A 3TBVB 5JO5A 3G9AB 3MX0A 3FT2B 1JGUL 1A5FL 1P2CA 2OR9H 1H3WM 2QTEA 5CJOH 5E8PA 4LPTA 3RIFF 5ADPL 1SMAA 5D7KE 5FK9A 1QUNA 2LVEA 4HLJA 4PJAE 3B83A 1ZHNA 3T8XA 2YD8A 5JLZA 1JGDA 4XAWL 1WAAF 4YWGH 4JAMA 3LEVL 4NO5A 1H5BB 1V5JA 1WICA 4NHUA 4WV1A 2B4CL 1PAMA 4JDZA 3C2SA 1KB9J 1WZ1L 4HWBH 4ZS6D 3SQOH 5I1EL 5J8OA 1I7ZA 1V05A 5JUEL 5D1QA 1YMMD 3MNZA 3OKOB 1NKRA 4ODXA 1MREH 4LSQH 1QFUL 1NCDH 4GRWB 5A16B 3KNBA 1SEQL 3MYJA 5E8PB 3EO1B 1GZQB 1Q0XH 3O3BA 3MRRA 3EZ8A 4OGXH 1FLRH 3UBXA 2FIRT 3G08A 4ZFFB 5DHVA 4OZIB 2MHAA 5T1KA 2Y1VA 3LEXA 1MFCH 2AERT 4H0HB 2KDGA 5L6YL 4JFFD 1FORH 1PKQA 5F3HA 2ID5A 3CAFA 4QHMB 2AK4D 4TSAH 4YBLC 2ITCB 3LKSB 3LY6A 4NZRL 3SE9L 5D2LA 5HYQB 2V5SA 4DZBA 5HPMA 4FTVD 1OP9A 4I18B 5DHXB 3RQ3A 3ZKND 2GAZB 4H8WH 2AJYL 3DIFA 4XP1H 4CMHB 2F8XC 1TTUA 2EKJA 1KPUA 5GRVK 1MPAH 3ECBB 1ZA3A 5IEKB 3VA2C 5EA0L 4DKEH 1KEML 3N85H 1MFAL 2XICA 1MHCA 4PTUA 4LGPB 5GJTL 1DANT 3H9SD 4PGBB 4YDKL 4YHZL 4Y16D 4PB9H 2BNRA 5I66A 4ZUSB 2DQJH 2W65A 4Y4FB 2J8HA 4JGJA 3MJGX 4DKFL 4GRWE 1GH7A 4I9WE 3S4SB 3D3VB 3UPAA 4X5LA 4OCRH 3GMQA 2VH5L 2D2OA 4YHLH 2DQUL 1OAXH 1O5DT 2OTUB 4KKLC 1U8IB 4WTWA 1IGCH 4HUWA 1WK0A 4HWZB 4D8PA 1EFXA 4AY0A 3TYGH 4ZSOE 4L8SC 4YX2L 5I17B 3TM6A 4F2MB 4GS7C 3OJVC 3UC0H 5E8NA 4XPAL 4CW1B 3CPLB 3QIBA 3GJFB 3RGHA 4NO2A 1DLHB 3OJDA 3VFOA 5ICXA 4EI6A 4LDEB 3BRFA 3L5HA 1CF8H 1HZHH 2FBJH 3LIZL 3TO4A 1Q9WA 3DSFL 1PZ5A 3P0VH 5MERB 4XVJH 2EXYC 3QG7L 5D1ZC 1C08A 3HCVA 3L3KA 4YPJA 4G6JH 4HCRA 2GJ6D 1LDPH 5I1HH 5LWYL 4N0CD 4UOJA 5FYJD 1I1RA 1IGMH 1MNUL 2EE6A 3SGDI 4NFDA 4YH6A 1D7FA 1RUAH 3MRIB 1SY6A 5F7UA 4YDJB 4DZ8A 5EH1A 3N9GH 5L2KD 3L5JA 2XKUA 4L3EB 4HGMA 5C6TL 1MY5A 1QFHA 1DL7H 1SY6L 2E9WA 3GJFA 2QADC 2GT9A 2YWYA 3LQZB 4K3GA 3WUZA 2CRYA 3ARUA 2K7PA 2F54D 1NEUA 4Y19A 1GZPA 5C0AD 3FTGB 5BJTA 4OZIF 3FB5B 1QPPA 3BXNB 4CMHC 5HYJB 3MOBL 1XGYH 4XCYB 1HHGA 1U95A 4L9LA 5EOCL 5F9DC 2E7LA 1EZVY 1WITA 4GQ9L 5CHNA 2IBGA 2UYLA 3MZGB 3QXUA 4MHHG 1MCWM 5H37G 4LARH 1NGWB 3T2OA 3Q0HA 2AXFA 1KGCE 3VWJA 4K23L 1S5HA 5TDNA 4NKIH 5HHME 2VLME 1NCBH 1EAPB 3WKML 5JW5A 5E2TL 1UWGH 2H8PB 4P99A 4XBGB 4RQQB 5AG8A 2HH0H 4OD1H 4LQFL 5DQDH 1A6AB 5IMMB 2MQCA 1CIUA 4IS6A 2DJ4A 5D2NE 3EHBC 2VDQH 4IM8A 4R4BB 5GSRA 12E8L 3U9UA 5LAXB 1T4KA 4XCNA 3P77B 2HG5A 1VHPA 1C16B 3EYFA 4QCIB 2BY2A 4M7LH 3VRLF 4F7CB 2EICA 4NQUA 1KJ2L 5I8CB 2CQVA 4EJ1C 3MROA 1CLYL 2PYFB 2ADIA 4PJBF 4CAGA 5T5NF 2R0ZL 3MBXH 3W0WB 4KJYB 1GC1H 3JWDC 4JPVH 2PCPB 5F9JB 5F6IB 2P44B 1S7XB 1CL7H 1FH5H 1F00I 2XZQH 4IS6B 4QXWA 2AXGA 4DAGL 1T20B 2YKLH 3U9UB 1BZ7A 1T2XA 3B6SA 3EYFB 4QCIA 2FZ3A 3DV6B 5ITBH 3VFNB 2HT2C 1AGFB 4P9HC 3X14B 5IVXB 2Z4QA 2YUWA 1NMAH 1FDLL 1UACH 2DLTA 5IB5A 3RAJH 3LH2L 3CSPA 3RKDC 2EDTA 5HDOA 4XVTL 2C26A 5T1KD 4WI4A 3UJTH 5K59F 3WXVH 4DKEL 4YXHL 1YY9D 1TNNA 4RWYH 2OZ4H 2R8SL 4NJAH 2OL3A 3MLWL 4ZFGH 2PO6C 2RGSA 2ED9A 3C5ZA 2Z8RA 4X6FB 1BVLB 4HKXB 1I1AD 4PY7A 4H20L 4ZUVA 4HBCL 1J7VR 5D2NC 3UTZB 1F11A 4Y5YC 1NFDA 3WE6B 3QB7C 4ZPVB 4V1DA 2PW1B 4DCQA 5IFHH 1W72A 1WUNT 2E7HA 4U6HB 1FZKA 2DM4A 2DQEH 5B39B 2HFFB 2FJGA 3QFJD 4P4RA 5K9JL 3T0EA 2IGFL 4DGIH 1R3IL 4JN1L 3REWB 4A2MA 4DOHB 2B5IB 5HJ3A 2VIRB 4LCCC 1HKLL 4I13B 3BUYA 1JHKH 1NAMB 3VXOB 2CUHA 3RDTC 4PLJD 5CZVL 4XI5C 1FV1B 1BVLA 4HKXA 1I85C 3A6OA 3D87B 2O61A 2BJMH 5D7JA 4BFGA 5D4QA 3U0WL 1NFDB 4PJEF 4JDVB 5F1NA 4P4KC 4PV9A 3SDDC 4KTYA 5ICYA 5DHVH 4NT6B 3C6LC 4GOSA 1UFUA 2APVA 2Q7YA 3ARED 3TN0B 1B6DA 3WFBL 3F7YB 3LQAL 4PG9A 1HXMB 2GUOB 1ETZB 3X13B 1FZMB 2Z93B 4TTDC 4X5WB 4F33A 1V8HA 3DARA 4NZTH 1NAMA 1FGVL 3SDAD 3TV3H 4KAQH 3RUGE 1GGCH 1MCCA 3GHEL 1DVFA 4MNQB 1FFPB 5ERWA 1OTSD 3VXOA 3VXUE 4F37K 3KYOB 4PJEB 1FPTH 1WGOA 5LVEA 3O6FC 2CD0A 1FL5A 3AM8C 5JDSB 3MYZA 2DMKA 3GSRB 3KXFE 2R2HA 2E8ZA 4JN2A 5DQ9B 3CCHB 3BW9B 1QSEE 5BZDA 2SEBA 3U4BL 4GO6B 4PGDB 5SX4I 3S36X 4F9PA 3VI4E 4NT6A 3WDIA 4UZGA 5HHOB 1D6VL 5E4EB 4E9LA 3FN0H 5M94B 3B2VL 4R4FH 3NBNA 3F6IA 4KPHL 4YE4H 5EN2A 2JE8A 1WFOA 4F33B 1WIPA 3OXRA 3J7HA 1FE8L 4C56B 1RZFL 3DTXA 5GS0D 4R4NC 3KYOA 1FFNA 1G7MB 1KJ2A 2WMPA 5IK3B 1A22B 1NH6A 3X11B 1A14L 2IFFL 5BOZG 3RVWC 3SDDB 1VERA 4ODHL 5DWUL 3HR5A 4L8SA 4JRXB 1NGPL 3KYNB 1JTPA 1B2WL 1TVBB 1DE4A 3RI5K 1QO3B 5BZDB 4ZS6C 4GKZB 5IP4A 4XWGH 2GJ6A 2ZUUA 4C57C 3UPRA 2KH2B 3KXFD 4WGWB 3MCG1 5BVPL 2F58L 5FYKU 4GXUM 4WUUA 2WM0A 4NPYA 3VXMB 5MEPA 5FEBA 1IAMA 4B5EA 2E27L 2FX8L 5DJCB 3QQNA 3RWFA 1H8SA 4ZTPL 2PTTB 2B0SH 3S97C 2Z92B 1QYGH 5FDWA 4I2XB 2BC4A 1REIA 4P2QB 3TYFA 3CSBA 3IDGB 4LCWE 2J8UA 4P48A 2DIBA 4GRLD 1ZAGA 2GFBB 2GTZB 1YEJH 1JN6B 3VFWB 3WD5L 2YR3A 3DUUA 1JHTB 4BK5A 2PYED 2XA8L 5KSAB 4YDIL 3EKCA 4WEBH 3U36B 4QRTB 1NGYA 4UB0L 3HC0B 1AO7B 3MACL 1CD1A 1M7IA 5F7NC 1X7QB 3MPCA 3SOBL 4F9LC 4H1LA 2R9HC 1FC1A 1P4BH 4JO1H 4PY8J 3BPNB 3QXVA 5F7YC 2HMID 3RKDD 1T2QH 3IF1A 2BVQA 4Y2DD 2VXTH 1U3HB 1E4XI 5F88A 4GW5A 4X9BA 1FG9C 1R0AL 1A4JA 3OR6A 4QOKE 1U6AL 3MRQB 4KRPB 3HRZA 1S7SA 3EGSB 1MVUB 1RQ5A 3O2WL 3T4AA 1QLEL 3D48R 1RIUL 3CJJA 5HTSA 4YDLB 2YUXA 4JO2H 3MUGA 4NO3A 2OTWB 4FMKA 1BLNB 1G7LB 1IGJA 4QHUA 4OQTL 2VLMD 4YK4C 4BSWA 3C60A 4K7FB 1G6RH 1P4IH 1F2XK 3TZVD 5B38A 1GOGA 4Q9BA 4XP5L 1TJHH 4JPWH 1K8DA 1N64L 4AIOA 3QP3A 1EHLL 4UQ2A 3LPFA 4ZXBB 5C0DA 5J12B 4GW5B 1A7QL 1Q72L 4H20H 5GIRB 3GRWH 4OZHE 2F53A 1XZ0A 2O26U 4XCEA 1AHWC 5FM5M 4DGVH 2F54E 1MVUA 3O3AA 3W2DH 1QPXA 3O6KL 3QCTH 3P11L 4UUJA 2VDLH 2DQDL 1CG9A 3KPQA 1OTTD 5I6XC 1CYGA 4PRHA 4MZ3A 4B0MM 4NHCH 3T3PE 3BKCH 4GRMB 1CE1L 1ZLSL 4BJLA 1KBGH 4LVNC 4UTAH 2VDOL 1AY1H 4O2FA 1I9IL 1N5YH 3KPMB 4I48B 4NN5C 2ICWB 1BIHA 3T0WA 2QQLL 4N5ED 3W11C 3WNKA 3PL6D 3PIQB 4RMWA 2Z31D 3BRGC 1EJOL 4PRDA 3ZDXE 2Q86B 3MMEA 1A1MB 2VXVH 5AG9A 1ZSDB 1QR1A 5LBSL 5FHBH 5DC0A 1A64A 3L3IA 4WWKA 1B2WH 1YC7A 3GIVA 4Z78B 4PRHB 3PL6C 4HJ0D 3MA7B 4XMKH 3MXWH 5CBEB 5HGAB 3STBA 4EIZC 1CTOA 2VUYA 2OL3H 4ORZC 4EQ2A 4MD5B 3DO7A 4YFLI 4JRYB 5DEFA 4KHXL 1ZKAA 2Y72A 4QHNA 1FPTL 4O2FB 3QDME 4PG2A 1KENH 4FFWD 3CLEL 4OCSH 4ZPTA 5HHMD 3QO0A 5FYLE 5MI0C 3MRNB 5FV2A 1W72H 3TJHD 2NY4C 5GS0L 3GMRB 3DLQR 4NWUL 4J3TA 5D1QC 3E8UH 1UWEL 4K3EH 4PD4J 5FUZH 4X83A 3LAFA 5C70A 4D9LH 4JR9H 3JVGC 3MA7A 4IEFB 3RY6C 1U8QB 5DK2A 2XG5A 1CD8A 4JVUA 5T3XH 3P9LA 1CD9B 3LKRA 1VPOL 4FQ1H 5DEFB 3TPUB 3TBTB 2Q3ZA 3KHOA 3H7LA 2BOBA 2ATKA 2F5AH 5C8JA 2OR8A 3ZE2F 4PJCE 4U05A 4BQCA 4NNXA 1H15B 2NXYB 5DRXA 2ADGA 4XGZB 2AK4E 2ARJA 4JCLA 5HGHB 2A6DA 2R4SL 1QEWB 5EIIA 2ORBH 3LSOB 1XGYL 3FRPA 1P5VA 5E2JA 4AIZA 3LKNA 1NSNH 5GGSA 4I77L 3CX2A 3KXFA 3EOBA 1U41A 4ZOCA 5DK2B 1I75A 2DD8L 3FCTA 2ZUTA 4G7YL 3O8XB 4KK6C 1QBBA 3O45A 4MDIB 5JW4R 4FQHA 1IT9H 3OKNB 1K4DA 5SWSE 4M7ZB 1IZKA 2V9RA 4GXUN 3T09A 4IDJH 3T1FB 3QO1B 1T03L 3SKNA 1R3JB 3GBNL 1PY9A 5IVNA 1KJVA 2APWA 5EPMA 3EUUA 2A6DB 4UT7L 5J3HD 1G9NC 2DQGH 3RA7H 3LD8B 4JQVC 3LSOA 4DTGH 3P73A 4ZFZA 4NN5B 4LEOB 2YS4A 1PDKA 1KIUA 4Y4FD 5F7HA 5GGSB 1U8NA 3RPIB 3P0VL 5GRWA 5J12C 2X89A 5DLMH 2JF1A 3BKYH 4NQEA 5IJKC 3AY4C 2VLLA 3MLWH 4ZFGL 3WJLC 1YNLH 1RUML 5EOQH 5EU6E 4PY8I 2V5MA 3X12B 3LRSB 3I9GH 1SJXA 3IAGC 3VWKD 5HI3D 3VXRE 1X5ZA 2NYYC 1DSFH 3HG1D 4QTHB 1BD2D 1ERNA 4URTB 3RVVC 4GAFB 1ZEAH 5EPMB 4FXLA 4GMTH 4ONGL 3GKWL 4HUXA 4KMTL 4PV8B 2WW8A 5DMIH 5KBNC 2APTA 4KRPC 5EUKB 2P5EA 5I1KH 4JZJC 3VJ6B 2WQRA 5D7JC 4XAKD 1KXTB 1ZEAL 5DVKA 2AEWA 1S8DA 5HDQH 3MNVB 4CDGC 2Y5TB 4DN3L 3GIZH 3HE7D 5E8EA 4GG6A 1ORSA 5F7KC 4E41D 3DX6B 4IHOA 4P5KA 2YD9A 3F7QA 2HFEB 2VLJD 3QNYA 3LEYL 5T33L 3MNWA 3PV6A 3TBVA 4HCRH 2AABL 4TOYL 1LO5A 5CBAB 4JFZH 4IJ3C 4HUXB 2JJTC 2YPKA 4YXKL 4ELMA 4OGYH 3VJ6A 5ACZB 5ENWA 4J2XA 1ITBB 1DQML 5DUPL 4KKBD 1E6JL 2DM7A 5E03A 5SWZE 3S3PA 2RCSL 2W0FA 2AJZB 3HR6A 3KS0H 4X6EA 5JOFB 1JFQL 3DJ9A 4JDZB 1OD7A 1K85A 4R0LB 1ADQH 3TIDA 3EDKA 5CD3A 3IETB 1MI5E 4JHWL 1LWRA 4PIRF 4R7DA 4X9IA 4I18C 5GSVA 5T3XL 4M7KH 3S34H 4E42B 2HTKD 5EDXA 3W82A 4HDIA 4PGJA 3UPCA 4M61A 3RL1A 3EJYC 2XN9D 4PJDF 2B4CH 4Z7VE 3FFCA 5TQ2H 2NNAB 5ID1A 3C5SA 2EC8A 2W9EL 3QDAA 4PBWD 4WI3A 4KZEL 2DQIL 1NKOA 5D1XA 5EO9B 4JN1H 4WW1B 5JXEC 1DBBL 3TNNB 2LTQB 1D5BB 4MZ2A 1CFSB 4RGMB 1NGQH 3LKSA 1NAML 2XXCB 4MA7L 3VFGL 4DZBB 1NLDH 1EAJA 3PQYA 5EBMA 5C92A 1EGJL 4WWKC 2B1AH 3P30H 2R2EB 1UVQB 3G6JB 1LNUB 1RZ7H 1QQDB 2DS4A 1LO3L 1CDIA 2XNAB 4AG4L 1SBBA 2JELH 5IVXF 1T7WA 2NLJA 5BV7L 2W91A 2CIKA 5JNYA 5E5RB 5I75B 4IRSA 4OGAC 4XCCH 3QIBC 2NY3C 4Q97A 4JAMB 1CFVH 3L5WB 5EO9A 5IV2B 4UV4L 4IJ3B 1U2CA 4L8BA 4U0RB 2WBWB 1HXYA 1QRNE 1DJSA 4LPUA 4DVRL 1FFOA 3V7AG 1G7JB 3D18A 2CMRL 5IGXL 4JFHE 3U7AA 1KB5H 4DKFH 2KPNA 2HRPL 4OFDA 5D71L 1OAUL 5ILTH 4YDLC 1IILE 1QSZA 5IHUL 1X5JA 5JW4N 3V4UL 4MXVF 4ZNCD 2YC1B 5C6PB 2CIKB 2MHAB 5T1KB 3LV3B 1ZTXL 1ZGLB 5GRZA 3QIBB 5GGVY 5DMYA 3GRWA 3QIWB 4HEME 4LLQB 1HH6B 2DQUH 1QSFA 5I9QB 4J3XA 5CILH 3CDYA 4ZS7L 4Y16C 3BDXA 4NO0A 3HCVB 2FEEI 5DGRA 4DK6A 2J6EA 3MJ9A 4NN7B 1XR8B 5E9DE 4CVXA 2BNRE 2JJUA 4GMSL 1JZ5A 5IG7B 4UINH 5GISL 1LP9B 4UAOC 1C5CH 1WBYA 3CSGA 1EHLH 3ZDZE 1MCNA 5GJTH 1BIIA 3O11B 4MNHB 5DJ6A 4JJ5B 1AR1D 4AEHH 4J4PC 4Z7QE 3HG1B 4X7TB 1HE7A 3SKOA 5HVHB 1WWBX 1AC6A 4RWHA 5HI3C 3OAYK 5A40E 3V4PL 1IAOB 3U0PA 3DROB 2BNRB 5I66B 4Q9QL 2A83A 3INUH 4Y4FA 1T04A 5DFVD 4OFKA 3PWJB 2VN4A 3S4SA 2GK2A 1YEHL 1M4KA 4LOUD 4NQED 5C09A 5E95B 3DO3A 3U30C 1W0VA 5DJYB 2BHUA 4LLUA 4H5SA 1YDPB 4MQTB 4U31A 4Y16A 2XN9B 3O41A 1D6EB 1JGEA 1UCBH 1RJZA 1KJMB 3CVHB 3LKPA 3ULUE 4HWNA 4Z7OE 2X1OA 3VI3E 4U2YA 3VWJB 1E4KC 2WINA 5I1IL 4GJTB 4HZLA 1T66D 3SDYH 5E8DH 4L4VE 1BMGA 5I19H 4OZFA 1R6VA 2JJSC 4RDQF 4XC1L 5ALBH 1Z6JT 5A1AA 2R1YA 5HXMA 3OGCA 4G80B 2NXYD 4FQCH 4OLEA 4KTEL 3H42H 1TCRA 5F7WC 1B6UA 4F58H 2M1KA 2BNUB 4PLKD 3BKCL 1J10A 1XF3B 3KWWA 4LIQL 1S9KC 3MLRH 1CXEA 1YDPA 1AQKH 1C16A 3VFMA 3T77B 5L8LB 1G9ML 1V3KA 3JV4A 1JGEB 1FFQA 4L4TE 4MJ6A 3BPLB 4DZ8B 1BJ8A 3BRDA 3ULUH 4L3EA 2PR4L 4JZJB 4OZFB 1JYNA 4Z8FH 2Z8SA 4J6RH 2F74B 1HK6A 5DVOA 4FQPA 3RDTA 2UZYB 3L6FB 2EH8L 4UT9L 1GXEA 2R29H 1FP5A 5IHZA 3O6FB 2FBJL 1FL3B 1CFQA 4W68A 1MHPH 3RJQB 1KPRA 2DTSA 1UM4H 1C5CL 5MI0B 2XACC 3ZTJH 1RJYA 4KH2A 4YQXL 1MRCH 3FO9A 1ES0A 3WYRA 2DMCA 1U8KB 3SO5A 4RGMC 1FN4B 4LCIL 1NDMA 3DV6A 3I3DA 5CHNB 2H26A 3NFPB 3Q6GH 1BBDH 5D7IE 4F7TB 5D2NA 2AXFB 3BAEH 3Q5OA 1XAUA 4MAYC 4HUNB 5IW6B 1EHXA 1MCDA 3OAZH 4S1DC 4TUOB 1YYLL 4O2EA 2EECA 3BSZH 4U1SA 3KLSA 2VDOH 1CR9H 4P23D 1MI5B 3MFFA 1I9JH 4YJZL 4U1GC 2CO7B 2VDNH 1KPRB 2IQ9L 5CSGA 2DTML 2ARWA 1PYWA 3HMXL 1WZMA 5SWQB 1G6VK 2NPLX 2X9YA 3V0WL 4XCNB 3P77A 1VEPA 1XGRB 3I84A 1NDMB 4PY7B 1ZLUH 4G7VH 3UTZA 2PR4H 5FYKD 3CVIH 4R90H 1KEGL 1EDQA 2V2WA 2NY1C 1FVCB 4GAYA 3PWPA 2PNDA 4OZ4A 1MQKH 2HFFA 4HT1L 2VL5B 3SY0B 5DUML 4TUJA 1U8OA 2EKSA 3A67L 3EYUL 4WDIA 4TNVF 3PWNA 4S1RL 4FXKA 4X0KB 3BH9B 4CKVX 4MCZB 3OPZH 4UDTA 1HDMA 3B6SB 4G6FD 1XCQA 4P49A 4XMPL 4Y4HD 4ZG1A 3IS0X 3CUPB 4R3SA 4G8FA 4BH8B 3MREB 5IIEA 1MHHB 3LHPH 1M71B 1EBPA 1FL6A 3IJYA 2X4UA 2BHYA 2PXYB 1RZKH 2IH1B 3CMOH 1IGYB 1LO4H 2NYYD 5B8CA 5F70A 2BXYA 3HMWH 3ISWA 3OB0K 5F96L 3U7WL 1ETZA 1WCBB 3DI3B 3P4MA 3JWOC 1EUTA 4X7SL 1ZHKB 4M3JA 3BQUB 3QDGB 4G8EA 4PS4L 4X0KA 4FHBD 1BJ1J 2X4PA 3PF2A 4U1NB 3ZL4H 2NTSP 2VRAA 1NDGB 2NX5D 1NC2B 1KTDA 1UH4A 2YN5A 1QBML 2A0LC 2CDEB 3BP5B 2FSEB 4P3DB 3RU8H 4PJFF 1K8IA 4HBQA 2RFXA 4EUPB 2VLKE 4MA3A 4OIAA 2R0LL 2HLAA 3RL2A 4HHAA 3IJYB 3MJ9H 4PJHB 4NQSA 3FRUB 2FX7L 1J0JA 3HLAA 1FZKB 1UM5H 3RZWA 5B8CB 2H41A 1T0MB 3KLHC 3C8HA 3S88H 3WHXB 4WUKL 5FA4B 2UV3A 1QA9B 1NUGA 3MLUH 3BUYB 5LJYH 3LZFL 5FGCE 3ROOA 4DVBB 1MF2H 5IBLC 1KJ3L 1BWMA 2BP3A 1KIRA 5CJQL 3QULA 4KGLA 3UCRA 2X4SB 4KK8D 3UTTB 5GXBB 3V6ZB 2A6IA 3T3MF 4CNIA 2D0FA 2VISA 3QFDB 3B3IB 4G8IA 3KYNA 4X80H 4GG8A 3QXAA 3WDJA 5FO9B 1FAKT 1PLGH 3DUHA 4LRNL 3QJFB 4L1HA 1RZ8B 5IBTL 3BD3A 2VMFA 4PRHD 4OTXL 4EUPG 4WEUD 3ARZA 4PREA 3E0GA 3HI6H 5DJ2A 5HHVH 3VXRA 2Z93A 4X5WA 2D4FA 4DVRH 3HI1B 3LS4H 1CICA 3LKOB 5IBTH 1P4LB 5HHXL 4ZAKB 1TPXB 3BIBX 1LHZA 1HYSC 1BEYH 4KHTL 5HGDB 3EHBD 5BMFH 2EYTA 4KUZL 1DBAL 5EFIA 5C0EB 3MA9L 3MGTA 1DBJH 4JY6B 1DUZA 1CBVL 3OHXB 1FNLA 5F6HJ 5LQBL 3VXPA 5MENA 3D3VD 4FFVC 1AXIB 5FYLL 1JN6A 3VFWA 4LKXB 4KJQD 2YRPA 3WIHA 3LMJL 1JWSB 1T1WA 4K3HA 5DJAA 2AABH 4TOYH 2R0ZH 1ZLWK 3TA3C 5CEYA 3K0WA 2DICA 3MRDB 5AZ2H 3QIUA 4YHMH 5LXGL 4QGTA 3I85A 1FGVH 4LPVA 4Y1AB 3EYSH 1LEGA 1KCLA 1MUJA 2EDDA 5EORL 4DN3H 4OCWH 2NY3D 4JPIB 1TVDA 2BNRD 5EFIB 3BHBA 1JF1A 2I27N 5ISZD 1U3HA 1MCPL 5F88B 1V7NL 2ICWJ 5LGKA 2A73B 1W0YT 4EKXA 3OR6B 4GKZA 3MV7D 2JB5H 3WFDH 4NKDB 2E7BA 4J12A 2GJ6B 4OTXH 5IMOA 2GI7A 4PJ7E 3WXWH 1MFDH 4Y4KA 2OZ4A 2YXMA 3WSQL 4RFNC 3SDXF 1MCRA 3RWGA 1NC2D 4PJAF 3FAWA 1QBLH 4XCCL 1R3KB 3R4DA 3PDOB 4BFBD 5T3ZE 2KKQA 4I0CC 3X3FL 3MZTA 4RX4A 4PJGA 4FZ8H 5HDBF 5KS9E 3G6AB 4PRPB 1N6UA 4Y4FC 5DMGC 3WSQH 2HP4A 2XQYK 4XPBH 3RKPA 2AK1L 4HFWA 4JPIA 3OAUH 3IDGA 3G9VA 1K9TA 3RNQA 1FG2B 1H3XA 1QRND 4G9DB 5C0AB 2WZPD 5GIRA 1Q38A 5E2UH 3ARVA 2V7HA 4MAUH 3TBYB 4JQIL 2YZ8A 5FECB 3TZVB 3BO8B 2WUBL 3ESUF 3UTSB 4F8QA 1DQDL 2ZNXA 5CMAA 3U7YL 1N6QH 1R5IB 4ZDHA 3STZB 2B5IC 5KS9F 1A7PL 2GK0B 2J1KA 4NQXB 1MQKL 3UC0L 3CSYA 5D5ME 3PNWB 5T5NG 4NBXB 2VN7A 3PJSB 1R3KA 4F7PB 1WBXB 4KKAD 3OKKB 3FB7A 4PJGB 1TQCB 1K4CA 2BCKB 3IVKB 1GRWA 3MCLH 4H0IA 4LBEA 4D0BB 3L3DB 3IF1B 1MOEA 3DHJA 1ND0B 5J9PB 2V17L 3CK0H 3K8MA 4K94C 5IBUB 3V6OE 4OZGB 1I4FA 4RFNB 3UJJL 1YNKL 4XPAH 4OFPA 1UC6A 4MDJB 1HHKA 3WEXA 1UJTA 4CJ0A 2NR6D 4PJCF 2P8PA 1KLUB 1EGJA 3MUGB 3P4NB 1N7MH 2OBGA 4NO3B 5L88H 2M2DA 3QXDB 2FEDD 1JGVL 3CSYB 4M03A 2WANA 4JDTH 4Z7NF 3ZDXF 4O5LL 4W4NA 5DQJA 2OJEA 3OKKA 3VGFA 4TTDD 5E7FA 1K8DB 2D7TL 5AEAA 1MF2L 4JRYA 4LBEB 1QFWM 3EYQD 4P46D 2GCYB 1MCJA 5GGTL 4MAYA 5D93C 3QWRD 2MCPL 2EC9T 4PJXE 1X5AA 3IRZA 3P0YL 2DKMA 4JB9L 3RVXD 2ZG3A 5EB9A 1CICD 2ZCLH 4Y89A 5HY9B 1HINL 4Y4HA 5B3NA 3ME0A 3RZCA 4M6OL 3F5WA 2LE9A 3LDBC 2JLLA 3QAZC 4J6RL 4F57H 4WEMB 3T2NH 4HG4J 4ZO8A 5KSBA 4KKCC 2M8XA 4WHCA 2NY3B 5DQJB 3BDBA 4WWID 1KELL 1ZLUK 4X4XA 1EH9A 4PR5B 1GSMA 1MEXH 2Y36L 1MVFA 1MREL 1CE6A 4LHQB 3OKMA 5LGHL 1A0QL 4RSVA 2YD7A 3U7WH 3HNSL 5DRXB 1QLFB 4YC2C 5GGUB 4PRDB 4OQTH 3SO3C 4DFIA 2VDRH 3DV4B 5DF0A 5HY9A 4JREB 1DDHA 4JO2L 4BSVA 2PF6A 3L3IB 4WWKB 5EUOF 4GAGL 5E8DL 3TH3T 4G9FA 4M1GH 15C8H 2XA3A 4JM4H 4AQOA 5JUEH 4BZ1H 3HB3D 5DRWB 3WS6A 3VFRB 2AXHA 1UM4L 4NDMA 3SEPA 4Y5YB 5DEZA 3MRBA 4PRBA 3KPOB 5DZLA 4U6XA 2NW3A 1A6TA 2GW5A 1J12A 1INEL 1F3JB 1VDGA 1S7VA 2I60H 2DQDH 2E7LC 4H88H 3PGDB 5DSCB 3TWCH 5C2BH 1G7PA 4WNQB 3DV4A 1M1SA 3GMRA 2OS7A 4NWTL 4AT6B 3V6OA 3H2WA 1IAII 3QT2A 1FZJA 1I1CA 5GZND 3UP1A 4JFED 2EEDA 1PGRB 2FGWL 1ZVYA 1BVZA 2C4XA 4MJ5A 1S9VB 2H6PB 5JMOC 4M6NH 5JZ7D 2W60A 4OF0A 4YHNA 1C7SA 2R4RL 1RY7B 2FL5A 1U8PA 1T3FB 2XQYG 3FOMB 5CZXD 1MJUH 4KQ4L 3BYTA 4HD9A 3SGDH 4LSVH 5I0DA 3EO0A 5GPRA 3W9DA 4KTEH 4NNXB 1EJ6A 1I1AC 3SGKC 1J8KA 3PGDA 1CS6A 5DSCA 4JHBA 2X42A 4WNQA 1QEWA 5E6ZA 3NAAH 3VRIB 1WV7T 1U6AH 4YEFA 4KZDL 1C8PA 1TENA 3Q1SL 2BVOA 1IEAA 1Z9MA 1BGXH 1FZJB 3GSQA 2PXYC 1QFWH 3QUXC 4M5ZL 1JZ2A 3VDCA 4Y8DC 4Z9KB 1AR1C 3FB6B 4X8XA 4YHPA 5ESAB 5D7IA 2R23A 2ITDB 1T3FA 1ORSB 1JPTH 3BN9D 5D6CA 4EI5D 2CKBB 2Y36H 2C3VA 3L3HB 3UEZA 3MNWB 1CI5A 3T1FA 1G9EA 5ALCL 1KN4H 3JTTA 5IKCB 3BZFA 3MCLL 3M17A 5E00B 4YE4L 4LCWA 3VRIA 3RFZC 2WV3A 3MXVH 3PP3K 4Y7MA 4X6DE 5EO0B 3V0WH 3SDDD 1FNSH 4F8TA 4TVSa 2GITA 2XTJC 3BT2L 2ADFL 1QYGL 2PTVA 3ARFA 3V52L 2ZP0T 4OLVL 2CLVA 3C5ZC 5D6CB 5BCAA 4DUXA 3BZEB 5FGBC 4R0LA 2C3VB 3LS5L 3MV9D 5DA4A 4MQ7A 32C2B 3TT1L 4OAWA 5GS2H 4R26L 3NAAL 5I74B 3KYKL 5BVPH 4JFDB 4NNYB 1E27A 1SEQH 4RFOL 4QRQA 5J89A 5L7XH 5FOBB 2BNQE 1FO0B 2DAVA 5DT1H 5IHUH 5E0QA 4TTGA 2OLDA 3WLWD 3HE6D 1NANI 4HULB 1F90H 5C0CB 3TBWB 4HQQH 2EDBA 1L6ZA 4BQBA 2W0LA 1BBJA 4L4VA 1I1FB 4QHLB 1VGEH 4WW1A 1AKJB 5M95B 4OFVA 1D5BA 1I7ZB 1ZT7A 5D1QB 3MNZB 1AO7D 4KKNA 3S3JA 1RHHB 2NY5L 3RGVB 2FD6H 4HIXL 5CBAA 1VKXA 2FYYA 4Y4KC 4ZSOA 8FABB 4MJID 2J4WH 1X4YA 3QWRA 1A7OH 1ZWIB 3ZTJG 4ELMB 5I1CL 2XZAH 1S9YB 3DGCR 1I7UA 3V5HB 2H2SC 3WN5C 3QH3B 4EDXB 2YUZA 4X6BA 2CJUH 3RBSA 1GOHA 5I73C 3ZE2E 1I1FA 4QHMA 3DRTB 3ZDYE 2B1HH 2ITCA 1HI6A 1TPXC 1FFOB 2KZWA 4Z95L 4R6UA 1BFOB 5HYFA 3CZFB 4FQLH 4NRXA 5H35B 2VXUH 3MRKA 1OL0A 4AEHL 1N7ML 3RWIA 3DURB 3MRPA 4OD2B 1G7IB 1V7MH 1H3GA 1X44A 4HFUL 1X5YA 1MHCB 5BS0D 3FMGH 5D7SH 1ZGLA 2NNAA 2BJML 3WO4C 5HYJE 2XI9A 1BAFL 3G6DL 3QIWA 3WUWG 3WHE1 1L7TL 3OKDB 4QF1A 4OGAD 1KIPB 5C0GA 5HGGS 3SE4C 3PGFH 1ZMYA 4AIXA 1T5WB 3FQRA 3MLXL 4NUGH 1MAKA 4BSJA 3GSNB 4R4FL 4Z7QF 2V5RA 3OXSA 1E4WH 3VH8A 2X70A 1NMCC 1AGBA 3QQ9D 1U3ZA 1N6QL 3UBXB 3H3PL 1DBKH 3MBED 3SCMC 3CPLA 4IRSB 4ZYKB 2BDNH 4TVPD 2D7TH 3GZKA 5ICXB 4EI6B 4R9HA 3O8XC 4Z7WA 5C0GB 1CBVH 3RA7L 4LVNB 1Q9WB 4MA7H 4NJAL 1H3VA 3DOSA 2IALB 4LAQL 4NN7C 2IPTH 4QRPA 1JPSH 2DQHL 2AJUL 5DJYA 4LCWD 4IIQB 1QFPA 2KZ1B 2X4RB 3O6MH 4MQXD 3ROLB 1EZVX 4Y16B 1N0XH 4X9GA 1OQOA 3GNML 4KKAC 4AG4H 3HPJB 4LVHC 1D6EA 2MQ0A 3UJJH 4ACPA 5D96C 2E5EA 1JPFA 4BZ1L 2YC1A 4NNPH 1I8IA 4W6WB 3IAQA 2HVJB 2R69L 2YZ1A 2GT9B 3PHQB 4X8JB 1ZHBB 5I18H 4I3RH 1HWGB 5F97E 4PJIB 2P5WD 5DRNA 2WWMD 4M5YL 5KVGH 3G5VA 5CP7B 1ROWA 2XZQL 4Y5VC 1CZ8L 3HE7C 5K9QG 5KVMC 1NL0L 1RZJH 4QLRA 1T21B 5DK0A 4CVXB 3UZEA 5CLTA 2X4RA 2CIIA 1LP9A 1WBYB 2QSQA 3IU4L 4OJFL 3JV4B 2R69H 4HH8A 1BIIB 3O11A 2D7MA 5IR1B 5C08E 1NGWA 3VG9C 3KDMA 4H25B 1ZANH 4X7TA 5TQ0H 1KFAL 3SKOB 1MCQA 1MCPH 2IQAB 4Y2OA 3P2TA 4KDTA 3O9WD 1XF2A 1H8NA 4ONOA 1QFOA 1N5AB 5ADOH 4GRLA 5C3TA 4YXHH 1S78D 1QSED 3MRHB 2M26A 4IMKA 2B2XL 3FO9B 1UJ3A 4OD3L 3ES6B 1VACB 3WLWC 1ZT1A 4LSPH 2OSLA 4KHXH 3JWDH 5A2IH 2FH8A 4G6AC 4F7CA 3HC4L 3HUJE 3MRIA 1VGEL 1PX3A 3HI6L 5GRVL 5HHVL 1F6LL 2AKRB 3VXUD 1P7QA 3KDMB 4MVBC 2WINB 3L1OL 3EYOB 1S7QB 5GRYA 4POZD 1RZGA 4FQQA 4NRYA 3BKJH 4JQVA 4ZAKD 1XR9A 1IKFL 3V6OC 1N5AA 3SDXA 7CGTA 4RGNE 4LNVA 1Z0NA 2BNUA 3O0RH 3U1SH 4YR6A 3BXNA 4B41A 3K80A 2E7CA 4TQEH 5JXED 1IAIL 1UA6H 4OI7A 3NCJL 2FZ3B 2V2XA 3ZO0A 1KBGL 1PFCA 3BD4A 5DC4B 1R24A 3AU1B 4JO4H 1WAAA 1BD2E 3UTTD 3HG1E 3M1BA 3VXRD 1XIWC 5IBUG 3EFDL 2JCCE 2DJUA 1XR9B 4M6NL 4HKJB 1HQ4A 1Q1JH 1YNLL 4OGZA 1B3JA 2EKSB 1MPAL 1IGIL 4FTVA 4CADA 1MJ7L 3OBAA 5IMMA 1UYWH 3BH9A 2YA1A 3N1PC 3MLUL 4UDTB 4QRSA 1EBAA 3U9PL 1BAFH 4X6FA 5LKNA 5FKAB 1YEFH 4LCYA 3NFPA 2JJSA 4KJWD 2VWEC 4HKZA 5C0BB 3ULVD 4X9FA 3SJVA 4BM7A 2DDQH 3O4LB 1AR2A 3RWCB 1XIWB 2HJFA 4RGNB 3DXAB 3IFNH 3X3FH 4HC1L 4UDUB 4ELKA 3WJJC 4B53A 1JHLL 4G43B 3UXFA 1GGYA 1FGNH 4JKPH 5HJ3B 2VIRA 1D5IH 3QUMA 3C09C 4PGEA 5M7QA 1D9KC 2W59A 2YPLE 4NQTA 4N90E 2PXYD 5SWQA 2JB5L 3NZ8B 4LL9A 1V3JA 2Q8AL 4XNXL 1EFQA 2LFGA 3G5YA 1MHEA 4N0UB 1LO4L 4NYLA 4UT7H 2FWOA 5I1CH 1TDQA 4G6KL 4W4OA 3MLSL 5IVZA 5IHBA 4FZEH 4OLUL 4ONFL 3H9YA 5F1NB 1R3HA 5EC2B 3FRUA 2HVKB 3C6SA 5ICYB 1XH3A 2YEZB 4ZNEA 4ELKB 4D0CA 3TO2B 3I6KB 1OWRM 4LCCB 1AGEB 1IFHH 1ORQB 3DUSA 4FXKB 3QXWA 4WHYG 1X6LA 3AVEA 1I9EA 4N0CC 2Q76A 4G6KH 4D9LL 2OL3B 4LLMB 1FAIH 2X4NB 4YXLL 1J0IA 1KNOB 2L0DA 2BMKA 1ZK9A 4WFGD 4HUKB 4FFZL 1KCSH 2H32H 3KJ4B 1MFCL 3MA9H 2VQ1A 5F89A 3FQTA 1PVHA 5FGSA 5FO9A 3BW9A 1NCWH 3BX7C 4KVNL 3QJFA 1R3HB 1OAZL 5IB1B 2YEZA 1D5IL 2HTLC 5HHOA 3K2MC 3RWHA 4ORGA 4R2GB 1YEGL 4FQXC 1FCCA 1X5FA 2AJ3A 5DZOA 3RWJB 1JIBA 3AXLA 3KLHD 2IPKB 4WU7A 3D2UB 4F7MA 1JNNH 1KIQA 2HTLD 3S96A 2FJFB 5C08A 4JM2B 1EMTH 3QZWA 3QQ4B 3CFEB 3SOBH 3HE6C 3IDMA 2O61B 5HYIA 5C0EA 2G2RB 4AL8L 4JKLA 5IJKA 2HLAB 3RL2B 2EYRB 5DURD 5EC1B 1NFDE 3MLPA 4OB5H 5MENB 1U8MB 4PJHA 4NQSB 4PV9B 3QUZB 4QRPD 2IEPA 1JPGA 3N50A 3UPRB 2Q7YB 4M6OH 4ETQB 1YECL 1T0MA 3GGWB 4PG9B 1HXMA 2C4FT 2GUOA 4PJXA 3QCVH 3BN3B 3IDUA 1FVDB 4Y19E 5JQHC 1L0XA 5D5MB 4Q6YA 5CSZB 2NY5C 1A6ZB 3NFSH 5L2KE 5EBWB 3TVMB 5CLWA 2Q3AA 4Y19D 3ARDB 2EH8H 4UT9H 4YPGA 1N4XL 4XNXH 3IU3A 1MH5A 2FLRT 3CDGA 3P30L 4A6YH 3E1F1 3B3IA 2E27H 2QQQA 5F44A 5C0ND 3NCJH 1CQKA 1JF1B 4QRPE 3EJZD 3LPGA 2X89D 4OGXL 5DTFB 5T1MA 1HHIB 1RPQA 4GAGH 2GTZA 2EDEA 1ULVA 4P2OC 1UT9A 2W9LA 2XRAL 5I8EA 5EULV 2YSSB 1KLFA 4ZQKA 5HHNB 5DC9B 1RIHL 4MS8C 5DWUH 3NPSC 1WWCA 4HK0A 2AEIT 3ULVE 2CSPA 4XCFL 3BPOB 1JZ3A 1X5IA 2NY6B 2X9XA 4NFCA 1TJIL 4LSSL 5GZNC 3WFDL 3V8CA 4OZHA 3ZTNL 3KPRA 3H0TB 3ALWA 3MACH 2BVQB 2FX9L 3BZDA 3RY5A 3RNQB 4Q9QH 1DUZB 4IRJA 1DE4B 1UYWL 2AEPL 4OZGF 1NCWL 4BH7B 1QSEA 4U6TA 5EORH 2EIBA 3P9MA 3RRQA 3C6LD 3GMNB 4L4TA 4WFGE 3RHWF 1I8MA 5HI4D 5F7FA 1QLRB 3DXAD 4FABH 3DX7A 1T7VA 2IG2L 3PJSA 4OGYL 4LF3B 4O51B 5F1KC 1LE5B 1I9RH 4BKLA 3RTQD 4YEEA 1T80A 1QTYT 2Z92A 3F12A 3H0TA 1KLGA 2A6JB 2WP3O 4ZXBA 4MB4A 2BC4B 2PYEE 4P2QA 4EOWH 5J6HB 5LQBH 1UGNA 1NGXA 3B5TA 4U1MB 1UWXK 3MUZ1 4Y4HC 3QPXH 2WUCH 4DGYL 1CVRA 2H45A 2XWJA 1JK8A 4LLDB 4LVHB 1EPFA 1IKFH 1FNGB 2Y7QB 4GKSB 1UXSA 2BRRL 1WZKA 3KPQB 1DEEA 3NA9L 5IM7B 3C8KA 2VDPH 4JFDE 4LHUB 1P84J 4NGHL 1KCVH 3CLFL 3VWJC 3HC4H 2VLRA 3GJFH 5EUOE 4XWOD 3F12B 3HZYB 4HFWB 1XGUB 1A6PA 4PJ8C 1JWMA 4YGVB 5B38G 4ZNEE 3ABZA 1OF2A 2I07B 3FOLB 2A0LD 4G5ZH 4FP8H 5D7LB 3C5ZD 5JA8B 1L6XA 4XH2A 3BKJL 5ECJE 3WFCH 4CN1A 1KB5L 4K94H 1PG7X 1FJ1B 2MCPH 2R39A 1RZ7L 4U7SA 1MFBH 2GK0A 3MOAH 3VW3L 3K1KC 4P5TB 5INCA 3C8KB 4K7FA 3VFSA 3MUY1 1H0DA 4WY7L 1IQWL 3QUYC 1T2JA 1WBXA 4F7PA 1NBZB 4ENEC 1K4CB 4W4OC 3IVKA 2RIKA 5FCSH 5DVMA 5KSVA 3RVTC 1B4RA 4XPFL 2EDFA 1YEIH 3ZDYF 1ZTXH 2J12B 3V0VA 5IUSA 2YN3A 2X4TB 2EZ0C 3EYQC 4WW2A 3BESR 4TNWK 2NW2A 1I4FB 1U2HA 1HSBB 5LCVL 3PGCB 1BFVL 2R15A 4MD4A 2IFFH 3TC9A 2W0PA 3FL7A 1WEJH 1JGLL 5INCB 3N0PB 3HAEH 2BY1A 4ZUUB 1T6WA 3AREA 4RCAA 4EXKA 4JFPA 3O4LD 3GMLB 1U8QA 4NBYB 4GRMA 5C7XH 1DBBH 4L8DB 4X4ME 3WO3B 5C0CE 1ADQL 3ZZ1A 1KYOJ 3AS0A 3CMOL 1V3LA 4HS6B 2NCMA 1GVIA 1HQRB 4KRLB 3MO1A 1UB5A 2X4TA 1H9VA 5KAQF 1F3JA 3PIQA 5I1DB 2OJZH 1MIML 2O5XH 2VDKH 1GC1L 3AAZB 4LRIA 4MD4B 1OP3H 5C9JA 5EIIB 4JRYD 4LIQE 2YK1L 4UTBL 5F1IA 3EJZC 3F5WB 4NZUL 4OJFH 1MJ7H 1Q9KB 4U3XA 3U82B 2Y23A 1JRHL 4ZUWA 1MWAA 3C8DA 3BZ4A 2CH8A 3OR7B 1CE6B 3U2SB 4RGOL 4XBEL 1BEYL 1UB5B 5L2JA 3CVIL 3IGAB 2IMNA 4XP9H 1GPOH 1MRFH 4G6JL 4NFBA 2FX9H 5ACLA 4LPYA 4XTRC 3NGBC 5I1DA 5GHWH 2ZCHL 1KJVB 1UACL 5C08D 5TDPB 3VW3H 5HYJD 2DM3A 4FA8A 4ZFZB 4UBDC 5IESL 1RZJC 3BISA 4RBPH 4ONGH 5CJBA 1F2QA 3V4VH 4DQOL 3KR3H 4UIMA 5IEHB 3B8SA 5GGTA 5FDYA 3QI9B 3SDAC 2P5WE 4PTTB 4CU7A 1FH5L 3VFRA 1FNEA 3KPSD 1YUHA 4MQSB 1F4WH 4PRBB 3PHOB 3SO3B 2LV4A 4S0SD 2HWZH 5HGHA 2QR0A 1G7PB 5IF0A 2D9QB 4FS0A 3I75B 3JWDL 1NLBH 1I3RA 2Z91B 2UWEB 2C7UB 4LCUA 3GKZA 2ATPA 3MRFA 3VDBA 3GI9L 2F5BL 3D69A 1DBAH 2DQHH 3D6GA 2PYEA 3QI9C 1F42A 4KHTH 4IDJL 4S2SB 1N0LA 2DYPA 3ARFB 4L29B 4XVTH 1U8PB 3GBLA 5E8EB 1DQQA 5MEQB 1LDPL 5LWYH 4PTTA 1W0WA 3BZEA 1FNHA 3C08H 4JPVL 2JJTA 1RHFA 1D9KB 3ZL4L 4MQ7B 1DBKL 1EGJH 4NGHH 4HK3J 4FFWC 4U1JB 3SKNB 1ITCA 2VDNL 3MRJB 2CDGA 2DQFA 2P8MB 3HC3H 5FYKL 1E4JA 2BSTA 4P5MB 3HI5H 3MGOB 5C9KA 4ELMF 4NC0B 2FHFA 5EUOA 2YD3A 3NCYP 3QHZL 4GBXC 3BKMH 4M5YH 5KVGL 4JE4B 4U7KA 3TBWA 3I6GB 3BMVA 3QG6A 4L4VB 4QHLA 3G6DH 4JKKA 4K7PL 3X12A 1AGDA 1TZIB 3L3HA 5CD3B 2ZUYA 4F80A 5C0FA 1E28A 1N26A 1F90L 1YNTA 3VD3A 1I1YA 1FHGA 2IG2H 1QNZL 4U6YA 3TT3L 5DYOA 2FX7H 3QEUA 5I1LA 3AMLA 4QRUB 4XNMB 5DRZA 2Y06H 3O3DA 3F7VB 4P3CL 3I6LD 1ZWIA 3UO1H 2NY7H 4BFIA 2IANE 4CDHA 1T1YB 3OB0H 1A6VH 2FD6L 5AYQA 1H3PL 5TF1H 3K7UA 4X6BB 4MXVE 5C0AE 2J5LB 4P59L 2Q1EA 4J23A 2KL6A 3DX6A 4IHOB 4P5KB 1H5BA 1IQWH 1BQHB 1A5FH 4NHUB 4WV1B 4TSCL 3TNNA 2G75A 4YIQA 5E5UB 1AQKL 4GW1B 5DUBB 2OL3L 2P24A 2YXFA 5EZJA 5GJSH 4IIQC 3VFVB 5ESQA 5ICZB 2HN7B 3QIUD 1T1ZA 2OTPA 2QV2A 2LTQC 4MJIE 5AAMA 3WIHL 2YA2A 1LNUA 1E4WL 1G7IA 1LEIA 1CR9L 1SJEA 5DJZB 1KENL 2XRAH 4OZIA 3HUJA 2GJ6E 5CD5C 4NZDA 3NIFE 1QBAA 1K6QH 4XVJL 2VDRL 4O2CA 1PKQB 5F3HB 4YNYA 1N4XH 5A2JH 5CD5D 2GSGB 4MX7A 1L4IA 2DQJL 5C07E 5I16B 4OUUB 4QHKI 5FYKH 5F93C 2MOVA 2AGJL 5LGHH 3REVB 1XGTA 3ARXA 3IDNA 1MCLA 3ZLQC 4RX4D 3TYGL 1RZKC 1F3DJ 2D7NA 1K6QL 5E5MA 5IB2B 4X99A 5FK9B 1SJEB 1FBIL 3BE1H 3U79A 3UTPE 3WIIH 4YBQD 3WO4B 2EXYD 3HUJB 4JPKL 5D1ZD 3LV3A 3VG9B 4KVNH 1I3GH 3OB8A 4OIIH 3EYVA 5CAYB 4PGBA 1A7QH 4I9WD 5F21B 1QSFB 4L5FH 3CZJA 1UG9A 3B9KD 3T04D 4YAQA 4WU5B 2KBGA 1UM5L 1CGVA 1M7DA 2PW2A 4Z76B 1LO3H 5DD6A 2K7QA 3MRCA 4X5XA 4Z7VB 3QCVL 4IRSD 1LEKA 1A7OL 1XGTB 4OCXH 3IDNB 4N5EC 3MRKB 3DETD 2CR6A 4HUWB 4D8PB 4HWZA 2HT3C 3EO1A 4P2RD 4X7FC 5E6YA 5BVJA 4KROB 5I1AB 2BK8A 5IMKB 5TF1L 3NCBB 3O2WH 1JZ6A 4CW1A 3LEXB 4NZRH 1IC7H 1PQZA 3SE9H 1ODAA 5I1IH 1JZ4A 1F58H 4NO2B 4C55A 4GW4A 2QSTA 3U48A 4MB5A 3TESA 4HQQL 1JV5A 4JFFE 4WI8A 4E0RB 4HWEL 1U91A 1N2RA 4AJ0A 1JE6A 1P4BL 3RNKB 1BPVA 2I5YL 4UILH 1RZFH 2XIDA 3DIFB 1IC4H 1MRDH 3V2AR 3EO9L 1AGBB 2P45B 2F8VA 4BQ6A 4FXGB 5I1AA 2K1MA 3I3BA 4NO0D 4YUEH 4P46A 3B5HA 2VZUA 3QUKB 2VERN 3HRPA 1G0YR 1YEJL 3UZQA 1H3UA 1QHOA 1CXIA 2NR6C 5SWZB 4LFHG 1SYVA 3D85B 5E24E 5HYSB 3H7BB 1IZJA 3BT2H 3IJSB 4YXKH 5GS0H 5HYJA 1N2RB 1TFHA 5FM5O 3U9PH 4FQCL 4J3OC 3INUL 5D7KD 1ZT1B 2OSLB 3HPJA 5TJWK 4M7ZC 4QEGA 4G7VL 5CWSA 1OAQL 3FFDA 1D5XA 3HG1A 5TDNB 2X44D 4LP4A 4U0QB 3IXTA 4HLZG 4KI5E 1JGVH 4V2CB 4CN4A 1RZGB 5C0JA 4OT1H 3T2QA 1T2QL 4BZYA 5IB4B 2Z9TA 1VFMA 3HI5L 3WN5A 3BYYA 1QNZH 4OKVB 5IB3B 5GRXG 4NQVA 3O9WC 2F19L 4IRZH 4K9EC 4PJCB 3VGDA 1SYVB 3WXWL 4PJIA 1FL3A 1FFRA 3A6BL 5ITFB 1HIMH 3G5VB 1A6AA 3QRFM 3TCLB 2EH7H 2XY2A 1RJYB 5GSRB 4GLRH 1KELH 2BHZA 1RSFA 4PJ9C 5TFSL 4NQCB 2BX5A 2XN9A 3O41B 3BIKB 1UXWB 1AY1L 5FV1L 1RJZB 4G6AD 5T3XD 1FLTX 2ADIB 4ELME 1A02N 4L3AA 4QRRD 4X4YA 4RBPK 4JB9H 3T0AA 2DBLL 3JZ7A 2LU3A 3WN5B 4OBRA 4OKVA 1MQ8A 1MCEA 1T22A 2WUBH 1GYAA 4Y19B 4FTVB 5ITFA 4MAUL 3MBXL 5DFTA 5FFLA 1MFBL 5TPWH 1PYWB 4P59H 1HHGB 4JPKH 4BYHA 3ES6A 5FM4A 1YC8A 3ULUL 1J0KA 3LQMA 4C83A 3BPCB 1QRKA 1K3IA 3BP7A 2DQIH 3FB8A 3OKYA 3F6LA 4M02A 4Z5RB 5K93A 2D31B 4LHUG 4P9HH 3BPOC 1KXVC 4TVPH 4EI5B 2B7DT 4OCYH 1BHGA 2FIKA 4H0GA 4X4YB 4GUPA 4OM0H 2F74A 1RU9L 3IFLL 3SY0A 2VQUA 5E2WL 2DQTL 4M43H 4OF6A 2V17H 2E8YA 15C8L 1YEDB 2XZCH 3H42L 4RQQA 1NSNL 4K7PH 1L7IL 3PWNB 4KY1H 4OFYD 4BUGA 3MODH 4GMTL 5C0BD 3ARBD 3PL6B 5DJ0B 5JZ7C 4UBDD 5DD1L 2AK1H 1CFVL 5CZVH 1KG0A 2FCBA 3IDYB 1NL0H 1RZJL 1T4KB 3FJTA 2VYRE 5ETUB 3F58H 4QNPE 1VFBB 3U0TB 5DD5H 1PD6A 1DQJA 1SM3L 4P2CG 4X98A 2OK0L 3ARGB 3SQBA 1ONQB 1MHHA 3ZKMD 1DQDH 2PW1A 5I71C 1MFDL 3S37H 1PKQE 2IH1A 2IPUG 3QNZA 4O2EB 1W72B 4U6HA 3U0WH 4JHAL 3CU1A 2DB8A 4PJBE 2DF3A 4JHWH 4OIBA 3HS0B 5J13B 1WCBA 3V79C 3OAUL 3D3VE 1S9WB 4KAQL 3IDJB 1F5WA 5SWSA 5J6GB 2VKWA 2WWKO 3WIFB 4PPTA 3SDXE 2GJZA 5KS9A 2E6PA 4BZ2L 4RGNC 2A74A 1Z5LB 2Y06L 2CDFA 1WQVT 1E6JH 3B9EA 3U7YH 3RZCD 1Y6NR 3HE6B 1WTLA 4NZUH 4RAVA 2RFXB 3BPLC 2VZOA 3ARGA 3IS1X 5E6ID 5MENE 3OJ2C 4XP4H 3BPNC 3DXAA 3T0VA 4GAYB 2DKSA 4AM0A 4U1IA 3FO1B 5FB8A 3W5MA 2DI7A 2VL5A 3TN0A 1F4XL 1MIMH 3MRGA 5KN5A 3F7YA 2RR3A 4WDIB 5DFVC 1RIHH 3SJVD 4KGJA 3HZMA 1CDBA 5FGBA 1RZKL 3C6LB 5IW1B 3BKML 4OCMC 4A6YB 1OT1A 4FP8L 5BRZD 2DQCL 4K07A 2GJJA 1X6NA 5D1ZA 2ENYA 3FRPG 4OUOA 1U8LB 4P4KA 5EOQL 5K59E 1TIUA 3HE6A 4NYLB 2FHCA 2L7JA 3ULVF 2ICCA 3MV7E 3CCHA 5F6HI 1J0HA 2EH7L 4FG6D 4ZPVA 4A6YL 2PXYA 4PGDA 3MRLA 3CH8A 4AM0B 1XH3B 3GKWH 1IGYA 3BEVA 4C56E 1UJ3C 2NX5A 4P4RB 4YFEA 3ARWA 4D0CB 2B20A 2WWKT 3V6BR 3B5GA 4GSDH 3GMPB 1DBML 3GB7A 1T83A 4OT1L 2ICEB 3Q3GB 3MJ9L 3GBNH 1JNHA 3EIFA 1RZIB 4HGKC 4JGUA 5IWLA 5JOPD 2J6EL 4U3HA 4XC3L 4GSDL 5JIHA 3ARDA 1RAMA 1T7ZA 4PJ5D 3AS1A 1GHFL 3X11A 1C12B 2BERA 3CDGB 3LS4L 2NX5E 2HH0L 3HR5B 1QVOA 3EBAA 1GGIH 1XCTB 4NOFA 1CK0L 1L7TH 3FN3A 3FQTB 1TVBA 2ICWI 2DD8H 4KK9D 4WUKH 5DA0B 5L0QC 4IDLA 4N0RA 3IFOB 1J1PH 3MRLB 1IAIH 3GSUB 3VXME 4LKXA 3HLAB 1LMKA 3WDHA 2GSIA 5C07B 1ZVSA 1MCWW 2BRRH 4I0PA 1MCOH 1Y0LB 4JFYB 4JY5L 1BQUA 3CDCA 1KCUH 2O5YL 2DQCH 3UZVB 4KI5D 5D70L 2YD6A 4I2XE 2PO6D 5I9QC 4D9RE 2FNBA 1RJLA 4Y2DC 4HK0B 4KJPD 3N1MC 4Z95H 3V6FA 1BM3H 1MUJB 3EO9H 4OZGE 1P53A 1KCVL 3KPRB 3IDMB 1A9BA 2VISB 3EDFA 3QFDA 4GRWF 5DXWA 3GSRA 3TYFB 43CAB 2DMBA 4JN2B 5DQ9A 1YN7B 3FN9A 2EYRA 5EC1A 3LDBB 3QAZB 4HWEH 2CLRA 4M6MH 5E08L 1S7WA 4K2UH 3ARBA 4TVPL 3FONB 2P47B 3D0VA 3EYSL 1VFAA 4G42B 3DX8A 4RFOH 4QRRA 1LP9F 3W2DL 4J3VA 4XX1E 4EUPH 5CJQH 4XI5D 1DN0A 2C5DC 1X7QA 1QBMH 2HJLB 3LB6C 3O4OC 1RVFL 3P0GB 2VLRE 3V6FB 3MBEA 1L0YA 4PJEE 1W8OA 1AH1A 5HGDA 4HWBA 2FECL 5DHYB 4WY7H 4WTXA 3SDDA 1S3KL 4JPWL 4NM8H 5IJVA 4J8RB 4PGCB 1QO3A 2VZ1A 2ORBL 4OSUL 4NBZB 4HUUA 4QXTA 1IBGL 1T66C 1RK0A 3BO8A 4JRXE 1F3RB 3CX5K 3VXNB 3QQ9C 4GKSA 3FONA 5LGJA 5BV7C 3U30B 3MV9A 3DX8B 3IAPA 3DETC 4NQXA 5HHNA 3G04B 2LAAA 3DYMA 5IM7A 1DN0B 3R1GL 3ZKMC 3MFGB 5L0QB 4LHUA 1PG7H 2GY7B 4HZAA 1R0AH 4HUVA 2BCKA 3VCLA 1LEGB 2VZVA 2A1WH 2Q8BH 3W11D 4U1KB 1OW0A 5HHQB 3LVEA 4UQ2B 2IH3A 3QEHB 4WHTA 2RQ8A 3HNSH 2F19H 2GTWA 2P5WA 3T65B 5C6WH 4D94A 3VGHA 4DOHE 2BSSA 1QSEB 3M07A 4J3SA 4MNGA 2AQ2A 1F6AB 1LO0H 1B0WA 4PYGA 5IMOB 3MGAA 4S11A 3VXNA 3WEXB 1NUNB 2EDOA 4NQCD 1QLRA 1NGYB 4P5TA 5D6DC 2X40A 1FBIH 3BE1L 2ZSVB 4M6AA 2BDNL 2APXA 4H1LB 3PDGA 1WSST 3DBXB 3G6AA 1XMWA 4EDWH 4L4TD 5E9DA 1IMHC 1G7QA 5FO8B 5K9OA 5B3JE 4CU8A 5CINH 1NCCL 4FQJL 1S3KH 1WIOA 5TDOB 3DRQA 3J8F7 3BGFB 5KZCB 5AD0A 1OGTB 1Q9LB 3PGCA 4MYWB 2FB4L 4KJQC 1J88A 4ODVH 1FC2D 2Q86A 5CMAB 3MMEB 4RRPG 2AJVL 3KLAA 4YHKL 4K9EL 4HPOH 4HS8H 3PWLB 4ZD3L 4U0RC 3HAEB 2C1OA 5E2VH 5J1AA 5KSBB 3VXUA 2QQKH 4FQXD 4WI5A 3WJJA 1F4YH 4TULH 4D9RD 1D3CA 5FF6A 5D7SL 4NP4H 4MD0A 2W92A 4NJ9H 5E99H 3GI8H 2VB5A 5GRJL 1JYXA 4K8RD 4YXLH 1HQRA 3MO1B 2VUOA 3S36H 3HPLB 3DRQB 1A7NH 1RUKL 2V9TA 1Q9LA 4MXQD 4UV4H 2BSRB 4MMZC 3MR9B 1HHKB 3Q6FA 1JTTA 2P8PB 5JTWA 3X3GH 4X9HA 4KK9C 4XXDA 1AI1H 4XZUA 4ODUB 5JOPE 1VEOA 3ARGD 1MCOL 4JY5H 3U4BH 2XV6B 4APQA 1KN2H 1C1EH 1RUPH 3DX9B 3RPKA 3L3OB 3NFSL 5EU6B 1QKZH 3OR7A 4HKBB 2MWCA 3UTOA 3TBTA 5DZNA 1DUYA 2VLKB 3MRBB 2BOBB 3IGAA 2YMXL 1TITA 3RP1A 3ZYJA 5JDJA 3Q48A 1HSBA 2JTDA 5BRZA 2VL4A 3WIIL 2EDKA 4JKPL 3MV8A 2OZ4L 2R8SH 5F9WC 5ALCH 1K5NA 5JW3H 5D7IF 1U8JB 1ZE3C 3UX9B 1WFNA 3QWOA 3BUTA 4U1LA 1MJJB 1RIVL 2L4OA 4K2UL 3GIVB 4Z78A 5T1LA 4Q2ZB 3D39B 4HH9B 4HS3B 4ZFOL 2N1KA 1CU4L 5KAQG 3LN5A 4Q6IC 4PP2A 3DI2B 1I9JL 3DX9A 3VWKC 4X4XB 4KDVA 3IJHB 3QUXA 4M7KL 3L3OA 3S34L 4L1DA 3VD5A 2DLHA 5F72S 1FNEB 1DUYB 4KTDH 4R97B 5FGCB 4E5XA 3QYCA 1LILA 3PHOA 3W9DB 2EDQA 1TLKA 3DPBA 4LKCA 5GGRB 1QLFA 1R3JA 3EOYG 3GMMA 5HYSG 1ED3A 1A47A 3S5LB 4D0DB 1I7TB 3MLVH 3QSKB 3KPSB 2H2PD 4RAUA 1DQMH 4RAHA 5DUPH 2AK4B 3JSSA 4CVUA 1UH2A 4WCYL 5C0IB 1ZA6A 5JHLL 2PYEB 3FB6A 1MEXL 3NH7L 3S98A 4S2SA 1MWAB 1L0QA 3QUXB 3ZE1F 3BZ4B 3HUJF 4QT5B 3TIEB 2V5YA 3U2SA 2E9JA 3FAXA 4U1HA 4Y5YA 1CT8B 1SMOA 5EU7E 4I5BB 1EEZB 2DLGA 2Z31C 3DVIA 5L2JB 3E2HB 4KPHH 5C8JB 3KPSE 4JFEA 2B39A 1IRAY 3FKUS 4K8RH 4D3CL 1XFPA 3GDBA 4XGZA 2ARJB 3WHE0 4QYOB 4M93B 3T3ME 1G0DA 5JORA 4M8QB 1G9MH 3AROA 4HJ0C 2ZUXA 3MLSH 3OWEA 1T0NB 4Z7UB 4C59B 3LH2H 1SYSA 3WFHA 3H6JA 1H5BC 5EUOB 5E9DD 5ABDE 2N56A 3GJFK 2J3SA 5C0IA 1ZXQA 3NIGF 5DURB 3F65A 4XB7A 5E1AB 3LN4B 2WSKA 3GSWB 3Q1SH 2UZXB 4QGYA 1PG7L 5JHDD 2HFEA 4AEIH 3W9EB 4JDTL 4P2RA 4P23B 5CCKH 2CUMA 3EOAA 3VI4F 3WIHH 3QEUB 5I1LB 4Y5XC 3CFDB 4FQXA 1HCVA 5CSBA 4JFHD 4BFIB 1S5IL 1G1CA 3SKMB 4POUB 1L9NA 3VWKB 4XNYH 1U8HA 4XPHH 2AJZA 5D7IB 5E1AA 3WL9B 1DQQB 5MEQA 3V5DA 5JOFA 4OD3H 5F7DA 1X5HA 1BQHA 2FO4A 3QNXA 4LNRA 3CC5B 3FO2A 4Q58C 3TF7C 2XKNB 3SBWA 1JNLL 4NKOA 3JTSA 1YEIL 1INEH 4OLZL 1T1ZB 1OB1B 1QBLL 1KB5B 4YLQT 3L95B 2H32A 4EN3B 1DTUA 1DP0A 5C0CD 4E41B 2CDGB 2P8MA 4ZSOB 3LD8C 5J0BA 5IT2H 2Y6SC 4ONHB 3CFDA 4XPTH 2BSTB 4P5MA 3FQXA 4M7LT 1A6UH 4LLYB 2B0SL 5DJZA 1UKSA 4XAKE 1K2DA 1JGDB 4OV6F 3ULUF 2OJZL 3H3PH 3QH3A 4EDXA 1OCWL 2Y5TA 4XPBL 1TTGA 2OK0H 1F4WL 1FYHB 4NO5B 5D72H 3F8UB