1BOGA

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-homologous peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
b'DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGTASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY (CB 4-1)
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
molecule tags Complex (antibody/peptide)
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1998-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogA01
3BRFA 4O4YL 5E2VL 5JOPD 3GNMH 5E94A 5DJ0B 1NC4A 1FVEB 2FGWL 1F4WH 4RQQB 4UTAL 4P5TA 2Q86A 2AJUL 3ARGA 5D1ZC 5E08H 1OAZL 4ZSOB 5KSAA 4XAWL 4F7CA 4QTIH 3TN0A 5CGTA 3T2QA 4CW1B 2ZSVA 3EDEA 2BNRA 2DTMH 4AYFA 2OJZL 5IW6A 3TYGL 5DRZB 2XKUA 2P7TB 1P1ZA 5FYKE 2RFXB 2W60A 5I74B 2DM3A 4ONGL 3JXAA 4Q97A 4Z78B 2WQ8A 1D6EA 1LO3H 1RMFL 4JO1H 4OGAD 1XGYL 4IRSA 5DJCA 1HH9A 3CLFL 3U79A 3MXVL 4X9HA 1YEKL 2GUOB 1NSNH 5DFVC 4G6JL 3LKQB 4OLYL 3GSNA 4MLSA 1I8LC 5D71H 4W4OA 5I76B 4JM2B 1F4YH 2RR3A 4GRMB 5GIRA 3K0WA 4UAOC 4WFHE 3RWCA 2P5WA 3T65A 5JA8B 1YN6B 5E1AA 5HY9A 1CR9L 3L5XH 4MAYA 4YXLL 1ZS8A 5ERWA 3TBTB 3C6SB 2IPKA 5AYUL 3WL9B 2HT2C 2P1YA 1IGFL 5HVHC 2YRZA 1IGCL 3M8OH 4Y89A 4U6YA 2IALA 4DVRH 3ZDYE 4E41A 3VRIA 3QPQD 5IB2B 1QFWM 1SBSH 3J7HA 4BFGA 4N0FA 4YZFF 4OT1H 3LEYL 2VITB 5F1IB 1IEHA 4JG0H 3QDME 1TJIH 2NTFB 4O51A 4PB9H 4KK9C 4FQPA 4DW2H 5E6IC 1NKRA 2XWJA 2R2HA 43C9B 4NUJA 4V1DD 2WUBL 2L7JA 2P8PA 5F6HJ 5FOBA 4D0BB 3CH8A 3FB7B 3T09A 3BDXA 1D9KD 2HFFB 1YEGH 3F7VA 3JTTB 3SDXF 4M5YH 4N0CD 1FNSL 5F9JB 5BQ7B 4JFDD 1RUPH 4BA8A 2N1KA 4AIZB 1T7ZA 4UNVA 4MB3A 2NXYD 1S9WA 4Z7WB 5IF0A 2GITB 5EZLA 4YHPB 1HHHA 2XT1B 1V7MH 4ZG1A 1R0AH 1Z3GH 1YMMB 4P46C 3H9SB 3ULSB 2YA0A 4NCDA 1KN2L 3MBEB 4BKLA 3NAAL 2FD6L 3RX8A 1IM9D 2B2XL 2UZIH 3C5SA 3L5HA 3BGFB 4KUZH 4QLRA 4JREB 1EVTC 4PREB 3QT2A 1X3DA 5F7WC 3CDGB 4ZPVB 3RWHA 4P2QB 4OCRL 4ZODA 3ZL4H 4IDLA 4X6EA 4XRCB 2AEPH 1FJ1A 1L6XA 1ZVYA 4QXTA 3SQBA 1QBLL 1WWWX 5DMGC 3IJYB 4LPYA 5FYLD 1QQDB 4FXLA 4U1SB 2EDDA 4PJIA 5EBGA 2P49B 3TIDB 2NTSP 3DUSB 2ZUQB 4GT7A 3DPBA 1Y18A 4I3RL 4XNQB 4EXKA 3C5ZB 4XCFH 1AO7B 1YPZB 5SWZD 4M5ZL 5FUCE 2XN9D 4TQEL 5DD6B 3HFMH 3QDGA 4ZUWB 5DZOA 3NN8A 1RJZB 4C55A 1N6QL 4YE4L 3O3DB 2H8PB 2PW1B 3IF1A 2EDNA 4AEIH 3H7BB 5EUOE 4IOFD 2Q8BL 2V5SA 4GUPA 1AXSA 4PV8A 2XQYG 1JJUA 2RQ8A 2I60L 4M7JH 3UDWC 5CEYA 4HUUA 2P5ED 1DBBH 3NCJL 1KCVH 1EFXA 2DDQL 3HG1E 3TIEB 3BE1L 2CK0L 4UIMA 4GOSA 3KGRA 3HNSH 5F1KC 1Z9SA 4X4XA 5DEGB 3JBG7 2ZKHH 1IKFL 1WT5C 1RJYB 1OTUD 2VDQL 1NH6A 1FGNL 3WS3A 3VXSA 3MGOA 4FOMA 1T66C 3H3KA 2D31B 3GB7A 3FRUA 1XF3B 1HE7A 2IEPA 3QA3A 4JFFA 4JFQB 4YDVA 4JAMB 5EU7C 5SV3A 3P9MB 4UZGA 1MCWM 5E8PA 3SDXA 3U4BL 3QJHA 2A73B 3K3QA 5T5FL 5FKPA 1FYTA 1EERB 1DANT 5IVOA 1FGVH 4UTBH 5GGUB 4KJQD 3WDJA 5FYLH 1I7UA 5KZCB 3D85A 4P9HC 3QDGE 4X98A 3BPNC 4JFPB 3CFDA 3A6CL 3JWOL 1T4KB 3IETB 1A47A 4EQ2A 1OAXL 5IQ7H 1SEQH 3GBNL 1Q94A 1TVHA 3X13B 1B0GA 3LKOB 2FEEI 1S7UB 2DD8L 4R7NB 5GGQL 4L3CA 4X6BB 3VGFA 1UA6L 4MJ5B 2DLFL 4DFIA 4S1RH 1T2QL 1OM3H 1J1XH 5CSBA 3OXRB 3LSOB 4P4KC 1T5WB 1OGTB 1MCNA 5MEOB 4XWGL 1UYWH 3PIQA 1IM3A 2XI9A 1FC1A 5D96B 2OMBA 4FN0A 4ZPTA 3CLEL 4JN1L 2Q7YB 1CD8A 3NPSB 4JPWH 4YZFE 2QQNL 4PRIA 4LVHB 3VXSE 4JGUA 4UQ3B 1U93A 5GRZA 2X05A 5ADOH 2DKSA 1I1AC 4L1DA 3BN9D 4PFEA 5TE4H 4R2GB 5EU4B 2IFFH 3MLWH 3P9LB 1NGWA 4ODXB 5IV2B 4KJYA 1QLEL 4OCNC 5EWIH 1GIGH 3MJGX 1LMKA 1I9RH 5ICZB 2EDEA 4Z7VB 3SDXE 3PL6B 2Q20A 4R6UA 3W2DL 4I18C 2D3VA 4A2LA 3VXRB 1FYTE 5I8KH 4EDWH 1J8HB 1WISA 3O2WL 1JZ4A 4G8FA 5DTFA 2VN4A 2D7MA 4XVSH 3VRJB 4M6ML 5DUBA 2A38A 2H41A 5D1ZB 4NWTL 4OF7A 3JWDC 5HI5D 4OI7A 5HPMB 1VDGA 2Z31D 3DMMC 2VZOA 4M6NL 3QHFL 4LHUA 2GJJA 4FMKA 4ZFFA 1D7FA 1WJ3A 2VAAA 2VXTH 2VNCA 3CIQA 4PY7A 1A2YA 1PSKH 3DETD 1JNLL 2B39A 3LPGA 4FS0A 4M9PA 5D6DC 4ZO9A 4LQFH 2JJTC 4KROD 1KENH 2R29H 1ZLUK 3QQ3B 4AQ1B 4ESKA 3EOTH 1WZMA 4G43B 4DFHA 1KXTB 4R9HA 3IU3A 1SHMA 4NM8H 3UPRA 4PTTA 4KKBD 2IAND 2ZNXA 3O6KH 1DP0A 4PUBH 4UAOB 4UT7L 5TPWL 4Y88A 1Q72H 1MVUA 2IH1B 4PRIE 3NTCL 1CLYH 3GRWL 3BESR 2G75B 3F7YA 5BRZB 4HUMB 1A6AA 1XF4A 3VE0A 3R4DA 1DQLH 4LCCA 3U36B 2CXGA 3G5ZB 4LRIA 5HVHB 3WD5H 5I18L 5GZOC 3ZE1F 4FQCL 2O61A 4JZOB 2FX9H 2X4TA 3BP4A 1MJ7H 3HR5B 4K3EH 4UT9L 1KLGB 4POZC 3UPAA 1E4WL 2DQIH 2Y25A 1MCSA 1DLFL 5JOPE 1MNUL 2BVTA 4KAQL 4QOKB 4C56D 3QIWC 1VPOL 1I7TB 3ARSA 2C9AA 5JW3L 3MLZL 5MHSD 2PETA 3SO3C 2IC2A 1KN4L 5MEND 5E6IB 2M1KA 4I1NB 5EC1B 1RZ7L 3KYOA 4V1DA 4TPRL 3E6HB 5K9OB 4RIRA 2HKHH 4IDJH 4YGVA 2P43B 4KXZI 1D9KA 3ARED 1KF9B 1UWGH 4GMSL 3LPFA 1JGDA 2MPAH 1IC1A 3T77B 3MRCB 5AEAA 1DDHA 2X40A 1TITA 2Y06H 5E4IA 4YHOL 4WW1B 3GGWB 1NAMA 5FHAH 3VA2C 5L88H 2NZ9C 4H5SA 2HTLD 2DLIA 2NY0C 2ARJA 3C2AL 1BECA 2DQEL 3CUPA 4X6CB 2Y36H 5B39B 3H9YA 5KANG 5J3HD 1MREL 5SV4A 2VERN 4ODHL 2FIKA 4P3DB 4F37F 2A6IB 2V2TB 2J8HA 1K8DA 4PLJC 4WHTA 1FDLH 3PP3H 5C0RL 4HXAH 3TBYA 4P46B 5DSCA 3QZWA 1IM9A 4XMKH 3NPZB 4JY5L 1JPST 5JIHA 1R3IL 3D18A 2R1WB 4K8RC 3VFMB 2XZZA 3D69A 3KWWA 3OJDA 5ECJE 3S4SB 1QR4A 4EUPB 3VFGL 3KR3L 3DIFB 5ICYB 2VZUA 3G08B 4PB0H 5HGGS 1MAJA 1MCFA 1ZV5A 4ALAH 3QZWG 3LDBC 2E7LC 3LRSB 5FF6B 2A74B 3KYMA 5JZ7D 1NCWL 4NN6C 3KJ4C 3DURB 3IDJA 1X44A 2XN9A 2UUDH 3BKML 1PAMA 3FOLB 5C08B 4PGEA 1OCWL 3OPZH 4YPJA 4V1DE 3ROOB 4WTZA 1BIIA 2B1AL 1GHFH 1JMXA 1R24A 4WDIA 4HBCL 4JGJA 1ND0B 1RIVL 3RZCC 1KTLB 4WEBH 5KG9B 1P7KA 2CLZB 2P5EA 3LN5A 2FHBA 4PJ7F 4NWUH 4JFDE 1WIPA 3WLBA 1U42A 1N59B 5LXGL 1ZHLA 4GRLD 3G6DH 1LE5A 4ENEC 1AGEB 3HI1B 3TC9A 4ELKB 5AD0B 4F9PC 3VXTB 4BSJA 2VYRE 4FQQA 4GXVH 1MEXH 2X4RB 4P2RA 1AD9B 7FABH 5CIPA 5L9DL 1FVCA 2BVEA 2W07A 2X4OA 2Z35A 1ZAGA 2WUCH 4Z76A 3IDMA 2AI0H 4PYGA 3QJFB 5HDOA 2EDTA 5JNYA 3U7YL 2ZCHL 1GRWA 3DBXA 2Q6WB 2YBRB 1GOGA 1K2DB 1U58A 1GGBL 1YEFL 1CL7H 1ED3A 2Z91A 4G8GB 1CTOA 2XWTB 2I24N 2FO1A 1Q1JL 3V6OA 3QWRD 4JPVH 3TBSB 5FYLE 2NR6D 1UZ8A 4WENB 4H88H 1E6JH 4ZFZA 5BZWB 2UYLA 1WIUA 3KPRB 1XGRA 3ORJA 5DK0A 3CNKA 1RZKL 1ADQH 5D2NC 5EOQH 5SWZE 4DQOL 2ZCKL 4FQLH 2XN9E 5IVZA 2YD7A 1VACA 1DQJB 5CS7A 4NQEA 1U8OB 5T1MA 3BPNB 3B9DA 4Q9CA 3QYCA 4OCXH 1CFSB 5L8JB 4OZHF 5FDWA 5EN2A 3PJSB 1F8TL 1ZHBB 3NACH 4KRPD 4M7LT 1SY6H 1FNFA 1UJTA 2P5EE 4F3FA 1Y0LA 5EOTB 1H8OA 3RWEA 1WWCA 3IDXH 3PGDB 3LS5H 5J1TC 3T8XB 4P4KB 3G6JB 4PP1C 5TQ2H 3ZE1E 4LHQB 4FQ1H 2DTSA 4KGLA 5GRUL 1JNNL 1IGYB 2UZXB 3EO9H 4MS8C 4WHDA 1II4E 3KPPB 2DJ4A 4PGCA 1CDCA 4AENB 1MIML 2XPGB 4X4YA 5JPMA 3V7AG 2OJEA 1EXUB 1P4IH 3OJVC 1NBQA 2OS7A 5F1SA 1I1AB 4OLWH 2XQBH 2D03H 3V4PL 3FQWA 1LO0H 3V79C 1BHGA 1YZZA 3RQ3A 4P2OC 3V6OE 5DD3H 4I3SH 1KJ3L 1LD9A 2ADJA 1A6TA 4NKOA 2BVUA 4PJ7A 3SN6N 5DD1L 3OKMA 3NFPA 4LIQL 4JDZB 2ZUWA 4I18B 1TCRA 1XIWD 3K7UA 4HWEH 3DVNB 1NCBL 2MJWA 5GHWL 1NC2D 1EO5A 3BO8A 1RJLB 4PRBB 1CGTA 4NKMA 3MRHB 1TJHH 1TTUA 2M2DA 4HKXA 5MEQB 2Z31A 1TZGL 1W72A 3MROA 3CK0H 3NA9H 5IB5A 3ARFD 3DMMB 1OARH 4L4TD 3TVMD 1AHWC 4M03A 5F3HB 3LPWA 4UB0L 2V5TA 5L6YH 5T1DH 4NNYB 1EEZA 4PD4K 3EBAA 3R0NA 2YUWA 3RWFB 2D7TH 3BIAX 3S37H 1F11A 1A6WH 2X4QA 3GKWH 1KTKE 1IEBB 4PR5A 5HGAB 3V7AE 1BD2B 4ERSL 3NOIA 1LK2A 1HH6A 3QUYC 4KHTL 5D70L 2Z8VC 3WXWH 1XGQA 2H2SD 1EUTA 1JF1A 4P4RB 3L5WB 4N0RA 2H3NA 4XZUB 1TZHA 2V5MA 5HI4D 3IFOA 4O2CA 4H1LH 1F6FB 1ZHKA 4GJTB 4LU5H 4F7PA 5IWLC 2FJHA 5ACZA 3OKKA 4JFED 3PNWA 2LU3A 4ELMF 1ZEAL 2H1PH 1AD0B 4EOWH 3T2PA 1B9ZA 4Y2DC 3RGVC 3C9NA 1BFSA 5FM5M 1J1OH 1U2CA 1AIFB 3ZTJH 2AS5M 2N4IA 4PJ7E 4C56A 4G8IB 4O2FA 5FA3A 3IU4L 5MENA 3QIWB 4K7FB 1HIML 3VXOA 5F7UA 1JGLH 15C8H 3SO3B 3ARDC 5ICXB 3LKSA 5ITBL 1NGPH 4G6AD 2PKDA 5JW4R 1JBJA 4TUKH 1OT1A 5H35A 2R0KH 4YDIH 1CXFA 4BH8A 3LS4L 1P4BH 5DWUL 2DQFB 1UACL 3QXDA 1WFTA 4HLJA 1G6RL 5HGHA 2VO5A 5I1CL 5DRWB 4WJ5A 5GISL 3QCTL 4X99B 2NY0B 4CKVX 1A7NH 4XP4L 4XP5H 2F8XC 3S5LB 3QI9A 4XNYL 3O3EA 5SX4I 4B0MM 3GK8L 3JV6B 4TNWK 4YHYC 3HB3C 4DN3H 2IANE 2IQAB 3RVUC 1MFNA 5JTWA 2AKRA 3SHSA 1FV1B 2YA2A 3TYFA 5HSFA 1Z6JT 5CINL 4FFZH 4LLQA 4UILL 4NKDA 3U9UB 2APWA 4I77H 3ULVD 4RRPG 5IJKC 3S35H 1I75A 5IB1A 1LGVA 1MI5B 5LCVH 3VFVA 3MZTA 1TVDA 3EOAB 3QXAA 5K9KA 3QXTA 4OZHE 3QEQD 3RU8L 3OB8A 4LSDA 3NCYP 1BBJB 3DX6A 3LDBB 2DQJL 1NFKA 2AABH 2Z92A 5DVNA 2FBJH 1IGMH 2IQ9L 2JB5L 1J8KA 1JHLL 5JW4M 4NN6B 2ZNWA 3JSSA 3KJ4B 4J1UB 5MHSE 1INEL 5MENE 5GGVH 4XPGL 3FQTA 4WFFD 4PS4L 2HT4C 1SY6A 2I26N 4Y16C 1IAOA 1JUFA 3RDTC 2V2WB 5LGJA 5CD5C 2EYRA 4HKBB 5EO0A 5J89A 4JCLA 5IG7A 2FSEA 3I6LD 4M8QA 1VENA 3RZCB 1UM6L 4X83A 3WDHA 3GMLB 2MHAA 1L0YA 4LEXL 5D7LA 1K6QH 4GRLA 3H0TA 1A4JA 3QIUC 4M6OH 1T80A 3ZDXF 1RU9L 5EU3A 3TV3H 4ELMA 2DIAA 4F58L 3IRPX 3HUJA 1AGDB 1JWMA 3F58L 4HJ0D 4PJFB 1IC5H 1EFQA 2VXVL 2Z93B 1CN4A 4OCYL 4NJ9H 4YK4C 5BS0D 1I7ZB 1QSFD 3MREB 1S5IH 4XCCL 3S3JA 1MJUL 3STLA 5DJYB 3BI9X 3VMNA 4GMTL 3I9GL 4C83B 3EFDH 2ZG2A 2LQRA 5T3XD 1T21A 3B2VH 1AC6A 1CIUA 2FYYB 3E0GA 3H9HA 4QY8A 3K8MA 1JHKL 2K1MA 2DLTA 4R0LC 2OR9L 3PGCB 3QWRA 4CAGA 2VDOL 2WIIB 3UTSB 1WTGT 4OZFH 1MCQA 2HRPH 2R9HC 3QDAA 5C0AB 3CFCL 3VFRB 4MJ6A 3EJZD 3EFFA 4D0CB 4HC1L 3ULVH 2VLRA 2BXYA 1R3HB 1ACZA 1RZ8B 5FGSA 5D2NB 4TYUA 4GAGL 4LLVB 1I8IA 2VZ3A 4JEGB 5DD0L 1HKLL 1XGTA 2PYFA 2VAJA 3S3PA 4U1NA 5IB3A 1BZ7A 1EGJA 3SDDD 4MX7A 3KPQA 2GTWB 1FVDB 3K8KA 1U8MB 3RVTC 4Z7NF 4GKOA 5DHVB 4H8WL 4BH7B 5I8OH 4M4PA 2E27L 1CLOH 2JTDA 4LVNC 3RA7H 4HUKB 4HH9A 4YPGB 1QP1A 1QHPA 1H0DB 4QCIB 3MLYH 2ZSWB 4XPFH 2CIKA 5E8EA 1UXWB 3GMRA 2W38A 4H1LA 5EZIL 4ELME 3WKNA 3HUJE 4MA1C 1G7JB 2NY7L 1HQRA 3D2UD 2EXYD 4XH2B 1NAKH 5CKAA 2CMRH 3BT2L 3BH8B 1YJDL 2AK1H 3BZ4A 4XXDA 5D7IF 3ESUF 4ZUSA 3MV9A 4X5WA 3RNQB 4OCLC 1E4KA 2R0WL 4ZFOB 3SPVA 2R23B 3QDJB 4H1LG 3O2VH 1I3VA 1B4JL 3BW9A 3PDDA 4QNPF 5HD8C 3NCCB 4GAJL 3RY5A 1T7WA 4PJHB 4EIGB 5EA0L 1HYRC 4NFCA 1G7PB 4JO3L 4P2OB 4N8PA 2Y5TB 4K94H 2ED7A 2EDRA 4GG8A 3CD4A 1ZANH 4UUJA 5ALBH 5DQ9B 4A6YB 4X9IA 3Q6GH 4MNGB 4G80B 2FBOJ 1XIWA 2XFXB 1HYSD 4NHUB 5FGCB 3S34L 4JPIB 4B7LA 1NC2A 1H9VA 3PV6A 3U1SH 3ZKQD 5HYJB 3VCLA 3WO3B 2BNQB 2QKIA 4YDLC 5T3ZH 3G5XB 3ULVF 1H3TA 3SQOL 3CU1A 1BP3B 4YHKH 3AS0A 4L4TA 5MERB 4GW1A 3TVMA 1FC2D 2AXGB 5F9OL 1AHWB 1WQVT 4LSPL 2GHWB 3MNVB 3EYFB 3RY6C 5JHLL 5DURB 3SBWC 2BX5A 4LGSB 4ZFGH 1BJ1J 1KC5H 4MA3B 3IDGB 4YDKH 3V6FB 4JN2A 4XP1H 2E7CA 4U6VL 3EOBA 2XQYK 3MRJB 1U8KA 2G2RB 1Z0NA 4PRHB 4RZCB 3QUYB 5CILL 1QLFB 3A6BL 3EAKA 1XH3B 4OIIH 4M3KB 5I8EB 2WBJC 1R6VA 1DN0B 2WLZA 5HDLA 3MRRA 4FFWC 4HJGB 4KMLB 3DNKA 3OKYA 3BRDA 4HIIB 3SE3C 1JRHH 4OKDA 5E4EC 4H0IA 1KPRB 2WMPA 4EQ3A 4JFEA 2BNUA 2V2XA 1KT2B 1F2QA 5ID1A 1KEMH 5JMRA 3IGAB 4BQ8A 5DQJA 3O4LD 4WI7A 3VWKC 1OB1A 1S7VB 1WBXB 3MOQA 3ECBB 1URLA 1RY7B 3MJ7B 1S9VB 4Y2DB 4ISVB 4XTRC 3RGVB 4HS8L 1WBYB 5CFHA 3UO1H 3ZHKA 5GJSH 4JRYD 1A9EB 5JIKA 3CC5B 1WCBB 1S7QB 1KJ2L 1W0YT 1GZQB 1FO0B 3VD5A 2ITCA 1Q9LB 3ZDXE 4JO2H 2N7BA 1D5IL 4J3SA 5HYSB 4X7CC 3ARDB 3L3HA 4HWBA 5C8JA 5DK2A 3TFKC 5DLMH 3UJJH 1FIGH 3MSPA 3EDFA 5F7EH 2CDFA 4WGVB 1HOCB 1PZUB 4L4TE 1EAPB 1KIQA 3UBXA 2OSLA 5DJ8B 4LDEB 2COQA 3T1WA 1HZHL 3AMKA 3W11D 4OZ4B 4Z0XB 2MCPH 3FAWA 1AE6L 3RWJB 3FT4A 1JYXA 5K9QG 2GJ6D 3DI3B 4OZIF 4U6HA 4OUOA 3X14B 3AGVA 3UBXG 4MD0A 1M6OA 3BJLA 3BAEL 5INCB 5TE7H 2L7UA 4ZS6C 4YHYB 1CD9B 5JO5A 4X6DB 5DEFB 3V5HA 1LEGA 3HAEA 4M00A 3QG7L 3DUUA 3NABL 5CZVH 3QP3A 1WTLA 1JNHA 3AMLA 1P7HL 3DX7A 5TH2A 5TFSH 3C08H 3C60C 4JFEE 1CDIA 4MQXD 2W91A 1U8PB 1L7TH 5E5MA 3CPLA 3NFSL 2AJ3A 1MQ8A 2JELL 3SY0B 4X5XB 5GQBA 5HYFA 5C6WH 1OQXA 4OM0H 3QEQA 5DD5H 2F74B 3FTGB 1C8PA 4YEFA 5JA9A 4Z7NE 3HAEG 2D7QA 4NO0D 4ETQA 3MFGB 1M7IA 3PHQB 3VFNA 5EFIA 4HWZA 1J0JA 3CSGA 5GGSB 1RUQH 3MV8D 3SOBH 5KVFH 1MRCL 3BUTA 5I15H 3H3PH 3WFEL 4IJ3C 4WFGD 4DK3A 1JZ5A 3UJTH 4Y16B 3HI6H 3RDTB 3DARA 2I9LB 3OKDA 1BPVA 5KVDL 4JQXA 4JFYA 5TE6H 5D7IE 4D0DB 5E8DL 3O2DL 1IBGL 1MY7A 1JGUH 3NCFB 4HZLB 1CFTB 4CMMB 4PGJA 3FMGH 3CFEA 4UDUA 3QIUB 3TWCH 4QNPE 3MRGB 5FYJD 2E7HA 1YEIH 5I19H 2D2OA 4RWYL 4JVPA 5BS0A 3E6FA 1QSFA 2DQCL 4L8SC 3TH2T 3WUWA 3VXPA 4YK4B 1OW0A 4ONFH 1C1EL 4DTGH 4M4RA 4JFZH 4L8BA 4HV8A 3BEWB 4HIEB 3L3DA 3UAJC 4UBDD 3GUTA 2P45B 1K5NA 4YAQA 3ZDZF 2PTTB 4JY4A 1OL0A 1P84J 5ESVA 3RWDB 4PJCB 3ARYA 3TT1L 3ULVE 1D3CA 4R0LB 2QQLL 3WUWG 2IGFH 3ULUL 1CE6A 4U6XB 3QEQE 5FGBC 3GSNL 3D0VB 3MR9A 4Y8AA 4XVUD 3QHTC 3KS0J 5KSBB 1FL6A 2FHFA 2BOBA 3I85A 5EU5B 2W65B 2IFGA 2VQUA 1SMOA 5BO1H 4OLUL 3G04A 4N1CA 4LLAA 1Z5LB 4WFFE 4Z18A 3SGJA 5F1NB 2B1HL 2DN7A 1U92B 1IZKA 2A6JA 2XKNA 1KIPA 4QHNB 3CH1B 3GIZH 3I6LE 4KJWC 5JQ6L 1FSKC 2A9ML 3V6BR 1BZ9B 2CGRL 4LVNB 5F88B 3RTQD 3WIFB 1J9CT 3UYRL 3K2UH 1GZPA 3BH9A 3MRBB 4YFEA 1ZLSL 1YEJL 4DN4H 3X3GH 3S36X 2FO4A 4MA1B 3D2UA 4IOIB 2Z9TA 3DROB 5BS0E 4QYOA 1QSFE 3SKMB 4BFIA 3CXHK 1UQSA 5FYJH 2J3SA 3EYQD 1N3NA 1L9MA 1T7YA 3BXNA 3L5JA 3EYOB 3ZZ1A 3HCVB 2Q7NA 5DJXB 1MAML 5T3XE 5JOEA 4KVCH 4M43L 4Y4HC 1XCQA 1FZMB 4QRTB 1SJHA 2VABA 1NGQH 1QKZL 4YFLI 5ANMB 2AEQH 4WW2C 1MFEH 3THML 1F4XL 3EGSB 5DJZA 5EOCJ 3CDYA 1FE8L 4MD5B 1NFIA 4ODUA 2BDNH 3MRFB 1MCDA 2YPKA 3FT3B 4X8JA 4XMLH 5T3ZE 3QIBC 5D7JC 4HF5H 4OD2A 5F44A 1FG2A 4N90D 5DQDL 1XR8B 3OGCB 1H3WM 4QRPB 5TDPB 1HEZB 4NRXA 4LSSL 5KSUA 5E2VH 3CGTA 4PJ9D 4YDLB 2FGWH 1MFBH 4OZIE 2K7PA 2ZUXA 1CD0A 5CZXD 4UTAH 2B7DT 4APQC 1OAZH 4XAWH 4HGWA 4R96B 3O8XC 4KZEL 4KQ3L 2OJZH 3TYGH 2DMKA 3MRKB 2OK0L 4KXZH 1YYLL 2VLKA 4ONGH 1NQBA 3O6ML 3CSYB 1CFNA 2QLVB 1RMFH 1XGYH 3L6FB 3RY4A 3CLFH 3L3OB 3MXVH 1YEKH 5L7XL 4N9OB 5HGDA 4G6JH 4BYHA 3GHBL 3WJLA 4OLYH 5DVKA 2BY1A 4RFNC 5CKGA 2FR4A 3SGDI 1I8KA 1WC7B 4ODSL 2BFVL 5E4EB 2BVYA 1QEWA 5K9JL 1CR9H 1DUYA 4YXLH 3U2SB 2PCPA 3VWKB 3ZKND 1GPOL 4W6XB 1CCZA 3QEHB 2QTEA 4G42A 5AYUH 3VXMB 1RI8A 4MXQD 4P23A 4PJEF 4JRYA 2YUXA 1IGCH 1FFPB 2X1XR 3W5MA 4PG9A 1NBZA 3V52L 2GK0B 4HIJB 2P8LB 4Y5YA 1OLZA 3LEYH 1YDPA 4XBPB 1ZTXL 5GRXG 4OB5L 4P0DA 4PJ8C 1BF2A 2RJMA 4RNRA 2VDNL 2PO6C 3BUYB 4P57A 3FFCA 3W9DA 2JKXA 4I4WA 3GNML 4OQ1A 2MKWA 5FO9A 3QFJB 5C9JA 3LKRB 2H32H 4FZEH 3P4OA 3WIHH 2NY4C 4BSVA 1FNGB 2FHCA 5AAMA 3ZDZE 5GS0D 5E08L 3CVHB 5FECB 4QTIL 1J87A 1QOKA 2XZQL 2X09A 4U05A 3EO0B 2DQUL 2YUVA 4LVOC 3MLPA 1FNSH 1H8SA 3SCMC 2GJ6A 3ILQD 4IHOA 4ZS7H 1P6AB 3FONA 4HK0B 3MBED 4F37K 1MFAL 2HJFB 3CDCA 4TOYL 4JO1L 5FOJA 3GMPB 2DWDB 5FO8B 4QT5A 5IMMA 4RCAA 1YC7A 4U0QB 3KPSB 3VGEA 3MUZ1 3REVB 5I1HL 3O4LE 1JTTA 3C60B 3UJIL 1ZLVH 4S1QL 1M7DA 4Y1AB 1KNOB 3UPCA 4JZNB 2FD6H 2XTJC 3HNVL 4YHNB 3AAZA 2B2XH 2IPTL 1UB5B 4KC3B 4NO0A 4JRYE 5D72L 3DECA 2EIEA 3C5ZD 1A7BA 4P5KA 4OCRH 5IM7B 3GMOB 4PY8I 4JFOB 4WNQB 1QBLH 2BERA 3BSZL 1HSAA 5EBWA 1LO2L 4MWFB 3RL2A 3WIIL 2X1PA 1IRAY 3IJHB 4IJ3B 1PFCA 1XZ0B 5DRNB 1YMHB 1CGWA 1T0PB 4I3RH 5IBUB 1F4AA 4M5ZH 4KI5C 1TJIL 4TQEH 5JLZB 2OLDA 3JV0A 4OM1L 1N6QH 4NNXA 4YE4H 4LCWD 4ZMAT 1PYWA 4HPYL 4LQ1A 4OTXL 4KZDL 4AL8L 1B90A 3AC0A 2Q8BH 3FRPA 4LOUD 5IT2L 2ZOKB 5ENWB 2Q76A 3TBWA 2I60H 3BP5A 5E03A 2I5YL 3NCYS 2GJ6E 4PJEA 4L9LA 5F71A 3NCJH 2DDQH 3BE1H 4L8SB 1ORQB 1TZIA 2CK0H 1CZ8L 1U8JA 3LY6A 3PWUA 4YFDB 1I7RA 1CD1B 1Z2KA 1IKFH 3IJSA 2VDQH 4NQCA 3ET9F 3FRPG 3F12A 3BKJL 2OXHA 1MLCA 1CVSC 1FGNH 2VDRL 5DJ6B 3FO0H 2E6QA 4GXUM 4RFOL 1G9NL 2XA3A 4FXKB 3VJ6A 1V7ML 4XP6L 5GSRB 3TEUA 1R0AL 1HQ4B 1XCTB 4HX1A 2PYED 3PABA 4G6ML 4JDVA 4PRNB 1JCKA 2V6HA 2WZPD 5JW5A 1BQLL 1PG7X 5HDQL 3X12A 1RUAL 2WWMC 3MV8E 3U4BH 3S6CA 4QHLB 2BXZA 3HPJB 2DL2A 4BM7A 3GSXA 5T5FH 4HGMA 4MNQB 4X7TB 1BVLB 2IAMD 4WWKA 2XV6B 1ETZB 2VXUL 4HS6B 2IADB 2PXYC 3HZYA 4ZUVA 4BSWB 5EIQA 4NNPL 1ZA3B 4LCYB 1SYSA 4L9DA 1YNTA 3GMQA 3A6CH 1F58L 3JWOH 1FSKB 4FQHB 1OAXH 3C87A 4GAYA 1X7QA 3GBNH 5GJTL 4K9EC 3KNBA 3RTQA 2WP3T 1CG9B 4Y5VA 2IJ0C 5FYJE 2AJYH 2DD8H 1MAKA 5GGQH 5C0GB 4XBGA 1LQSR 4ZDHA 1UA6H 4R8WL 1ZWIA 3V0VA 1QSEB 3MRMB 1NUNB 2VLME 1HDMB 4PJEE 1T1XA 1T2QH 2GCYB 2FATH 4ODTL 4G8EB 3K8LA 4JQIL 4XWGH 3HE7A 4R2GD 1MIEL 4NSKA 3E8UH 3CLEH 4PJXF 3C6LC 3JV4B 4JN1H 4G9DA 4PJGB 2QQNH 4HUXB 2QR0A 4N8CL 3AU1A 3QUXC 3Q3GB 4JRXB 4Y4HB 2B4CC 4U3XA 3BHBA 2EECA 3S7GA 1NAML 4WW2B 3PL6D 5DJ0A 4JQVC 4D8PB 4EI6B 1FVEA 4NZDA 3L3IB 4XWOD 4ZOCA 5F8RC 4UMGA 4PJBB 3QIBB 5D7JB 2DRUA 5DDHB 4OF3A 2BC4B 4CW1A 5D1ZD 1QLEH 4M61B 1GOFA 4XCEB 1VEOA 4OLZL 3WIHA 3W2DH 5CEZL 2ZZUT 2P7TA 2RFXA 4FMFA 3QH3B 4I0PD 3O2WH 1DE4B 3GM0A 1PDKA 1MSPA 4FQXC 2ADIB 4M6MH 4APQB 4NWTH 3QHZL 4HZAA 3TO4C 1XF2B 3IKCB 1O7VA 3ZHDA 5CBAB 1NMAL 3O8XB 2YOCA 1EHXA 4WUUB 1KCRL 3LKQA 4M6NH 1TDQA 5DFWH 3QHFH 2FEDC 5A3ID 5I76A 4JM2A 4GRMA 4ODBD 8FABB 4UV4L 1FNLA 5IQ7L 4I2XB 2VWEE 5CZKA 3O81A 1X5FA 3M17B 3D39D 1YN6A 4JVWA 1JNLH 3RIAK 4HKZB 3BPCA 4M62L 3TBTA 1AR1C 2YRPA 5BRZD 3C6SA 2OCFD 2VQ1B 1XGUB 3WL9A 1T7XA 5CJXC 5C7XH 1G1YA 2HT2D 4CJ1A 4RFNB 3FB8B 1KJVB 2I27N 1HKFA 3MLVL 2HAZA 4UT7H 5TPWH 4P49A 3D9AL 5GS1C 5I0ZA 4GO6B 3ARZA 1VEMA 3NTCH 5SX4H 3V0AC 2VITA 3GRWH 3NCEB 4JPWL 2NTFA 3ZYJA 4JKMA 5DMIL 4QOKD 4IIQC 2J4WL 4KK9D 5ADOL 3X3FL 5I18H 5KS9B 43C9A 4FQCH 2F5AL 4N90E 4D0BA 4UT9H 4NKQB 4JGMA 3FB7A 5B8CA 2HFFA 5IBLD 1DLFH 3JTTA 3X11B 4HK3N 4KAQH 1JFQH 1P5UA 4PJ8B 2KZWA 1VPOH 2BSTB 4TVPL 2ZPKL 5F9JA 5BQ7A 2PO6B 5JW3H 3MLZH 3OZ9L 2E9BA 4AIZA 5MP6L 1RZ7H 4E0RB 4Z7WA 4YHPA 2NY4B 4CBPA 4GMSH 4DCQB 1AXIB 4O5LL 1YMMA 3GSVB 2QSTA 2X70A 2YEZB 1RFDH 4KK5D 4LVOB 3SCMB 3H9SA 4YHOH 3ARBD 3ULSA 2FJGB 5L0QC 1U2HA 3MBEA 3I02A 2X44D 5FYJU 1ODAA 2DWEB 3C2AH 2DQEH 4PREA 1MREH 2OQJB 4C4KT 3CDGA 4ZPVA 4ODHH 2R29L 4P2QA 3QFDB 2C3HA 5HI3C 4XRCA 2JIXB 5C0RH 5JXEA 4TULL 3MNZA 1QQDA 1VADB 4Y4FC 2IBBA 1X5HA 4U1SA 2A9NL 3IKKA 3QR2A 5C6PB 4JY5H 4NZRL 2VE6B 2XTJB 1R3IH 3OL2A 3TIDA 1WLHA 1F45A 3DUSA 1OT2A 4Z77B 1BFOB 4MSWB 3HZMB 4XNQA 3C5ZA 1H15B 5DD6A 4OD3L 4OLVL 4ZUWA 3FN9A 1RJZA 3N50A 4KK8C 3BN3B 4KQ4L 3KR3H 3U0TB 4TUJA 2FRGP 3O3DA 4ZO7A 2H8PA 3M45A 5E6YA 3H7BA 2FJFA 1KLUB 5DS8A 5AG8A 1NCWH 4XP9L 5H2BB 4Z7VF 2HVKB 4QRRB 3V8CA 3NVQA 4TNVF 1FN4B 4XX1G 3TIEA 1T2XA 1A64A 1U95B 1GGCL 1OCWH 2CUHA 1JZ3A 5DEGA 3MLTB 2R0ZL 4OZGB 4PJXE 1RJYA 4KKCC 1LDPL 3K4AA 2XKSA 4UINL 1PX3A 2HKHL 1RIVH 5TQ0L 1X5LA 5J12C 3HI5L 5FO7B 3F65A 1VFUA 5LXGH 4PGZA 1UADC 1T66D 1XF3A 4NFDA 3GMMB 5F9DC 3OKEB 1EHAA 1YNKL 1W72L 3FCTB 3VA6A 5L9DH 4AEEA 4ONHB 2Y36L 5DJ2B 1AC0A 4JAMA 3P9MA 4P5TC 1KCSL 4PV9B 4RBPH 3ARGC 3D3VB 5KSAC 2A73A 5M95B 2PYEA 2A6DB 3SKNB 3U7YH 2ZCHH 3NH7L 1FDLL 4KTYA 4OFYA 4MJ2A 4UNTA 5ELIA 2OYPA 1GGBH 3RGHA 4NDMB 1YEFH 5GGUA 4NBXB 2MCG1 1V7NL 1Q1JH 1IEAB 4XX1E 5IVXF 3FO9B 3IETA 1T4KA 2Y72A 4YBLC 2CRZA 1J7VR 1U8NB 4S1DD 2IAMA 3LKOA 4HFWB 1S7UA 4MD4A 4R7NA 1DCLA 1HHKB 5B4MD 1K4CB 2PF6A 4X6BA 1RZKH 3RVWC 5SWQA 4MJ5A 4XI5D 2PXYB 4IS6B 4DQOH 2ZCKH 4OV5B 1PG7W 4QHKI 3I3DA 2W0FB 4OFPA 3FFDB 3OXRA 3LSOA 3P4NB 5FCUL 5L8LB 1T5WA 1X5XA 3R8QA 2LVCA 4LCWE 4P4KD 4J4PA 5MEOA 5HDBF 1RZJC 3GBLA 5SX5H 5E5RB 1HHJB 1T89C 5CP3A 5HHOD 5FK9B 3P73B 1F8TH 4Q74A 4UQ3A 1T83A 4IMKC 1HHIA 4U33A 1EUUA 2XRAL 4YR6B 1RZIB 3BZEB 3O9WC 1OAYL 1F5WA 2AGJL 1AKJD 1L0QA 4ORGB 3QXWA 3CZFB 1I1AD 5EU4A 1T7VA 3N06B 5GZNC 1JNNH 4X6CF 2Q3ZA 1M7XA 1KJMB 1PKQE 5DUML 4LPXA 4ODXA 5IV2A 1DBAL 3C6LB 2GFBB 3IXAB 4AIOA 1MCPL 4N5UA 3QUXB 3B5TA 5ICZA 1MIMH 4Z7VA 5I66B 5C0CB 3PL6A 3ME0A 3LQAC 4CN6A 2PYEE 4DAGL 2X89D 3VXRA 1CDJA 4OFKA 2R69L 1J8HA 4P3WA 2E8YA 5GXBB 3VRJA 4URTB 5D1ZA 2NY5C 4U1IB 4CU6A 2B20A 6FABL 1KJ3H 5HPMA 2MTPA 1EJ6A 1TVBA 3TT3L 4RMUA 5DD1H 1RPQA 2NY3D 1P9MC 4LIQH 3L7FB 3DMMD 3BP6B 4XMPL 5D1XC 3EHBC 2ESVB 1F3DJ 1NCBH 5GHWH 4N0UB 4ZUTB 4LSQL 2FDBP 4JHWL 3ZLQC 4FQXB 2V17L 3IDUA 4RAUB 4KWUA 4YHML 5C09B 4MJIB 3R8BB 3TO4B 1J11A 3P3YA 1TZGH 3QQ3A 4UOW1 4G43A 3K1DA 1I8LA 4OGYL 3FHAA 3B9EA 4UB0H 3WHE1 5F7YC 3D39A 4LEOB 3FB5B 4C54A 2BY0A 2G75A 5BRZA 4R90L 1BIHA 4HAFA 4U0RC 4ZO6A 1H3UA 1SY6L 3T0WA 4EBQH 4ERSH 4KHTH 3U36A 3G5ZA 2QHRL 1PVHA 5J06A 1BLNA 1I85C 1IL1B 3U4EB 5GZOD 1WV7T 3HR5A 1KLGA 1TETL 1FAKT 2HP4A 2HJKB 5DMYA 4Z7VE 5DT1L 1FZJB 4QOKA 3HC3L 5ID0B 2ZCLH 1I7TA 1A7RL 1IT9L 4IIQB 3AM8C 4PGDB 1QFHA 4XNMB 1YEHL 3EZJB 5E6IA 3AB0C 5EC1A 4H25B 1UM5L 3H2WA 1O7SA 3E6HA 5K9OA 4BUGA 2AXFB 2XQBL 5EULV 3KVQA 4BUHA 1VFAB 3MYZA 5I0DA 2A77L 3VXUD 4LRNH 1E6OL 2YUZA 2AJVL 1B88A 2AJXL 3MRCA 3T77A 2J8UF 3MTRA 4U4BA 4GQPH 4X4MA 2EDKA 3IU4H 5AYQA 4WW1A 3GGWA 5A2IH 1HIMH 3F6IA 5H94B 5ITBH 4X6CA 4MDIB 5B39A 2NZ9D 4EVNB 1YA5A 4P3CL 1U3HD 4P3DA 3LS4H 5FKAB 5DWUH 1JI2A 2A6IA 4YNYA 2V2TA 4OV6F 3BVNB 2JK5B 2KUTA 4ZXBD 4LLWB 3CK0L 2I9TB 3NA9L 2BOCB 1B2WL 1G6RH 4JKWA 4P46A 2GQHA 3D39E 5L0QB 5I1CH 3HLAB 1U3ZA 1U8QB 4AM0B 4BFBD 1MUJB 5T33L 5BRZE 5GISH 2R1WA 1N8ZB 1CGSL 3LKPB 3FZUC 3QCTH 4XP4H 5B39G 3VFMA 4K8RD 4XNYH 3K4ZA 4HT1L 1EGJL 3JUYA 5IVXE 5J8OA 3RVVC 3GK8H 5DYOB 4HG4J 4K3HA 5KN5B 4EUPA 1JYVA 1CICD 1MI5D 3DIFA 5ICYA 3NGBC 5FM5O 1OWRM 1EMTL 4Y4FB 1QLRB 1F13A 3LRSA 5FF6A 2A74A 1D6VL 5CINH 4UILH 2CKBB 2NYYC 4QOKE 1WUNT 3DURA 4OUUB 3D6GA 4MJ4A 5KSVB 3FOLA 1UB6B 4JANB 5J6HA 4L3AA 5HDBE 3ROOA 4EUPG 1BVKB 3RU8H 6CGTA 4IRJD 2OMNA 2JCCF 3MPCA 1L6ZA 1ND0A 2DQJH 1KTLA 5KG9A 5TJWK 4XPHL 3DSFL 4YWGH 2CLZA 1AGFB 2JB5H 4R4FL 3PQYD 3O11B 3RZCD 1FFNB 3UDWA 1N59A 4XPGH 4KMTL 4XPTL 1U3YA 2BHZA 5CAYB 1AGEA 3HI1A 3U48A 4ELKA 3VXTA 4X6CE 4ENED 2X4RA 2EDWA 1AD9A 1WT5A 2YD8A 3B83A 5I1GL 1UM6H 2ILLA 4S2SB 5J12B 3T2OA 4LEXH 3QJFA 1XF5A 2QQKL 5FFLA 3P11L 4HIHB 2Q6WA 4F58H 2YBRA 3UZVB 4DGIL 3F58H 1A22B 3U7WL 5E8NB 3QDMB 2Q3AA 1TCMA 2VXVH 5F8QC 3EIFA 4OCYH 2P8MB 1BJ1H 4G8GA 2XWTA 4P59H 1UEMA 4XCCH 4YLQT 2YD2A 1MJUH 4CRPA 3UEZA 1JK8B 4P5TB 4U7KA 3ARGB 1UM4L 5KSAB 4GMTH 2BP3A 2OI9C 4K8RH 5C0AD 4F7CB 1YEDB 4R3SB 3I9GH 3BPOC 5BZWA 1UKSA 4DN3L 3KPRA 2OZ4L 4X80L 3DRQB 1MOEA 1JHKH 1QYGH 4XGZB 2Y07L 2OR9H 2YD9A 5HBBA 1DQJA 1QFUL 3IDNB 2EEAA 2VDOH 2F53D 3GO1H 1RURL 1U8OA 4W70A 3RWGB 4YBLB 1CFSA 1GGYA 1G7QB 4HC1H 1RSFA 3CX5K 3PJSA 1ZHBA 2DKUA 5F97E 1EZVY 5EOTA 1P53A 4GAGH 4ZQKB 3PGDA 5DD0H 1HKLH 3W39B 3T8XA 4P4KA 5L2KD 2MQ0A 2VXQL 1IGYA 4D9QE 1VEPA 2B5IC 2WK2A 1R5VB 1I3GL 4H8WH 1JF5A 2E27H 4CDHA 4KKNA 2CPCA 1NJ9B 2KQMA 5A2JH 2XPGA 3QPQC 4OI9A 3FQNB 4YC2C 5AZEL 1C12B 3VRIB 1EXUA 1WAAA 3O9WB 4FFVD 5EZIH 1I1AA 1K9TA 4HWBL 2EXWC 3QDJD 1MRFL 1GSMA 2NY7H 1UG9A 3HC0B 5FM4A 1UZ6F 3P77B 1K3IA 4X7SH 1MCKA 2JCCA 3BT2H 2GSIB 1YJDH 4WI6A 4LSUH 4NJ9L 4HPOH 4P2OD 2J8UE 2R2HB 2X89A 4N1HB 3GJEB 4JDZA 3K2MC 5HHVL 4I18A 1UH2A 2Z8RA 1D9KC 3DVNA 5FOBB 5EUOB 1T03H 1KB5B 1B4JH 3RI5F 4O02L 2VQTA 3VDAA 3SGDH 4N0CC 5HYJD 4GAJH 4LIQE 2C1PA 1RJLA 4PRBA 4WI5A 4YIQA 3MRHA 4G6FB 4I9WD 5EA0H 3OXSA 4JO3H 2OL3B 3HG1B 4NRYB 3LKNB 4WHYH 5MEQA 4ZD3L 2OBGA 3RUGF 2W1NA 2A6KB 3DMMA 5HVGB 5F3HA 1KFAL 5D1XB 1HHHB 3RWFA 5DURD 2CLRB 3ZKMD 4YFLF 2VDML 1AR2A 4LPVA 2EDLA 2JJTA 1IEBA 5IQ9B 3LEXB 5HGAA 3SQOH 1BD2A 3MXWL 3VD3A 5E9DB 5DHYB 5EH1A 1BM3L 4PRHD 3B2UD 2LABA 3QUYD 4P4RA 5F9OH 3L5WA 4LSPH 5HHOE 4OF5A 1A6VL 4QGTA 5JHLH 4DVBB 3QO1B 5DI8B 1FJ1B 3OTTA 5E00A 2ZUSA 4U6VH 4U0RB 5JXAL 5CILH 3A6BH 1AD0A 4XPFL 1V3JA 3UC0L 2GY7B 2JLLA 5IB4B 2WNGA 2JCCE 1AIFA 3IS1X 4MVBC 1F6AB 4AK1A 3PV7A 2YD5A 4DGYH 4M1CC 4IOFC 2NLJB 2NZIA 4K7FA 1T0MB 1MJJB 4FP8L 4JFHD 3OKOB 4ZTPL 2OL3L 1PQZB 3AB0B 5ICXA 2BSSB 2DYPD 2DI7A 5CEYB 3UXFA 4G3YL 3VXUA 3BZFA 1KJ2H 1NDGB 4UIMB 2VDPL 2D0HA 3VW3L 4QRUB 5T3XL 4G7VL 1ZGLP 2D7OA 1D5IH 3Q48A 3KS0H 3KXFD 1QPPA 3CSPA 4X99A 1HINL 3MGOB 4MAUL 1RD6A 1Q0YL 1U3HA 3S5LA 5FM8A 3WNMA 3GB7B 2LU7A 3FQUA 1XGPA 1GC1L 3JV6A 1A1NA 2HG5B 2IQAA 1EA9C 4CJ0A 1DEDA 4KDWA 1HZHH 3HB3D 1T22B 1C5CL 1QO3B 4JHZA 3V6OC 1X5JA 3RVUD 1FV1A 4MCYB 1H5BC 5IMOA 3TN0D 1AE6H 4ZFGL 3QJHB 3S5LG 5K59F 5C0EB 3U9UA 2BNRD 4LKCB 4MQ7B 3UTTD 5ISZB 4JE4B 2EIDA 4JJHA 4ODVL 5FKPB 3U6RB 1EEQA 4XXCA 3BAEH 1CICA 1DQQB 1MI5A 2JJSC 3EOAA 5C2UB 4NZUH 3U46B 5GRJH 3NGBB 3QG7H 4WU5B 1INQB 1BBJA 2Z0BA 3D85B 3NABH 5E5UB 4CNIB 3ULUD 2E7LA 5EIIB 1BWWA 4J1UA 5IIEB 2IPUG 3NFSH 2JELH 3HMWL 1P7QB 2UY7A 2APFA 3RWIA 2V2WA 1KTRL 2P5WD 4Y16D 4IRJA 4HKBA 3RDTD 4RGOL 3VXUE 4S1SL 5F1OB 3EJYD 1A6UL 3PQYA 3F5WA 3RZCA 2BHYA 5GJSL 3GMLA 4F7EB 2DICA 1V05A 1MRCH 1IM3B 3V5KB 2J6EA 4PYHA 4JKLA 4MZ3A 1AGDA 3FN0L 4PJFA 5JR1L 1UZ6E 2NY1B 4F9PA 2Z93A 3DYMA 2VIRB 3BN9C 4OLXL 5IEHB 1A8JH 1I7ZA 5KVDH 3MREA 3RHWF 2YN3A 5IW1B 5E8DH 5AZ2H 3UTPD 2YXFA 1IBGH 5CJ8A 2AK4B 5DJYA 2QSCL 4NJAL 4C83A 5J13C 3PP4L 1NGWB 1R3LB 4RWYH 2O93L 4QRSB 2DQCH 5T5NF 3PGCA 1HXYB 4I5BB 4NQSB 4ODWB 3RUGE 3KJ6L 2WIIA 1C1EH 1MI5E 5DTFB 5C0AA 5J7CC 3VFRA 1U8HB 5HI5C 4X6FB 2OI9B 4IEFB 5FV2A 2UV3A 5CP7B 4D0CA 3BPOB 4CL7A 1S7XA 3TF7C 2I07B 4X5LA 1R3HA 1RZ8A 1TENA 1ERNA 1OD9A 4NQDB 1MFDH 4LFHD 5D2NA 3TT1H 4LLVA 2QQLH 3UP1A 2F53A 1ES0B 3DETC 2R8SL 2VXSL 4CVXB 3ULUH 1ZLVK 1A2YB 2ARJQ 3I6KB 1R5IA 4NN5C 3BGFC 1QNZH 2GTWA 3GSNH 1FVDA 4YHZL 3VGAC 4WHYG 1U8MA 4OM0L 2IBZX 4J7RA 1UJ3C 4BH7A 3PQYE 4HDIA 3RVTD 2ITDB 4KKBC 5INDB 5DGRA 1GH7A 5IMLA 4OLUH 4YPGA 1H0DA 1W8OA 4XCYB 4PTTB 1QPXA 2ZSWA 1X5AA 2YD1A 1B4RA 5L2KA 1RIUL 1UXWA 2B1HH 1G7JA 4Y5XC 1IGJB 5KVEL 4YEEA 2B5IB 2V9RA 5J6GB 1KCUL 5JQ6H 3BH8A 2A9MH 3BDBA 2C7UB 4L5FL 3RNQA 5CSGA 4NRZB 1CU4L 4YC2B 3QDJA 4NQTA 1ZLSH 1YEJH 4HBQA 1C5DB 4KU1A 3RJQB 3UX9B 3UROR 5I2IB 5HD8D 3QQNA 3DUHA 4PJHA 1G7PA 4P2OA 2AV7B 2Y5TA 3STBA 5DVMA 5DQ9A 5C0AE 4MNGA 4G80A 5DVOA 2XFXA 3H3BC 4JCMA 3AREC 5CLWA 1YEEL 3LQMA 1MAMH 1U8LA 4JPIA 2AV1B 1YY8B 2J8OA 2X1WL 4M43H 1D9KB 4HHAB 4LL9A 5HYJA 1QKZH 2BNQA 4OGXL 3THMH 1F4XH 3BP7A 1FE8H 3OBAA 1DQDL 4JFDB 2DMBA 2F53E 3G5XA 1IJ9A 5MERA 1IC4L 3MV01 5I1DA 2X4NB 2IGFL 5J3HC 1ULVA 2AXGA 1AHWA 2AXJA 3MNVA 3D25A 3EYFA 1IGTB 5DQDH 3ULUF 2DBJA 3JTSB 4JFFD 4LSSH 3IDGA 4YBQC 3V6FA 4DZBB 5K59E 1Q8MA 3MRJA 5FIEA 5L2KE 2G2RA 3V4VL 4PRHA 4N9GA 4RZCA 3QUYA 1QLFA 2BVOB 3MBXL 1DN0A 3Q1SL 4KZEH 1FFRA 4XHJC 5GPRA 4HJGA 2WBJD 4HIIA 4KQ3H 1SM3L 3GIZL 4FFWD 3LMJL 5IWLA 1NGZB 1SJEB 5T5NG 2OK0H 1KPRA 4JHAL 3UBXI 5ETUA 1KT2A 1YYLH 3QDJE 3IGAA 2RHEA 2E9JA 3O6MH 5JZ7C 1S7VA 1X4ZA 1WBXA 1TMCB 4HULB 1PJ9A 4A2MA 3MJ7A 2F54B 4ISVA 4Q2ZB 4Y2DA 5SWZB 3RGVA 2P4AB 1WBYA 5KVMC 3GHBH 1U6AL 3CCHB 4XTRD 1WGOA 1A9EA 3E1F1 5BW7C 1S7QA 1AY1L 1Q9KB 4ODSH 4MNGE 2BFVH 4JY6B 5FYJL 1GZQA 1FCCA 1FO0A 3ARTA 5FAAA 5K9JH 5BV7L 1Q9LA 4RAVB 5HYJE 1J1PL 4WDIB 5HYSA 3V5DB 1KBGL 5EB9A 3ARDA 2P5EB 4I9WE 3HS0B 4GRLC 4XNUL 1MFEL 1HOCA 2D9QB 3DGGB 1EAPA 1WVZA 2F5BL 3H42L 4MGXA 1V5JA 3OG4B 2P42B 3QFJD 5DJ8A 4XNXL 1FYHB 3V52H 5KSBF 5HYSG 3PWVB 1ZTXH 4OB5H 4OZ4A 4Z0XA 2YD6A 3CFJA 1CBVL 2VDNH 3KLDA 3NFNB 5T1LB 3RWJA 5E2UL 3KPOB 4PRHE 5IW3A 3X14A 2YA1A 4NZJA 1MFBL 1U58B 5INCA 1T3FB 2R4SL 4YHLL 4X6DA 5DEFA 1R3KB 3D87B 1YYML 2XZQH 5CJ5A 1NUGA 1H5BB 1S7WB 2DQUH 2GTZB 1F90L 2ENSA 2VL4A 3UTTA 3KPSD 1G7MB 1U8PA 1WEJL 3WLWC 4LHUD 4D9RE 3SY0A 4PLKD 3G5VB 5IJKA 4Y1AD 3KPMB 5DJAB 1H3GA 4CDGC 4X5XA 1MFAH 4M1DL 2MWCA 4PJIF 4TOYH 5C92A 1JHTB 2F74A 1QRKA 3FTGA 4XVTL 4YHIB 3WFBL 4F15C 4OD1L 2YPVL 3PHQA 3DX8A 3S36L 5GGSA 4KH2A 5I1HH 1K3ZA 3UJIH 4JFHE 2Y6SD 4S1QH 4KRPC 4AEHL 3ZSSA 3HNVH 5I17B 5JHDB 1J0IA 2IPTH 4Y16A 2YXMA 4F3FB 3PWLB 3RDTA 1RK1B 4NCC1 2I9LA 5D72H 1GXEA 1BOGB 3GSRB 3F8UB 1MHCA 4U1JB 4D0DA 4WEUD 1MCBA 1AXTL 1S78C 3TGXA 1IILE 3BSZH 4HZLA 5J4MA 3Q6FB 4CMMA 1LO2H 3ROLA 2EKSB 1S7SA 4AT6B 3QIUA 3WIIH 3MRGA 3KXFE 4KTDL 4LCIL 1OHQA 3A0OA 1Q9OA 1QA9A 4FTVD 1K4DB 3U0WL 4F7MB 4P9ML 1G7LB 2LAAA 2FECL 3EJJX 1A1OB 2XXCB 4OM1H 3BX7C 4XBEL 4HIEA 4HPYH 3I50L 4OTXH 4KZDH 4AL8H 2C4FT 4X6DE 1DBJL 4WIQA 3UAJD 4FZEL 4EIZC 3WIHL 5IT2H 4BK4A 5J13B 1AGCB 2NPLX 3F62A 3FQRB 3VFSB 2ADJB 3CXHJ 3R1GL 5HPOA 1A6TB 2I5YH 3RWDA 2BNRE 1SBBA 3UTTE 1RUML 4R0LA 1TCRB 5DFTA 1CZ8H 4D2NA 3QUKB 5BOPA 4WI8A 4KJPD 2EZ0D 2YMXL 2BRRL 2YR3A 4M8VA 4ZS7L 4U6XA 3REWB 1HNFA 1OLLA 1UC6A 3D0VA 1XMWA 3BKJH 2JF1A 5KSBA 3ULUE 3ARFC 2IMNA 2VDRH 3GSWA 2X7LB 1G9NH 4RFOH 2W65A 4XP6H 5BXFA 3MLSL 1Z5LA 4G6MH 4NO2B 2X9XA 1QFPA 3VGDA 2RGSA 2P5WE 2H26B 1B0WA 1U92A 5HHNB 3W0WB 5CEZD 2QSVA 4NN5B 1BQLH 4PR5B 1INDL 4QHNA 5DGQA 3DV4B 3TBVB 3PWPB 5HDQH 3VGAB 2H2SC 5F7KC 1HH6B 2YC1B 1RUAH 1UJ3B 5BZDB 1XGQB 4LFHG 1E27B 1BZ9A 2R2BA 2CDEA 2IANB 3RNKB 3HNTL 3N9GL 5HI4C 1S3KL 2VXUH 5HHPB 4E41E 3MRBA 4O2CB 3CDFA 2KDGA 4IOIA 4Y5XB 2BVQB 3DROA 4AG4L 4NNPH 3DYOA 1ZKAA 1FORL 3VDCA 5DF0A 3OKKB 3VD9A 1F58H 4HUVB 4XPBL 5GJTH 3IFPB 1RVFH 1ZVSB 3ESVF 2WP3O 4OZHB 5DJXA 1FZMA 4Q7DA 4R8WH 5ANMA 4JRXD 4Y4HD 1BBDL 4LK4A 3EGSA 2D4FA 1OAUL 1T2JA 4ODTH 1J12A 2EEDA 1BFVL 1YN7B 4HS3B 4MD5A 4NM4L 32C2B 5FA3B 5MENB 4I0CC 4N5EC 3MRFA 2CKNA 4G6AC 3FT3A 4JQIH 2LV4A 5GS0L 3WEXB 1MIEH 4OFIA 4P2CG 1H3VA 3VFTB 3AREB 3QIBD 5D7JD 5KSBE 1JZ6A 3S9DB 1XR8A 4N8CH 1M05B 4LDLB 4QRPA 4P2RD 5TDPA 1HEZA 1NAMH 1Y6NR 4DUWA 5IEKB 2XA8L 4RBPK 4PJ5B 5CWSB 1CVRA 3FO0L 3GIVB 4NP4L 4GKNB 3O45B 3OF6D 4Q9BA 4M1GL 3SKJH 1JVKA 1XAUA 5TDOA 3WKML 5HYQB 2H2PD 3GSQA 2IF7A 1RULL 3I2CL 4CN4A 3DRTB 4TVPD 4R96A 4XC3L 3RY6A 1F3RB 4K55A 3SBWA 1IGIL 4OLZH 3MCKB 2VLLA 5CEZH 3MRKA 1D5MA 5F7DB 5IFAL 4MHHI 3O6FC 3CSYA 2GEEA 4PJIE 3L6FA 1IMHC 2WINA 4LLQB 3QHZH 5HTSA 3L3OA 2HFGL 1JYWA 3ULVC 3WFHA 1G7HB 2WBJA 1NMAH 1J5OL 2G5RA 1KCRH 4OAWB 3OKNB 2W9LA 3VFWB 3SE3A 1WC7A 4NGHH 4NQED 4UV4H 5IROC 2HJLB 4IOSD 5SX5K 2ICWB 3U2SA 2VDLL 2JB6B 3VWKA 2GJZB 3MYJB 2AJYL 3OAYH 4M62H 2Z92B 4MDJA 1A6PA 3VXMA 5A2KH 1CDYA 1N4XL 4NUGH 5T1KB 3SDCC 4RGND 2FATL 1FFPA 4GSDL 4NOFA 3MLVH 5LGJB 4PJDB 2EYRB 2GK0A 3D9AH 4LNVA 2P8LA 3E8UL 4L3EB 3B4NA 3BQUC 1S9XB 2FH8A 1MCCA 3NZHL 2YWYA 2D9CA 5DMIH 3BUYA 4GRLB 2J4WH 4PJ8D 2HA1A 4HJ0C 1SVCP 3X3FH 4ELMB 3KG5A 5CIPH 3QFJA 4H0HB 3LKRA 5ESAB 2F5AH 1FNGA 1IAMA 2YSSB 5CSZB 3CVHA 4JFFE 5TDNB 4L8DB 5FECA 1OPGL 5EUKB 4FQJL 5I30L 1VB9A 3H9ZA 4TVPH 2P47B 2ZPKH 4OF6A 3VDBA 2YS4A 1I3UA 4K94C 3OZ9H 4HK0A 5MP6H 4JFXB 3H9HB 2HJFA 3KHQA 3ARXA 3GMPA 2DWDA 4Q0XL 5FO8A 5JORB 3TO2B 1G9ML 3IB4A 4O5LH 5MI0C 3EJZC 3BKYL 1LK3L 1ZOXA 1VHPA 5F6HI 3KPSA 4U49A 5GGRB 2BK8A 3REVA 2LE9A 3C60A 1MWAB 1P6FA 4IMLB 4Y1AA 1KNOA 4JZNA 2YD4A 4YHNA 1WF5A 1EIBA 3ZYOA 1UB5A 3F7QA 4C4KO 3WNNA 4F15B 5IM7A 3RL1B 2V7HB 3HC4H 4JFOA 2PYFB 4WNQA 3SDDC 1BZ7B 1Q9WB 5C7XL 4TULH 4MLIA 3V8OA 3UMTA 4LKXB 2NW3B 4LHUG 3U0PB 1BX2A 2A9NH 5JDJA 4MWFA 4KRPB 4NZRH 1BREA 1D5ZA 1A0QL 1QBAA 3IJHA 3N85L 3BIKB 1XZ0A 5DRNA 1YMHA 5HHXL 5TGBA 4WW2F 3IS0X 5JLZA 1QSVA 5DHXB 1FCGA 4OD3H 4YGAB 5E8EB 4OLVH 1VCAA 2DF3A 3WNPA 3QFJE 4KQ4H 4QWWD 5E2TL 4JPKL 3IT8D 2EXYC 1I1FB 5AWNL 3DXAD 4PJBF 2YN5A 2R0LL 3INUL 2ZOKA 3NBNA 5ENWA 4XP9H 4FTVA 3BZ4B 4TUOB 1NBYB 5IBUG 2ZUTA 4KRMB 4RMRA 3ARRA 3MRQB 4L8SA 1JFQL 1ORQA 5CD3B 1GGCH 2F9BT 1TPXC 2OTWB 3O3BB 1F3DH 1CD1A 2AJZB 2R0ZH 2M26A 1FZKB 1LDPH 1Y6MR 2DAVA 4UINH 4S10A 5TQ0H 4LDOB 4LLYB 1DVFD 2NX5B 5DJ6A 1HYSC 4DWHA 3MRNB 3HI5H 4FXKA 4ZAKC 5GSRA 3D3VD 3KPSE 1HQ4A 1XCTA 1RFDL 1QACA 4Y1AE 4LP4A 5F9WC 4LBEB 4PJAB 3TCLB 1YNKH 1W72H 2QKIB 3T0VA 5D5MB 3VGGA 4PRNA 5IK3B 5FGBA 4GXUN 1PZ5B 2AP2A 4OBRA 3ARFB 1KCSH 1KELL 4L4TB 3QI9D 1DQML 4QHLA 3HPJA 2CO7B 4G9FB 3NH7H 4MNQA 4X7TA 1BVLA 1UH4A 4BZYA 3B5GA 4HS6A 4P5MB 2IADA 4BSWA 1JPGB 1U0QA 1KXQE 1KGCD 3G6AB 1V7NH 1ZA3A 2E7BA 1LEIB 1FBIL 4KY1L 2DBLL 5EZJB 4Q9RH 1CDHA 4FQHA 2KH2B 1MCOL 1CG9A 2FECI 5C0GA 3Q2CA 5DMKB 3V4UL 4FTVE 3T4AB 1I1CA 2J88L 5E8OB 3STZA 2ICWJ 3P0GB 2GCYA 3HA0A 4O9HL 4QTHB 5FCUH 4G8EA 3QWOA 3CFKB 3OJMB 1S9KC 2QHLA 4PJGA 3KLHC 3C6LD 3Q3GA 1HILB 4JRXA 4Y4HA 3MUGA 3SKUD 2XRAH 4WW2A 5IBTL 5C0CD 4EI6A 4D8PA 1OAYH 2AGJH 5EPMB 3GFUA 4F9LC 3VRLF 3L3IA 4BQCA 5D7LD 1TJGL 2ADFL 2Y5EA 4PJBA 3QIBA 5D7JA 5DUMH 1RK0B 4WTZG 4POYA 2BC4A 1DBAH 1MCPH 3QXVA 4M61A 2EH7L 4HIXL 1I1RA 4RFEB 3GI9L 4XCEA 4M7KH 5D7IB 2F58L 1JGEB 4TSCL 1QTYT 4DAGH 4K3JL 4K2UL 3OF6A 2G60L 3QH3A 2R69H 1DE4A 1YUHB 5CEZE 1NGXB 3B9KC 3WFDL 3SO5A 3WN5C 4Y19D 3GHEL 3VFUA 4APQA 1EVUA 4ZTOL 3VXNB 1XF2A 4FQXD 3IKCA 1NFDB 6FABH 5CBAA 1A4KB 3O8XA 4MJID 3C5JB 4WUUA 3TT3H 3GSUB 1WFNA 4XMPH 8FABA 3IVKB 1RHFA 4I2XA 1ZT1B 1FAIL 3MC0A 3RKPA 4LSQH 3L7EB 4OZFB 4JHWH 5GGSY 3O6FB 4QKXB 5GGTH 1CXKA 2V17H 5TH2B 4QHUB 2VLRD 4J3UA 1UXSB 4YHMH 2VQ1A 1XGUA 3DWTA 2LVEA 1RIHL 3FB8A 1KJVA 3WFZA 4OGYH 4QRQA 1ZT7B 4NYLB 1VGKB 1KTDB 1YC8A 4JRXE 2PR4L 3JV5A 3BEVB 4R90H 1N64L 4HWZB 4W4NA 3O41B 4X8XA 4F8QA 2LFGA 2CDGB 3SDCB 5AG9A 5F7NC 4LAJH 2QHRH 5KS9A 4H26B 2B4CH 5FEBA 2KKQA 3ELAT 4PJBE 3CVIL 4AIXA 2W0PA 4P2RE 1TETH 4NQXA 2B0SL 1I8MB 4WV1C 1KG0B 3BQUB 5DT1H 3X11A 3HC3H 4PJ8A 2BSTA 4DZ8B 1A7RH 1IT9H 2PO6A 2HLAB 3EDKA 3MV9D 5DC0A 1YEHH 1ZA6A 4Y2OA 2PN5A 1UM5H 2V7NA 4TVPE 4LPTA 2OTUB 3F7PC 4DCQA 3VWJC 3VXPB 2A77H 4LSRL 4UBDC 1E6OH 1N0LA 2AJVH 2AJXH 3GSVA 1BAFL 2YEZA 2BMKB 1UKQA 2HRLA 3SCMA 1I4FB 2FJGA 1K5NB 4I2XE 2GW5A 3W5NA 4XAKD 1MHPL 2DWEA 4CVWA 1CLZL 3AROA 4P9HL 2OQJA 4P3CH 5IFJB 2Y7QB 3TZVC 2VZTA 1FL5B 4NQEE 1D5BB 5MI0B 2SEBB 5HI3D 3FKUS 1B2WH 4XVUC 3SJVB 5LQBL 1F3JB 1ZE3C 1VADA 3MR9B 4AEFA 2YKLL 3EOYG 3QSKB 2VE6A 5T33H 1CGSH 1FL3B 5IMKB 3HHRB 2YWZA 3O0RH 4PGBB 2JJWA 3VGHA 4Z77A 1BFOA 2G9HB 4MSWA 3HZMA 4HT1H 4DJMA 1H15A 1E28B 1EGJH 3ARWA 4RGNE 4OZIB 4QXUL 4EBQL 2AJSL 3SDDB 1E4XL 3U0TA 2OX5A 1NBVH 1EMTH 3BWUC 3MA9L 3JWNC 3GBML 1QBBA 3QAZC 3U4AA 1D6VH 2DS4A 4ETYA 5H2BA 3ILPB 4HUWB 4ZYKB 3TH3T 3BD5A 3DV6B 3D1MC 1MQKL 2E6PA 2VWEC 4CADB 1FN4A 1OTSC 4UU9B 1U95A 2ZCLL 3DXAA 3D2UB 3MLTA 4OZGA 3HUJF 1S7TB 2KQNA 2H6PB 3SEPA 3QNYA 4XPHH 3DSFH 1L7IH 3V6ZB 3FO2A 4R4FH 2HVJA 5EO1B 5FO7A 4LRNL 1UWEL 3BGMB 4GRWH 4KMTH 4XPTH 3MZGB 3TNNB 3VRLE 4HCRL 5DEZA 2X4SB 4Y4KD 4H20L 1UWXH 3OKEA 3RHWK 5F7LB 1TPXB 2W0LA 4YDJB 3JWDL 3MMEB 1RHHA 3UZQA 3MOAL 5FCSH 2OR7A 4ONHA 1NFIB 4E9LA 1DVFA 4JO4H 5I1GH 3TESA 4Q58C 1MCRA 3V0WL 4PV9A 3D3VA 3WNKA 3T2NL 3QULB 5FB8B 4L8CB 1FG9C 2A6DA 2QQKH 2FL5A 4ZAKB 3P11H 1CFVL 2VZ1A 1XR9B 5D1QC 4DGIH 3U7WH 5F9WB 4PJ9C 4U1HB 3EO1B 1IEAA 2HWZL 4OIAA 1RZGB 3PF2A 3FO9A 3NZ8B 3MOBL 1UM4H 4K7PY 3B8SA 3ZHLA 1U8NA 2Q1EA 4HFWA 2FH6A 2OZ4H 1T0NA 1UCTA 2ZWLT 4X80H 1HHKA 1K4CA 1F6LL 5E0QA 2OP4H 1JYNA 3OAZH 5IR1B 4Z5RB 5CGYC 4IS6A 2Y07H 1TQBC 2KPNA 3RVWD 1LO5B 4OV5A 1QFUH 1J10A 2W0FA 4MZ2A 3FFDA 3P4NA 1SEBB 1RURH 5GGTA 3VXQB 3FT2B 1RZFL 2CRMA 1T1ZB 3P2TA 3DGCR 3DXAE 4I48B 2VC2L 1AGBB 1BEYL 4OFDA 1HHJA 8CGTA 1BFTA 3JUZA 3MA7B 1I9IL 4X7DC 5FK9A 5HGDB 5JIIA 2RAMA 5ADPL 3MCLL 4LAQL 1KEGL 4YR6A 5HYIA 1RZIA 4C56E 4YWGL 3BZEA 3O4LB 5IHUL 5C0NC 3P0YL 3VFPB 1VFOA 3CZFA 2XYCA 2VXQH 3L3GB 5DJDA 1NGYB 1MCIA 4GRWF 1KJMA 5GZND 1I3GH 3RAJL 3IFLL 3C6LA 2GFBA 3IXAA 4FQ2L 1REIA 3QUXA 1CE1L 3D3VE 4LLMA 5I66A 1G1CA 5C0CA 4R97C 5DMJB 5AZEH 3OV6A 4N8VB 1AQDB 4JQVA 5B8CC 4HWBH 1MRFH 1YDPB 1F97A 1W2KT 1ITBB 4U1IA 1KOAA 4OSUL 4G6FD 4TSBL 1EX0A 1YY9C 3QNZB 4HD9A 3T0XA 3ISWA 5FUZL 1OSZA 4P59L 4R26L 3GKZA 3L7FA 3P4OB 3BP6A 3AS3A 5HHVH 5IHZB 1A21A 1K8IB 1A6ZB 4TNWF 3FQXA 4K8RL 4N0UA 4O02H 2ZJSL 4ZUTA 3QQ4B 4Y19A 3EHBD 3EYUL 1KGCE 4E5XB 3ILQC 3B9KB 4FQXA 3WN5B 1XF1A 1A3LL 5C09A 4MJIA 2FB4L 1QYGL 4RWHA 3TO4A 3FONB 4ZD3H 3M07A 1MCWW 4KFZC 5E9DD 1OAQL 5I8CB 3HAEH 3GO1L 3H7LA 3TPUB 1KFAH 3QG6B 4MXWL 4LEOA 1MHHB 1FPTL 4R4NC 3BMWA 4JM4L 5FGRA 3RPIB 2VDMH 4NC0B 4GW5B 5IVNA 2CO6B 1BGXL 2QADC 3MXWH 3TNMB 4D9LL 4WCYL 1H8NA 4KPHL 4PRPB 1BM3H 5CJXA 4LPUA 4EDXB 5FDYA 3U4EA 1A6VH 4U3HA 4BELD 1A1MB 1DUZB 4NO0B 5GS1A 3SE9L 5A43C 2UWEB 5DC4B 5C0CE 1BVZA 3MV8B 1FZJA 2J6EL 5ID0A 4UDTB 1DZBA 2DQDL 5JXAH 4IIQA 4PGDA 4XNMA 5D7LE 3JWOC 3FB6A 1P4LB 3NCBB 3RL2B 4LSVL 1MH5B 3UC0H 4H25A 1ZGLA 1VFMA 4Z0BL 2VZVA 4LASL 4KMQA 4KKLD 4MA8L 3T0BA 5LBSL 1HCVA 1CXHA 4X7SL 1CF8L 4WO4C 2EE2A 3PWJA 4WV1B 5EORH 4LSUL 1YNLL 4HPOL 1JPFB 5K33A 3BWAB 4FP8H 4ZTPH 2OL3H 1CGVA 4Y19E 3WHXB 5H94A 5TF0A 3V7MA 2CIIB 1T03L 3VMOA 4MDIA 4G3YH 4EVNA 3LEVL 4MJIE 4RGMC 1S7RB 4MMXC 5FKAA 3VWJB 4KI1A 2JK5A 3BVNA 2VDPH 4M3JA 3VW3H 2XTLA 5T3XH 4LLWA 4MMZC 4G7VH 2BOCA 1EPFA 1DBKL 5GRVL 4JKPL 3HLAA 1U8QA 4AM0A 1MUJA 2VLRE 1N8ZA 3LKPA 1HINH 4MAUH 4O2EB 1JF6A 1HXMB 1Q0YH 1QBMH 3FZUD 1JTPA 3QUMB 3EKCA 4UQ2B 1GC1H 1T1YB 4F8TA 43CAB 3LHPL 5DYOA 5ISZD 4OQTA 2ORBL 3TZVB 1QZ1A 3PDOB 3RVVD 3KLAB 3SE4C 1C5CH 5JW5B 1TTFA 3MRLB 1FNAA 2CH8A 4NO5B 5C0DB 2B8OT 1LHZA 3LCYA 1VA9A 2CKBA 2IAMC 5LWYL 4JG1H 3OX8B 2OZ4A 5IGXL 4ODVH 4JB9L 5KSVA 1UB6A 4JANA 2VLKD 4FFYL 4U1LA 2HMID 1BVKA 1DLHB 1OP3H 1NCNA 4KK6D 1SYSB 3LRGA 3UZEA 1X4XA 3QAZB 5ESQB 4ZFOL 2V5RA 3ZTNL 1FFNA 3MV9E 5DXWA 4WI3A 4DGYL 1CT8B 2AW2A 2NY6D 3HMWH 1AI1L 1PLGL 4ZDHB 1IAKB 1T83C 3DX9B 2VDKL 3CXDL 5CEXB 3CFIC 4GRWE 1EHLH 1C7SA 4RGOH 4A6YL 4S1SH 3D5OF 4AH2B 1A6UH 1C7TA 4P23D 4S2SA 3SKOB 2VKWA 2AK4D 4V2BA 1OGAB 4XAKE 4HIHA 3RP1A 5SWSD 4Y4KA 2HN7A 1I3RB 3AUVA 2HKFL 5C86A 1LE9B 3FN0H 5JR1H 5E8NA 3QDMA 3BYTA 3BHBB 1JE6A 4WWID 4OLXH 2P8MA 1KYOK 4XWOC 2C1OA 4EXPX 2BHUA 2W59A 2OXGA 3SGKC 3QBTB 1JK8A 3K80A 2QSCH 3FFCD 4KDTC 5FV1L 1U41A 4NJAH 1YEDA 4R3SA 4U1MB 1OY3B 3PP4H 4BQ6A 4S11A 3MRDB 4JJ5A 4X0KB 5D1QB 3DRQA 5LKNA 2H32B 1E4XI 4XGZA 4PJ9B 1T04B 1NANI 4UNUA 4RMSA 4I0PC 35C8L 4LPCA 4NQDD 4Y7MA 5CJQL 1MHEB 3IDNA 3KJ6H 5DUPL 2J12B 3WJJC 3RWGA 2EO9A 4HKJB 1G7QA 4NZUL 2DQTL 3QO0A 5A3IC 5GRJL 4DKDC 1QFOA 3DI2B 2HTKD 2WM0A 3QQ9D 1XT5A 3B9AA 3VD4A 5EBMB 5B3JF 1LILA 5I1JL 1TQBB 4ZQKA 1J0ZA 3BJ91 2R8SH 3LH2L 2VXSH 3W39A 1ORSB 1UGNA 1AQKL 1VKXA 2Y1VA 3CX2A 4R7DB 3ALWA 3BPCB 5CJOL 1KCKA 3BGAA 1IQDB 4YHZH 1QRNB 1R5VA 1T89A 3GJFH 4D3CL 5IFHL 4MQTB 1FO0L 3DVGB 1NJ9A 5EOCL 4IMKA 3FQNA 4R4BB 1C12A 1J0HA 5A2LH 4CU7A 1RIUH 3O9WA 4E42A 1U91B 5KAQF 5JDSB 3NIDF 2H9GB 4LGPB 1ZSDB 3HC0A 5KVEH 2EXWD 5KTEL 3P77A 1KCUH 1MPAL 5IHLB 2EC9U 4NT6B 2PNDA 2GSIA 5D6CB 4C59B 5J9PB 3WXVL 4L5FH 1W0WB 4RA0C 3TCXA 2XG4A 3GJEA 4Q6IC 5AZ2L 4R97B 1EO8L 5KVGL 1CU4H 5IBLC 1JP5A 5EUOA 1KB5A 2X9YA 5B8CB 1Q0XL 2BVPB 1MRDL 2ICEB 1OD7A 1X5IA 3HE6C 4LARL 3UCRA 2OL3A 3HG1A 4NRYA 3LKNA 1W0VB 2A6KA 1KIRB 1JRHI 1UCBH 2QSQA 2XIDA 3AXLB 4MCZB 1P9MA 3B3IA 4U7SA 1YEEH 4PJXB 5D1XA 1R3JB 4RSVA 2CLRA 3D0LA 2GSGA 4NQCD 4OGXH 4KK5C 1ZVHA 3ARBC 2X70B 1DQDH 3T0ED 1C5BH 2VL5B 5IQ9A 3LEXA 3I02B 4NIKB 1MFDL 1JGVL 4NN7C 5E9DA 1IC4H 5DHYA 4WEMB 2W9EL 4NQUA 3GSOB 3QUZC 3CU7A 1A7PH 4DVBA 1BJMA 3CFBB 1QNZL 2YK1H 1FLRL 3RIFF 3QO1A 4GBXC 5DI8A 4K07A 3MNZB 5C0JB 1J05A 3V4VH 2QADB 4HQQL 3P4LA 2N7AA 3F6LA 5EO9B 3MBXH 4WWKD 3EYSL 5IB4A 2DMCA 3Q1SH 1I85A 2F54D 4WUKL 2BY3A 5IKCB 1RZKC 1SM3H 5A1AA 1F6AA 3PGFL 4GKSB 3LMJH 1VESA 5IESL 4MVBD 3LVEA 4JHAH 4TUJB 2NLJA 4M1CD 3S96B 1T0MA 1MJJA 2FJFB 3OKOA 3AM8A 5DS8B 1PQZA 2EYTA 2ID5A 4TVSa 1B3JA 2BSSA 1WFUA 1NEZA 2Z4QB 1KPUB 3OHXA 5E6ZA 4YXHL 2PW2B 4ZUUB 4F57L 4BQ9A 1U6AH 5FYKU 1NDGA 25C8H 1AY1H 1ZXQA 4LCWB 4WO4B 4JVUA 4QRUA 1ZK9A 5BV7H 4FG6C 2E5EA 4G6KL 3HE7D 1J1PH 3GMNB 1OSPL 1KBGH 3CMOH 1NEZG 2F19L 4XNUH 5DZLA 2P24B 2IH3B 5T1LD 4LMQI 3CAFA 4RGMB 1Z9OA 5E9DE 5FA4B 2F5BH 3H42H 2HG5A 1JNJA 4XNXH 3TA3C 3P9WB 4OCWL 1T22A 1QO3A 5LG1A 1PKQB 3WE6A 5KAQG 4MCYA 3VU2A 1ZHNB 1CBVH 3LB6D 4EI5C 5IP4A 5E2UH 2PYEB 1RAMA 5C0EA 1WBZB 1B6UA 4LKCA 4MQ7A 5ISZA 4HLZG 3U6RA 2A83A 3AY4A 3RPKA 2OM5A 2DJUA 1DQQA 4L4VB 1QHOA 2R4SH 4IM8A 4YHLH 1P2CB 3U46A 2HYMA 4WU5A 1INQA 1YYMH 2FIRT 4CNIA 1Z0MA 4B7IA 1KB9J 5EIIA 4S1DC 3UTQB 1F90H 4DK6A 4WU7A 5B3JE 2IAMB 5B4MC 5IIEA 2FWOB 1WEJH 3BYYA 5KJRL 4MD4B 4XI5C 4JM2D 1P7QA 4PRAB 5DVLA 4M1DH 2JE8A 5JHDD 2NY2C 5SWQB 3OAYK 3C8KB 3MODL 4XVTH 3WFBH 4Z95L 5I1KL 1WK0A 4OD1H 1D5XB 2YPVH 4Q6YA 1J0YA 3S36H 1MJ8L 5LAXB 2ZOLB 1M71B 3MQIA 1B6DA 4F7EA 1PEWA 4U1KB 4LF3B 3BPLC 1T5XB 2ATKB 3VI4F 1CLCA 3GJFA 5EU6B 3V5KA 4AEHH 2YD3A 4WHCA 1RQ5A 3NIDE 5BVPL 4F2MB 3VFOB 4BFEA 3VI3F 2J2ZA 1HHIB 3L95A 2H45A 2VIRA 5IEHA 3QEUB 1TFHA 5IW1A 3WS6C 4HW6A 1IAIL 5CHNB 4TRPL 1AXTH 2AK4A 5ALCL 4Q9QL 1JWSB 4UIKL 5LGHL 5I1AB 5SWSA 4Z7OF 2EDHA 1F02I 2HFTA 3PG2A 1L9NA 1N26A 3QRFM 2PUQT 4KTDH 3Q5TA 1ZGLM 4LCIH 2DLEA 1R3LA 1EEYB 3U0WH 4FZ8L 4QRSA 4P9MH 3ABZA 4LP5A 5ISZE 1HXYA 4I5BA 4NQSA 1CTNA 2QJDA 4ODWA 3TJHD 4XBEH 3SE8L 3UTZB 3I50H 1PBYA 1CFQB 4MHHG 1U8HA 1DBJH 4X6FA 4YUEL 5CP7A 4NOBA 3MJ8B 4CN1A 2I07A 2NY3C 3R1GH 1TVBB 4EN3C 2EC9T 2RBLA 4DKEL 2O5XL 4NQDA 1RUMH 3DVFA 1SYVB 3HN3A 3SDAC 1ES0A 2APVA 1YMMD 4I0PB 5DRXA 1U3JA 3L3JB 3E3QC 2HT3D 4CVXA 4K7PL 2VLKE 4M48H 2YMXH 3H9SD 2BRRH 1IKNC 3I6KA 1FQ9C 5FHBH 1DFBL 4GKZB 5I16B 5B38B 3W0WD 2X4UA 3DOSA 3PWPD 3RBSA 5F6IC 2ITDA 5INDA 3MLSH 4GQ9H 4P2QD 4DKFL 4XCYA 5CMAB 5E24E 3H8NA 3WCYA 3D39B 3TJEL 5JXED 4HFUH 3I6GA 2VTFA 1IGJA 3JVGC 5EC2B 1INDH 3ZKSD 3ZT6A 3LD8C 5J6GA 5IVXB 3K81A 1CXEA 2AK4E 1AO7D 2C7UA 3M1BB 3QWQB 3HNTH 3N9GH 4NRZA 5SWSE 1BLNB 1R5WB 2GI7A 1DSFL 2WANA 1S3KH 4EJ1C 4CVZA 4WTXA 3P4MB 2RB8A 3S88H 4LNRB 2GAZB 1C5DA 4NO3A 3IAQA 5I2IA 4AG4H 1FORH 3RFZC 2C3WA 2HLFC 5KOVC 2AV7A 3FFCE 2A0LC 4XPBH 1JPTL 1IFHL 3L9RB 1OAKH 3CVHL 5IOPB 4Q6IB 5HGBB 2R1YB 3PWNB 2AV1A 1YY8A 4HEME 2CSPA 4HHAA 4HJJL 1BBDH 3U7AA 1OAUH 4NQDE 2J7LA 3HE6B 4JFDA 1BFVH 4NM4H 4Z7UB 5F70A 4PJ5D 5GS0H 4Y8DC 2X4NA 1T1WB 1N5AB 3ES6B 3R06B 1U3HC 2EH8H 1IGTA 3ZKXC 1FH5L 3G9VA 2ZUYA 2ENYA 4ZXBC 2GKIA 2WWKT 2O5ZL 4K3GA 5EG6C 3JTSA 2O5YL 4YNYB 5IJVB 3T0EA 2XA8H 1FFOB 4DZBA 3ARBB 4NP4H 4YBQD 3QPXL 4IRZL 4JM2F 2NW2B 1NMBL 5I1LB 2FX8L 3N0PB 3PP3K 4LLDB 4M1GH 4NN7B 5F93C 2DIBA 3WKMH 2BVOA 1RULH 3I2CH 4OFYD 4U1GC 4G5ZH 3QUZB 4UOW0 2BY2A 4XC3H 1IGIH 2VR9A 4XXCC 4XHJD 1CICC 1LP9B 1DBML 3WHE0 1NGZA 4GBXB 1SJEA 5KZCD 1FNEA 5JUEL 5IFAH 4FXGB 5GRWA 3MFFB 2AEWA 5CGMA 1VFBB 5JPNB 1A9BB 4WFGE 1MF2L 2HFGH 2F54A 4Q2ZA 5SWZA 2EYSA 2EE9A 1WWBX 1J5OH 3CCHA 1JI1A 5CJBA 5HHMB