1BOGA

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-homologous peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGTASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
molecule tags Complex (antibody/peptide)
molecule keywords ANTIBODY (CB 4-1)
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1998-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogA01
5LQBH 3O3BA 3WIIH 4MMXC 1I3VA 4MZ2A 5GGQL 1BZ7A 4HK3J 5C0CE 1NGYA 1MCRA 4LPYA 3GBNH 5D7KE 3WJLA 1ZHBB 3ARBD 2IQ9L 2N4IA 4HWBH 5GSVB 1DBML 3QO1A 1D5IL 3P73B 4UT7H 4EJ1C 3QDMA 2YXFA 1YZZA 2V17L 3W11D 2C1PA 1B6DA 3AB0B 1AR1C 5LCVH 4JO2H 5ALBH 1T6WA 2WP3O 5D72L 2VL5A 1MIML 3MA9L 1MRCL 3BGFB 4XPHL 4WI4A 4Y5YB 4M8VA 5DO2D 1D6EA 5F7LB 5TDOB 4JFED 3B3IB 3HC0B 4PP1C 2P7TB 5SWQB 5EU6E 4IMLA 4XMLL 4OZIB 4KK9C 4PJAA 1MCWW 4U0QB 1BFOA 1KCRL 4IRJB 4L4TA 1DEEB 5SWSE 4XP5H 5FEBA 2Q8AH 2WBJC 4F9PC 4HEME 3DVIA 5HYFA 5D6CB 1RK0B 2VQ1A 3GJFK 3MREA 5FGRA 3RKDD 3D25B 4K71B 2Z92A 4U2YA 1SJVA 3GMRA 3W82A 1OB1B 3LIZL 1F42A 3BP4A 5I6XC 4GLRI 3VXUA 4F3FB 1P7QB 5CSBA 4DK3A 5HGDB 3L5WA 3OAYH 4KUZL 1FO0H 2HMID 5KSAB 1SHMA 3GI9H 3BKYL 1MQKL 1TVBB 1U8JB 5ADOL 5K9QI 3RGVB 1Q94A 1XF2A 3I3DA 1U92A 4PGDA 2CR3A 3QUZC 3OB0H 5IHUH 4KDVA 3JWDH 1L0QA 1A4JB 1UZ6E 1HQ4B 43CAA 3V52H 3UJIH 2BY3A 4TUOA 4JM2A 5EU6B 1CFSB 3V6FB 2XWJB 3TO2A 5C2UB 4JAMB 3HHRB 4JFDE 1OP5K 3MLTB 1DN0B 4D0DB 1PD6A 1QKZL 5D4QA 4Y2DB 1FLTX 1YYLH 3KPSE 4L1DA 4ZS6C 4FMKA 2JB6A 4JCMA 1JV5A 3CFDA 1EAJA 3RU8L 2ZG3A 3H9ZA 2G75A 1EO8H 4IHOA 1J05A 5FM5M 1G9NL 4L3ED 4HG4K 1ZANL 4JAMA 3MRNB 2EO1A 1AE6H 1AJ7H 2QSQA 1VPOL 4JO1L 3U7AA 1DQDH 1KPRB 5FYKH 5H35A 3B3IA 4JZOA 4RSVA 4M8QA 4RDQF 2W60A 5ISZA 1AFVH 5KVGL 3IXAB 1EBAA 1ORSA 1ZT1A 5EZOH 4L4TD 1UWGL 4MD5A 2W9DL 2BVTA 4P9HL 2ZWLT 3G6AA 5DHXB 3RGHA 5L2KE 4NPYB 2DQIH 2Q7YB 1I7RB 1JGVL 4OJFH 5HI3C 1V7NL 4OGXL 4DVRH 1IKNA 3H9SA 3GMRB 5E2VH 1ZLSL 2EIDA 3JV4B 2B5IC 1RK0A 2VQ1B 3MREB 3MSPA 1IAKA 3B2VL 1K5NA 3N1QC 4X80H 4OF5A 3RP1A 2CK0H 4KRMB 1LP9B 3PG2A 2VLLB 3QIWA 1QLEH 4MX7B 1VENA 2D7PA 2XG5A 1T1XA 3QNYA 1HHJA 5JQ6H 3MR9A 5GZOC 5JW4R 1Z0MA 3ROLB 3B6SB 3HS0A 3RGVC 3O9WC 5IM7B 2YS4A 4UUJA 1KJVA 4GRLB 5J6GA 3CSYA 2ARWA 4ERSL 3LEXB 4HGWB 4N9GA 1W0YT 5HJ3B 3TVMA 4IOFD 1LE9B 5C0GA 1KB5L 5I1KL 1BJ8A 3HE7B 4QOKD 3B83A 4OZHE 1Z2KA 5IK3B 3IFPB 3RX7A 4LCWB 5FYLD 1UJ3B 1OP3K 3LN5A 4PJXF 3O6LL 4WO4C 1OLZA 1BX2B 4O58H 1I9RH 3T3MF 4G7YH 1N64L 4KJPD 4K3EH 1MJUH 3WS6C 1FL3A 2AV1A 2NW3B 4MJIB 3AREA 3O3BB 5FYJD 4CMMB 4HWZA 4NJAH 4OGZA 3FZUC 4K94C 3ESUF 4P4KA 5DF0A 3Q5OA 4KROD 4PG9A 1QNZL 1JGUH 4K3DL 4HUMB 2IMMA 4Z5RA 3WUWG 4PLJD 3RBSA 3HI1B 2DYPB 2PO6B 5B4MD 5E5UB 2X41A 2AAVA 4G8GE 1GC1L 3VXRA 3LKQB 2PYEE 4MAYD 2J5LC 1WWBX 2R9HD 2YPVL 1FO0L 5FO7B 1GGCH 2OSLA 4P3CH 5IVOA 2DQGL 4XH2B 5HHOE 2EYRB 1SEQL 2FEDD 1FZMB 4WFGE 1WGOA 5C0DB 1SYSA 4X5XB 3PQYB 3KPRE 3RWDB 5I1LA 4Z7WA 5BZDA 2OMBA 3HG1D 5HHQA 1C12B 1D9KD 3X3FL 2RIKA 4ZFFB 5JO5A 4RGND 2DQHL 4G6JH 1A1OB 4JPVL 2X4SB 3IJHA 4NZTH 2IALB 2CIKA 3K8KA 1NAML 3T1FB 1KCUH 2GK2A 1YYLL 1S9WB 2J88L 1KIRB 2YMXL 1S9VA 2W07A 2DAVA 5FO8B 5TQ0H 3K2UH 5DQDH 4P23B 3QQ9D 4ZOCA 2Z31B 1G9NH 3GIVB 3TIEA 1B9ZA 3U0PA 3IJHB 3ZTNH 2R2HB 3CVHL 3E0GA 3RWGA 3RNKA 4GKSB 1FNFA 4GKNA 4YIQA 3S98A 1DQDL 3C60C 4L3AA 4LARH 3TN0D 1ZHKB 4AEFA 1KTDB 4QHKI 3S96B 4JEGB 3ARED 2OJEA 5HHOB 5E94B 5EFIA 5FIEA 2BERA 4NCC1 2Y07L 2YPLD 2Y5TB 4QEGA 2HLFD 5EO0B 3FL7A 1B88A 1I9JH 1KNOB 3F7YA 1OAKH 2VQTA 1C1EL 1JI2A 2HH0L 2J4WH 4RGMC 1CLZH 2DQIL 2XWTA 4FRWA 3UTTD 2CUHA 5KG9A 3QAZC 1T66C 4ONFH 4G9FA 4OGXH 4KJYB 3QJHA 4PJEA 4LCIH 1A6UH 4PJ9D 3LHPH 5KBNC 1T4KA 1R0AH 2AEQH 3QI9C 2D7QA 4JFFA 3NABL 3N50A 3DO7A 4HIJA 3UBXB 4GO6B 1WEJH 1N8ZA 1WT5A 4PJDB 4X99B 4PJHB 4BH8B 2XN9B 4ZMAT 4PBXA 3QEHB 4U2ZA 3T0EA 5A16B 4PGZA 3BUTA 2JK5B 5LG1A 3QXDA 1Z6JT 3O4OB 3P9MA 1IGJA 2IFGA 3MJ8A 4KTEH 3N1GC 4JB9L 3VD5A 2OZ4H 1E27B 3CFKA 3P40A 3HMXA 5HJ3A 2J8UB 2QR0B 4JQIL 4P9MH 3WFCL 3I3BA 1H3XA 1DZBA 4R26H 3T0EC 3MRPA 4ZUTA 4YXHL 3C8DA 1KJVB 1C5BH 3BZ4A 1NC4A 2EDQA 3HTLX 1P4IH 2EYRA 4DZBA 1I1RA 1NCAL 1AHWC 3QULB 2NY7L 5IQ9A 1GOHA 1R3IH 4CVXB 5EBMB 1G6RL 3PUCA 1G0DA 3ZKND 5I1GL 3RWCB 3O6LH 2GKIA 4JRXE 3VH8G 3H6JA 4FQXB 4U3HA 3O2VL 3QG6B 2PO6C 3V4VH 3WIHL 1K5NB 1BMGA 3E8UH 4HIIB 3M8OH 4QHKJ 3G5ZA 5DRXB 4JM2F 2VAJA 1TFHA 4NHUA 4OCSL 4LVOC 4N0FA 1IM9D 4MVBC 3VH8B 5SWSA 1W0VB 1FFOB 5TH2B 5E0QA 4GSDL 3QPQD 3OWEA 3IF1B 1GC1H 3GSNL 5I74C 2W9EH 4JR9L 1TXKA 5E00B 3RPIB 2EDRA 4QYOA 2BVEA 5SWZE 2UVEA 3WJLC 3ZE0E 2NY3D 4FQ2L 2DMCA 1AC6A 4EUPA 4F2MA 2DLGA 3CK0L 2PTUA 3BWAA 1LE5A 4PRPD 3FT2A 5DGRA 3TZVD 3WFDL 1U3HD 2CLVB 5KSUA 4ODXB 1QSEB 1RFDL 3MV01 3BGAA 1SMOA 5C0GB 4XCNB 3U36A 4TVPL 3HA0A 5K93A 4LOUD 1F4YL 3PXJA 3QNYB 3FHAA 4HCRL 5CINL 3WIFA 5I19H 3WFBH 15C8L 5D2LE 4J4PC 4X6EB 3T0VA 3BX7C 3P30L 4LSSH 4U31A 5IB2B 2JK5A 4JGMA 1YEFL 4OZGE 3UMTA 1CBVL 3CPLB 4HJJH 4WY7H 4EN3D 3A6BL 2WBKA 3PL6B 4P0DA 3KPQB 1JN6A 4YGVA 4ETQA 4MXWL 2H2SD 3RKPA 3VD4A 5AZEL 3WNNA 3CFBA 1F6FB 1CLCA 4H88H 2I9TB 1Q9OB 3N0PB 3WE6B 35C8L 2DQDH 3AGVA 3EYOA 3IETB 1IGCH 1NANI 4OZHA 3MC0A 5GGQH 4FQCL 4BQCA 2J4WL 4N8VB 1F11A 1S5IL 3EYSH 3CFJB 5E1HB 4Z7UF 1A5FL 4OV5A 3LB6D 2J8UF 4XNQB 3FO2B 1RZJC 4LCIL 3B9KB 3KPLA 4G8EB 3CUPB 5CS7A 5D2LB 1GGTA 2AEQL 2O61B 1WEJL 4PRHD 4ODHL 4NO0D 1MSPA 3U6RB 3MUZ1 4OQTA 5CD3A 2F58H 4NQSB 1P4BH 3SKMA 3HE6D 3QXWA 5D1ZD 3GSQB 1GGBH 1G1YA 3VGEA 4OZIA 4P5TB 3EOAA 3GBML 3GSUB 2XKUA 4RGNC 1A1MA 1A9EB 1NL0H 1NQBA 4HBQA 4CW1B 2VDQL 4NRZA 4M9PA 1H3PL 4FFYL 3NTCL 3CFCL 4JHWL 4RAUB 1OGTB 3ARBC 4X9FA 4M1DH 5ESQA 5IMLA 1T3FA 1OCWH 4FFWC 5EUOB 2CIIB 4HV8B 2IQAA 5C8JA 4DTGH 2FLBT 3QBTB 4NO3A 3V4PH 4MCZB 3SEPA 1QSEA 2EZ0D 1VEPA 4QNPF 1BGXL 3CSGA 4QTIL 3TIDB 4ZTPL 3BPCB 5DJ2A 1AP2A 5DQ9A 1MH5A 3KR3H 5HDBF 4TNWK 3TH2T 3S4SB 2OJZH 4Z8FL 4RFEB 3V95A 4H25A 1T6VN 3SGKC 3BKYH 5ADOH 3ARFD 4YHLL 4XP1L 3D69A 5KOMC 1N6QL 2HRPL 4ZUUA 3VU2A 4TPRL 1YNLH 3OJDB 3MX0A 3GSNH 1JN6B 4JG0L 1UVQA 2GUOB 3FB6B 4F58H 5I9QC 1I7TB 3QIWC 1BFTA 1A3LH 5EOQH 1DANU 3VRJA 1NBQA 5SWQA 4WEBH 3B9VA 2ADFH 2H2PC 2IAMA 1S78C 3OHXB 2E9JA 3PE9A 3EFDH 1XF5A 3VXRE 1G7JA 3ULVC 3UC0H 2VL4A 2N56A 4HFUL 4IMLB 3VGBA 3TJHC 4LCWD 1N0XH 4FHBD 5T1DH 5KS9B 3T3PE 1QQDB 3TO2B 4YFLF 5FOBB 1NC4B 1MEXL 2Z8SA 4Y5YA 4P49A 3M1BB 1IEAB 2CLVA 5KSUB 2VL5B 5INCA 1QBAA 3OKKB 5F71A 1MWAB 2DMKA 2P4AB 3BH9A 4J1UA 1DBKH 1IFHL 5CJ8A 4MAYC 3FOMA 3MRGA 4L4JA 1IT9L 5D7KD 5CJOL 3NIFF 2G2RA 5MERB 2AI0L 4Z18A 3JBG7 3NBNA 1BWMA 1MIEH 2VZVA 3FT4B 1RJYA 1E4XL 2X40A 1W0VA 1MCQA 3A6CH 3GUTA 2BVPB 3D0LA 3UEZA 5HYJD 1AIFA 2IPKB 3QDAA 3HZKA 4G6AD 3WYRA 5DUPH 5E4EB 2F19H 2XWBA 3PGDB 4FQCH 3TBWB 5F3BA 5FGCB 1Q0YH 5BZWB 3FKUS 3KGRA 4QXGH 2VLMD 3OKNA 2Y25A 4K7FA 1S3KH 4XNYL 3EOTH 4APQA 2D03H 3SE4A 3VFTA 3BP5A 5BV7B 1MCPL 1ITBB 3VXNB 2P5EE 4FQIH 4HLZH 3RAJL 1OY3B 1L7TH 4IM8A 4DAGH 5ETUA 3IDIB 3EW3B 1D6VL 4ZUUB 3U4BH 3BIBX 2OQJB 1BVKB 4M03A 5SWZA 4JFFE 1H0DA 5EO1A 5IVXB 2IPTH 3FO0L 3DVFA 3DETC 3QRGL 4CJ1A 4G6FB 4B7LA 2AK4A 1OAYL 1DVFD 3TBVB 5A3ID 4WFFE 5FKPA 3GMLB 3SDXF 1L9MA 3DO3A 2BNRE 2MMXA 3FMGH 2IG2H 4CNIB 4Q2ZB 4AQOA 4JHZA 4KKCC 1QA9B 2JTDA 4MJ4A 4R97C 3UZQA 1INQB 2X4OB 1VFAA 4R9HA 1LEGB 2DQFB 3LD8B 2X1XR 4EBQH 4WRLA 1F58H 2M8XA 2DIJA 2I24N 5DJ6A 1MFBH 1A6AB 1ZXQA 3U48A 2OP4H 3ZKMC 2VC2H 1N2RB 3UXFA 3KPOB 2V7NA 1IM3B 2WLYA 3FQTB 4BFBD 4LDEB 1JFQL 2JJWA 2YN3A 4FXKA 4LSPH 1UKSA 3TLRA 1INEH 4NIKB 1G7IA 4CN1A 2ICEA 5C0EA 5EOQL 3VE0B 4RFOL 2OXGA 2FD6L 4XPBL 3N1MC 3ULSA 4J3SA 1S9VB 1BECA 2QEJA 1CD8A 4YHNA 1JZ3A 1YA5A 3BHBA 3RBGA 3ILPB 5DZNA 3MNWA 1HDMB 1T5XA 1RUPH 1ZS8B 5BOPA 3O0RL 4LCWA 1G7HB 5CIPH 5CP7A 3QUML 3PL6D 1XIWD 3VGGA 5HYQB 4ZFFA 2CPCA 3LOWA 1MEXH 1HEZB 4HEPG 1ACZA 3B2UD 2ED8A 3GB7B 1EFXA 3FB7A 4JPWL 3I75A 1PLGL 4X6DF 3MRHB 2YA0A 2GI7A 4QRPD 5C1MB 3PDDA 5E7FA 2EDWA 4C57C 4J7RA 4PJ7E 5I17A 4AENA 4AIZA 5CZXC 5D70H 1WBYA 5CJOH 4XPGH 2HG5A 3BT2L 4M61A 4HLZG 1OAKL 4MX7A 1MFDH 1Y6KR 1JBJA 2VABB 5HDBE 4H1LG 5INDB 3E6FA 4R3SA 4WWKC 3U30C 5DJDB 4OCLC 2X2YA 3NFSH 5J12B 3T2OA 2FEEL 4PRHB 4KK8D 2OR9H 1ZA6A 1J1PH 1CXKA 4OI7A 1X5FA 3EDEA 3ARRA 4LKCA 1OD7A 5I18L 3U9UB 3KYAA 2ZKHH 3BZFB 1NEZB 1VERA 1TJGH 2E6QA 2J3SA 1DLFH 4X6FB 4XNYH 1T1ZB 1NSNH 4PJ8C 3KPSB 2DL2A 4Y16A 1F6AA 2BNQA 4ENEC 1MJ7L 3ISWA 4JQIH 2QKIB 3RL1A 3NVQA 3MV8D 4OGAD 4OCYH 1KLGA 3ROLA 1F3RB 1Z3GH 1C5BL 5L8LB 5I9QB 4DKFL 1CDHA 3QUZB 4C4KO 1P4IL 2FECI 3BZEA 1D9KC 4JQXA 4ZS7H 3MMEA 2VMFA 4WGVB 3FO0H 5IMMA 3QHZL 5C0CB 1NAMA 4BJLA 4X6CA 5HHXH 3TBSA 3JTTB 3PWJA 3CVHB 5KG9B 4H25B 2BSSB 3UTPD 3Q3GB 2VLRB 1IQWL 3WIHH 4YZFE 5B8CA 1BM3L 3MUJA 3M45A 3UTTE 4OCSH 3V4UL 4M5YL 5IROA 5JMOC 3ZE1E 1VEMA 4QHNA 2WUBL 5I1CL 1FDLL 1NGWA 1EEYB 4O5LL 1MCCA 2DYPD 4F15B 4PLJC 1AO7E 3BP6A 2QSTA 5DJYB 3I75B 5SX4H 3GUTB 2APXA 3EYFA 3T1WA 1HEZA 3LPGA 4Z78B 1ORSB 1N59B 3RIAK 3C09C 3RWGB 4UQ3B 3UP1A 1WBZA 2VXUH 4PJCE 2ZOKA 2NQCA 2R15A 4B53A 2XXCB 1RUMH 2C3GA 3S37H 4X6BB 4M1CD 4D9RD 2F5BL 1MWAH 4NN6C 4HIXL 3VWKA 5FAAA 4JKWA 4PJDA 1F3DH 2AJVH 4F8TA 1BVKA 4NNYA 5GSRB 4P2QA 5CBEA 3E2HB 4HT1H 4XPBH 3HZYA 1B6UA 4OI8A 1NPUA 2IEPA 1ZLWH 1UACH 3QJHB 4PJEB 3D87B 2W92A 3I6GB 4WHTA 1FV1A 2FYYA 4H8WL 2Y06L 3Q1SL 4JFHD 1CBVH 3O0RH 4YHOL 3PQYA 1AGCA 3SKUD 4X7DC 5F1IA 3VWKD 1N6UA 4IOIB 1YECH 4OZIF 3AU1B 5K9JL 1OAQL 5DEFA 3SY0B 1YEJH 5CBAB 1RZ8B 1DE4B 3MBEB 1KC5L 4UZGA 1BJ1H 3WL9B 2R1XB 3I50L 2Q8BH 5HHOD 2PO6A 5GJSH 1MI5E 2PXYC 6CGTA 4I13B 1LK3H 3OB8A 3TESA 4RQQA 5C0RH 1NCCL 4XMPL 2B4CC 4JKPL 4ZPVB 5AYQA 4XCYB 4PRIB 1DQML 1ONQB 4YGVB 2Y7QB 5IW1B 1NLBL 4I3SL 2NY6D 4BELD 4K23H 5B21A 2H2SC 5GGRB 4K7PH 4R2GD 3K81A 4GJTB 7CGTA 3ZZ1A 1KF9B 5HHVL 3SGDI 4HMEA 2DM2A 2BNRA 3VXMA 1MELA 3QA3A 4M43L 5FCUH 3X13A 5I30L 3WNLA 1INDH 1PDKA 2QHRH 4KTDL 5JXAH 1ZT4A 4NFCA 5BS0E 3ARPA 1IAOA 4G6KH 5DGQA 5KTEH 1E4XI 2X89A 1EVTC 1FAIL 4RDQG 5KOVC 3NCJH 1A3QA 2GY5A 3LV3B 3ME0A 4RMRA 5C0FA 2FB4H 2O5XH 1NSNL 1E6OL 1IZJA 4HD9A 4NT6A 3CDFA 3FT2B 1E6JH 3JTSB 2YRPA 1MFNA 3UPCA 2Y72A 1H3PH 4FFYH 4OCYL 5EZIL 3T4AA 3AROA 4M1DL 3TVMD 4LVHC 5CMAB 3K4ZA 5E00A 1FNGB 1WIOA 1AI1H 3LN4B 2P8LA 3H7BA 4ESKA 2KDGA 3IDUA 2Y6SD 4NNPL 5HVGB 1SY6A 1AGFB 1FIGL 5KS9E 2JJSC 2DLFL 3V0WH 5JIKA 2YBRA 1RZIA 2C7UA 3PDGA 4KPHH 3L3IB 1VGEH 5BMFH 2E8ZA 5I66B 4APQD 2PNDA 4DEPC 4IDLA 5HDOA 2GIYA 5D1ZA 5LWYL 1BM3H 3QT2A 2R2CA 1A7PL 2FBOJ 5CEZE 3GMNA 4R7NA 3BRGC 3VCLB 3IETA 2A6IA 4EDXA 4A6YB 4TVPE 5DQ9B 5JXEA 1NH6A 2DD8L 2EXYD 4OF8A 4Z9KB 3S35H 4LU5L 2YWYA 1G7MA 1JVKA 4PJ7A 3L3KB 4WUKL 1G7LA 1UEMA 1LEIA 2JJTA 1A1MB 1SBSH 3D9AH 4WV1C 3RDTC 1Z9LA 3KXFB 1MCOH 2NR6D 2UWEA 4GFTB 4NM4H 1U8IB 2WP3T 2X5PA 3J8F7 4E41E 1OARH 4YEEA 2BNRB 4P23D 4TULL 5BO1L 3KYKL 2YD4A 4DGVL 2UYLB 4QXTA 3O2DL 4LASL 3TJHD 4DVBA 3V5HA 5E6IB 3WLBA 3ZL4H 2B39A 3SGJA 4NQDA 2QQLL 5GXBB 1GGYA 1LO0H 4Z0BH 2FBJH 5T3XD 4P9HC 2Y06H 4H8WH 3VFOA 2CDGA 1T0PB 4BZ2L 1IL1B 1GZPA 3T4YB 4Q9QH 4XTRD 1IE5A 4DGIL 3S34H 3DIFA 1JPSL 4OAWA 4JPIA 3CUPA 1JZ8A 2BJMH 3IXTA 4Y7MA 2NR6C 4HJGB 3PIQA 3EYFB 2Z9TA 1YEEH 1KB9K 2IAMD 4HK3N 2IH1B 4FQ1H 3UO1L 4HS3A 1F8TL 4H0HB 5D1XC 4LHUA 1NCTA 2ADGB 1OM3L 1FYTE 1FPTH 4KV5E 4Q6IC 1YNTB 5DS8A 5GGVL 3FQRB 3RDTD 5TE7H 5C09A 1H5BB 5BRZB 3ZDZE 3Q2CA 4LGRB 4N8VG 4RISH 2DTML 4UB0H 3TFKC 5CMAA 4FNLH 4L1HA 5IB3A 3QEUB 4NQEE 4X6EA 3VXPB 1S3KL 5HHMB 4KVNH 4TUJB 3CXDH 2NY1B 4ELMB 2GY7B 3P0VL 1GL4B 2P5ED 1LWRA 3TZVB 3ZKMD 25C8L 1WZLA 5GZNC 5EO9A 2VLKE 4FFZL 2HJKA 2XXMB 4JFEB 4KQ4L 2H9GB 3H3KA 1P7KB 3GMNB 3C09B 4PP2A 3CX5J 2AGJH 3OKLA 3VDBA 4P59L 5H37G 3IDXL 1WAAF 4PJBF 3SPVB 2V9RA 4JLRB 1DEDA 3GRWH 5EZIH 4Y1AB 4RX4D 2NXYB 4PTUA 3CFEB 5C08E 3BD5A 5TH2A 3BO8B 2VDPL 3OGOE 1IGML 5IW1A 1GJIA 5D7LE 4ZFGL 2BSSA 4GG8A 3L3DA 1FIGH 3RPIA 4PRIA 3HB3C 3ZYIA 1I1YB 1D5BB 3X11B 5K9OB 4GAGL 1SEBA 1YY8B 4Y5VB 4ZUVA 3F7RA 4HZLB 1PEWA 1P1ZA 3BP7B 5BCAA 3D18B 2QQQA 3WNKA 5IVZB 3QHFL 5KVEL 2HYMA 5LWYH 5EPMB 3QEQB 4OIAA 5HI3D 5J3HD 4Y88A 3U46A 3RZCC 1D5IH 5DXWA 4L8CB 4HUNB 1QRNA 3ECBA 2MQ3A 1AD9A 2DKUA 1EFQA 1LDPH 5LXGH 1OOAA 5D72H 3D39E 1MJ8L 3L9RB 3DYPA 1MY7A 4HPOL 1MI5A 1J0JA 3T0BA 3Q6FA 4I0KA 5J3HC 5D6DC 1M7IB 4G6AC 1AD0B 4XVSH 1FBIH 4NO0B 1KIQA 2SEBA 4ORZC 1WFTA 3VI3E 3VXMB 2HWZH 2A83B 4XB8A 4YQXL 1F90H 1OARL 1K4DB 2GHWB 1T5WA 1UQSB 3ZYJA 1ZT7A 1KG0B 2BP3A 2P8MA 3LPWA 3GHEH 5ACZB 4FQHA 5IHZA 3B9KC 4OLXH 2A9ML 4Z7NE 4WCYL 1PBYA 1QO3B 2KUTA 4MJ2A 1CF8H 3BDBA 43C9A 3GSVA 1PZ5A 1M4KA 1I85C 3TO4C 4PGEA 5ID1A 4PJ8A 1P9MA 4JREB 2XPGB 2DBLL 3KPTA 2ICWB 3D0VB 4YDKL 5A2JH 3WHXA 3KPOA 5JLZB 3KHQA 3R1GH 1MOEA 3ESVF 1PEZA 1FZMA 4GG6F 3MRHA 1ZLWK 1ZLUK 3QDHA 2OS7A 1UYWH 4IRJD 1I8IB 5E08L 1QFWM 4QGTA 1INQA 1MVFA 3FTGA 3T09A 3MJ9A 4GKNB 3O6FD 3DRTA 3T2QA 1PKQA 2AV1B 4MJIA 1PSKH 2NW3A 2AK4B 1T0NA 4NQDB 5D2LF 5MEOB 5FO8A 5FO9A 4FNLL 3PGCB 4PLKD 4MGXA 5K33A 4N5ED 3G08A 5DD1L 2IFFL 3BEVB 1JZ4A 2AK1L 5CJQL 3K8MA 1ZA3A 1H3TA 2CH8A 1ZEAL 5I73B 5JHLH 5DRZB 4LCYB 3MJ9L 4JE4B 4P46C 4YDJA 2L4OA 5I74B 1RZKL 5DJ8B 3UJJH 1Y6MR 3QQ9C 5J6GB 4MAUH 4ZOBA 4Z7OF 1U36A 4CVUA 1FO0B 1AD9B 2OTUB 1X6LA 2OK0H 2NY0B 4S2SB 1KGCE 3A67H 1FLRH 4R0LB 3BVNB 2XWBB 2RFXB 3QUXC 3TBWA 1R6VA 1V7NH 3LY6A 1VCAA 4HXBL 5LKNA 3DGGA 2Z35B 1BJ1J 1XIWC 4KAQH 4CUCA 3H8NA 1XH3B 1H3UA 1ZHLA 4NQDE 2YEZA 5JA8B 1EHLH 1HCFX 1JF1B 1H0DB 1VFOA 4MJ6A 1CCZA 2CK0L 1XGQB 4G8FA 1OTTD 1CGWA 4G80B 3QEQD 2HTKC 4FTVA 3B9AA 1LO3H 4GBXC 4YXKL 4KK6D 4BSVB 1ZGLM 3S8WA 4QXUH 4Y0GA 4ZAKA 4EIZC 2EEBA 2A6KB 4WWKD 2J7LA 2E7LC 2HJKB 3I02B 2DF3A 2NY1D 2XKNB 2HRLA 3HRZA 1KACB 4X7TB 4UV7L 5E9DA 3HUJF 5IJKA 1GZPB 4HPOH 1OSPH 1P84J 1U8LA 3IGAB 1XF1A 3IFOA 3CZFA 4LLAA 3VI3F 4L4VA 2GJZB 2UVFA 4D2NA 3SO5A 4XXCA 4YEFA 4YQXH 5E6IA 4R7NB 2Z8RA 1II4E 4R3SB 3HE7D 3RZCD 4RNRB 4BQ9A 3ECBB 3CCHA 4ZQKA 1DQQB 2BVPA 1EHAA 5MENB 1IARB 4XCFL 1OAQH 5HDQL 5DMGD 1BQHG 4YK4C 2BCKA 4Y5VA 3MLSH 1I7RA 2QADD 5C0AA 5KAQG 5EZLB 2YPVH 4HS3B 5F93C 5BVPL 1RUQH 2J12B 4XX1G 2AXFB 2YOCA 5JW4N 4QKXB 3IYLW 2JIXD 1QR1A 4GQPH 3STLB 1TTFA 2I07B 3SCMB 2DWEA 3OXRA 4OCXH 1WWCA 2VXSL 3V0VA 1UWEL 4J3OC 3MV9E 1S7VB 3C5ZB 3KPMB 4P5MB 2FJHB 2CDGB 2JKXA 1SM3L 3HLAB 3IT8D 4Q9RH 1M7XA 3WFEH 5KSAD 3MRMA 4I0PA 3NCYP 5DHVB 3P77B 2AERT 4PJDF 3WXVH 3GI8H 5SWZB 4LIQE 3OAZK 3EIFA 3GMMB 3O4LE 5TQ2L 3MOQA 1LO4L 2BXYA 2PO6D 4MDJA 2APFA 2PTTA 2F54E 3L1OH 3MZTA 4QOKE 4YUEL 1KCVL 5DI8A 4OM1L 1UM4H 1RU9L 2DQUL 3X14A 2DQTH 1GH7A 5I1JL 3FRPG 1G6VK 3STZA 1T2JA 4ISVA 3JV6A 2NMSA 3QZWB 2BVUA 1HSBB 2ENSA 5DC9B 2PUQT 3F12A 4NQEA 3T0ED 1QD0A 1T1YA 3O2DA 4Z7NF 2Y07H 1FCCA 4ZFZA 1MH5B 5L6YH 4OD2A 1J1XL 8CGTA 4R4FH 3W81A 2Q7YA 1I9JL 1Y0LB 2IAMC 4NQCA 5E8DL 5DEFB 2B1HL 3CFJA 4X6CF 1F11B 2AABH 4Y5XC 3ZTJH 5KZCD 1Z5LA 3SE3C 1DBMH 3D3VA 3DX9B 4GS7B 5IMOA 1FNAA 1J1OH 4LSRH 2I9TA 5EORL 4WGWB 1KCLA 1CIUA 1P7QA 4PPTA 1P4LB 4TTDC 4YHKH 4HK0A 1MY5A 4OGAC 4M1CC 4QRPB 4AMKL 4JFEE 5HHPA 3QSKB 1OB1A 4IJ3C 5HYSB 4NJ9L 2D0GA 5ADPL 4X0KA 3OR7B 5CIPB 4JFHE 4JCLA 2VO5A 1EDQA 3KJ6H 5AAMA 2WK2A 3H42L 1Q9WA 4HKJA 2X70B 4Y16D 3MRFA 2BOCB 1T66D 4KUCF 2YSSA 3MRMB 3KYKH 4LSVL 4H5SA 1KJ2H 1XEDA 1IAOB 5GPRA 2EDDA 2IPUK 4H26A 4S1SH 1JMZA 4TRPH 2GJ6B 3P11L 1SMAA 2XQYG 3C5ZA 3KPMA 1KJMB 3U36B 3ZL4L 5GS0C 2FX7L 2VUOA 2BHZA 1JPTL 4ODXA 5CZVH 2ORBL 3LIZH 5I1EH 5I1GH 1DQJA 1TJHH 5FDWA 4MJIE 3C6LD 4W4NA 4YK4B 3O2VH 3V4VL 2C3HA 3VWKB 4WO4A 5C0CD 4HH9B 3CLFH 5C7XH 2Q76A 1J88A 4DQOL 3Q5TA 2BCKB 5CP3A 1S9XA 5JR1H 4LLDA 4ZSOB 4ACPA 1WTGT 3MRBB 4ODTL 2ATPB 3U4EA 4QF1A 2G5BB 1JHKL 1V3JA 1RUQL 1DE4A 3MBEA 3VDAA 5KVMC 1HE7A 3P4MA 1KENH 4HULB 3HFML 5TGBA 3ARFC 4PJ5A 1GIGH 5FUCC 1NEZG 1UWEH 4ODSL 3ARVA 3O11A 3CMGA 3WFDH 1U42A 4CBPA 3JVGC 4HX1A 1U8LB 2EDKA 2R56H 3RKDC 1IMHC 3HPLB 4E41D 5DRWA 4KKNA 4U6VH 3M17A 3MUGB 2P1YA 3VRJB 2ADIB 1KIUA 2EXYC 3MV8B 4WHDA 2HFTA 3FFDB 2B0SL 2R23A 1M7DB 1BLNB 4FFZH 1YEFH 2AQ2A 3UZEA 5CD3B 1KCVH 5EB9A 2B20A 3IJSA 4Z76B 2E9WA 4R96B 4X4ME 4PJEE 4PRPE 2MNUA 3IFNL 3QQ3B 4JREC 4KK5C 3W9DB 1FVEA 3MUHL 4RMTA 5AEAA 4ZNEA 4L8BA 1XIWA 4PRAB 3MBXL 1R3HA 4P9HH 1XGUB 3S4SA 4YHML 4JPKL 4LLMB 5JOEA 2Y7QA 3EYUL 4OJFL 1IGMH 4H88L 4DVRL 5DHYA 2CKBL 2H3NA 1MCHA 3KJ4B 1KEGL 5L2KD 5I8CA 3KYOB 1V7ML 5T3XL 5EUOA 4ZFZB 5IB5B 3DETD 4QNPE 4BSWB 3LB6C 1W8OA 3RWEA 2AK4D 1X44A 4RMUA 1I9IL 2A6KA 2MKLC 1LGVA 2J2ZA 1QFOA 2NX5D 5F7DA 1FC2D 1HQRA 4AMKH 3WLWD 5FYKD 5ID0A 2JIXA 4CDGC 2C5DC 5IIEB 3CIQA 1CGVA 4YR6B 2SEBB 3K80A 1EGJL 4EQ3A 2VSDA 1FBIL 4M1GH 3LS4H 4P23A 1TCMA 4IMKC 4FMFA 1NMCB 3QIUD 3VRLE 4HIEB 1XH3A 2B1AL 5EIIB 4JANA 5I1AA 1MVUB 3NFPA 5AG8A 2VAAB 4FTVE 1FSKB 2EIEA 4ZOEA 4LCCB 4LSVH 4NZJA 4XZUB 2PW2B 2IALA 5FUZL 5C6TL 2DN7A 3AY4A 4UNTA 4MDIB 2ZUWA 5FHAH 1VKXA 2FX7H 3LKSA 5KVDH 5ECJE 3C5JB 3TN0A 1LEGA 2DQFA 1QNZH 2LU7A 2ORBH 1XR9B 4XXCC 3K4AA 1CYGA 3LN9A 1HNFA 4CNIA 4Y4FA 3BKML 3RWHB 2OJZL 1RUKH 2LTQB 4Z8FH 1ED3A 4PJIF 4JO3L 3JUZA 2QADB 4L8SA 3VH8A 5FKPB 1I85A 4L4VE 3RX8A 2DQGH 4KK6C 1KTDA 5ITFA 4ZFOL 4R4NC 3MRBA 3UBXI 5D8JH 5EOCL 3RA7H 4PTUB 2BZDA 3Q3GA 4GKZB 1JWMB 3R4DA 4Z7UE 1QFWL 4JJ5B 1YNKH 5EUKB 1JHKH 5C0BB 3REVA 2A6JB 1Z9MA 3LCYA 3VXUD 4C83A 1P7KA 2VWEC 2CMRL 3BPLB 3QPXL 1DR9A 1GIGL 4GRWH 1QHPA 2A74A 1PJ9A 2BDNL 3HRPA 2RBLA 1SYVA 2A1WL 1UJ3A 3QXTA 5T1DL 1PAMA 4OLYH 3NH7H 5FYJH 4Y16B 1RVFL 1J87A 4HIHA 1IKFL 1UC6A 5L8JB 3U0TA 5IKCA 4HAFA 5CJQH 5MP6H 3KLHD 4CL7A 4MQXC 2DRUA 4LARL 3O3AA 1B2WL 1JHLL 4P46D 4L8CA 4PJFB 5IEKA 3UTQB 3FQWB 2R4SH 1PG7X 5ETUB 1QFPA 2YXMA 1UM5L 3QEQA 3RX5A 2E7MA 3RJDA 4JRYA 3RI5F 4O9HH 4Z0XA 1MFCL 5F1NA 4M9OA 4AJ0A 4ORGA 1UH3A 2HN7A 4YNYB 5GHWH 1JGLH 5F1SA 3C8KB 1FGNH 1I8IA 5EN2B 3RUGF 5GRWA 3QNZB 1S9KC 4NO5B 4HXBH 4CDHA 1YPZE 1UGNA 3F7VB 5L2KB 3TT1H 4ODVL 1K8DB 1ZT7B 4MXVF 2EDFA 1R0AL 5DUPL 5E8PA 2XTJB 5L9DL 5D96B 3D2UB 4GQ9H 1KT2A 3GBNL 4V1DE 5HYEA 2A38A 4EI6A 1OAUL 5L8KB 1GHFL 1XGYL 4HUKB 3QIWD 3IVKB 4K8RL 1PX4A 3DWTA 4OIIH 3W5MA 3P9MB 3OHXA 1HHKA 1IAII 2YA2A 4M8QB 4V2BA 4E5XB 1KIPB 3DX7A 5J11B 4FXLA 3DOSA 2X1OA 3UTSD 4Z76A 5DRNB 2X4RB 2Z8WC 3WS3A 1T0NB 5MEOA 2Z93B 3MJ6A 5TF1L 3O8XC 2FATH 4O2FB 5D7JD 2HLFC 1FL5A 5INCB 3DXAA 3C60A 1JGEA 4RFNC 1F02I 5B38A 5E24E 3QRGH 4HH8A 3FN0L 5T1LA 4GG8B 2H6PB 4ZO8A 1CFTB 5CGTA 2P47B 4OFPA 5D7IB 5IVXE 3OSKA 3VA6A 1A6VH 1B4RA 2XTJE 5DLMH 3K46A 3FRUB 3TYFB 1BFVH 1CE1H 3L7FA 4ZXBB 1AP2B 5KVDL 3NOIA 4AIXA 4TNVF 1GOFA 5H94A 1YEKH 4NC0B 4JRYD 4PJXE 1DCLA 4KY1L 4PRAA 2ERJB 3BKMH 5D1XB 4GRWF 4WFHD 4XBGB 5DJCA 3UDWA 4KUZH 5HI4D 4E0RA 4JO3H 1J5OL 5I8EA 2VE6A 1EA9C 2HFEB 4I4WA 3FAXA 4FQ2H 5F7WC 3QCVH 2ZJSH 4XRCA 2ITCB 5AAWA 3RRQA 1MREH 3MRNA 5DVNA 3KPQA 5MEPB 1HCVA 2EYSB 3UJIL 1IC7H 4WUUA 2GJ6E 3M17B 5B3NA 3DRQA 4LSUL 4YWGH 3MLWL 4XHJC 1IEHA 4WV1B 3MGAA 4J4PA 5GJTL 4W6WB 5CHNA 5M94B 3JZ7A 1FZKA 3QFJE 3HUJA 1KXTB 4JZJB 2O61A 4CMHC 5MHSE 5DEGB 2GJ6D 4JVWA 1UCTA 3O2WL 4XC1H 2L7JA 4WY7L 4NRZB 1L7IH 2WINB 5CHNB 4KVCH 2CRYA 1EJOL 4NWUH 4X83A 4M6AA 4OD3L 1YC8A 4N90D 2DB8A 5LBSL 3UTOA 3C2AH 5D2NC 3I6LE 1S7TB 1WZMA 4JFOA 2FX9L 2VDNH 2MPAH 4UINH 3L5WB 3BP7A 1HHHA 4J8RA 2ZUVA 3IDGB 4PB0L 3B5GA 1ZE3C 4XWGH 4G8FB 1XGQA 1JJUA 4WWID 3ARGA 2OMNA 4QRQB 1HOCA 1NCBL 1S7TA 1W2KT 2FIKB 4I3RL 3ZKNC 4CU6A 3DSFL 4L8DA 1VFMA 1EMTL 2AJ3A 1T2QL 3PHSA 4LBEA 3IDGA 2JCCA 3C08L 4PRPA 4X8JB 1T89C 3TIDA 4DFHA 4M6NH 5FV1L 3VG0H 3F65A 1C16B 2M2DA 4HAGA 1AGCB 4XWOD 2V9QA 1LE9A 4HV8A 4EI5A 3SQBA 3IXAA 4MNHA 1CLYH 4FABH 3CZFB 1OGTA 5ESQB 3D39D 5F7EL 3QJFA 4RAHA 3SDYL 1F4AA 1GGBL 4FXGA 5SWSD 1A8JH 1KN4H 3AAZA 1OTSD 4PV9B 4EI5B 1T1XB 3V5HB 1KFAL 3CU1A 4X6BA 2KPNA 4NN7C 5IB1B 5TE4L 3BPLC 3BIAX 2ZOKB 5TE6H 5JXEC 5JTWA 1KCSL 1CLOH 3ARTA 4D9QD 5FA4B 4O51B 4PJIA 4DUXA 4BQBA 3E2HC 3GMOB 4XC3L 3VJ6B 1S7XB 3F7QA 4KU1A 2CKBA 3OR6B 4EI6B 3NN8A 3KPLB 1RV6X 1MFEL 5I8OL 3HNVH 4LEXL 4K3EL 1HH6A 1ZHNA 4XNXL 1L4IA 4C54A 3KLAA 1VACA 1EBPA 4OBSA 2XT1B 2A2QT 5E7BA 2IAND 3QYCA 2BFVL 5A40E 4I0PD 2EZ0C 1JZ7A 5D1XD 1YQ2A 1G6RB 2BHYA 3TA3B 1CD9B 4JG0H 2XTJD 3VWJD 4YX2H 3MGTA 5HXMA 3C60B 1WT5C 1EIBA 4MLIA 2F53D 4EUPH 1S7RA 5DMIL 1ZHKA 2RJMA 5DSCA 5CCKH 4HXAH 2WIIB 1MREL 2ZSVB 5I1IH 2XRAL 3IB4A 2D31A 2NY5H 2Z93A 4N8CH 4U6VL 3JTSA 4LPCA 5D71H 3BEWA 1SJXA 1A6WH 1PG7H 1UM6L 4WW2A 5ICXA 2ESVB 3QIBD 3GHBL 2VKWA 4XCYA 1IM9B 5ILTL 4RZCB 4UOW0 1TCRA 1RQ5A 5DYOA 2EE3A 3IRPX 1MCJA 5IMKB 1QR1B 1KB5A 2J8HA 5T3ZL 1IT9H 5E2UH 2OTPA 1FGVH 2I5YL 4NO5A 4O2EB 5ENWA 2XZCL 2PR4H 4B0MM 4OSUL 1KC5H 3I50H 3RVVD 3MOBH 5J13B 1MAML 3T0EB 3RHWK 4JFZH 4Q0XH 4ELME 5T1MB 3E1F1 1VA9A 4O02L 1TZGL 2HJFA 1R3LB 3FCTB 4PB0H 1MPAH 2HVKB 3W11C 1GAFL 5EC2B 1V7MH 1PVHA 1ZLVH 2BNQE 4OUUB 3CFBB 1NAKH 1ZVSB 4P4RB 2R4RL 4QXGL 4EIGB 1A7NL 4ONFL 4KFZC 4L9LA 3PGFH 3SDDA 1CT8A 3P0YL 1BEYL 2IBGA 4PV8A 3NZHH 5CJXA 3NACL 4POYA 1NCNA 1T04B 1VHPA 5HPOA 3DV6A 5I8KH 3CXHK 1R24B 4LVOB 1HSAB 2YK1L 4NCDA 3SY0A 2MTPA 4O00A 1F3JA 5F88B 1KXQE 4ZD3L 4G6KL 2GSGB 1D5ZA 5DURB 1JWUB 4N0UB 3EOBB 2D4DA 4KTYA 2V7HA 3MRKB 5ANMA 2D7NA 5EBLB 4YO0B 5T33L 2WM0A 1QACA 1E27A 3ARWA 3O4LB 1DLHA 2K7PA 4RMQA 2IPTL 4L29B 2YKLH 1DSFL 4GH7B 4Y8AA 4XPAL 3KPPA 1VADB 5CWSA 1K6QH 4YXHH 1ERNA 5FUZH 3MYJA 5DJXA 4HKXA 2V7NB 4JM2D 1OSZB 1QSFE 1N2RA 3CVHA 4XC3H 3DV4B 4G9DB 4GW5B 5EBWA 3DARA 4Y4FB 3MRIA 4JZJC 4U6XB 2Y5EA 3L3DB 5F9WC 5GRJH 5LAXA 5HY9B 1OAZH 3D48R 4XNXH 3DURA 4FQQA 3CFEA 5F89B 1BQSA 3S3SA 2V5SA 1BVLA 2BVOA 4O4YL 1G6RA 3TA3A 1ND0B 1CIDA 3G5VA 3ZDXE 4GXVH 4PJBE 5C0IA 4YC2C 4AEHH 4LU5H 1N6VA 1J86A 2DDQH 3UYPA 1YN6A 3LKQA 4YX2L 1CFTA 3TWCL 2PXYB 4I2XB 3UZVB 2D9CA 3RWFA 5EIQA 1MAKA 3MPCA 3ALPA 1RIUH 2VH5H 4R7DA 4RWHA 2QR0A 5E6YA 2A1WH 1IC5L 1K2DB 3AFLA 3BQUD 3P4LA 4HC1H 4E41B 2GT9B 5FA4A 3HAEB 4LASH 4OFIA 3EDKA 1AGEB 1I3GH 1D3CA 4KI5C 2BOBA 1R5WB 1PG7L 1PLGH 3HPLA 4PJHA 5DUML 4NO0A 1KTLB 5E5RB 3SDAA 8FABB 2UUDK 1R3KA 4YE4H 1QG3A 5C0AD 3S34L 3KYOA 1I75A 3C6LA 2UZYB 1FGVL 3WHXB 4PJBB 3UYOD 1U8PB 1NDGB 1SVCP 4EOWH 2C4FT 5IROC 4C58B 4CN4A 2VJXA 1HINH 5IT2L 1TVBA 1U8JA 5BJTA 1WAAA 2VR5A 3OXSA 4JKLA 4L3CB 4XPFH 3RZCA 3E6FB 3IS0X 1JTPA 5DHYB 3TT1L 2HFFA 4NUJA 2XA3A 1CICD 4FZ8H 4X6CB 4DN3L 3NPSB 1G9ML 5JPMB 4LBEB 2W65A 4ORGB 3VXOB 3QG7H 4HKXB 1J1PL 3C60D 2B2XH 5HYJA 3BZEB 4LDLB 1E0OB 4JHBA 4LPVA 1VADA 1FVEB 4D9LH 4WW1A 1G84A 4WW2F 3VRIA 4M5ZH 1BEYH 1FC1A 3WEXB 3PV7A 4JFDA 4WWKA 4K8RH 1JHTA 2GSIB 4J8RB 4G7VL 4IMKA 2AJXH 2APBA 1P7QD 2IGFH 4XVTH 3LEYL 5GGTH 1LNUA 1WZ1L 1G7JB 5IBTL 1G7QB 2W38A 4JGUA 3KLDA 1ZTXL 4M00A 3SJVA 4XX1E 1ND0A 3G5VB 5C9KA 1F3DJ 2P5EB 4HMCA 3T8XA 2YN5A 1OGAA 3B2UC 1EEUA 3L95A 1MJJB 4U1MA 4GMSH 3U82B 4ZUWB 3H3PH 4NGHL 5GGVY 4TSAL 4WFHE 4LLDB 4M6ML 4K71C 1MJUL 2ZUUA 3ARQA 4NJAL 1CE6A 2FR4B 1CE1L 3NFNA 5EOCJ 3V4PL 5AWNH 4NC2B 1NFDB 4MQ7A 3BJLA 2X4NA 4KH2A 2NPLX 5F6IC 4LAQL 3TCXA 1YEKL 3H9HA 2LAAA 2YPLA 5JOFB 1CK0L 1YYML 1U3JA 2YHGA 2EKSA 2AEWA 2PYEA 2K9UA 4M62H 3CLEH 5FYJU 1JZ5A 4PTTA 5IG7A 3FO1A 2MFNA 3VFRB 2HJLA 4LL9A 4X7EC 3DXAD 1Q8MA 4MSWA 1XF4A 4FA8A 5T3XE 1NBYA 3DUSB 3LRSA 2UZIH 5C09D 4CVWA 1VKXB 5DA0B 5KSAA 5BOZG 4NFDA 2CDEB 5HHMD 3VXUB 5EA0H 1U8QB 3MLWH 3HE6C 4ELMA 4NN7B 3ALXA 4XVSL 4PV8B 1RIUL 3TO4D 3VXSB 5FDYA 5CEYA 1GGUA 3BGMA 2QSCH 2PTTB 1IGFL 1T89A 3N85L 2EICA 2XACC 5DQDL 4PRBB 1TQCB 4LNRA 3O2WH 1CXHA 3C87A 3IJYA 1SJEB 2A9MH 4HGMA 5FM8A 1YMMD 4U1NB 1KTRL 2R69H 3O9WD 4U6YA 4NKIH 1CZ8H 4E9LA 4ZO6A 1M6OA 5DUMH 1FRGL 1U3HC 2DJ4A 2WQ8A 4JM2B 4U4BA 5FV2A 2MPAL 4UINL 1LMKA 3T2PA 3PIQB 5DFTA 1IVLA 3JUYA 3FB5B 2NY3C 3WSQL 4RGNB 1DQMH 5JW4M 1L9NA 3BPOC 4XNZB 1LO2H 2HH0H 4ETYA 3MNZB 4OBRA 1IL1A 1DUZB 1NCBH 2IWGA 3A6CL 5CGYC 3ZE2F 1RK1A 3RDTB 5MEQB 4I2XE 3QQNA 2R0ZH 3LZFH 4G9FE 3DYOA 3R06A 2MQCA 4OZGB 1QP1A 3F7VA 3LHPL 5FUOH 3MCLH 2F19L 5JQHC 3BW9B 1HSBA 3DTXA 3MGOA 3O41B 4JDVA 3CCHB 4W4OA 2KQNA 1H8NA 2M1KA 4B5EA 4D9LL 5HHME 1DQLH 3DI2B 1N3NA 2HN7B 1EUTA 2MCPH 1EH9A 1UCBH 2UWEB 3DPBA 5CIPA 3NIDE 5CAYB 2C4FU 2GTWA 1WQVT 1AKJB 3E6HB 4G7VH 1NGZA 5DR5H 3ZE0F 4JB9H 1C08B 1E6JL 1S5HA 2IGFL 3MCKB 1NBVH 1UENA 2HKHH 3O4LD 4GXUN 4PRIE 4XVTL 5M95B 3VD3A 3Q0HA 3L3GA 1KIPA 2L7UA 1ZEAH 4OT1L 5E1AA 3O3EA 2A6IB 3U4BL 2R0KH 4GMTL 5TE6L 3BISA 4NCC2 3P4OB 1C7TA 3KNBB 5EWIH 5I1HL 4NNPH 5KSBB 2CXKA 4JQVA 4ZO7A 1YEGL 2VLJE 3EKCA 4LLUB 1QBMH 5IBLC 1R5VA 1TTUA 4X5WB 4BA8A 4LNVA 5C0AB 4ZFOB 3VGFA 3VRIB 1EAPA 1GGIH 3DURB 4DW2H 5K9KB 2MHAA 3DUHA 2I25N 3I2CH 3L3IA 4Y4FD 4LEXH 1JZ2A 3D39A 1EO5A 4G9FD 4ODWA 4NHUB 4ZXBD 4FQPA 4O51A 4MB3A 5H8DA 5IJVB 3VXOA 4A2LA 1S9XB 1FL6A 4P57A 4TNWF 4M48L 4NYLA 4F9LA 2K1MA 4GSDH 1F58L 4C56A 3LS5L 2ZG2A 4NKDB 3S6CA 4YFDB 3AAZB 3RWJA 4MJID 4YBLB 4GW1A 2H32A 4W4OC 3ROOB 1CFVL 2AEIT 1IC4L 1FNEB 1CDGA 3VFNB 5FGBA 4MA8H 2DJSA 5DK2A 4KHTL 1CICA 1OTUD 4JY5L 4D9QE 3GB7A 4U1MB 3WS6A 1M71B 1C16A 3KPSD 4LLVA 2BOCA 3MRFB 2Q20A 1ES0B 1HH9A 3HNTH 2D0HA 2ZUYA 4C4KT 4WWKB 3ILPA 1LO0L 3UTSB 1W0WB 2CUIA 3GIZH 1V05A 5SX5H 1YMHB 2CGRL 4LCUA 4DGIH 2CLRA 1U2CA 5IQ7L 3SDAD 2BJML 5J8OA 4DGYL 2BNQD 5IOPB 3RWFB 2NY3B 5F97E 1FRGH 4N1CA 3RZCB 1HI6A 5D7IE 5FA3A 4AT6A 3FQTA 3LKRA 2VB5A 3K2MC 1KPVB 3NIGE 4MA1B 1OTUC 2W65B 1OM3H 4XBEL 3WD5L 4O02H 3AU1A 1ODAA 1IGCL 1OP9A 1JPFB 4L3CA 4U7SA 3QIUA 2IANA 4KQ3H 2XZAH 1QTYT 4DWHA 1UFUA 1QLFB 3N1FC 3LQAL 3C6SA 4FQLL 1A5FH 3L3JA 1A14H 3T0AA 2I9LA 4GKSA 4NKMA 3SBWC 4Q9RL 4NZUL 4OFYA 5DJAB 3MCLL 4WV1A 2OR9L 1R5IB 2VZTA 2JJTC 2VSCA 3CSBA 5IFJA 4HUUA 4YHIA 2XV6B 1DQLL 3GSQA 5GS1A 3SGEI 3HC3L 2ARJA 2FL5B 2Y6SC 5CJBA 5AZ2L 3DRTB 1NUNB 4L29A 4TVPD 4S1QH 5HHQB 3HPJA 4FXKB 1NDMB 2WUCL 1ETZB 1FE8H 2HT3D 4PRID 3MJ7B 3MXVL 5D93B 1MRFL 1OGAD 3RWDA 3GFUA 4ALAL 3F58H 1DDHA 4JG1H 1BAFL 4X4XA 1PZUB 2A6DA 1UB5A 1Z3GL 1OCWL 2VDPH 4BFIA 3OAUL 4FQXA 2VLME 3UAJC 1SY6H 4KDTA 4OD1L 2Q3AA 1OVZA 1I1AB 1QBML 1JWSB 1CQYA 1U93A 5JIPA 3MV7D 1KSRA 1YC7A 5D7LD 4CMHB 1H9VA 3BUYB 5HGHB 1F45A 2OTUA 1IQWH 4ZUVB 1A6PA 1OAZL 1BZ9B 2FGWH 2R0WH 1OGAE 1U8NA 1GOGA 1WIPA 3BAEL 4ETQB 3CJJA 2C1OB 3DX6B 4YHYB 1FCGA 5JZ7C 4LLQB 1N6QH 4JY4A 2VXVL 4UILH 4PJIB 3RTQD 2P8MB 4AEHL 6FABL 2YWZA 3SQOH 3U7WH 1FP5A 2C3VB 3V2AR 3TWCH 3OKLB 1PKOA 1RHFA 5HD8C 1QSZA 1HIML 5D2NE 5TFSL 2VXUL 5JOPD 5DUBB 4XP4H 3HR5B 3KPPB 4KHTH 1T4KB 3IAPA 2GJJA 1IC5H 1QBLL 4BM7A 2OX5A 3IFLL 4U6HA 3MRPB 5GRVL 4Y19E 3VFVA 4I2XA 3GNMH 3C6SB 4TRPL 1YJDC 3KS0J 1WLHA 3CXHJ 1RIVL 3HNTL 2E5EA 3ZDYE 1YQVH 4N5UA 4Z7UB 1CT8B 1IGJB 3GJFB 5TPWL 5DTFA 1CR9L 5C0NC 2VXTH 4YNYA 5C07D 3ROOA 1KJ3H 1B3JA 5IQ7H 1FFOA 4G6ML 1YECL 4X0KB 1BBDH 2RGSA 3R1GL 5FXCH 2AI0H 1ZVHA 1N7ML 3GSXA 3H9SB 2DQEH 3P9WB 5CEZH 1I4FA 2VLKB 3OKMA 5C3LD 1U3YA 5C07E 3PDOB 1U91A 4XPFL 3BD3A 2DM3A 2H8PB 2VR9A 1U93B 3W0WA 4HJGA 4DN3H 3PWPB 5IEHB 5HYQA 5EO0A 3EOYG 4NRYB 5IUSA 4FQLH 4U1HB 4ODSH 2A6DB 2CO6B 2KZWA 2GAZA 5C92A 4PJAF 2NY1C 5HHVH 4WTWA 1FG2A 3EYVA 3ULUL 5I30H 3W5NA 1RZFH 2AJXL 2IFFH 4ZS6D 3VDCA 4DN4H 3SKJH 1IZKA 5F88A 1A4KA 2ARJB 1A2YB 1XZ0B 4ZTOH 2CQVA 4YBLC 2OQJA 2VDLL 1XCTA 1D6VH 3QFDB 4Y2DA 3EO9L 4LGPB 4MYWB 3QRFM 3CGTA 4RAVB 5GS0L 1J0ZA 3WFZA 5IW6B 1TZIB 4ODUB 5TDPA 3KDMB 1TJIH 2WUCH 4L8SB 3BP5B 3RVUC 4JN1L 3RWEB 5KSVA 2WWKT 2NX5E 2P5WA 4PRHE 3KLHC 3ULUE 4UV4H 1OAYH 3ARUA 4G9FB 2HVKA 3N9GH 1QLRA 4R90H 3ARBA 2E3VA 2MHAB 5F44A 1I1AA 5T1MA 1J0IA 3IXTB 1SYSB 2IANB 3MGTB 3FFCE 4JQVC 1FVDA 4BFGA 1JGDA 3SE8L 5D7LB 3S36H 5F9WB 4NP4L 4XH2A 2AJYL 3TBVA 1P6FA 3S35X 3BP4B 1F4HA 4NQVA 4YPJA 4LK4A 4AT6B 3I3EA 3O3EB 1KCKA 2ICES 2LTQC 2LABA 1KB5B 3MJ7A 3O6ML 5IMLB 1DUYA 3EHBD 1RJYB 4KV5F 5CP3H 2UYLA 1FNGA 3AC0A 3C8HA 3W9EA 4F7MB 2Z31A 5FB8A 5ICXB 1BBJB 5DWUL 5E9DD 1FL3B 3FN9A 1U8IA 4TN9A 5C0BD 3VGHA 1OAXL 4NN5B 1FZJA 1J8KA 2IBZX 3KXFA 2R8SL 4EEEA 1MWAA 3DX7B 4NT6B 3VXRD 4BUGA 3LS4L 4MQXD 1CVRA 1IILE 2ZZUT 5DURD 1GSMA 2D9QB 1AQKH 2B1AH 3CDGA 3Q6GH 3MOAL 3IFLH 2EXWD 1A9BB 1AXIB 1JMXA 5DHVA 2YZ8A 4X7CC 4Y5XA 1DFBH 4UNVA 2EYTB 1LILA 5ISZE 4PJGE 4UQ2B 2F8VA 3EJYD 4OQTL 1HQ4A 5ACMA 5FHAL 4UUJB 3RIFK 1TZHA 4WI8A 4KI5D 3HNSH 1IKNC 2DWEB 2Y36L 3OXRB 3FT3A 3PJSA 5J13C 3IDMB 2W60B 5EU3A 3B9EA 4LLYA 4XPGL 3OKMB 2HFEA 1M6OB 2EKSB 4J12A 5F1NB 2DBJA 5D5MB 4PR5A 4HWZB 3U4AA 1RZIB 2C7UB 4LF3A 3BPNB 1NCWL 3WLBB 1KV3A 3RY6A 3D6GA 3BYYA 3V52L 3NPSC 2Q87A 1IEAA 3U1SL 2EDLA 2DLHA 4EVNB 1XMWA 3JWOC 3QUYD 4ZQKB 5FUOL 1VGKB 1XR8A 4AG4L 2JELL 3MCG1 2AKRA 3MROB 4X5LA 5KJRH 4PRNA 5HYSG 5KS9A 4UB0L 4HX1B 4MD5B 2BDNH 4ZNEE 3TPUA 4I9WE 4HQQL 3RIFF 3V6BR 3RU8H 7FABH 4HKJB 1DLFL 4S11A 3MTRA 4LHQB 3MLRL 3QFJD 5ESAA 1N26A 1MJ7H 1VPOH 3V8CA 4YHYC 3IDNA 1ZSDA 4MVBD 5ALCH 3AB0C 1FZJB 3VFRA 5EUOE 3MLXL 3OJMB 4I77H 3W0WB 5IR1A 4WHYH 2YD5A 1J0YA 3SKMB 1AFVL 5EUKA 1UM5H 2ITCA 3W9EB 4F7MA 2DL9A 4GRLC 2QLVB 4TYUA 5DJ0A 2XIDA 1I4FB 4R4FL 4X99A 3IDXH 5C07B 4QRQA 4LLQA 4NQXA 3QH3B 1H5BA 2WLZA 3GRWL 5DJCB 1B0RB 3BZDA 4P2RB 4NDMB 1UADC 4WFED 1FGNL 2XFXA 3NAAH 3FO2A 3HE6A 4HIIA 4KI5F 3MLZL 5C6PB 2MQ0A 2CDFB 3VD7A 5IFAL 3V4UH 3GDBA 1L6ZA 1J1OL 3FRUA 4PGDB 3GSWA 2XWTB 1EXUA 1FDLH 4BKLB 1UWXK 5CD5D 3MLPA 1CDCA 4HDIB 4GRWB 2AJSL 1CI5A 1JNHB 4JPIB 3HC4H 3PP4H 5KVEH 4UDUB 2F9BT 3VA2C 2WBWB 3EOAB 2P5WB 2NZIA 3O6FB 2FO4A 3OR7A 1IC4H 3GK8H 3WUZA 4QTHB 2P48B 1JPGB 4HWNA 4KROB 2VZ3A 4MQTB 4QGYA 3FB8A 4WNQA 1P2CA 1E28B 5GSRA 1UT9A 2C3WA 5CSGA 1KB5H 5JPNA 2FATL 4UQ3A 2AS5M 5IHZB 1Z5LB 2N7AA 5F7DB 2X4TB 1UACL 2BX5A 2HWZL 3LH2H 1A02N 2G60L 4QRRD 1NEZA 1ORQB 1ZKAA 3DBXB 2CGRH 4PJ9B 4OFKA 3RDTA 3QXVA 5A2KH 4M7LH 1IAIH 1MLCA 2QBWA 4OLXL 1T20A 4OLEA 4K2UL 4MNQE 4WCYH 1MCDA 3RL2A 4PJ7F 5BZDB 3BWAB 1S7WB 1AXTL 4RWYL 1T03H 5IEHA 1JGUL 3QDMB 5DJDA 5J56B 4PTTB 4ZOAA 5HGBA 3H9SD 4JVUA 2Q8BL 3OZ9L 4QOKB 1KOAA 3QWOB 5EN2A 3SE4C 1S9YA 5LVEA 2LVCA 2DBLH 4RGOH 4KMTL 4LLMA 2LAGB 3TV3H 3T77A 3MMEB 1GGCL 4K7PY 4WTZG 4X9BA 5E94A 1HKLL 1U9KA 3MRJA 4YFEA 1SJEA 2W0LA 2D7OA 3SDDD 4NQCD 5I17B 4KJQC 1RIHL 3S9DB 5J12C 3ZE2E 1QOKA 2QKIA 4OUOA 4Y4HC 3RL1B 5F7YC 3AY4C 3AS1A 3G6JB 2NY0C 1WK0A 4JDZA 4NZUH 1WBXA 4NO2A 1ZGLA 4YWGL 4XCNA 5DMKA 4BZ1H 1CGTA 1IGTB 2WWMD 4LVNC 2XTJC 1S7VA 1T22A 3SPVA 4PJDE 2DWDA 1HHIA 7FABL 3NCJL 1N59A 3K2UL 4N1HB 2ENYA 4UOJA 4ZYKB 4AM0B 1RHHB 4HIEA 3U2SA 1E6OH 3ULVE 2NY5C 4YPGA 1YPZA 2ZUQC 2GQHA 3CVHH 1NCDL 2DLTA 3IKCB 5FM5O 3B9DA 4HJ0C 4KJQD 3VE0A 4PJFE 1FZOA 3IDJB 3QO1B 3U9PH 4QHUA 4E42A 4KROC 5JHLL 4G80A 4R2GC 3MLXH 4JPKH 4GW1B 2O93L 5JMRA 1CD1A 4LVEA 3AUVA 3BE1H 1VESA 4U1KA 3UJJL 1T04A 5HGAA 4ZUSB 2ATPA 1KYOJ 1OPGH 5J6HA 3KXFE 3QEUA 4I48B 4CU7A 4Y19B 2OK0L 5LGJA 2P8PB 1ED3B 1S8DB 1FLRL 3G5XB 4C55A 12E8H 4MHHI 4NFBA 5FECA 3DVGA 1C8PA 5EBMA 1DVFC 5A3IC 1I7ZA 2XQBL 3B5TA 3TNNB 4ONOA 4J23A 3L5XL 3MLVH 1A6UL 1QLFA 5C0ND 3BAEH 5IFAH 4KAQL 5K9KA 1RZ8A 2APVA 2NX5A 1XCQA 3NABH 4LP4A 2ZG1A 4CKVX 3LRGA 4DKAA 3KPNB 1C5DA 1MVUA 1MHEA 3NFPB 3BMVA 5TJWK 5IESH 4MHHG 3EOBA 1T7WA 1D5ZB 3VXME 4L8BB 1U8OB 2HVJA 4XNMA 5H35B 1M1SA 2DQCH 4XI5C 1TCRB 1MNUL 2UWEE 2XZQL 4AEEA 4X9IA 1KFAH 1BQLH 1K3ZA 3DJ9A 3WFCH 3RWJB 4KHXH 3T0DA 4KC3B 3IU4H 1KN2L 2UY6A 1KLFA 4ZDHA 3TNMA 5IFJB 4XHQA 3X12B 5JORB 2HAZA 1YQVL 2FBJL 3EO1A 1JWMA 4KI1A 4BZ2H 5IJVA 4Z78A 4D0DA 1U8HA 3TH4T 4BKLA 2XA8H 4NBZB 4NWTL 1YEDB 4NUGH 3LEVL 3LMJL 3PGDA 2XWJA 4G6MH 2PYED 4K2UH 1JRHI 2R1WB 2CDFA 1FNEA 5HGGS 1YJDH 4M93C 1Q72H 3G9AB 1KB9J 2EEDA 1PW3A 2XTLA 3RFZC 5GQBA 3MRRA 4WFGD 1KPUB 3OZ9H 1U92B 4L5FL 3EZ8A 5FFLA 3WXWL 1RHHA 1LQSR 2KKQA 5D1QB 1EX0A 4U6XA 3TV3L 1RUAH 4KKLD 1AGBB 3PWLB 4WFEE 4GKOA 2WBJB 4F7TA 1P6AB 5SV3A 3V7AG 3BHBB 5I0ZA 1F4WH 4HXAL 5J6HB 5I16B 2P5WD 1F4XH 3KHOA 3MBED 2AP2A 4JFFD 4U1KB 5HVHC 3O3UN 5JPNB 4BH7B 4UBDD 5GISH 3ARZA 2NY5L 2ZCKL 5GGTA 5IBUB 3WO3B 3IDIA 4BZ1L 1ES0A 1HH9B 2A77H 4JO1H 3ES6B 4HCRH 4TUKH 5MP6L 3SKJL 4PD4K 2CO7B 4LFHD 3OX8A 4N9OB 1MHPH 4Z95L 3MLTA 1K8IB 2CJUL 4R2GB 4KQ4H 3BZFA 4D0CA 3RWIA 3KPNA 4LPTA 5D93C 1KLUB 1MCNA 1D6EB 2G9HB 4U6TA 4Q6IB 1TDQA 1XCQB 3ZMRA 3QQ4B 5FO7A 2X05A 2BXZA 2FJGA 4MXWH 3U9PL 5HY9A 5LAXB 2G5BA 2P46B 5L0QC 3OJDA 1NKRA 4PLKC 4JRXD 1OPGL 5CSZA 1J8HD 1J1XH 1M05B 5CZXD 1A64A 3O8XD 3MRGB 1AGDB 4ZUSA 4X80L 1S5IH 5ERWA 2AV7B 1CGUA 2XY1A 5MENA 1YDPB 3LKNB 1BQHB 3BYTA 2XQBH 1GHFH 3G6AB 2M26A 5JQ6L 3NACH 3MRLA 3QXAB 4ODHH 5AG9A 5FDWB 3L9RA 1OW0A 2FO4B 4TVSa 1JI1A 1W0WA 2RCSH 3CSYB 5IESL 1U8QA 4Q9CA 1DP0A 1OAXH 5ADPH 2ZCLH 4N0UE 3GKWH 1ZWIB 3JXAA 1YPZF 1G7QA 4YHNB 2GUOA 1MNUH 3FB6A 4PJXB 4F37F 5JHDA 1F90L 2O5YH 2J8OA 2VWEE 3Q6GL 3NTCH 1I9RL 4L3EE 1ZVSA 5IG7B 3VRLF 3F6IA 4NC1E 4GBXD 1JV5B 1RULL 4LFHG 1HHGB 4V1DB 4KK9D 3VFPB 3AVEA 4Y4HA 3P11H 3K0WA 3QEGH 3S3JA 1UVQB 1B4JL 5ESVA 3BO8A 5I16A 1BGXH 4ZTPH 2Y36H 3DVNB 4NNXA 1DL7L 1FNLA 4WU5A 1T83C 5C08A 4HHAA 5ICZA 4LP5A 4JY6B 5D7LA 3LEVH 1XGRA 4QOKA 5A1AA 1YEHH 3LQMA 4HPYH 5JW4Q 5E6ZA 3KYMA 3T04D 3QO0A 4HKZA 2AXHA 3MFGB 1U8PA 2CRIA 3HZMB 2NXZD 4XVJH 1YNLL 5FM4A 3RVWC 4L5FH 1OGAB 3QQ4A 1NCWH 4NQCB 3EJZC 3WHE0 1A7RL 5EO9B 4NZDA 3O3DA 3S97C 4F58L 4ISVB 4MNQA 2CIIA 4PB9H 4MXQC 4AK1A 2VITB 4NZTL 1U8KB 4NQEB 4LOUC 3QFDA 1FV1B 1TITA 2D31B 2FHBA 4NQSA 3ZT7A 5FKAB 2YMXH 3UC0L 4A6YL 3PWUB 3T08A 1JUFA 2R56L 3EFFA 5DJZB 4A2MA 4HS6A 4ZDHB 2R9HC 5DVOA 3TNMB 3ARYA 4HUVA 2BY1A 2APWA 4D9RE 1NGZB 3THMH 4I5BB 3MA7B 1FG2B 3EYVB 2J5LB 5DS8B 2A77L 5EIVA 5JOPE 2ADGA 4M7JH 5I8EB 2G5RA 2AK4E 1AGBA 3PWLA 5DD0L 2FX9H 3BRFA 3IDMA 4YE4L 4OLZH 1PYWB 3MLYH 4FN0A 4UAOB 4G3YL 1I8LC 2DM4A 2FEEI 4F80A 2DOCA 1LNUB 2R1YA 3HLAA 2VRAA 3QXAA 4QHLA 5HHNB 2ATKA 1KEML 4AL8H 5M7QA 4LKCB 5DDHB 5DK3A 2MCG1 3CMOL 2YD7A 2L0DA 5E4EC 3P73A 4Q9BA 2PYEB 1AR2A 5D7JA 3DSFH 4UQ2A 1EMTH 4PFEA 5I71C 1NUGA 5L7XL 5B3JF 4LHUD 2DKSA 4WI9A 5ANME 2N1KA 3MV7E 2IH3B 1EHLL 4OZGF 1R5WA 4J3VA 4HUWA 4D0BA 3C8KA 3KDMA 4ODUA 2IQ9H 4FQHB 4LVNB 4PJAB 4HWBL 5J0BA 4Y1AD 1LO3L 3FAWA 3T65A 5ACZA 5D9SA 4UT7L 4XHJD 1BD2D 2QADC 2VLJB 3VWKC 5IQ9B 2D03L 3CVIH 2X09A 3VFVB 2Z8VC 3HAEH 5IB2A 3REWA 1PKQE 3B8SA 2G9HA 1WZ1H 5E9DB 5J1TC 4LRIC 5IBTH 2VZOA 1ADQL 1YUHB 1F6AB 5DK0B 2ZCLL 1B0GB 4POZC 4OV5B 2I60L 2V2WA 3VXQB 2DJUA 3EYQD 3LH2L 4YGAB 1S7QB 5A16A 4WENB 2OTWB 2O5YL 3VD9A 3SDCA 3HNVL 3QCTL 4F2MB 1BZ7B 5HVHB 4WW1B 3ULSB 3FO9A 2BMKA 3ARGB 1BBJA 1CFQB 3MV7B 3IDYC 1P1ZB 5D5MA 4JM4H 1AC0A 3D1MC 4Y2OA 5EU5A 5T1LD 3D69B 4F15C 3PHOB 2XN9D 1LD9B 5F7MC 1FJ1B 3ZKQD 1ZHLB 1Q1JL 5DRXA 5ITFB 2X6MA 3JWOH 2WW8A 4N90E 3VI4F 1D7FA 1HKLH 1EHXA 3H3BC 1FFRA 4OCRH 3WN5A 3CK0H 3CH1A 4R0LA 5CJXC 1JK8B 1DJSA 1RIHH 2EH7H 4PJHE 3SDDC 4LSPL 1A7RH 2CK2A 1CWVA 5A2IH 1TETH 3AM8A 3DI3B 1EPFA 3WFEL 5DFWH 4N8CL 43C9B 4TVPH 3O45B 4R4BB 4Z7VB 2NXYC 1XGPB 3GI8L 3G08B 5ITBH 4FQJL 5D96C 3VXTB 1LO4H 4P5TA 5EIIA 1IGFH 2OL3H 5F7HA 3SHSA 1J18A 4H0GA 4ZSOE 4OM1H 2HKFL 4M02A 1NFDF 3I6KB 3E3QE 3LPFA 4Z7VA 5E2UL 1P2CB 4PY8J 5GRVK 2VKXA 4JPWH 5SX4I 4P46B 4OUUA 2JIXB 3TFKD 2PR4L 3J7HA 5BV7C 2YRLA 3S7GA 4XBGA 1BREA 3SCMD 3WL9A 3SCMC 4XNQA 3RWHA 3T77B 3NA4A 4JFXA 5C2BH 3TN0C 5I71B 4JZNB 4O9HL 4PYGA 2RFXA 4ONHA 3MRQA 1UH4A 1R24A 1I8KB 1UXWA 4LKXB 1KPVA 4PBVC 2H1PH 3EYSL 1AR1D 4Y4HD 2EE2A 3WE6A 2E6JA 1A7NH 1NDGA 3HR6A 3PHOA 2V5TA 5F6IB 2H3NB 3DXAB 5DJ8A 3RVTC 3BQUA 4X98A 4ZXBC 5EORH 5F21B 5A2FA 3QUZA 2GK0B 5TF0A 1UZ8A 3ZKXB 2QHLA 4J6RL 4DVBB 3KPRB 3VW3L 5DFVC 1NGQH 3AMKA 3NIFE 3U0PB 1NCUA 1XGYH 1X4XA 5BW7A 1WJ3A 5ABDE 5T33H 2BRRH 3GBMH 3HI5L 3HCVA 5LJYH 1FZOB 4P3WA 1NL0L 2W0FB 3EGSA 3PHQA 3O4LA 3BH9B 4J1UB 2YKLL 2XZQH 1PX3A 4OIBA 1MRDL 4YPGB 3DNKA 1Q38A 3CFCH 4JHWH 3DX8B 1U8NB 3O45A 4X6DA 3ZDZF 3CH1B 1U6AL 4I3GA 2DWDB 1KN2H 4OLWL 1UA6L 1RMFL 1QVOB 2X44D 4BZYA 4UU9A 2GCYA 4OGYL 2FGZA 4NN6B 4G42B 4UDTB 5J1SC 4QTIH 5F3BB 3KR3L 1UEYA 3I2CL 1N64H 4Z5RB 2P8PA 3BSZL 3V5KA 5C9JB 1DDHB 4JM4L 4M61B 4HSQA 3F5WB 4HWEH 4JRYB 2CKBB 1LD9A 4QRUA 2DYPA 4XP1H 2C1OA 1XT5A 3DX6A 4PREB 5JR1L 1CD1B 3VFUA 4F7PA 4TPRH 2A73B 1BX2A 4L3EA 3W39A 4EN3A 4CN6A 5JUEH 4JM2C 5DHVH 1FN4A 3D3VE 3AREB 5JHDD 1J5OH 3UTZB 3ALWA 4P3CL 3BRDA 4WEBL 3KNBA 4KZEH 2ADFL 2GFBB 2XNAA 4R8WH 1K4DA 2YD9A 4PJ5E 4I18A 4YFLI 4JFEA 2VLJD 3NCCB 4MA8L 2UUDH 4DUVA 3MNWB 1HK6A 2V5RA 1T20B 4HIXH 4RIRA 1KPRA 4U6HB 1TENA 3KWWA 4W6YB 5JO5B 5DT1L 5FYJE 5IM7A 5GISL 3X3FH 1T21A 1KJMA 4HF5L 1J0HA 3QFJB 3HR5A 2VQUA 3DBXA 2DQHH 1MCBA 3TZVA 4JPVH 3IRZA 4WJ5A 5ICYA 1ZVYA 2FRGP 4TUKL 5ITBL 2Z4QB 4P5KB 2FHCA 3ZKXC 2C4XA 1IFHH 4GKZA 2JCCB 4X8JA 4I1NB 1IAKB 1PY4A 3GO1H 4W6XB 2FECL 4K3HA 4Y4KC 4HUUB 4YHIB 5C0BE 2FIKA 3QIUC 4YLQT 2Q86B 2GK0A 2ICWJ 3QDGB 4YAQB 5EU7C 4TTGA 5LBSH 4KZDL 5DJ6B 2IH3A 3PABA 1Q0XH 2OL3B 4P4KB 5B8CC 1MI5D 5DDHA 4ODWB 2BC4B 1Z9OA 1W72H 4PJEF 4NQVB 2IC2A 3VI4E 5E4IA 4LHUB 4KQ3L 5GS3A 3IU3A 5CP7B 4YH6A 4OZFA 1I1FB 3BI9X 4RFNB 3OKYA 4WI7A 2H32H 3L7EB 1D5XB 4H5SB 2O26U 3VWJB 4Z77B 1E4WL 3SDCC 3TVMB 1HOCB 2VOTA 3I6LD 4OKVA 1PYWA 5IVXA 1I9IH 2H6PA 2HTLD 3VJ6A 4JO2L 5ALBL 4RZCA 1JGEB 3V8OA 2P42B 5KANI 3QUXD 4FABL 1AKJA 1MRCH 5F6HI 1RJLB 1T1WA 3VW3H 3WKNA 5FYKE 1A22B 3DUUB 3PL6A 3SOBL 3MV8A 2EYSA 2IBBA 4RAVA 4Q97A 1KN4L 2BRRL 1NFDE 5B22A 3O9WA 4YZFF 5GZND 3TA3C 2OZ4L 1FE8L 2PW1A 3QXUA 5CILH 3TBTB 1A1OA 2EDYA 3L3KA 2D3VA 1QZ1A 1JP5A 1I1AC 4I4WB 2Q8AL 2QSVA 4XP6L 3MRCA 4ONGH 5KSBE 3U0WL 3L3JB 5F8RC 2X4PB 4XNZC 2A9NH 1RULH 3SE9H 3TO4A 1J12A 1UA6H 1RZKC 3OAUH 5I8CB 3FO1B 4JZJA 1ZLUH 4GRMB 2NY7H 1SY6L 2X4QB 4OD1H 1G6RH 1VFBB 3KLSA 3FOLA 4FP8H 3KXFD 5D7IF 5BMFL 4M6OL 4DZ8A 2FO1A 3H9HB 3DGCR 3ZDYF 3P4OA 3PWPA 4M93B 1RUKL 4ZSOA 5D7JC 3E8UL 1OP5H 3CLEL 5C71A 2R0WL 4LF3B 5GIRB 2VC2L 4K8RD 1U3ZA 1JE6A 3L5JA 4MD0B 4IS6B 3L5IA 2J6EA 3BWUC 3ULUF 1HHHB 3RPKA 3S35L 1BLNA 3OB0K 6FABH 3T4AB 4W70A 5IHLB 2NNAB 5EULV 1DQJB 4IRJC 4WUKH 4UT6L 2P8LB 3H7BB 4APQB 2FD6H 5E03A 2NXYD 3NCEB 5DRWB 1I1AD 4OZFG 4XGZA 3KPSA 3G5YA 2DIBA 5GRZA 5FGCE 1MHCB 1RFDH 4DGVH 4MNQB 3OV6A 4HF5H 5DK2B 3MRLB 3THML 4HG4J 3RGVD 2QV2A 2V9TA 3TVMC 2DMBA 4YDVB 3R0NA 1AE6L 1AJ7L 1U0QA 4PJAE 1O7VA 3F6LA 2A74B 5BRZD 1B2WH 1JHLH 1MUJB 4MSWB 3QISA 5J57B 3RGVA 2HJLB 1WSST 1HNGA 2FH8A 2R4SL 4FG6D 4OFDA 5KVGH 3MJ8B 4HJJL 1HYRC 1CN4A 3QNXA 5CFHA 3BT2H 2FDBP 3MGOB 3O41A 4HHAB 2Q76B 5ICZB 5E2JA 3WCYA 2H26A 2QJDA 1V3KA 5AZEH 3VFUB 4P4KD 4F7PB 3UO1H 5ESVB 2UZXB 1UZ8B 4MQSB 5DMJB 1MAMH 4JFZL 2YEZB 4UTBH 5T5NG 4U0RB 4JRXB 2A0LC 4X6DE 2ED9A 4PRBA 4Z7VE 3AXLB 1X4YA 4P2YA 4X8XA 2NY2D 2NZ9C 3K1DA 1F13A 4QY8A 1P69B 4WW2C 3Q48A 2VN4A 4POZD 4MA7L 5K9QG 5JHDB 2DTMH 1K8IA 4Z7UA 4B41A 2PF6A 3V0AC 4EDWL 3IFOB 1NGPL 1QSFD 3K1KC 3QNZA 2ZKHL 1OAUH 5DMYA 1FO0A 4G6FD 1Z0NA 1NC2D 3EZJB 3TYGL 4AIOA 3HZVA 25C8H 3E6HA 4P2RE 2NNAA 5E99H 2YC1B 1OHQA 3NGBB 5HSFA 1OF2B 4L8SC 4DFIA 2NLJB 2X4RA 3WS3B 3EGSB 1RAMA 4ZG1A 3WEXA 2R0KL 4GMTH 2FWOB 2P45B 2OBGA 4P48A 1BQHA 1E4JA 3GIVA 4JFPB 1A1NB 3TIEB 4LRIA 2I60H 2Y23A 2BRQA 3WJJC 4RFEA 4B7IA 2JJSA 2VDQH 5IP4A 2H41A 4X6FA 3VWJA 4R6UA 3HAEG 1EJ6A 3I84A 3BP6B 4G7YL 1KPUA 4C56D 2OXHA 3U0WH 3O3DB 3IAGC 3PV6A 4N8VA 2BVOB 5HI4C 3KG5A 3BVNA 5AYUL 4ZFGH 2I07A 4DUWA 1J10A 2ZSWB 3RVXD 3TJEH 2W59A 3MV9B 1JL8A 4ZUWA 1TVHA 2WUBH 2X4PA 2NYYC 5T1KA 1OT1A 1MFAH 5L2KA 5KVFL 5E8EB 4L4VD 1JPFA 4G8GA 4GW5A 1G9MC 4Y19A 3FHQA 5JA9A 2KH2B 1TZIA 4OCRL 3R0MA 2ZJSL 4W81A 1WBYB 3T2NL 3WNOA 3ZSSA 1EGJA 1HHGA 3GSVB 1TETL 1A3LL 3P0GB 4UT6H 2Z91A 4YO0A 4N8PA 2GTZB 4LQFL 5GS1B 4YDIL 4KXZI 2VDKL 1NAMH 1OTTC 3SDCB 1NLDL 4BYHA 1HHIB 2JLLA 2OL3L 4RX4A 4HFUH 3MOAH 1F3JB 5TQ0L 5DJAA 2HKFH 2VAAA 3DV6B 4GG6A 1I9EA 1UH2A 3RVTD 5J9PB 1I3GL 3EYOB 2IADA 4PJ5D 2ZPKH 3WJJA 4U1LA 5IV2A 1KT2B 5F96H 2F53E 3HZKB 2GITB 2H32B 3ZKSD 4XBEH 3WD5H 1YDPA 5IVNA 4WHYG 3RUGE 1O0VA 4ZAKC 5L2JB 4PY7B 1NFDA 4MQ7B 4XWGL 2RQ8A 1JNNH 4NSKA 1X5XA 3C6LC 3K7UA 4EOWL 3QUMA 1BZQK 5DTFB 3DV4A 4G9DA 4CADA 3QNXB 4K23L 1UYWL 3LDBC 2CSPA 1T2QH 2WBJD 1X5AA 3RVVC 1HXMA 5B3JE 3MJGX 1DBAH 3QULA 4M43H 3VG0L 3VGAC 2NXZB 3OPZL 4AG4H 3LKSB 3P4NA 3ZO0A 2QHRL 1IGIH 4KTDH 5JXAL 1U95A 5IEKB 3QUXB 3T0XA 1PSKL 1G7HA 3SKNB 1WICA 2VYRE 5DO2C 2GJ6A 1UB5B 1U8OA 1MHCA 2HVJB 4TSCH 2DI7A 4MJ5B 1XF5B 4UTAH 4KTEL 3V79C 1T7XA 4JDZB 3LEXA 3ULVH 2EDBA 1MRDH 3IF1A 4X9GA 3GSOB 4APQC 4N0RA 2ZNXA 4ALAH 4DAGL 2ARJQ 4GBXB 4V1DD 5LGHL 2E27L 2GTWB 1AI1L 4JDTL 3DO7B 2X9WA 1RMFH 4QWWC 5DQJB 3WUWA 4C83B 2X9XA 3VFTB 5KANG 1ZLVK 1R3IL 2DLFH 1I1YA 1CU4H 4GMSL 5BVJB 1E4KC 2ID5A 3C5SB 2HFFB 4NUJB 4R4ND 4NGHH 4OI9A 1NUDA 2HP4A 3PNWB 1HYSD 4WO4B 4W68A 2UV3A 1T7VA 4GS7C 1GPOL 1N5AB 3FMGL 2IG2L 1TVHB 4MS8C 4EKXA 3MV9D 5AWNL 2D7MA 5MI0B 4QY8B 4ZFOA 3O6FC 3WN5C 4DCQA 3P4MB 2W0KA 4Y16C 1P5UA 4LCYA 4H26B 3MV9A 3CFKB 1NDMA 5J9PA 4WI3A 3FT4A 5DZLA 3OKOB 3ULUC 3FQUB 1ZS8A 2FL5A 1MAJA 1T22B 3GMLA 5BS0B 3MACH 2F54B 4R96A 3QUKB 1RD6A 2EECA 3O81A 4TULH 4U6YB 2RB8A 3C5ZC 1WAAE 3L3HA 5EG6C 3MYZA 4JO4L 1A1NA 3G6JA 1MUJA 4I18C 4Z6AT 2BNUB 4LNRB 4YDIH 3MUGA 4U1SA 3U83A 3BXNA 4QRPA 4TSBH 15C8H 5CLTA 3CH8A 4OB5L 4XNMB 1MCEA 4HMDA 4IRSB 4P3DB 3N85H 5FK9B 5HYJE 5ILTH 1BVZA 2X4UA 4I0PB 1NANH 1YNTA 1CR9H 1IM3A 4U1GB 4OZGA 1IGYB 3F7YB 4LLWB 1HXYB 3PF2A 2RR3A 1BD2B 5JIHA 5JIIA 4NKIL 5D2NB 1AO7B 4K94H 4JRXA 4LIQH 4FQ1L 2XFXB 1L0XA 4F7CA 1YEIL 2NTFB 3U4EB 5HHPB 1MCSA 35C8H 2DQDL 5TE7L 2EC9U 1TVDA 1RZGA 1GAFH 3NN8B 2AV7A 2QQNL 1NGYB 4KKBC 4F7EA 3PJSB 1FNSH 3QIBB 4K3JL 4U1NA 1TMCB 2D4FA