1BOGA

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-homologous peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGTASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY (CB 4-1)
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
molecule tags Complex (antibody/peptide)
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1998-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogA01
3S36H 2IMMA 4Q6IB 2PO6B 2HG5B 1CDIA 3MRCA 1U58A 3ZLQC 4HFWB 4PYGA 5CSZA 1JRHI 4Y5VA 4S1RL 5I15H 3VG0L 3ZSSA 4PGCA 5AUMA 1N6QH 5HI3D 4N0UB 1JNNL 5IGXH 1A6WH 1AH1A 4JPKH 1CXHA 4DVRH 3A6CL 5F44A 2APBA 4JRXA 3SO5A 5A2KH 1H15A 2GJ6D 3L3JB 4IDJL 3ZL4L 1SJHA 5LBSL 4WTZG 3RHWK 1L6ZA 4E41D 2E27L 3HC0B 2GW5A 2P7TB 3EAKA 3OGOE 4WHTB 4UU9B 3OXSA 5EC1B 1E4XH 2GK0A 4DKFL 4YDVA 4KKNA 2GUOA 1VDGA 1A4KA 4O02L 4QWWC 5EWIL 1YN6B 3P9LB 4PRIE 5FYKH 3BKCH 4LOUD 3VGHA 4P5KB 1M6OB 4OGAD 3L7FB 3U36B 2AK1H 1H0DB 5EBLB 2AP2A 1FLRH 4YC2B 2NY1D 2H1PH 4AJ0A 2NYYC 1T1YA 4ODTL 4X99B 4YHKL 1JGVH 5CINL 2GY5A 3HC3H 5DQJB 4AEIH 4U1GC 1IGTA 1VFAB 3B2VL 2YZ1A 4YK4C 5I74B 4WU7A 1T03L 2I9LB 1UZ8A 2VDKH 5EO1A 5I76B 3UJJL 4AK1A 5HY9B 1WF5A 3PGCB 2IADB 5HD8D 3HE6B 3WNKA 3H0TB 5IK3B 2F54A 3RGVC 1WZ1H 1SJEB 3D25A 5BZWA 3BKJH 1TTFA 1CTNA 1TJIH 4DOHB 2QJDA 2OBGA 1FV1B 2OXHA 5C70A 1NJ9A 3SKNB 4S1DD 3LEXB 4XP5L 2NY4D 3CSGA 3WUZA 1QSEE 5T3XD 3U0PB 2Y4SA 1TXKA 1FH5L 1U3HC 1YEFH 4HKXB 2HN7B 3G5ZA 3K8KA 4PTTA 4OKVB 3TIDA 1UCTA 1LO4H 2UZIL 1WEJH 4LHUA 5F6IC 1DBBL 5EUOA 3P9WB 5CD5D 5FM5M 3VXMB 5FGBC 4KZDH 4XAWL 1TNMA 1ADQA 3PJSA 5F72S 3S96B 3MBXL 5I1JH 4YHLH 1KV3A 3T4YA 1DLFL 1DANT 4G42A 5KSBB 2UYLA 4HZAA 4LEOA 2NXZC 4MYWB 1R0AL 1Z0MA 4MA8L 4NGHL 1MJJA 3D85B 4Y2OA 2B2XH 2P45B 4PJXF 1ZLUK 4GAJH 2CDGB 4ZPVB 4F80A 2P5EB 3ULSA 5DLMH 1RSFA 3OG4B 5DHXB 3BZ4A 4YNYA 1UM4H 3MBEC 4XMLH 1ZT4A 2LVCA 3H2WA 5DJAB 4EIZC 5GGSB 2NW2B 1AGEB 3JSSA 1WSST 1IJ9A 5FDWB 4G9FD 1Q0XL 5ACZB 1MNUL 2K9UA 4M43L 3O6FA 3GB7A 4JFFA 4QXGL 1FHGA 4JVUA 1QSFB 3B2UD 1ZSDA 2XV6B 3D0LB 4Y4HB 4P9ML 3QXAB 3FN3A 3O2WH 4I8DA 3TV3L 5BZDB 1CK0L 3LD8C 3RNQA 3IETA 3T0AA 4Y5VC 3NTCH 3GK8L 5DRXB 4GKSA 1DBML 2N1KA 1Q38A 3O6LL 1XZ0A 4XP1H 4ERSL 1MRDL 1RV6X 2OLDA 3BP6A 4YR6A 5TH2B 3K4ZA 4WUKH 4OFYA 2VWEE 1KPUA 5CIPA 4R7DA 5D7IB 3HS0B 1U6AH 2H6PA 4WUUD 5DC4B 4PJ7B 4OUUA 2BOCB 4NHCL 1T2XA 2OYPA 1Q9WB 1INEH 1BFTA 3HZKB 4OT1H 2I24N 5JDSA 2GSIA 3ILQD 4PUBH 5HHXL 4WV1B 3MACH 1WICA 2FJHA 3K7UA 4M6OH 4LIQL 5C7XL 2Z92A 1S7WA 5DO2D 1S7TB 1A7NH 4NM4L 1FZKB 1J87A 3C5ZA 4PJ5D 5E0QA 5D70H 2M8XA 3MROB 2YMXH 3GMNB 3T77B 1U8QA 2VDPH 4JQVA 4XP9L 1I9IL 2BSRB 5F7EL 5T3ZE 4H1LA 4OV6F 4H8WC 2VXUL 3AB0B 4LSUH 5IF0B 2QADB 4KV5E 1I7ZB 4PRBA 3V4VH 2YHGA 2EIBA 1XF5B 4NFBA 4P2OA 2GEEA 4UB0L 3HE7D 3MV9A 3Q1SL 3B8YA 2FX9H 4AZ8A 3SEPA 1WISA 2FBJH 3OR6B 5HHQB 3DVNB 5HYJA 4Z78B 1ZGLA 4JM2D 3V0VB 2D7TH 4YDKH 4LRNH 3RIAF 1TZIB 4HWBH 4MAYA 1ZA6B 2A1WL 4ONFH 5L7XH 5I17A 4P3CL 4YBQD 3UTTE 3LRSA 5FKPB 1J8HD 1L7TH 3REWB 5IKCB 3NGBC 3ZKMD 1B6DA 1XIWB 4GUPB 5D96C 3BWAA 5HPMA 4NZTH 3EGSA 1OAXL 1ZHBB 2JJTC 1ZS8A 2X4TB 5T5NF 4JFXA 3KPLA 2FYYB 5ISZE 4UZGA 5T33H 4XNQB 4IRJC 4G6MH 3ZDXE 2CK0H 4WI2A 1D5BB 2BXYA 1OLLA 1WBXB 2JE8A 4K94H 3QAZB 1JF1B 2I9TA 3LSOA 3QNXB 2H26A 3NPZB 1IVLA 1T22B 3WHXA 1J11A 4IJ3C 3ULUC 1AGBA 4XVTL 1S5HA 5JHDA 5J11B 3TBVB 4MD4A 3C2SA 1IAMA 1TTGA 1RUMH 3BVNB 2GQHA 2GKIA 4NQSA 2J8UA 2CLVA 4QRSB 4IS6B 5D6CA 5F9WB 4LNRA 2G75A 1CYGA 5I8OH 1G84A 3KNBA 3ARGB 4GOSA 3FFCE 3BUYB 1U41A 2PXYA 2PYEE 2PKDA 4GG8B 5D93C 5CKAA 1B0RB 2VRAA 4LSDA 3O6FC 5MEND 4E0RA 3CFDA 1J0HA 1BD2E 2VR5A 3C6LB 2AQ2A 3R4DA 4LCIH 1LWRA 5DJ6A 3PNWB 1FL6A 4CU6A 1NLDH 4EIGB 1OPGL 1EO8L 1L7IH 5I1AB 2CIKB 1QLRB 4OZ4B 2HMIC 3WS3A 3SPVA 5J13C 3C2AL 3P4OA 3SJVB 3V6OE 4C54A 4LSTH 3RWHB 5T3ZL 3ARTA 1MHEA 3X3GL 3M8OL 1FYTB 2X4UA 3OMZA 3PL6D 2V5RA 5JOPE 5AG9A 2WAHA 3JV4B 3WDHA 2BJML 2UWEE 1NGZB 2AGJH 4HC1L 2EDQA 4K8RC 3UC0L 4JB9H 3VGGA 1UXSB 1PEWA 1RUPH 5EUOF 3OKEB 3CLEL 3NIDE 1ND0A 3LKQA 3D18A 5DR5H 5E8PA 1OGAB 2ZPKH 5FIEA 1S78C 1CD0A 1MCOL 2D7MA 5E8EB 3TNMA 3SDAD 5L0QC 5DJ0B 5GS0L 5F1NA 5IHLB 3NZHH 3QH3B 1OARH 2DL2A 3BW9B 2GTWB 4NC2B 2D31B 4JQVC 5CZXC 2ESVD 1YC8A 3V6ZB 5CEZH 3V4UH 3TNNB 3KPNA 5IFHL 1T2QH 2VIRA 3KS0H 1UVQB 3T65B 1J88A 4HPOL 1VERA 1CLOH 3O9WA 3H9YA 4ZAKC 1A7BA 3RNKA 3PHQA 1AO7E 4YE4H 3PWPD 2BY0A 1Z2KA 3U4BH 2GSGB 3J8F7 4HK0A 4APQC 2L7JA 5DJCA 4F7EA 2AKRA 3WUWG 1YEGL 4MAYC 2VZUA 5CP3A 5AG8A 4PY7B 2XN9D 4PJFB 3HCVA 3QPQC 1BFOA 4X4YB 2XACC 4ENED 5IP4A 5FHAL 3MRLA 3GSOA 1AIFA 1INDL 3CDGB 2DF3A 1YMHA 4NN7B 1GOFA 1MEXL 4P5TB 3FTGA 1AKJB 2FO1A 2JJUA 4ZO8A 3FONB 4DW2L 4V1DA 4JZNA 1ZLSL 4L1HA 4KTDH 4KKCD 3T1FB 5C0CA 2X1PA 2M2DA 1E27A 4JR9H 3DUHA 2DQDL 1EAPB 4AT6A 5ACLA 4LCYA 2A6KB 2P8LB 4HGWA 3IXTA 4JJ5B 3VFRB 1FLTX 2NY2C 4LVOC 3DBXA 5DUML 3AAZB 1KEMH 3EYQC 5IMKB 3F8UB 3JUYA 2YRPA 3P30H 2YD4A 5T1DH 1RU9H 2B1HH 1A6ZA 1KPRA 1MUJA 4KRPD 4HLJA 4QGTA 3D9AL 4XTRC 2Y25A 2PXYC 4HEPG 1Q1JL 4E42A 4EXKA 1F58H 3Q48A 1Q0YL 3UPCA 5B39G 2Q7YB 4Z7WB 5DF0A 1KLFA 3OKYA 1IAIL 1IGCH 2AXGB 3L3IB 3BQUD 3HR5A 3V0AC 1AQKH 4U7KA 4ZPTB 5T3ZD 4S1QL 1S7VB 1F3JB 5JXAH 5C0RL 3LKRA 5EBMA 2ED7A 3RJQB 4GG6E 5B3JE 2CH8A 3H9ZA 2GFBA 5SWZA 1X44A 3NIFE 1CDBA 2BNRD 4NKDA 1PBYA 3O2DH 3V7AE 1BX2A 3IVKA 2FIKB 1QZ1A 1EMTH 4FQIH 1NC2B 1DN0B 3MLUL 5L8KB 4PJCE 3E3QE 2DJSA 4EDWH 4QEGA 1S5IL 4ZUWB 2P8MB 4J1UA 1FNGB 1NCDL 3BD3A 3HI1B 3EYOA 2E3VA 5D2NB 4XP4L 1A7RL 1XGUB 4LLMA 2Q76A 5EZIL 4CMHC 3QDME 4PLJC 4U1IB 4WWKA 2J88L 4OTXH 1OP5K 1FSKC 4D9LH 3I02B 4OD1H 5HVHC 1C12B 3MV7E 4YHOL 4DVBB 5DD5H 3LN4A 3DX8A 1CG9B 1SYSA 4PP2A 4EJ1C 2J8UF 5LWYH 3GJEB 3PQYD 4AQ1B 1SY6A 3ARDC 5FKAA 3O9WC 1OAQH 4EQ3A 1I1AA 1ZE3C 1T6WA 1IM3A 5DRNA 4Z7VE 4IDLA 4ZOCA 5T3XH 2YPVH 2MNUA 2DI9A 2Y06L 4ELME 4EN3A 1U92A 4JAMB 1HILB 3TYFA 5F1KC 4D9QD 3O3DA 3W9DB 2BVTA 1HK6A 4JVWA 4TSAH 3PWUA 1KB5B 3IJYB 2EDKA 1T21A 4YEFA 4BUGA 1ZHNA 2IH1B 5EULV 1MRCL 1UJ3C 5CEYB 5TJWK 1G7PA 1OT2A 5BRZA 5KVEL 1IL1B 1QUNA 4X9IA 2APWA 2CGRL 3TO4C 1XT5A 2A9MH 5JOPD 1IGYB 3W0WB 3WHE0 1MCWW 1T0NA 1MJ8L 4C4KT 4HEME 5J12C 4G3YH 2B0SH 3ZE2E 3BAEL 1BGXL 4XH2A 3B4NA 5EU6A 4AQOA 4NWTH 4YDIH 1G6VK 5DMKB 1T1ZA 4OLZL 4YGAB 1RHHA 3WEXB 1OP3H 1S7RB 2GJZA 4P2RB 4MNQD 5KAQG 4S1RH 4AEEA 3VG0H 1JNNH 2Z4QB 1SYVB 2Y6SC 2SEBB 4H20H 5JOFB 3ZYOA 3A6CH 2WV3A 3MV8E 1LMKA 3RY5A 4GXUN 3SHSA 4IDJH 3ZL4H 5LBSH 1IBGL 1QOKA 3PDOA 2E27H 3X11B 4XXDA 1F6AB 4X6CB 4O51B 1AO7D 3FB7A 3QEUB 3KPTA 1TVDA 4HZLB 2CKBL 1C16B 2DIAA 3JXAA 2Q6WB 1S9WB 1CL7L 4I4WA 4DKFH 4O02H 5EWIH 3CU7A 4PP1C 1K8IA 4JFDE 1Q72L 3NOIA 3CDCA 3MOQA 2JCCB 3VD4A 4XNUL 2JJVA 5GRYA 3S6CA 4FXGB 2YS4A 2OR9H 5D9SA 4U1KB 3RWIB 2X44D 1F4XL 4LKCB 4WFEE 4BSVB 2A6JB 3O4OC 4ODTH 4YHKH 3L7EA 5CJQL 1FVDA 4WWKC 3B2VH 3DURB 1T03H 3AREB 4ZXBA 4NFCA 3UJJH 2DIBA 2Z35A 2F53B 4GBXC 3IDYB 4R3SA 4N0CC 4OQTL 5F6HI 4JG1L 3S36X 4GRWF 2CD0A 3C60A 1U8MA 1I1RA 3CZFA 4XP5H 4FFVD 3G6JB 2OQJB 3ZTJG 4FZEL 3IJSB 5IUSA 1FC2D 1JGDB 1BVLA 2BOBA 1FH5H 4MJIE 4URTB 3QIBB 5FA3A 4I0PA 3SKOB 1FORL 5DMJB 2UZIH 4RMUA 1Y18A 4KXZI 1ZTXL 1DBBH 5JIHA 3ZDYF 2X40A 4QRRB 3FT2A 4XAWH 3OSKA 3BDYH 3MBXH 5C07D 1DLFH 2ICES 1V05A 5D2LE 3KHQA 2FEDC 5GIRA 4MA8H 4NGHH 3MRQA 1FL3A 5GGTA 3WFDL 3U2SB 4EI5B 5GSVA 3OGCA 3D39E 1OF2B 1XCQA 3DVGA 5I1EL 3MRNA 3MO1B 4OF0A 2EE2A 4NRYB 1FFPB 3VFPA 1X7QB 3F7YA 2XZCL 3AMKA 3ULVE 4WY7L 2ZOKA 1S9VB 1Q0XH 5FM8A 1MNUH 1S3KL 4M43H 4LASL 4MD5B 1HOCB 2VLRE 4QXGH 2X4PA 3RX5A 5EN2A 3D6GA 3VFNB 3TBTA 2QSVA 3NAAH 4QCIB 3L3GB 4PY8I 4U7MA 4P9MH 4A2MA 1RVFL 4YO0A 4M4RA 5DJ2A 5EBGA 1ZV5A 3TV3H 2VQ1A 3FAWA 1ADQL 4BM7A 2ZNXA 4P23D 1CK0H 3K1DA 2PETA 1FL5B 5KZCB 1IARB 3MNZA 4OF8A 1CE6B 1HXYA 4Y8DC 2ED9A 3MV7D 4UIKL 4Y8AA 3GK8H 1DBMH 3OPZL 2IBGA 3MRRB 4XC3H 1DR9A 3WUWB 3ZKXC 3O6LH 5GJTH 5IB3A 3MA7A 1VFUA 5K59E 5SWSA 4AENA 5JW3L 3UBXA 4DTGH 2VLMD 4PJIA 1NFDA 1OTSD 3RVXD 5CEXA 2BCKA 4TTDC 4LCUA 2HRLA 3AROA 3VFTA 5HYFA 4NHCH 4P3DA 1JV5A 1OSZB 5C3LD 5HGAA 3EDDA 5C09A 4ODWB 2APFA 5ALCL 4Y1AE 1DUYB 3M1BB 4OZHB 5FYLE 5HHXH 5C0AD 3RUGA 4YHYB 3U79A 3U4EA 3UYPA 3VWKB 2YEZB 4QOKA 3X13B 43CAB 3NVQA 4LIQH 5C7XH 5KANG 4MQ7B 1LGVA 2EXYD 4NM4H 3WFCL 5IVNA 2V7HB 3A6OA 3VI4F 5C0FB 3HRZA 1YJDC 2EYRB 3LPFA 4LPUA 1MQ8A 5I6XC 3QFDB 4XP9H 1PY4A 1I9IH 1H3GA 5F7EH 2VXUH 3D2UB 3SDCC 1N6UA 3QUMB 5IV2A 1U9KA 3QA3A 3SOBH 3QIWA 3KLHC 3JWDC 1MFCL 2R2CA 4MNGB 4UB0H 3Q1SH 2BHZA 3JWOL 2IANA 3VGEA 3BH9A 4L8SB 3SGEI 5ESAA 2ENSA 2J12B 2UUDK 2A1WH 4K71B 1NCWL 5B39B 1RZ7L 4XPGL 3LKOA 3JWNC 4P3CH 3ZE0E 3VRJA 2V2XB 2PCPA 1XF3B 1MCRA 4Z7UE 5ALBL 4I0PC 4L8BA 4XXCA 5E8OA 4RAVB 4MXVE 4GXVL 1OAXH 1YNKL 3QDGE 4X8JB 3O8XA 3FHAA 2ZUVA 5AWNL 2AXHA 2HLFC 3PHOA 4R26L 1E6OL 3UDWA 1ZHLB 1K5NB 3JTSA 1QNZH 2YRZA 3MRJB 1JPFA 1AGCB 4FHBD 2EIEA 4OFDA 1UADC 2X4OB 5JMOC 1FG9C 2R2EB 3PWVA 4PRNA 4XVTH 5FM5O 1IKNA 1OY3B 2F54D 2H32H 2X7LA 4OV5A 3QI9B 2VXVL 1G7LB 1EV2E 4E41B 1D9KB 1OQXA 1VESA 4G5ZL 1H3XA 1JZ8A 2B4CC 2W91A 2RCSL 3VXUA 4M1DL 1PD6A 3P4NB 5IW6A 5GRJL 4RDQG 5AYUL 4ODUB 1M4KA 1M71B 1UXWA 4CNIA 1FN4B 5IWLC 3T08A 3EJYC 2IMNA 4LHUD 3TESA 2C7UB 4NT6B 3SQBA 1EGJA 4PRAB 3VG9C 4WFED 4HIJA 3KVQA 4M62L 3V2AR 1D6EB 2CPCA 2FR4B 1NANH 1OPGH 4JEGB 1EO8H 2MKWA 2NY1B 1IEBA 3RKDD 1HSBA 2I27N 4FFYL 3F7VB 3KYOB 4K55A 1WT5C 3X3GH 3M8OH 5FB8A 2C3VB 2PW1A 3AY4A 1DQQA 1CFSA 1VHPA 5E6IA 5D7JA 1XF4B 4WW2B 2BJMH 4MDIB 1QA9A 4G8FB 4JFEB 5CGYD 5FGRA 4HC1H 5EDXA 5D5ME 3UC0H 4UDTA 3S97C 4CADA 1ZXQA 3G5XA 4MHHI 5DGRA 4A6YA 3RDTA 1OAZL 1CD1A 3CLEH 4J3UA 5IEKB 2Y36L 5GRWA 2VR4A 4OM1L 4RGNB 4KKAD 3V0WL 1MCOH 1KXQE 3QUZA 5TDOB 1RD6A 3CVHA 4BK5A 4YDJA 5BQ7B 5GS3A 1AR2A 1DCLA 5MEQB 2W9LA 4N8VG 3H9HB 2OJEB 1N64L 3CUPA 3LPGA 4LQFL 1AXIB 1R3JB 1BZQK 1B2WL 4HIHB 3JTTB 5J3HD 5KBNC 3R0NA 5CP7A 5IFHH 4NC1C 2XG5A 4HPOH 3V7MA 1F4YL 3STLB 4QRQB 2DOCA 5IEHB 1B4RA 1Q9KA 4MA1B 3W2DH 1HYSD 3MCKA 5FUCC 5BVJB 1U8PB 4Y19A 5CLTA 4X6DE 1YEGH 5E4EC 4ELKB 5CD3A 3DV4A 4Y16D 5FHAH 4UAOC 1INDH 3L1OL 4PREA 3PIQB 1DL7L 1HHGB 4F9LA 1LK2A 4XXCC 4KJWC 3HFML 1MEXH 4NN6B 4P9HC 3NPSC 3RPIB 1HHIA 4BH8B 3HNSL 3O8XC 4HH9A 5BS0D 4DW2H 5D7LB 4PJIF 1NFDF 3E1F1 1ZLSH 1QO3B 3H3PL 4GW5A 4JFPA 3RZCD 2DQDH 1HNGA 5I8EB 4P2OD 1H8SA 2F74A 3F5WA 3MV9D 3GSVB 4L3EB 4ZUSA 3RUGF 1IKNC 4OGYL 2D4DA 3EO0A 1N6VA 4KK8C 4P2QA 5DUMH 4JRYD 1XCTA 2VXTL 3DUSB 4S1SL 1T83A 4OUOA 3OAYH 3D9AH 2MTPA 1R24B 1JRHL 2EZ0D 1Q1JH 3UCRA 1CU4L 1TJGH 4FQJL 1Q0YH 4Y4KC 3DWTA 2MFNA 4PJ5B 5IR1B 5DURD 3KPQA 1NDMB 4FG6D 4JLRB 2XT1B 3RWFB 2APTA 1KG0B 4XNMB 4S1QH 5E6ZA 3STZA 4YHIA 1U8LA 5C0RH 2Z31A 1YMME 4OF7A 2VB5A 5D71L 4K9EL 5HVWA 1YUHB 5FDYA 1JN6B 3AY4C 2NY3C 4JFYB 1UB5B 5A2JH 2HVJB 5D7JC 4PRPE 1H3TA 3MLVH 5JOEA 4HUKB 5JHDD 1UC6A 1K3IA 4ORZC 5F3HB 3QJHA 3KLSA 4M93B 4NPYA 3MLUH 4G6AD 5J9PA 3FQRB 3VXSB 3LZFL 1PSKL 1S5IH 3LH2L 3EYUL 4KH2A 1FNHA 2H2PD 2PO6A 1NCDH 3VXTB 4M3KB 4LCWD 5F1OB 3UMTA 1A7RH 4HFWA 5EZIH 5LQBL 2J88H 4KK5C 4N0UA 4Z95L 4YHOH 2LU3A 5HVFB 1HEZA 1GC1L 2VAAB 1U95B 2D4FA 3SO3B 3L3JA 3O6KL 4NQVB 1T7VA 3DVIA 4P4KC 2CIIB 3HC0A 1VPOL 1WWAX 2JB6A 4LRIA 4WHTA 1DZBA 3X3FL 2DKMA 1EVTC 2FIRT 4UU9A 3C09C 1PG7W 3TZVB 2XI9A 4J3TA 3ET9F 1YN6A 5ESVA 4M7JL 4DN3L 4DUVA 1J1XH 1YQVL 2ADFL 3P9LA 3EYFA 4P5KA 2FGZA 5IFAL 3L7FA 3U36A 1H0DA 4PRIB 3QULB 1AR1C 5DQJA 1M7IB 5MENB 2KL6A 3QQ3B 1VFAA 4M8VA 3O4LE 2I9LA 5HDBF 3NBNA 1WAAA 5I76A 2FECI 3NCJL 4L4TA 5EOTA 1MRCH 5HY9A 1A1NB 2X9WA 2IADA 4QHNA 2VL5B 2R29L 3H0TA 2CO6B 5KVEH 1JL8A 1CE1L 2FNBA 1SJEA 1CFQB 2Y5EA 3EOAA 4XP6L 4M7ZC 5DC9B 2CGRH 1X5AA 1FV1A 4AH2B 4MJ4A 1X5YA 1E28A 1R5IB 5TDPA 1MJ8H 3JZ7A 1UH2A 4JANB 4I18C 3U46B 1BGXH 2DMKA 1TZGL 4HJ0D 4OKVA 3QNYB 1FAIL 2EDRA 4ZUVB 1QSEB 2WLYA 1KLGB 4RA3A 2VZSA 3VXMA 4OLZH 3OB8A 3BZFB 1GPOL 3NABL 2MOVA 4XPHL 2AJZB 4S2SA 5JLZB 3EKCA 3FT3B 2ZCHL 5I8CB 5KSBA 3SE3A 2DBLL 5IMMB 3VXPB 1AHWC 3VFWA 3F65A 3V7AG 5HHOA 4KRLB 3WDJA 4NHUB 3D85A 1P5UA 3C6SB 5L8LB 4ZPVA 1TFHA 2P5EA 5BO1H 1JMZA 3VXRE 2Z31C 1IBGH 4NIKB 4KROC 3M17B 5HHME 4I0CC 4NWUL 4QHKI 4C58B 4HFUL 5DJAA 2CKBH 5DEGB 4RGMB 4OJFL 2NQCA 4L4JA 3VA2C 1KULA 1CL7H 1AGEA 5FDWA 2D0FA 5JNYB 1I8IB 1Q72H 3P73B 5IOPB 4XNUH 1TQBC 2CK2A 1X4XA 2R1WA 1QSFA 1MI5A 2G60L 1F4XH 1N0XL 2PO6C 3WN5A 2WP3T 1UWGH 3CX2A 4K7PL 5KVMC 1I9RL 5HSFA 4LDEB 1PVHA 5BZDA 2VYRE 5J4MA 5CJQH 5I1CH 4IRZL 5DK2B 2OI9B 3L3HB 3O0RL 1EXUB 1KSRA 2OZ4L 4DK3A 3GRWA 1OTTC 3DV6B 2EICA 2RR3A 4MSWA 3F7RA 3VMNA 5TH2A 5L2JB 4OQTH 2CLRB 1CGXA 1YY8B 5D7IA 5CBAB 3O41B 2C26A 4KVCL 4ZNCD 2EDNA 4JG1H 4PJ7A 1S8DA 2BOCA 2BFVL 4LCCB 3TM6A 2DLIA 4PJEE 4PIRF 3HZKA 2EYTB 4LRIC 5JZ7D 2V9QA 5AAWA 1Z3GL 4JDTL 1BF2A 1IGFL 4FZEH 1UWXH 1QPPA 2KDGA 4WV1A 2E7LA 3LVEA 1DBJL 1PX3A 3IS0X 5EZJB 3F12B 1HSAA 4CVZB 2C3WA 1FORH 2ERJC 1S7TA 1RJLB 3TA3D 1ZTXH 2DD8H 5C0NC 3OKOB 2V2WA 2AJXL 3T77A 5GGVY 4MQXC 4ZQKA 1FIEA 2BSRA 5CJ5A 4KMLB 4EKXA 1I7ZA 1QRND 3VFMB 1MAJA 4OIIL 4LVEA 1XF5A 4WDIB 3CPLA 5ICZB 1YDPA 3FO2A 2A38A 3WFDH 1JFQH 2Y07L 1C7TA 4KHTL 3OR6A 5HHQA 3BZDA 3RP1A 5K9OB 5LXGL 3V0VA 1LE5B 1CDGA 2I60L 4F33B 1TZIA 4JREB 1U2HA 4TOYL 1ZA6A 3MOAL 3V52L 2XKSA 4NKMB 5I1EH 1GYAA 4KDVA 4M6ML 3W39B 2NY5L 1MCBA 1KACB 5DJYB 1OOAA 4N8VB 5FKPA 3REWA 5IKCA 1B6UA 4WY7H 1SVCP 2IALA 1XIWA 3A67L 4GUPA 3V79C 1GGYA 1S3KH 4LASH 2DQFA 3RIAK 3UTTB 1ZHBA 4Z7NE 1CFTB 1BMGA 1HXMB 1RVFH 2FYYA 3IU3A 4OLUL 3QXTA 4FQXD 4XNQA 2CDFB 4PRDB 4PJ9A 1D5BA 1ADQH 4JO1H 5C1MB 3SE3C 1F6LL 4RGOL 5ISZB 5HGDB 4UIKH 5I0DA 3O3AB 1CFNA 3LRHA 2AXJA 3OKDB 3P4MA 1P53A 3P77A 5JW3H 4LLVB 1TVHB 1KNOA 3TBVA 1EZVX 4JCLA 4OLEA 5CZKA 4TVPE 1T1XA 4QRSA 1JHKL 5ETUA 2Q1EA 1GIGL 4ZOBA 3FO0L 5JORB 3ARGA 1N7ML 2B20A 3BUYA 4UNTA 4CL7A 4GG8A 3IRPX 4ZO6A 4BYHA 1X5FA 3QDJA 1B0RA 1D5IL 3QNZB 4KJPD 1IILE 1B88A 1CICB 5GPRA 1G9NL 1VFOA 3WFCH 1WAAF 3FFCB 1MCFA 2X70B 2PYEB 2ITDB 5MEOA 3PG2A 2EDJA 3WN5C 2CIKA 5I1AA 1QLRA 3QG6B 1UH4A 4HH8A 4OZ4A 5F1SA 5T1KA 3SJVA 1BD2B 1VACB 5BV7C 3O4LD 1LEKA 1C08B 4JDVB 2RFXB 1KTLB 2DYPD 2CQVA 5AAMA 2AK4A 3OKNA 5HDLA 4L4VD 1MFCH 1DLHA 1FYHB 3JWOH 4KKLC 1NGZA 5MHSE 1A3LL 4QXUL 3QFJE 5CIPH 1UXSA 3V8CA 3OKEA 5KS9E 2UWEB 5I75C 2P24B 3KGRA 3MUGA 1IEHA 3PF2A 3WSQL 1Z9LA 1UM5L 2NNAB 4ZUUB 4WV1C 4PJDA 4YXKL 4ZSOE 5E8EA 3BE1L 3GI9H 5KSBF 5ALBH 2MCPL 3IJHB 2GCYB 2H9GB 3BPOC 1YNKH 1T0MB 2P4AB 3QH3A 5B38G 3QXDB 5EUKB 5TF1H 1F4WL 5HHPA 3BW9A 5AWNH 2GTWA 1MCQA 1U8OB 4Y5YB 2D31A 4R26H 1E6OH 5DVNA 3FN0L 1JCKA 2DKUA 1MFEL 1CGWA 3FKUS 3LB6C 3K4DA 5DI8B 3TNNA 1LE9B 4GAGL 1T3FB 3T65A 4MNHB 2NXYD 4OFKA 1P7QA 5KTEL 2FSEB 4V2BA 3PGDB 1GVIA 3DMMD 2GSGA 4G5ZH 4ZFGL 5JDJA 3C60D 3WFHB 1HCVA 1AO7B 4PY7A 4M1DH 4RFEB 4PJFA 4X4YA 2WMPA 5GRJH 3BIBX 1HH9B 3GHBL 5AYUH 4AIZB 3CDGA 4G8GE 4NBZB 3JV5A 1XIWC 1WK0A 3LKNA 1UQSB 3FQTA 4I3RL 3I84A 4PJBA 1GGBH 4P5TA 4WTZA 5FXCH 2YPKA 3KJ4C 3KPSE 4M62H 5D7KD 5CGMA 1X5ZA 3FONA 4WEUD 3SE8L 2I5YL 4GSDL 1MCDA 3ZMRA 5MERB 1X5XA 5D7IF 4K23L 5D8JH 4PJ9C 2FHCA 3AXLB 4PJ7F 3MZTA 4FFYH 3LRGA 4PJXE 2XKUA 3L5HA 3I6LD 3AVEA 1EAPA 4Z8FH 1MWAB 3S9DB 5F89B 3DYOA 2A6KA 2P8LA 1IGIL 4HKJA 4NN5C 3VFRA 5DD3L 4UDUA 1CDYA 3AAZA 2AJYH 2V5MA 3BI9X 5GRVK 1P5VA 3BJLA 5IMKA 1KENH 3LIZL 5LGHL 3V8OA 1EHLH 2DQEH 1YEIL 1R5VB 1OAZH 3MYJA 4LGRB 1S9XB 1TCRB 2Y36H 4K2UL 3S37L 5IHZB 3BGAA 3RAJL 4OM1H 5AD0B 5GISL 4S0SD 4PG2A 3V0WH 5TE7L 5JUEL 3S4SG 4CVWA 2JIXD 4Z7WA 1MREL 2EH8L 3UYRL 5IJVA 4QRPE 2AXGA 3I50L 1N64H 3ILPB 4LQFH 4R4BA 3EO1B 2ADGB 4O2EA 4ZPTA 1B2WH 3VFSB 4OCSL 4WCYL 1S7VA 3B9KD 1F3JA 3QEHA 2PTTA 5B21A 3NCEB 1N5AB 1I7TA 1T4KB 5E5MB 5ICYB 3E2HC 4NQED 1F4YH 4HIIB 5IQ7L 3KYMA 5J6HB 1UACL 2C1OB 4GG6B 1VCAA 2YXMA 2FIKA 5GZND 2R2BB 1DN0A 3SDXE 1RZKC 2FJFB 3J7HA 4ZUWA 2P8MA 3AC0A 2WWKO 1P9MA 2X5PA 5IVOA 3HI1A 1ZANL 3L95B 1DL7H 1G7JB 2R23B 4PJCB 5KJRL 1XGUA 1KFAL 1LO0L 1OWWA 3VWJB 1Q9OB 25C8L 5I8KL 3MLZL 5IFJB 4WHYH 3CVHL 3I02A 5E6YA 3HNSH 2DQJL 3GBNH 4XBGA 1C12A 2Z91B 1SQ2N 4M6NH 3DI2B 3FOMB 1CWVA 4NQCE 4DVBA 1JHLL 3QDMB 5J06A 4IRSD 4P23B 3MUHL 3H3PH 3ARBD 3GJEA 3MV7B 1YNLH 4M02A 3QIWD 4I2XA 1ES0B 5H8DA 1RJZA 1TENA 2GJJA 1V5JA 4JG0H 1W0VA 1U36A 1VEOA 3LN9A 5DFTA 3O11B 4OGYH 1WGOA 1N3NB 3MGTB 5H2BB 1H5BC 3OAZK 4N5EC 4NDMB 2CKBB 2VXTH 4YPGB 1SEBB 2WBJA 3FO1B 4LP4A 1XAUA 4S1SH 2DDQL 3LDBB 4Z7VB 3O3EA 2VISB 1A6UH 4JGJA 5B4MC 3VD9A 1JRHH 1HILA 2RIKA 1UT9A 3BIAX 3HB3C 4JAMA 5BMFL 1CU4H 4RMSA 4NN7C 1X5JA 4ELMB 1KB5A 3IJYA 3CXDL 4JRXE 3ECBB 4JY4B 4PPTA 1BFSA 5IM7B 1CF8L 4OF6A 1I3RA 1X5KA 4YAQB 4QHLB 5GHWL 3ZDZF 1PY9A 5CEYA 1QQDB 1AQDB 3EZJB 2UVEA 3DIFB 4OF3A 4M7LL 1Z5LB 5D71H 2EDFA 4W70A 2Q3AA 4K9EH 2DM3A 4HLZG 3W0WA 5MHSD 3B5HA 3VI3E 4PJDF 2EC9U 4POYA 2IFGA 5KSAD 1FQ9C 2XXMB 1V3LA 4HV8B 2PR4H 3LEYL 4E5XB 1ED3B 5SX4I 3QEQA 1CLZL 1NL0L 2VMFA 3MLSL 5E7FA 3LZFH 2R1YB 1PSKH 3LH2H 1GXEA 3EYUH 3VD5A 3WEXA 3VFVB 3QISA 3QT2A 3CSBA 3HAEH 4M5YL 1CR9L 5LQBH 4YH6A 3UEZA 4RMTA 4HIEA 1SYVA 2SEBA 3RKPA 1GC1H 4JHWL 3B5GA 3DUUB 5F88B 1KN2H 8CGTA 4OSUH 3IAQA 5HHNB 3X11A 5GS1B 1VPOH 1YEDA 4O51A 4PJFF 3MV8B 3NN8A 3QEUA 4HZLA 4GMSL 3H9SA 5E6ID 1JIBA 1F2QA 3X3FH 1C16A 1X4ZA 2Q6WA 4HWBA 3EJZC 4MZ2A 4ZFFB 1CI5A 4DN3H 4M7JH 4XPTL 1YQVH 2ADFH 4DAGL 4PJBF 3RVWC 3ETBF 2IAMD 3RDTD 4FXGA 2C1PB 3HNTL 1JWSB 4DKAA 5IFAH 5F7KC 4JFDB 1P9MC 2A6JA 1KT2A 4YPJA 2XWBB 4MJ5B 5ITFB 3ULUE 2WUCL 3FRPG 3QSKB 3OR7B 4ZS7L 3DURA 4XNYL 4HK3N 3VFUB 2QQQA 3NCJH 3D3VD 2R29H 4HJGB 1CE1H 3HNVL 3MRDB 2Y7QA 4XP6H 4HIXL 1SMAA 2ARJQ 1JBJA 2VDNL 3QXWA 4PS4H 2ILLA 5INDB 1SY6H 2OQJA 3QDAA 4JFFE 1JGDA 2GT9B 3QIBA 1TZGH 4Y19D 4Z7WF 3RL1A 3QUXC 3SKOA 1G7IA 2WBJC 3H7LA 3MRIA 2NY0D 4MJIB 4X0KB 5F9OL 3U0TA 4XHJC 4P2CG 1G1YA 1GPOH 3E6FB 3NABH 1FVCB 4NQDE 4CJ0A 4QT5A 3U7YL 1XGTA 2DBLH 1DTUA 3R0MA 4QRPD 3KAAA 1NMAL 1ZLVH 3MRBB 2ZZUT 4P46B 3BEWB 4U1JB 1OAYL 5I9QB 1EDQA 4Y4FA 3PWNB 1RK1A 3U2SA 2BVUA 5D2LB 4EI5A 3A6BL 1YYLH 1EVUA 1OF2A 3TH4T 4FABL 1U3HD 3HG1A 3O81A 1JPSL 4NWUH 2ZUTA 3KXFE 2YD5A 4HFUH 3D39B 3MO1A 2DLFL 4KI1A 4OJFH 5L88L 3FRUB 5B38B 4NRYA 3OKKA 4P2QD 1X7QA 1MAMH 2J5LB 4NOFA 2FX8L 3C5SA 4RFNC 5D1QD 3BRDA 1HOCA 1TPXB 1UKSA 5KVDL 3DECA 2X1OA 4LSRL 4QCIA 2G60H 4F57L 3F7QA 4OD2B 2FWOA 2X42A 1S7UB 4AEFA 5D4QA 4LVNB 2VLRB 4K7PH 5E56A 1I9RH 3RI5F 2D3VA 3VRIB 3FFDA 3ULUL 1J0KA 4IRZH 1CE6A 5BXFB 4FQCL 1KELL 4G6FB 4UQ2B 1RZIB 4NQCD 3MRRA 4U6YB 5H37G 3WUWA 2OZ4H 5BS0B 5GJSL 4ZNEA 3K2MC 4JZJB 4XI5D 3RZCB 4QF1A 3T09A 2BFVH 1JI1A 2EEAA 3VDBA 4U3XA 2HTLC 2NTFB 1OSZA 4YFLI 1H9VA 2ADIA 4UILL 1D7FA 5BJTB 2XTJD 1IGJB 1IGFH 4NO0D 2OM5A 3M1BA 4POUB 4OZHA 4QXWA 1DBJH 4NSKA 2WBWB 3VWKA 3X13A 2YEZA 3FB8B 43CAA 4Y5XC 3MR9B 5KANI 3OB0K 4Y1AB 3OZ9L 4H25B 2EYRA 2XRAL 3O3BB 1EUTA 3QFDA 4KUZL 4PBWD 2YD1A 2N4IA 1ZLVK 3LPWA 4MGXA 1IC1A 5AZ2L 4P99A 5I66B 2CRIA 2HT3C 2DWEB 3D2UA 3UZEA 3KR3L 5EPMB 4F7MA 4OKDA 5E94B 1CBVH 3DJ9A 1FAKT 2MHAA 2Y07H 3OJVC 4KHTH 4R97B 2CKNA 4L8SA 1JZ3A 1U8IA 3PWJA 3V52H 4BSJA 4TOYH 3MOAH 2DWDB 3ARSA 5B39A 4M6MH 3S4SB 2NY5H 3WYRA 4D9RD 3C87A 1DSFL 4M61B 1PQZB 3NFPB 4FA8A 2V2XA 4FQHB 2AI0L 1XF3A 3QIBC 4F3FB 3A67H 1MH5B 4PD4K 4RAVA 2CR6A 1IGMH 4OLWL 4L9LB 4X8JA 5AZEL 2H2SD 1O7VA 1QFHA 4Z7UB 1DQDL 2J3SA 4OLUH 3MRPA 3SCMC 4UNUA 3QDGB 1EH9A 4KTYA 1K5NA 1TVBA 4RGOH 1ZHKB 3MRJA 2ADJA 4DUWA 4Q2ZB 4Y4FC 3N0PB 4X7EC 3UZQA 1D5XA 3EOBB 4KKBC 1EEYB 2R2EA 3MRHA 3HE6D 3QI9A 1AD0B 2NW3B 1G7LA 5CZVH 4E41A 1KN4L 2W0PA 3BUTA 3SDDC 3FZUD 1MRFL 4PJGE 1JHKH 2F19L 1GIGH 3P4NA 3FO0H 4GW4A 3RY6C 1T1WA 5DMGC 5I16B 2NY6B 1N7MH 1BZ9A 1M71A 5E99H 1DQML 5F9JA 4IRJD 1FN4A 3PP3H 2G5RA 3PP4L 1D5IH 4K7FB 4TUOB 1HHJB 1G9NH 3N50A 3E0GA 4NT6A 4QRTB 3HZYB 3VA6A 2ZOLB 4PRAA 4RA0C 3VXMD 1D6EA 2FR4A 2X4RB 2AJSL 5E2TH 5ADOL 2I25N 4MMXC 3ULUD 2QR0A 4UTAH 5KVFL 4O4YL 1YN7B 5FGCE 4JPIB 1T6VN 4F7TA 1CIUA 4TQEL 4XWGL 2C3VA 2ATKB 4KWUA 4O9HL 3MFFB 3T0EC 2QHLA 1XF4A 1CDJA 4WW2A 4CW1B 1V8HA 4G8FA 1Z9MA 4PJ8C 1NANI 1BJ1H 4JFEA 5HI4C 2X4SB 4QXUH 2IPUK 5KSUA 4BQBA 1JZ5A 4YJZL 4DGVL 3OHXA 2EE3A 3HMWH 3WSQH 5IEKA 1JYNA 1ACYL 3RL2B 1UM5H 4NP4L 5D5MB 1FNEB 3Q3GB 4YXKH 3S34L 2MCPH 5TDOA 1MLBA 5BQ7A 1QSFD 3INUL 5TQ0L 4JFQB 4ZFOB 3H9HA 4Y4HD 2IH3A 1WFNA 1B4JL 1IC7L 3K81A 4NYLB 1F4WH 3TN0D 4LF3B 4BSWA 5DC0A 4KZEL 1R3JA 2IQ9L 2L0DA 3CZJA 3FN0H 1MFEH 4RBPK 1BREA 1PYWB 2OL3L 3GMMB 4X7SL 1MJ7L 3DETD 4GAGH 2EDHA 3GM0A 5KOMC 5KTEH 1DFBL 3STLA 4L3AA 4QRQA 1LO2L 5IEHA 1AGDB 1WFTA 4IIQB 2BVPB 4ZFGH 1S78D 1U8PA 4ODHL 3KXFD 2D2OA 3BESR 2D0HA 1NGWB 5JXEA 3ARPA 3EO9L 3QBTB 4ONHB 3GHBH 4LPXA 4G9FA 1GOGA 1HHGA 1K3ZA 3B3IB 5CZXD 5JPMB 3QCTL 3ZDYE 4I3RH 3TVMC 3RPIA 4W4NA 3QO1A 4BH8A 4DCQB 5CILL 1U8NB 4ZMAT 2EDEA 4ODSL 1OP9A 3WJLA 3BXNA 4GSDH 4K23H 3G5VB 3ZKQD 1OCWL 2QADD 3BPCB 5DYOB 3VE0B 5F1IB 4IOIB 4LEXH 5HI3C 3VXOA 4RSVA 1J18A 1IGIH 1U91B 4OZHF 1P6AB 4EUPH 4JKKA 1XR9A 2Y9RT 4PGZA 1URLA 3OKMB 5DD3H 3UZVB 2IWGA 3DUSA 3TIEB 3LIZH 3QHZL 5LGHH 2DM4A 1YEKL 1YEIH 4J3OC 2HFTA 3IDNB 3WFZA 4JY5L 3S37H 1R24A 4JQIL 4K2UH 2WM0A 3GSUA 3RAJH 5ID1B 5GISH 2DJUA 1DANU 5TE7H 4BELD 5FUOL 4EUPG 5JUEH 4LOUC 4MXWL 1CXLA 1VA9A 1WV7T 2EH8H 3UYRH 1N2RA 4PJ5A 3ABZA 5IR1A 4OGAC 3I50H 1NDMA 4JLRA 3FAXA 1ZT1A 4GS7B 4KI5D 2G9HA 3F58H 1FFNB 2ZUQB 1AC0A 5EU4B 3ELAT 1HQRB 4N1EA 1T7XA 4WCYH 5EU7C 1QRNB 4R96B 1BJMA 4YXHL 1YUHA 1KLUB 5DFVD 1JN6A 1B0GB 3HE7A 4JFYA 1UB5A 1G7HB 4MB3A 5IQ7H 5HD8C 2DJ4A 1IAII 1YMMB 4XZUB 4XTRD 4R8WL 2RGSA 1A0QL 2A6IB 2P42B 4PRPB 4S1DC 5CSGA 3FQRA 2NY4C 4CMMB 5EU5A 4X5XA 4M48H 1ZANH 4PG9B 3VXTA 2EO1A 1WBZB 5KJRH 2FECL 1KFAH 1LO0H 25C8H 5I8KH 3C6LD 3MLZH 3CVHH 4DEPC 5CD5C 5BRZE 1U42A 4UIMB 2FH8A 1PZ5A 4TUJA 3UTPE 1P84J 4Q97A 1JHLH 1U95A 3IS1X 3SJVD 2VLJE 3PE9A 2E9WA 4GKNB 1BIHA 4NQVA 2AV1B 5IT2L 2FGWL 1FCCA 1FYTD 2CIIA 2DLGA 4PGDB 1A6AA 2YPLE 4FQ1L 3S3SA 3MOBL 5F7WC 3GJFH 4AM0B 2PYFB 1WZKA 3OG6B 4QNPF 5GSRB 3UJTL 2DDQH 2KZWA 4HMDA 2HFFB 4J2XA 3WE6B 1OGAD 5A3ID 1JMXA 1YNTB 3WO4C 4PRIA 5BMFH 3RWCA 3HTLX 1NEZG 2BVQB 1KCUL 4KJQD 5MENA 1TITA 5DMIL 3CXDH 5DQ9B 3LQMA 2BY1A 1CF8H 5I30L 2IGFL 4TNWF 5GHWH 2V9TA 2FEEI 4WW2F 4RWYL 1A1NA 3GMRA 1IM9B 1BOGB 2DIJA 5DHYB 5M94B 3ZHKA 2VL5A 5ANME 3BN9D 3O4LB 2Z8RA 3WL9B 1VGEL 1CFQA 4AL8L 4M7LH 4MB5A 5C0EB 3G6DL 4AH2A 1NDGB 2DYPB 4YHML 1R5IA 4JO4L 2WQ8A 4JANA 1EHNA 3U46A 3QWQB 1K2DA 5ITBL 4NZRL 1MPAL 5DA0B 4HWNA 3QNYA 2Z93B 1CLZH 1NL0H 3MLSH 1KC5H 1KLGA 2JF1A 4OZFG 3ILQC 3BZFA 1CXFA 2VZVA 2AJZA 3RWGB 3SDAA 5SX5H 4M5YH 5I8CA 3PXHA 1CR9H 1JGLL 5IMMA 1AE6L 4ODVL 4DZBA 1NEUA 4JPWL 1AKJD 2HFEA 5E5RB 4LLYB 3C6SA 3L5WA 1UKTA 2ESVA 5C08E 1IAOA 2W0FB 2NX5E 4X7FC 4GRLC 3MXWL 4ETQA 3QQ9D 4EVNB 1QBLL 4GMSH 1JK8B 3HE7C 4PGBB 1FPTL 5DEGA 1SM3L 1FRGL 4BA8A 3DMMB 4KXZH 4JM2C 2YUZA 5JNYA 5HHMB 1MY7A 1I8IA 4XPTH 4DAGH 3MRGA 1IQDB 2R56L 3TGXA 1G6RL 3B6SB 3RTQB 4IMLA 3P0VL 3HNTH 4YBLC 3T3PF 3FQXB 3U48A 5EFIA 2ZJSH 3ZKMC 2DQIL 2VLKE 3CCHB 2HJKB 2A0LD 4KMTL 1CL7I 3BP4B 2BRQA 3L3HA 4ZS7H 5F96L 4XNYH 4G8IB 1EXUA 3GMPB 3UPRB 1ZWIB 5EIQA 2XY1A 3DV6A 2D7OA 2QSQA 5L2JA 2CLRA 1YY8A 1DDHB 1RZGB 3O41A 5IIEB 2RJMA 3H7BB 3HNVH 3QUYB 5C0DB 4HIXH 1U8KB 4PP1D 2AAVA 2H32A 2VDNH 5T5NG 2EYTA 1EEZB 3CC5B 1X5GA 4PJEB 1BQHB 1NC2D 1NMCC 1YJDL 3F12A 3FT4A 5GRUL 5IVZB 1A9BA 4CVZA 1RJLA 2GITB 3MLRL 4ZFZB 2R8SL 5F9OH 3QQ4B 1RUKL 3D0VB 4PJHE 4L5FL 3U7YH 5SWSE 3GSXB 1YEHL 2XWTB 4MS8C 4QO1A 3BQUA 1OAYH 1NFDE 4PJIE 2H3NB 3LQZA 4WDIA 4BZ2L 1WIPA 3A6BH 4PV8B 4FABH 1NGYA 1I8LC 1I7RA 4X7TB 1LE5A 1R5WA 1TZHB 5DHVH 4NKMA 1JPSH 2IEPA 3RUGE 3MFGB 4KPHL 5I71B 3W39A 4H26A 2MQ3A 4LAQL 3PL6C 5TDNB 2JJSC 3QHTC 5DJYA 2MWCA 2DLFH 4X4ME 4X4ZA 5C9JB 5L88H 4N8VA 3WLWD 2F8XC 4HDIB 3IDIB 3JV0A 2W07A 4MX7B 4NQXB 4I9WD 2OS7A 5KVDH 4LSRH 3UJIH 2UV3A 4NC1E 4F7CA 2CDFA 3UTSD 4PRDA 3SDAC 2KZ1B 3WXVL 4AG4L 1MIML 5CLWA 5C6PB 3ULUH 5ISZA 5GRZA 5J6GB 5HGDA 2VE6B 4FQCH 4UBDD 1KELH 3O3AA 1A14L 4R4ND 2IANE 4FZ8L 3UTPD 3FO9B 3SGEH 3LKSA 3VD7A 5FUCE 5GJSH 2MQ0A 1UYWL 2B4CL 2KQMA 4I3SL 5EIIB 1Q94B 1QLFB 4IRSB 3AS1A 1I8KB 5E8NB 2YPLD 5K93A 3PQYA 4R0LB 4F15C 4RZCB 2VZ3A 4UILH 3GUTB 1W0WA 3VW3H 4QYOA 3MPCA 1WFOA 4U05A 2Z8WC 3ARFB 3QNZA 1CXEA 4NFDA 3QIUC 3WJJA 3OZ9H 3FFCA 3L3DB 1RAMA 2PYEA 1MJUL 4JPVH 4YFLF 2XRAH 2YRLA 1QTYT 4KUZH 3QG6A 3TCLA 1TTUA 4P2RD 1HH6B 1VACA 5AZ2H 1C08A 4K07A 5C92A 3GNMH 4JDVA 2BVOB 2RFXA 5IB1B 1NC4B 1KTLA 2HJLB 5IBTL 5I73B 4LVHB 2E9JA 1CS6A 4NRXB 4MVBD 3L5IA 3C5JB 1KCVL 5EOCJ 1MLCB 7FABL 5EA0L 1K8DB 5FF6A 4NNPL 1X9QA 2FRGP 4EUPB 1MCIA 4XVJL 4K7PX 2P24A 2VWEC 2ZSWB 3GMLB 1DSFH 1IAKB 5D7SL 4OAWB 2FZ3A 3QFJB 3WNPA 2NNAA 1FFRA 4QTHB 4ZUUA 2AI0H 5KS9B 1OAUL 2F8VA 2E7BA 5A2IH 3IJHA 2GCYA 2DM2A 3UTQB 1F00I 5CJXC 5HYSG 1JJUA 4KRPC 3RWJA 4OLWH 4X7DC 5AZEH 4ZSOB 1NCCL 1II4E 3Q6FA 4FFZL 5EUKA 1DQDH 4N5UA 4Y5YA 1U8OA 4LMQE 1HNFA 3UYOD 4QGYA 5IB5B 1XGYL 5DRZB 4MNQA 2BP3A 3LHPL 5DI8A 3V5DB 1T3FA 4P59L 3JV6B 3ARED 5DVOA 2ZKHL 4MLSA 3WCYA 3BQUC 2K3TA 5IBLD 2F53D 2VXSL 3QUML 4OGXL 1GGIL 5C08D 3PGDA 3LMJL 2RBLA 2LFGA 3GSNL 4KAQL 2DB8A 4O00A 1CGYA 3QRGL 1MRFH 1AO7A 2F19H 1QFWI 2BSSB 4FTVD 4RFEA 1QSZA 3L5JA 3QPXL 1HH9A 1EO5A 4ZTPL 5KG9B 4P9HL 1DQMH 3OAUH 3PP4H 1G9MH 2IAMB 2XFXB 3LV3A 4TNVF 4BFIB 2W9EL 4G8GB 4QRRD 2VLKD 3DRQB 3BGMA 5E70A 5ADOH 3TCXA 4RDQF 4Y7MA 5FYJE 5F7DB 1WIUA 3OKLB 1EZVY 3KPSB 5I1IL 3AXLA 4O4YH 5KVFH 3DNKA 3BEVB 1Z6JT 4XWGH 4TQEH 3L5XH 4LSPL 3CX5K 5IW1B 4B53A 1LEGA 1SBSL 4O9HH 3WLBB 5C3TA 4PJXB 1T7ZA 1V3MA 2EDWA 2DS4A 1QBML 1Y6MR 4DGVH 4WU5A 1NEZB 3EJYD 4UT6L 4X9GA 1Q9LA 4J3XA 1S9XA 5GGRB 1TCRA 5IHZA 1ACYH 4YLQT 4NP4H 4FMKA 4NKOB 5AD0A 2WW8A 3PABB 1A9EB 3I85A 3ZKND 4AIOA 1HHKB 4F58L 3FCTB 4CVXB 4U1GB 2R2HB 5JW4M 4U1MB 5TQ0H 1X5LA 4GW1B 4YK4B 2V7NB 1YY9D 3K8MA 1B4JH 1IC7H 1IKFL 3ILPA 1WQVT 5C0IB 5SV4A 2J4WL 1QKZL 2FLRT 4HGMA 4KV5F 3RVTD 3EO1A 2ADGA 5HXMA 4KZEH 2IQ9H 3VFSA 4LGSB 3DTXB 3TJHD 1NCUA 4CN4A 4QRPB 1ONQA 2OL3H 3RGVB 2BSED 3VU2A 4X7SH 1MJ7H 2VC2H 2DQCL 1N5AA 3TO2B 4Y2DC 1UM6L 1IZJA 4HIIA 3DSFH 4PD4J 1LO2H 5J6HA 1UJTA 4OZFB 3OXRB 4U2YA 2C1OA 1T89A 4Z7QF 2IBBA 3MODL 1U3HB 3IF1B 4GG6A 4WFFE 4ODHH 2HKFL 3ARYA 2XPGA 2R2BA 2EH7L 2YD3A 4LARL 1LDPL 5F6IB 4OZIB 2FJFA 4R7NB 2R1XB 3EO9H 3IFLL 3JVGA 1PG7L 5GXBB 3L95A 2R23A 4P48A 4PJCA 3SDXB 4X80L 3QCTH 2YBRB 4G43B 4GRMB 3VWJA 1Q9OA 1I85C 3O45A 3RX7A 3ZDXF 3W9EB 5DD1L 2NXZB 5CILH 4BQ9A 3SGJA 2C9AA 2OTWB 2Z91A 3FOMA 4HS8L 1DVFC 1YPZB 4X5WB 3QDMA 1OSPL 2W0KA 4P23A 5MI0B 1OCWH 1KJ2L 4JHAL 2CSPA 3KWWB 5HHVH 2WIIB 1CDUA 3MV7A 1YQ2A 1YA5A 3CFBB 4NO5A 5E2UL 4NQCB 1ES0A 3TEUA 2QSCL 3MBEB 1G7QA 3MGTA 4YZFE 4HXAL 4NDMA 2CKBA 5ECJE 3QHZH 1SEBA 3FO1A 5B8CB 1JGUL 1YEKH 4KJWD 4HSQA 4Z7VA 2CLZB 5FGSA 2P1YA 1F02I 2VISA 3T0XA 4HUVB 3V95A 4JQIH 5ID0B 1PW3A 5C0AA 3EOTL 1J0JA 1KIRB 1G0XA 5FUOH 1U58B 3LD8B 3OF6A 2AV7B 3ECBA 4JY4A 4Y5VB 5IM7A 4PGJA 4PGCB 1KBGL 4QHLA 4U1LA 4JO2L 1AQDA 4JRXB 4Z77B 3DIFA 4PBXA 5M95B 1SJHB 4YXHH 5T1LB 4OQTA 2X1XR 5A16B 3DYPA 3OXSB 3QI9D 3MYZA 1H3VA 1T80A 1W72B 3MRFB 2C4FU 1D9KD 2GUOB 2WSKA 3GKZA 3NIDF 5DVMA 1CVSC 5DJ8A 3S7GA 4Y4KD 1JNHA 2AERT 1OL0A 4FFVC 2R1YA 1LILA 1OHQA 1X3DA 5C0GA 2BNUB 1PX4A 1P6FA 32C2A 3S88L 4L4TE 5I18L 3RY4A 1EFQA 4HHAA 1EBPA 3PDGA 2J6EL 1V7ML 3PV7A 4WU7B 1NAML 2P47B 5DT1H 4HAGA 5E9DE 5IB2B 2KPNA 3BPNB 1M1SA 3DUUA 3EYSL 3MUY1 4JFHE 4UOW1 4R6UA 3EFDL 1NGPH 5HHNA 5IT2H 3L9RB 1EO7A 2FGWH 2BHUA 3D25B 5BZWB 4YDLC 3S37X 5CBEA 2YUWA 5GS1A 1YYMH 4FQ1H 1SJXA 1NJ9B 3LAFA 1WITA 1ERNA 4JFED 2NZ9C 5DHVB 5A43C 3NGBB 3BMVA 3G5ZB 5D96B 1KJ3H 4JKMA 5F93C 4U31A 2C1PA 1JWSA 5DZLA 3V5KA 4KK5D 4UUJA 1F3DJ 4RGND 3MREB 5SV3A 4LSQL 5C0JA 4OLVL 2ORBL 4XCEA 3BYYA 5HHOE 4IRJB 5DJDB 2F58L 4MJ5A 3S3JA 1BJ8A 5ITFA 3MJ9L 3T4YB 5EBWB 1KCUH 1U8HA 1VADA 4LEOB 5IB4B 5HGBB 5I30H 3SGJC 5JPNB 1MJJB 2IGFH 2YWZA 4RWYH 4IJ3B 4M5ZL 4OCRL 4HJGA 2VQTA 4WFHD 1VGEH 3MRDA 4F37F 1FBIL 1UGNA 3C9NB 3CH1A 3G6DH 1NQBA 3BZ4B 5DRWB 2EDLA 5INDA 2VH5H 4YHMH 4JO4H 1ZT4B 3PWLB 4OLYL 4Q9QL 3RJDA 1IEAB 2GT9A 3RVXC 1MI5E 5D93B 3DGGA 4NZRH 3ESUF 1MPAH 5ITBH 3I6KB 1TQCC 2BHYA 3O6FB 4JFFB 5JXED 1ZSDB 4LLQB 3QWRA 2YD6A 4R90L 3I6GB 2MPAL 5J13B 1JGLH 2EXYC 4JKPL 1AE6H 4ODVH 3RNQB 2GI7A 4LNVA 5D1ZC 4JPWH 3MRBA 4P46A 3BSZL 2CUHA 4U1JA 4NQDB 1KB5H 2H45A 1QFOA 2QQLH 1HDMA 3PWNA 3TN0B 3EYVB 5D7LD 2ZNWA 3Q6GL 2A74B 2MSPA 5D2LA 1S7SA 4GG6F 5B3JF 4E9LA 4M8QB 2H6PB 1BBDL 3B43A 3MXWH 4R4FL 1JYVA 1KTRL 3PUCA 5HYSB 4L3ED 4XNXL 5JDSB 1CZ8L 4WHCA 1SM3H 5FHBL 5B38A 1FRGH 4WFFD 1DE4B 4PJCF 5HDQL 2E7HA 4UINL 3KXFB 5L0QB 6FABL 2R56H 2FJHB 1P4LA 4YHZL 1BVKA 2Z8SA 3P0VH 3N1MC 4Y16A 1H8NA 1BLNB 4J23A 4OD2A 4HQQL 3Q0HA 5INCA 3I75B 2DQIH 1IC5L 4F7PB 3HRPA 1U8QB 3MNVB 4ONGL 4OFPA 4HGKC 1CN4A 1FZOA 4IHOB 4PJAE 3K74B 4KMTH 3NA9H 3RVVD 5F96H 3U4AA 3CFCL 4UQ2A 3LS5L 3BH8A 2EE9A 5BS0A 3HZMB 4ZAKB 3VD3A 2X9XA 1DUZB 4JZJA 3RI5K 2BRRH 2X4QB 3WD5H 4APQB 3RZCA 3U0WL 3S5LA 3SGDI 4MAYB 4Z7VF 2NTFA 2OXGA 3BO8A 3MJ8B 2ICEB 1MQKL 5I17B 3LRSB 2FHBA 4BJLA 1A7PH 3SDYL 4JRYA 3FB8A 1GGCL 2ZG2A 1YJDH 1TETL 4KK9D 3MR9A 3N1PC 5GRUH 4HUMB 3VXSD 3MLRH 3TFKC 2R8SH 4JFXB 3O2VL 3O3BA 1RUKH 4Z76A 1FO0L 4UV4L 4OZGA 3FQNA 2DQGL 2R39A 4L5FH 5I66A 2DWEA 1YEHH 1JZ4A 4UQ3B 1ACZA 3LSOB 3QZWB 4C59B 3F6LA 4MB4A 3WHXB 3RKDC 1AGBB 4BZ2H 5BW7A 1S5HB 2NY2B 4LVOB 4JQXA 3IDUA 3LKPB 2YSSA 2EIZA 2DWDA 3K2UL 3I3EA 2ZG1A 3S4SA 4LNRB 3QDJE 2FBOJ 1BM3L 4LAQH 5CCKL 2O5ZL 4M61A 3IXAA 1YEJL 2FCBA 3KNBB 1NH6A 3TZVD 3A0OA 4FQHA 5CGYC 4ZODA 2IPUG 4PBVC 4KQ3H 2X41A 1MH5A 2XNAB 3O6ML 4E0RB 2QBWA 3VGFA 3CFDB 1MFAL 1KYOK 5FK9A 2CMRL 4YIQB 1FL6B 2ICWJ 4PRID 4KKAC 4LCWA 3BT2L 3QP3A 2FJGA 3RBSA 4FQQA 2AK4E 3BWUC 4J6RL 1EEUA 1EX0A 2NMSA 1MIMH 3QG7L 3SPVB 3WS3B 3WXVH 4AG4H 1S7QB 4XCYA 2IPTH 4R2GC 5ERWA 2HJFB 5JW4R 4GMTH 1A47A 1RJCA 3T2PA 4Q2ZA 4D3CH 5I9QC 3EOBA 2X4UB 1EEYA 2OL3B 1UYWH 4NCC1 4RQQB 5DS8B 4I3SH 4WEBL 3L6FB 5J3HC 1AD0A 3KPRE 1BWWA 3NCFB 4PJDE 3JWOC 3BFOA 3BOVA 3TWCL 4LBEB 3U9UA 5EO0B 5I16A 2PTVA 1NBZA 3ZTNL 1HYSC 1KGCE 5I1DA 1LO5A 4PJGB 2J1KA 5E8PB 4X6FB 3R8QA 4K7FA 5C86A 3TNMB 2DBJA 1RK0B 3RPKA 2NLJB 1QSED 4MA3B 4AYFA 2MKLC 2D9QB 4QRTA 4UV7L 3HZYA 1ZVSB 2ZOLA 4YEEA 5JTWA 4Y16C 1FSKB 1MJUH 3S35L 1WC7B 3ZT6A 5IQ9B 1F8TH 3HZVA 1RHFA 1D5MB 4JPIA 3GSWB 3C5ZC 1JPGA 2ATKA 5IBTH 2YUXA 3ARDB 2EDTA 3O9WB 3MFFA 5FGCB 1WWCA 3RNKB 3PHQB 4CW1A 2VN7A 3ZHDA 1X5HA 4AY0A 4PJFE 1KCVH 3RX8A 2X4SA 1J1OL 4XGZB 7FABH 3RZCC 4OCXL 5DJCB 5DTFA 4NNPH 4XAKE 4P2OC 3QEGL 4ZS6D 3DRTB 1EK3A 4XVJH 4ZYKB 4QHUB 2AJ3A 1SHMA 3HLAA 4Z0XA 1INQA 3UBXG 1BFOB 2R0ZL 5D7SH 5D5MA 4PJBE 1FNEA 3Q3GA 1AIFB 4LDOB 1J0IA 4D0CB 4BQ6A 1P69B 4FQPA 5FV1L 3BX7C 4IMKA 5KW9L 3BPLB 1F4HA 4JFQA 2OTUB 4WI7A 5DK0B 4FFZH 4NYLA 2EZ0C 2VITB 3IFPB 4LF3A 5D2LF 5FCSH 1UJ3B 2E7MA 3Q2CA 4EZMA 3X12B 4J3SA 1XGYH 3LHPH 4PRHE 4P59H 3T2QA 3QO0A 4HKZB 5DUBB 2ZKHH 4FG6C 3TO4B 4PR5B 2VXSH 3QUMH 4OGXH 4UOW0 3NH7L 5E24E 1GGIH 4XMKL 1AGDA 3IXTB 5BW7C 4Y0GA 4Q0XL 4KAQH 2VABA 3DBXB 4JQXC 3QRGH 4XMPL 5FO7B 2WK2A 5FAAA 5FYKE 1PKQE 4CKVX 1KPRB 3KYAA 5TE6L 3QPXH 4ONHA 1J1PL 4ZTPH 4P9HH 1DJSA 3MJ6A 3GGWB 5LGKA 1K4DB 3LB6D 1EJ6A 2DN7A 1LDSA 2W9EH 4DCQA 1U8NA 1P1ZB 3NACL 3HAEA 1LQSR 2GYSA 2B5IC 3ALPA 1IQWL 1A7QL 3GHEL 3AS3A 2QTEA 1JTTA 1ZA3B 4XVUC 5ESQB 1A2YB 5K59F 3BPCA 4XNZC 5DYOA 3VE0A 5F1IA 4IOIA 5A40E 2ZG3A 3MRMA 4RRPA 4LSPH 4UOJA 2APXA 4O2FA 1SBSH 4PLNC 1N8ZB 1Y0LB 4N0FA 2PW2B 4BQCA 1ITCA 1QBMH 1A6VL 4X4XA 3IVKB 3PGFL 1VGKA 3DX9A 3FRPA 4UT6H 4EOWL 2K7QA 2YZ8A 3NFNB 4LK4A 4OZGF 2WQRA 2O26U 3UAJD 3EYOB 3O4OB 4F58H 3UTTD 3QXUA 3ALXA 4MD0B 3TA3A 3G08A 4WWKB 4FS0A 2JK5A 3C8KB 5ABDE 1IKFH 1GGUA 5GS0D 2J4WH 1QKZH 1NLBL 4GBXB 4I2XE 3QHFL 5J8OA 5DWUL 1I8MA 12E8L 1SYSB 4PP2B 5ISZD 1QRNA 2DQCH 4R96A 1KLUA 3CSYB 4RNRB 1UM6H 1B0GA 5FKAB 4GKZA 4KMQA 1G7HA 1MWAL 1YMMA 1E4XL 3WMSA 1KCRL 4L8DB 3MODH 4HWEL 3MJ7A 4JY6A 4Z0BL 2E6QA 3RWEA 3JUZA 2HKFH 5EO9B 3JBG7 1I3GL 4KGLA 2A6IA 4LPWA 2EH7H 3ZE0F 4WENB 4LARH 1LDPH 1KIQA 2CDEB 1MHCA 4DFHA 4ODBD 3AS2A 3IFLH 2D7QA 4MCYA 4CMMA 4HULB 4MXVF 4KJYA 4H5SA 4NCDA 4PG9A 3TYFB 1PG7H 3H3KA 4HJ0C 3AGVA 1RZJC 1CICD 4N9GA 2FEEL 4X80H 4KDTA 4IMKC 3PWUB 3FFCD 4JO3L 1BIIB 5DD1H 2PYED 1T21B 4N0RA 1AJ7L 4FQXA 3MQIA 1V3JA 4HS8H 3UTSB 4YUEL 2OR7A 2F15A 1OSPH 1BD2D 3CK0L 5CJOL 5DD0L 5BRZB 1KJ2H 1YEEL 4JHAH 2AV1A 4U3CA 4PGDA 5E2UH 2BNQE 1FNAA 2QSCH 2VLJB 3ORJA 4FOMA 3ARUA 2VDLL 5SX4H 3KPRD 3QEQE 1F97A 4AM0A 2BK8A 4K9EC 1VKXA 2PYFA 2VTFA 2YPLB 4HXAH 2FX7L 5ADPL 2O93L 5GSRA 1L6XA 5CMAB 4HUXB 5B22A 2VXQL 1AXSA 1T1ZB 2IG2L 1Y6KR 2HFFA 3WE6A 1EEQA 1YNTA 3EOTH 3IT8D 1G6RB 3IAPA 4AEHL 3CX5J 3VXQA 1V7NL 2VZTA 4NO2A 3DROA 2GJZB 2HT4C 3WIFB 2P8PA 1VENA 3UTZB 2F5BL 4GJTB 1KBGH 3ZKXB 3VXNA 2B2XL 2Y5TB 3MX0A 1BOGA 1QD0A 5DHYA 3G9VA 4GAJL 1FJ1A 4JO2H 1B90A 2A83B 3O4LA 3FL7A 1WLHA 3H9SE 4LFHG 3WL9A 2OZ4A 5DLML 1GC1C 4HBQA 4N5ED 4XXDB 1NDGA 2DYPA 1UM4L 1DP0A 5M7QA 4L4VA 5ANMB 4TNWK 1IE5A 5D5MF 4G9DB 1GJIA 1CDCA 5B4MD 1J5OL 1XF2B 2Q7NA 2OCFD 1K8IB 1O5DT 4I13B 2EDOA 3L3OA 2AEWA 5JZ7C 3G5YB 1L0QA 3KLAB 1JYWA 1J0YA 5I1HL 5I6XB 3O2WL 4CGTA 3S88H 5IHBA 3L7EB 5I18H 1RZ8B 3TA3C 4OI9A 1FVDB 3SDCB 2E6JA 2J6EH 1V7MH 1T5XB 3SBWA 1E4KA 1QHOA 4GS7C 1MCKA 2HKHL 3EYSH 5CINH 3C8DA 5DUPL 2ITCA 5JO5B 3CFIC 1KUMA 1A7OL 3AU1B 1QSVA 3EFDH 4HUNB 1A5FL 2W0FA 1LHZA 1U6AL 4U0QB 3ZTJH 4F8QA 1U8MB 5C08B 1JK8A 2QKIB 4PGEA 1RULL 2Q86A 2BZDA 3DMMA 2NX5B 3BGFC 4KVNL 4PTUB 1KOAA 2BOBB 2CUMA 1HI6B 2OJZL 3OTTA 4D0BA 2FHFA 4I0PB 3EDJA 4MDJA 1I1AC 3THML 3RTQA 4IEFB 4FTVB 3MNWA 5C0BE 1ZT7B 3FQXA 4XRCA 4LSQH 3FT2B 4OLVH 1EHXA 2ORBH 2HJKA 3MJ9H 2ENYA 3BP4A 4LSUL 3BP7B 4G8IA 5GIRB 3GMPA 1OP3K 3HC4L 3UPRA 1MHPL 5HPOA 2VLKB 3KDMA 4EN3C 1ZWIA 3MRQB 1ETZB 4FQXC 3HG1E 1KB9K 4XPBL 4OCRH 3H42L 4TVSa 8FABA 1JYXA 2DKSA 1PFCA 4O5LL 1R0AH 3MLWL 1FBIH 5C0DA 1U8KA 2D7TL 4HUWA 4ONFL 1CGTA 1HYRC 5SWQB 2R0WL 4JDZB 4OLYH 1NUGA 2VDML 5DD6B 1L7TL 2XTLA 3VFPB 4X7CC 1BQHA 2EC9T 2ZOKB 1JF5A 1N5YL 4FNLL 2X4PB 1I1FB 1A1OB 5EN2B 3VG9B 3QQ4A 4R90H 1QVOA 3DGCR 1WCBA 3D0VA 3E6HB 1NCAL 2MPAH 3VWJD 3R8BB 2JIXA 3GSXA 3T0EE 2XWTA 4JKPH 2PNDA 2C5DC 1GSMA 2EIDA 2H3NA 4HUUA 4Q9RL 4PJHB 3QDMD 5SWSB 3Q6GH 4U7SA 4WI4A 3B9KA 3UBXB 1GAFL 4PV8A 1NFDB 1FFQA 4LCUB 1BBDH 2YUVA 1TZHA 3VFTB 5F3BA 3DXAE 4NQEA 4R4FH 4U0RC 4X5LA 4ERSH 1MRDH 5TDNA 4WI5A 4XNXH 1CZ8H 2UY6A 5FHBH 3FOLB 4P4RA 3HMXA 5HDQH 3RUGB 4MX7A 2FL5B 4PV9A 4UINH 4NQXA 1A8JH 3U4EB 1I3VA 6FABH 1A6PA 3GBML 4J4PA 1WZMA 4LKXA 4HG4K 3HRZB 4Q9BA 1AFVL 4HQQH 3N1FC 1L7IL 5LCVL 3BRFA 4ONGH 3U1SL 1UKQA 3OF6D 3SE4A 5K9KA 4LSTL 1L9MA 3T3ME 2X1QA 2X1WL 5J6GA 1HQ4B 2HA1A 3CFCH 4U6HB 3LS5H 3FO9A 3SBWC 1E4KC 1MVUB 15C8L 4IOFD 3VRLE 4YWGL 4C55A 5EIIA 1Q94A 4IRSA 2CRMA 2YD9A 1I8KA 3ARBA 1LD9A 2IANB 3T4AB 3BH9B 2FH6A 3U0WH 3IDJB 2NXYC 4ZXBC 5F9DC 4WGVB 1UA6L 1XGRB 3GSNB 5E4EB 2GAZB 4WFGE 2D0GA 1MAKA 4XBEL 1MQKH 5GGQL 1W2KT 5TFSL 2WWMD 1P7KA 4UAOB 3SDYH 3WS6A 2M26A 2PCPB 2NY5C 4B0MM 1GGCH 3C60C 4QHMB 4MWFB 1TETH 4L8BB 1J12A 3NPSB 3NZHL 2XOTA 3O8XB 4WTWA 3O2VH 1QBAA 3ULVL 1FO0H 4UV4H 2LU7A 3PHOB 2IQAA 2DQGH 1MF2L 3JTSB 1G9EA 2GJ6E 2BVOA 5IB1A 4HF5L 1MIEL 1NC4A 2HJLA 4U6VL 4DN4L 1CLOL 2HTLD 5F9AC 2GTZB 1QFWL 2X7LB 2AEPL 3U4BL 5CSBA 1T5WB 1K8DA 3MV8D 1G0DA 3BDXA 3K2UH 4EUPA 35C8L 1LP9A 2XG4A 5CCKH 1BM3H 3GMLA 2O5ZH 3RZWA 1YEJH 4QNPE 4H0HB 4QTHA 3ES6B 5KSAA 1QEWB 2LQRA 5KS9A 1FDLL 3PHSA 2VDOL 4CNIB 1RMFL 4Y4KB 1I1CA 3O6MH 4NZDA 3QXVA 1MFAH 3GSQA 5EU7E 4ZSOA 5FOBB 4JFDD 5FYLL 3DVFA 1G9NC 1I1YB 3MUJA 3BHBA 1HSBB 5JW5A 3ROLB 3ME0A 1TNNA 3UO1L 1H3WM 1CFSB 2NY3B 3GDBA 5D7JB 3C2AH 4K3HA 4WEBH 3B9KC 5T3ZH 4XB7A 3RVUD 3T2NL 3TBWA 5T3XE 1WWWX 1ODAA 4KTEL 1NBYB 1IRAY 2HVKA 3G5XB 4A6YB 2BSSA 3MLTA 5KG9A 3STBA 2HT2D 4ZUTB 1RUAL 1NFIA 5GZNC 3SCMD 2IAMA 1M05B 2XFXA 3DX7B 5C0BD 5KOVC 4BFIA 4UV7H 4CN6A 4NNXA 4MJID 4XVSL 2ATPB 4FXKA 1IGCL 1NCTA 3S35H 2YA0A 3QWRD 3CUPB 5IG7B 4KKBD 4X9BA 5F7DA 5JW4N 3OKLA 5ICXB 4JRWA 3KPPB 5GS0H 5DJXA 3KG5A 2F9BT 3BEVA 2ZUYA 3HUJE 4HXBL 4P46D 1F5WA 4P4KB 3UX9B 4TNVK 2ICWB 2P5WE 5IW1A 2W59A 1KJ2B 3WLBA 5IMOA 4Z5RB 3D3VA 5FA4B 3T04D 1MCLA 3C09B 3K3QA 3ARBC 4M6AA 1Q9KB 4KHXL 5E2JA 3ZT7A 1J1OH 1I9EA 4OCXH 3QIWC 4FQIL 3GJFA 1CGVA 3QEGH 4G9FE 3S8WA 4N68A 1ORSB 3D39D 5CD3B 1F6FB 3B83A 3BKYL 5GGRA 2R0ZH 5JMRA 3WS6C 1JE6A 4C56E 3PABA 4RFOL 4ZDHB 1A9EA 5KN5B 1HHKA 3EUUA 4CVXA 5KW9H 2R2HA 1RFDL 2KH2B 4U1MA 4GW1A 4OTXL 4MQTB 2V7NA 3TPUA 3ULVD 3GMOB 3FQUB 4OD1L 5C0IA 2HWZL 2VLRD 1J86A 4HH9B 4OCYL 4DKDC 1H3UA 4WO4D 4MXQC 4QRPA 4PJ8D 2YC1B 3D48R 4GW5B 4G6FD 4M7ZB 2XWJA 4WUUE 3NH7H 4K7PY 4XMKH 3RWDB 4OZFA 3UDWC 4ZUSB 4J8RA 4Q0XH 3EO0B 4I18B 3DXAD 1U3HA 3IF1A 4XMPH 1QRKA 2PF6A 4TSCL 1XCTB 4YFEA 4DZ8B 4IOSD 5TE6H 4OZIA 2R1XA 5H94B 1X4YA 1J1PH 1XGPA 5FGBA 1F11B 5KSAC 3WNOA 4Z7NF 2OX5A 4Z7OE 3SDXA 4OFVA 2HYMA 2V5YA 5D1QA 3ZO0A 2YBRA 1HINL 1J10A 4G43A 4GRMA 4C4KO 4Y1AD 5FYLD 3W9EA 1AHWB 1JUFB 1KIUA 3NACH 4ZFOL 4WGWB 1YPZA 3GBLA 4ZTOL 3GHEH 4X5WA 5CUSL 2Q3ZA 3REVA 1R3KB 3IDXL 3QJFA 1CT8A 1NAMB 4L3CA 2R15A 2B7DT 5KSVA 2WIIA 3CD4A 2Z31B 1IAIH 1M7XA 4NQCA 3H8NA 2OSLB 4KROB 2X9YA 2EKJA 3MBEA 1U93B 1ZVHA 3KYNB 5HI5D 2EDBA 1J8HE 1A6VH 3CMGA 3PGFH 1BZ7A 5B8CA 2COQA 5J9PB 1E6JL 5E6IC 1TQBB 3TVMD 1KJMA 2CLZA 5E2VL 4NO0A 5HYIA 4EOWH 5ID0A 4M7KL 3WXWL 1KIRA 1A6TA 5T5FL 3BMWA 1BQSA 2IAMC 2AQ3A 3RDTC 2AV7A 43C9B 1J0ZA 2GHWB 3ARZA 5EZLB 1D5ZB 4LLWB 1J7VR 4F8TA 4Q6IA 2YA2A 2HG5A 1NMBL 4H20L 4BK4A 1NLBH 3QUZC 4XP4H 1HEZB 1OW0A 3QDGD 3QHFH 1ZGLM 4Z77A 1ZLUH 5DWUH 3ZT5A 12E8H 5HYEA 2HTKD 1G7MB 1LP9F 1JNJA 5I1GL 3L3KB 2JB6B 5T1LA 1A4JB 3MLYL 5A16A 4BH7B 1GZQB 1MWAH 1Z9OA 1KCRH 1W72A 4GLRI 3MRFA 2DQTL 5IVXE 5KS9F 3EDEA 4HCRL 4HWEH 4Z0BH 4HS3B 2P7TA 5ESVB 1I3GH 3EYFB 2ERJB 4NUGL 4CU8A 3MV01 5EC1A 3ARWA 4K3JL 5HGHB 2OR9L 5MENE 3DX6B 2NY6D 1OVZA 1EERB 2VAJA 2VL4A 3KYKL 1NAKL 4AIXA 2BNUA 2GIYA 3X17A 3OAYK 1M6OA 1VEMA 3D69B 1WCQA 2NY0C 2WANA 4JO3H 2Y06H 3NMEA 1LK3L 2BERA 2DQHL 3OWEA 5A1AA 5EBLA 2LV4A 1AJ7H 4HBCL 5IB2A 2BSTB 4L4TB 5EOTB 3QRFM 4YUEH 4F9LC 4D0DB 4X99A 3CAFA 4QHNB 3CK0H 5CJOH 5DD0H 1YEEH 3L9RA 5E9DB 3QCUL 3EOAB 1CQKA 1QR1B 3U82B 3PGCA 1ORQB 1E28B 5IMLB 3HE6A 5TDPB 5IK3A 2VDLH 4FFWD 1XR8B 2O5XL 4XC1L 5DHVA 1NCNA 2RAMA 2FX7H 5ADPH 4LIQE 3SKNA 4CJ1A 3LEXA 2P46B 4H88L 5CHNB 4GFTB 2VXQH 3OL2A 4OFIA 2A2QT 2JJTA 3BAEH 1T7YA 1JHTB 3U0PA 2XZAL 2IG2H 3MREA 3GO1L 3LQAL 4HKXA 2HN7A 4AEHH 4IRJA 5DJDA 1GZPB 3U30C 1V7NH 3BDYL 4S2SB 5D1QC 1XH3B 5EBWA 3WIHL 3KS0J 4HS6B 1T83C 2ESVE 5IB4A 1H3PL 5HGBA 3VFWB 2F5BH 5HHOB 1R3LB 5JPNA 3S96A 2XXCB 5MP6L 1YZZA 5MI0C 4J3WA 2P5WD 2Q8BL 2Z8VC 4OD3L 3C9NA 3PWPE 2W92A 5DRWA 4JZOB 1PG7X 2CDGA 3PWLA 1DQTA 2XN9E 5J7CC 1IEAA 4XI5C 3FQWB 1ZVYA 4CAGA 1J5OH 2XA3A 4F37K 3I6KA 4XCCL 4RISL 5EC2B 3K4AA 5B8CC 4YQXL 5GGSA 2R1WB 1U8JB 4D8PB 2LAGB 2XTJC 1MI5B 2NW2A 3NAAL 4C56D 4LLQA 3VGAC 5I1HH 3W11C 3WN5B 5ACZA 5JHLL 4OCWL 3I6GA 4RMQA 5BV7B 4KUCF 3D0LA 4Y4HA 1FO0B 4NQDA 4Q6IC 3QXAA 4XC3L 3TN0A 5GJTL 3EYVA 2HKHH 2A74A 5L2KE 1OW0C 4MSWB 5DUPH 1A7OH 4DTGL 3GSRB 1A5FH 4M8QA 5DRXA 1S8DB 4OZIF 3D5OF 4RCAA 5HYSA 5I75B 2VKXA 1RULH 3HS0A 1B0WA 1DE4A 4KVNH 4YHNB 3SDXF 4L1DA 2OJZH 3BP5B 3KXFA 1Q9WA 1JWUB 1HSAB 3THMH 3BPOB 1BLNA 2J8OA 4I3GA 2V2WB 1YPZF 4Q9CA 4BUHA 3I75A 4F7PA 3MNVA 4ZQKB 4IHOA 1TLKA 3CVIL 4RAUB 3IDGB 1O0VA 1FZKA 3MROA 1CIDA 2H2SC 3GMNA 3HC4H 4QY8B 1MHPH 3SOBL 4RMVA 4GRLD 1EA9C 4YC2C 4B50A 4XPBH 3CPLB 4PJAB 3HZMA 4ZAKA 5I0ZA 3BPNC 1YDPB 3FO2B 3H42H 1AD9B 4JGUA 4O5LH 1DUZA 3WHE1 5IF0A 2X4QA 5I74C 3MLWH 4APQA 2BNRE 3TP4A 1SJVA 1AC6A 4NBYB 4DWHA 4Z7QE 2R0WH 2W0LA 3HE6C 1YMMD 2ICEA 2VDMH 3MJ8A 3DVNA 4Z78A 3SN6N 5FO8B 1OGTB 3EHBC 5TQ2L 4JHZA 3FZUC 2IALB 1N5YH 4PRPD 4KRNA 4FNLH 1XF1A 2DQFB 3BRGC 1LNUB 4BFEA 3KJ4B 2XZCH 1CCZA 2ZCLL 3IU3B 1UG9A 3TPKA 1UH3A 3VDAA 2V2TB 4B5EA 1NCAH 4PJ9B 5D72L 1C1EL 5E00B 1QNZL 2X4TA 4UQ3A 1BF8A 3P9MB 4LL9A 1QLEL 1CFNB 3QZWA 4Q9RH 3PQYE 5GRXG 3P4MB 1WBXA 4I48B 4NN5B 2N56A 3F6IA 3P77B 4NCC2 1KNOB 1GAFH 2FO4B 3M45A 1JZ6A 1N59B 3X14B 1JF1A 2AW2A 5F97E 3LKPA 3QNXA 3OPZH 3VI3F 1T1XB 1T22A 3HR6A 5ETUB 3OBAA 1F13A 4HKBB 2DL9A 4LDLB 3BVNA 4IS6A 1M7DB 3QDJB 2XNAA 3GBMH 4D9QE 1UWXK 1NBQA 4MS8D 2R0KL 5ALCH 4YIQA 5GGRY 5MEOB 1AFVH 2YK1L 5LCVH 3U1SH 4DKEL 2DRUA 5T1KB 1BOYA 2WINB 3R06B 1S7QA 3C6LA 1LEKB 2HJFA 4Y4HC 3PNWA 3IFNL 3E2HB 3TN0C 1IM9D 2AK4B 3OKNB 2OL3A 15C8H 4RQQA 5DS8A 1HE7A 4YWGH 1DLHB 3G6AB 1AI1L 3RWHA 3L6FA 4DGYL 4FQ2L 1BQLL 3DETC 1FYTA 2YD8A 1J05B 4JN2B 4UMGA 5L6YL 4IM8A 5F7FA 2FD6L 1UA6H 4X6BB 3TBSB 5I1LB 2Q87A 2X4NB 3JV4A 3MUGB 3KPRB 4LBEA 4XBEH 5GGQH 5EO0A 4GQPH 2ZP0T 1MSPA 5TFSH 5F7UA 4PJGA 5E5UB 4PJDB 4X6FA 3TJEL 1KB9J 4M1CD 1NCWH 1RZ7H 1RK0A 3HMXL 2NLJA 4MA3A 4WRLA 4XPGH 1ZVSA 4MNQE 3ULUF 2E7LC 1OGAA 1WC7A 5HHPB 5I1KL 5IQ9A 3ULVH 4OM0L 3PDDA 5FYJU 1FE8L 5DJ0A 3DARA 1D5MA 2WIMA 4GXVH 5H35B 4ZO7A 1MF2H 3GSWA 4S0TD 1HZHL 5DFWH 1MCHA 5EORL 4HF5H 2LABA 1MIEH 4U6VH 1ZKAA 1P7QB 4DN4H 3ARDA 3FHQA 4OIBA 2EYSB 3V6ZA 1RJYB 1QFWH 3AB0C 2ICCA 2QADC 2JB5L 3W2DL 2AEPH 1UVQA 1PGRB 4XGZA 1H5BB 3VJ6B 2HH0L 3HI6L 3QIUD 3DRTA 35C8H 4ZYKA 4QHUA 1HWGB 3VXRD 5E95B 3UBXI 2VXVH 1J8KA 1BFVL 5HHMD 4TVPL 1FDLH 2VDOH