1BOGA

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-homologous peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGTASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
molecule tags Complex (antibody/peptide)
molecule keywords ANTIBODY (CB 4-1)
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1998-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogA01
2ICCA 4RFOL 4NO0D 1F4XH 4CVZA 3MLWH 2R1WA 5FB8A 4H88H 4XCYB 5LG1A 5DJ2A 2CJUL 4JFXA 3Q6GH 2AXJA 5DK0A 3UPRB 4Y4HA 4MNQE 3PHOB 1ZOXA 3KYNB 3QEUA 4U7SA 5CBAB 1PFCA 2ITCA 2OTWA 3V4VH 1INDL 4XI5D 1FFPA 4MQ7A 4W6XB 1BECA 3NMEA 1WWBX 4KZDH 2MSPA 1UA6H 4X9GA 4WV1B 2A74B 3SDDD 3E3QE 1KEMH 5EA0H 4FZ8H 5ENWB 2EKSA 3O11A 5D96B 3UJJL 2X2YA 3O4LB 1JYNA 3RJDA 5EO1A 4G9FB 3T4YA 5KN5B 4KJPD 1J87A 2ZNXA 3QDJD 5BW7A 2B2XL 3BESR 3MV7B 1NKRA 1GOHA 4G80B 2Q8AL 1Z0NA 4HXAH 4RA3A 4PLNC 4N0UA 3OPZL 4I2XB 2VQTA 4JFOA 1CS6A 2VLJA 4XP6L 4PY7B 1T21B 3RUGE 4MHHG 3IS0X 4IDLA 4ERSL 3BKJL 3C5ZA 1E28B 3UAJC 1QSEB 1YQVH 3HZKB 3CSYA 1NCDH 5JHDE 1VA9A 2V7NB 5LAXA 3TIEA 4KQ4L 3QNZB 4GKOA 3EJZD 3X12A 3C5SB 4MA7L 2FL5A 4XC1H 1S7QB 1BZ7B 3L6FA 4ONGH 1RU9H 4ORZC 3VWJA 1QFOA 5F7KC 5DHVB 4MDJB 3VD7A 3G6JB 3VXPB 4G6AC 3OAUH 1KIQA 1U3HA 5EU6A 4PRDB 3UMTA 4CADB 5GZOC 4GG6A 3MXWH 5ETUB 1AC0A 2UV3A 3FQXB 1LO2H 1KNOB 3TYFA 3HR5A 1QVOB 3KPOB 4HMCA 3SE3C 5F7NC 3UZEA 3FB8B 3QJHB 5F7YC 5IKCB 5IQ9B 4OCMC 4JB9H 1MIMH 3ARDB 3Q2CA 3UYRH 3VXTA 2CK0H 2XI9A 2FECI 3H3BC 3P0GB 4NM4H 5KSUA 1LGVA 3QUMB 4PJ8B 3HA0A 1CTNA 3RVVC 4HCRA 3GMQA 1JPSL 1FC1A 1BFOB 2AQ2A 2OSLB 1FIGH 4MWFA 1H3XA 3P4MA 3P3YA 4KHXH 3FJTA 3V95A 3FO1B 3VMNA 1T2JA 2EKJA 4OFIA 2AEPL 3K80A 4JVUA 1J0ZA 3QUKA 4YXKH 3RGHA 4IMLB 1OL0A 3MRGB 1BJ1H 2IMNA 4G7YH 2ZKHL 1R3KA 1G6RB 1OAUH 5IK3A 3PWPB 2W9DL 3S35H 4M00A 1V3JA 1IGJB 3FT4A 2HLFC 4YXLL 1QFUL 3AXLA 1FFOB 4JM2A 1S7WB 1I1CA 2YUZA 3HI5H 4KZDL 3KNBB 1ZSDA 4WWID 2ZOLA 4XCFL 4MSWB 1OAYH 1RZKC 3O45A 1RZJH 1WISA 2Y07L 4MS8C 4EIZC 3SOBH 4YHZL 1IAIL 1T1ZA 5KTEH 4XPFH 2F8XC 5HGGS 3STBA 5LCVL 2GJZA 1S5HA 1I8KA 4L8SC 4QHNA 3NAAL 2BOCA 5F44A 2JJUA 2GAZA 5HTSA 3RKDC 4PJ9A 1G7JB 4WI9A 3MV7A 1A6VL 1JN6A 2UYLB 3ARDA 1QOKA 4FS0A 4UT7L 5M94B 3N9GL 4XNZC 4M5YL 1DBKL 1PZ5B 3O4LD 2VTFA 1YNLL 1T0MB 2W07A 4X4XA 5I15H 1SJHB 3HR5B 3KPOA 4ZXBA 2NNAA 3NACL 1EJ6A 4FFZL 4N8VA 4O51B 5C0NC 3O2DL 2KZWA 5F6IB 5ABDE 5D7IA 1TENA 2DS4A 1MFBL 4NO0A 3L5WB 2LTQC 4QRTB 4YHKH 3PGFL 1ZANH 4ZAKB 1D5IH 2NX5B 4U1GB 1SJHA 5C71A 1ZLUH 3G04A 3INUL 4P99A 3GBMH 4LKCA 3ZDYE 4JANA 3T0XA 1T03H 4PREB 3QEHA 3CX5J 5BVPL 1FG2B 2IANA 2PW1B 5TPWH 5DRWB 1G7IA 3D3VA 3SY0B 3WN5A 4OLUL 2VXUL 1X5IA 1PYWB 2CD0A 2PUQT 1XGTA 3C2SA 4XNYH 2WIIB 4GBXA 2GY5A 4JKWA 3IKCB 4RGMB 1AH1A 4PJ8D 4PRIE 2Z0BA 3QFDB 5DJXA 3OAUL 1KLGB 1U3JA 5DLML 5I17B 3PP4L 5C07D 4PLJC 1SEBA 3L95B 3LN4A 4YE4H 3H3KA 2AXHA 5SWQA 3ARWA 2Z9TA 3DSFH 3DO3A 4OGXL 2E8YA 2I27N 3SKJL 5I30H 5I1EH 1Y18A 2R1YA 4GSDH 4K3GA 1GHFL 5ANMA 2PCPB 4PJEE 5I76B 3O8XB 2FEDC 4X7FC 3MUGA 1VSCA 1G6RA 1PG7H 5DVLA 2OZ4A 3NCMA 5TQ0L 3OJMB 3OZ9H 3MRGA 4QXGH 5JXAH 1MJJA 2ZUQC 4ZTOL 3LMJH 4HKJB 1INEH 1KGCD 2O5XL 2YRZA 3CFDB 3GRWA 3SDYL 2YKLL 1Q94A 1LP9E 1YECH 5GJSH 3OKEB 4P2RB 5T5FH 2XN9A 4KDTA 1D9KA 5AUMA 2XYCA 4FXGA 3RVTC 4PJ8A 4OLWL 3RWGB 4DEPC 1Z3GL 1ZLSH 5DD6B 3UTOA 5K9JH 3ALWA 3BDYL 2OQJA 3LDBB 5TH2B 1FPTH 3TBSA 4EI5A 2I5YH 1Z9SA 1JZ8A 5HDBF 4KK9C 2BVPB 4NQVB 1NMBH 1DN0A 3DRTA 4EDXB 3DVGA 5CJOH 5E99H 1T0MA 4LSQL 4PJFA 2ZNWA 3WDHA 4OLZH 1A47A 3EJYC 2UVEA 2CQVA 3LIZL 4Z7WF 1QBML 5FUOL 1BD2B 3L5IA 43C9B 4KRPB 3THMH 2MJWA 3QCVH 4HJ0C 4QRRE 2NLJA 5ITFB 5C07B 4CUCA 1QRKA 2N56A 5E6YA 1T3FB 4QGTA 3T2NL 3ISWA 4PJBF 1PEWA 2WIIA 4GBXB 4JG1L 5KJRH 5E2WH 1X7QA 2VXSH 4E5XB 2DQGH 5ACZB 2OXGA 5DJ0A 3IDXL 1E6OH 3IFPA 3L3IB 1AJ7L 5IB2B 3ZDZE 1JNLH 2A0LC 1MNUL 1K2DA 3VD9A 1F90H 1NFDA 2HJKB 1TTFA 3NZHH 4HWZA 4K7PY 4P9HH 4HWBA 2E7CA 5HVHB 4OT1L 2BX5A 2AKRB 5JLZA 2ZUYA 4XVJH 5J3HD 1I9JL 4QRTA 4NNYA 5DQDH 4U3XA 1PKOA 1NGWB 3MRQA 5J06A 4WWKA 5DJ6A 4YR6A 4MVBC 4Z76B 5FOJA 3TC9A 1LP9B 4XNQA 2WUBH 4U2YA 4ZS7H 3UTTB 4CMHB 4ELME 1OPGL 2RIKA 12E8L 1A6TB 4KQ4H 5ERWB 4LK4A 3ULVF 4NM8L 5HI3D 4DOHB 4JKLA 1TJGL 2J2ZA 3C8KB 1WC7A 1TJIL 3BYYA 3QXUA 3QZWA 2P24A 1NC4A 5ACMA 5T3ZE 4WI5A 5J8OA 5L7XL 5IMLA 4ONOA 1NCUA 1NH6A 4LKXA 4UU9A 4POYA 1A6TA 1RJCA 4UUJB 3C08H 4FXGB 5I1JL 3OKOB 4LQFH 5CJQL 3CZFA 3SGDI 1G9NH 2Q8BH 4XGZB 4JRXB 3TFKC 3BZEA 4PRID 4MA8L 1FORL 1CD0A 1KC5L 4HKJA 3FB8A 3QJHA 1JK8B 1JNNH 3VFOA 4KAQL 3WEXA 4MSWA 5JW4M 3PWUB 1IBGL 2LTQB 1UGNA 2WWMC 4DGVL 1INQB 4BQBA 1UEYA 2CLRA 3DXAD 3GMRA 1IC5L 2NY2C 5E70A 5C86A 1FQ9C 4RX4D 3G6JA 3VXPA 3DTXB 5DA0B 2AK4B 4F7CB 5C0AE 1G9MH 5JIHA 2BSTA 4E41E 3LKSA 1PBYA 3EHBC 3TIDA 1MOEA 3U36B 3X3FH 3H7BB 3NGBB 5FOBA 3G9AB 5FKPB 2Y1VA 4AIZB 1V7NH 3NA9H 1F4YH 1T4KB 2K3TA 5D7LB 4QRRA 1F5WA 1W72B 2ZPKH 1HILA 2G9HB 1ORSA 4WDIB 2JJTA 4HAGA 5MP6L 4HH9A 1XR8B 3MRBA 4HT1L 1D6VL 1BBDL 2A6DA 3HZYB 3SDCA 5HPOA 2FYYA 2JK5B 2HTLC 3P9WB 2IH1B 3VXUB 3BRDA 2DD8H 2QKIB 1NFDE 4H5SB 4WENB 2VZUA 1D5BA 3C2AL 1FYTB 1R6VA 2ORBL 4PJ8C 3P9MB 3ELAT 2GCYA 4OFKA 4NQCA 4PJ5B 3QWOA 1F8TH 3PGCB 3PL6B 4DVBA 1Q72H 3L7EA 2CKBA 5B38G 3BKCL 4BFBD 3D0LB 4FOMA 5K9KB 1F11A 3DGGA 4YDJB 3U7WH 1MJ7H 3VD3A 3BPLC 2X4RA 4ODTL 1J8HB 2IALB 1A1OB 3SE3A 1KB5H 1HIML 2IQAA 3A67H 1RHHA 5KAQG 4TQEH 3OF6D 4GRLB 5K9KA 3GMMB 3S7GA 1C1EL 1PSKH 4L4TA 4RAVB 2ED8A 4NSKA 3GI8H 5DHXB 3S3SA 4PRPB 3V7AG 5IGXH 2VNCA 3EDJA 3G9VA 1V7ML 2F53B 1YEJH 4HUWB 2QBWA 4H5SA 1A6PA 4DN4L 4MJ6B 1FZKA 5DK2B 2IBBA 4MB3A 4PJ9B 3W81A 2R23A 4ZNCD 1NFKA 5T3XE 3T77A 3DVNB 3WDJA 3P73A 1E4XH 4MJ4A 4J8RA 1C1EH 2H32H 5HGBB 3UJTL 2HKFL 4K7PL 4HWEH 4HH9B 5AG9A 2FX7L 1LQSR 1A6UL 1P4IL 1BGXL 3P30L 4QRPB 1ORSB 3PGDA 5T3ZH 4G8GB 1YMHA 1IZKA 4FRWA 4HC1L 4R2GC 2BJMH 3UDWC 5IQ7L 5T1DL 3L3GB 5GRUH 2HLFD 2IFFL 4LASL 3CLEH 4KJYA 4NN7B 1V3LA 1MWAA 4KRPC 5M7QA 2V2XA 1B88A 3U4AA 3K4ZA 4LBEA 5CZXC 1JHLL 1CFNA 4NQUA 1RZGB 2A83B 4O02L 2JELL 1RJYB 3OJDA 1INQA 4B5EA 4IMLA 4M5ZH 4DGYL 3B9KA 3HUJE 4OD3H 2UWEB 2FH8A 4U1HB 2YKLH 1F97A 4G7VL 3V4VL 2GUOA 4DOHE 3WLBA 4JPKL 5F9DC 4ZUUA 2IALA 4KJWD 4U1GC 3NIGE 3JBG7 3AAZB 1XF5A 1ACYL 2RFXA 2XRAL 4WCYL 2V5MA 4F80A 3WO4C 3NFPB 1A7QL 1T6VN 1HZHH 1TVHA 2Y9RT 4M6OH 4KPHH 1FVEA 4N1CA 4ZO8A 1NLDH 3QBTB 4P5TB 1A0QH 2QSCL 3QH3B 4HBQA 3ARFB 3GMNA 4ORGB 5FYJU 1N26A 1WEJH 4EIGB 4X7TB 3TWCH 1X5LA 1FNGB 1P9MA 3RVVD 5C8JB 4O5LL 5B39A 3VE0A 4HXBH 4W4NA 3IAPA 1EJOH 4P2CG 1T66C 4KROB 2IAND 5IMOA 3BQUC 2N7BA 5CJQH 1CT8A 1W0VB 3D1MC 4WW2F 3SE4A 2BFVL 1ZHBB 5DT1L 3K2UH 2RJMA 1UJTA 1RUPL 1YUHB 3F7YB 4Y16A 1DBBH 4JN2B 2DBLH 3VFNB 2MMXA 4Y2DC 2VYRE 4HEPG 5KSAB 3C8DA 1I8MA 1WZKA 2PTTB 4U2ZA 1BBJA 1X4YA 3C5ZB 1KIPB 5C08E 4YPJA 4Y5YC 5E24E 3M8OL 3SPVA 5IHZB 3F7YA 5CJ8A 4DQOH 1WIUA 1HCFX 2NLJB 1IFHH 3FCTB 2VC2L 2PXYB 4WTWA 2H3NA 4HZLA 3EZJB 3ZTNH 4ODXA 1UC6A 1DUYB 2R0LL 2J4WL 4K9EH 3CX2A 2JJVA 4G8EA 4EVNA 1FSKB 1ETZB 2RHEA 2W91A 4PJFB 4XHQA 1JHTA 3NFPA 3BW9B 2XA8L 1WF5A 1C5BH 4Q9QL 5J12B 5KOMC 3N1GC 2F19H 4KI5D 2XQYG 4ZUUB 1ODAA 1YC8A 4MNGE 1KPVA 3C60B 4ZO7A 4HH8A 3D69A 3F12B 1DZBA 5F1IA 4RISH 3RWCB 1OTSC 2V5TA 5FK9B 3WIFB 2WLYA 3QIUB 4JY5H 3V6OA 1BFTA 2YPVH 3FRUA 5JTWA 3BKYL 4R96A 3HI5L 4DUWA 4LARH 4LLMA 4HCRH 1MCNA 1OGAE 4XMLH 1S3KL 3V6BR 4LIQL 2CSPA 1XGQB 5J11C 3IAGC 1G9ML 5F7HA 3GIVA 3QEGH 3D87B 3J7HA 2XRAH 5D6CA 1INDH 5DTFB 1S7VA 3GMLA 4N0RA 2ZJSL 5HI4C 1EJOL 1BBJB 3IFPB 1DANT 4G6AD 1IAIH 3F65A 3H8NA 5FUCC 5GS0L 1MUJA 1S3KH 4MS8D 1S7XA 1ZMYA 3A6CH 5TF0A 5A40E 1TIUA 1YJDH 2EIBA 4U1NB 5K9JL 4H88L 1T5WA 1N5YL 43C9A 4U0RB 3UTPD 3RGVB 4EQ3A 3EO1B 4MAYC 3WMSA 4BSWB 2PETA 3FFCA 1GGCH 4L29A 1RZIA 1R0AH 1T04A 4P4KB 1SBSL 3K1DA 1KENL 1HQRB 1P4BH 4APQB 1CK0H 4R0LB 2P5ED 4TVPE 4R2GB 4Y4FD 5FO8B 3RRQA 2GEEA 2FJGB 1NGYB 2AJUL 2X40A 4PG9B 1IAKB 2ZCKH 4Q0XL 5JORB 3KYNA 1N64L 3D18A 3OV6A 4U6XA 3WFEL 4AK1A 2VKWA 5F1KC 1C12A 5DZLA 3U46A 4G9FE 5D1QB 3PJSA 4X6DE 3QI9C 4P9MH 3TNMA 3V0WL 1WCBB 1K6QL 4R96B 4NO0B 4OIIL 5CSGA 3E0GA 4JN1L 4YGVB 4ODBD 2W0LA 1ES0B 3I6KB 4JFDB 4Y16D 5GPRA 4TN9A 1D5MA 2RGSA 1CXFA 3QDMB 1AGCB 4ZXBC 3JUZA 4MJIE 3D39E 3QDJA 3QIBD 2J6EL 4ONGL 5L8KB 4JZOA 3ARBC 4HKBA 2R1YB 3KAAA 2P8PB 2H41A 2IAMB 3A6BL 3O0RH 3BJLA 3IJHA 4KKNA 4P5MB 5BVJA 5BZDB 1R3IH 5HPMB 4WEMB 3H7BA 5C0AB 3U0TB 4QCIB 5EZLA 3S3PA 3DX6A 4X99B 1AO7A 2AV1B 2GFBB 1NEZB 3VI4E 1ED3A 4F7MA 5DJXB 2CDGB 4I5BA 1HILB 2G9HA 2UWEE 4PJCF 4UINL 1IC7H 3MPCA 4HW6A 1PGRB 1ND0B 4OF3A 5CLTA 4J23A 3QUZB 5BS0A 1WAAF 4HJ0D 2FSEA 5IB1A 4JFFE 4KKCC 4K71C 3P73B 4DW2L 5DS8A 1W72H 1SM3H 4K3JL 1K4DA 3RHWF 5D1ZC 3BZ4B 1JF6A 3OHXA 5HGDB 2EH7H 4IIQC 1F3JA 1ZLSL 3PL6C 1OTTC 1GGCL 3RU8H 1WBYB 5E8EB 5KSAC 3HNVH 2X1WL 3C5ZC 3REVA 4LLYB 2FCBA 4WJ5A 1AD0A 1IGYA 5I9QC 3HMWL 1BZ9A 4YC2B 5DRNB 4AEFA 4DFIA 4ZUTA 3U4BH 4HUKB 2FJFB 1G6VK 2VZSA 1BFOA 1EO8H 4QXTA 3PJSB 3TNMB 2VDPL 2MKLC 1LILA 1HSBA 4M7KH 2VAJA 4Y5YA 5JQ6L 1P4LA 4U1MA 5EB9A 3EFFB 1AI1H 1OAXL 2P7TA 3O6LL 5F71A 5I0ZA 3P9MA 5I1AA 1JTTA 4IRJA 1I85A 2VO5A 4GBXD 2J8HA 4GAYA 5IQ9A 1OF2A 3JV5A 5JLZB 2DKSA 3QUML 2C1PB 5EC1B 3L3DB 5CINL 4NQED 5MENE 3TBTA 1N4XL 1KT2A 3FO0L 3GEWB 5C0IB 3TO4C 2JF1A 4PRDA 1Y0LA 5DJCA 4YBLC 4JRYB 4JO4L 1KCSL 3D39A 3L9RA 3ULUC 4CU6A 1S7WA 1BZ7A 4PV9A 3H2WA 3BDXA 4ELKA 2AEQL 4O9HL 5JW4Q 4O58H 2E27L 1U3YA 3V6OC 2VIRB 4HQQL 5J11B 4LF3B 5SWSD 5C1MB 1AGBA 1NGQL 1I7RA 3WLWC 5C0CA 1I9EA 5A2LH 3AB0C 3RNQA 2HH0L 4W81A 1AO7E 1A7RL 3M1BB 3TBVA 3BGMA 3UTSE 1A9BA 4LSVH 3T08A 3NCYP 5EC2A 3BVNB 3IJSB 3QPXH 4HK3J 2DDQH 3MRKA 5GGTA 2Q86A 1B0RA 5GRJL 3BD3A 4RWHA 5BS0E 4GAJH 4JFFA 4KKAD 4D0BA 5IJKA 3LEVH 2V5YA 1NEZA 1KGCE 2BMKB 4L8CA 1PLGL 4OKVA 1OW0C 3F5WB 4OZIB 1P4LB 3H42H 4ODHH 3V5HB 1S9WA 3FZUD 3DI2B 3C6LA 5EOQL 3V52H 2AK4E 2HT2C 4NO3A 5EUOF 2EYTB 4FTVB 3ARPA 2CMRH 5JHLH 4AM0B 5JUEL 2ESVD 2WINA 1XCTB 1WAAA 1DVFB 1KCLA 2LQRA 4IM8A 4NYLB 3QUXC 2PYED 4UDUA 1Q8MA 1F4AA 2Y36H 3EOYG 2DIJA 3PHOA 4OLEA 4BSVA 3OR6B 3S8WA 3K74B 2X4SA 3BQUB 4QTIL 6FABH 5D7IF 4EEEA 3FQUB 3ALPA 4HGWA 2R2HB 5HHQB 3RKPA 2H26A 2Z4QA 3BGFC 2DQIL 3VGEA 1WFOA 5EIQA 5JXEC 1NLDL 3B2VH 4NZUL 3B5TA 2K7PA 5TDPB 4FQQA 4PJBA 3FO0H 3HE6B 1MIEL 4YHPB 2VDPH 4YO0A 3TJHC 5CIPH 2C7UA 3TYGL 1JGUH 2CDGA 4FXKA 4BK4A 3IKKA 4ELMB 1G9MC 1B0RB 4M3KB 1C8PA 1INEL 1H8OA 4FHBD 4MAYA 4RWYL 4I0PD 3BJ91 3OL2A 4HIHB 5EULV 4RGND 5GGVH 4YHNB 3C6LC 2CDFA 4PRPA 4M6NH 5KN5A 2D4DA 5F70A 2R8SL 3OKYA 1NBVH 5EFIB 5F7LB 5ELIA 1T2QL 2J8UA 5SWZD 1QP1A 4G43B 5FUZL 1NL0H 4I18C 5IJVA 5DWUL 1D5XB 3MYJA 3IRPX 2YBRB 3EGSA 3WNOA 5GJTL 1L7TH 1UM4L 1BFSA 2HFGH 4PTTB 5JPNA 3VDAA 5A2IH 2GK0A 2A73A 1MI5A 4Z0BH 3BP6A 4XVTH 2BCKA 1EFXD 2CKBB 4LKCB 4XP9L 1M71A 2C3WA 5HYFA 1PJ9A 2NPLX 4NZTH 1FCCA 4YK4C 3MFFA 4XZUA 5BRZE 5I30L 3WFCH 2YD3A 2YMXH 2VL5B 5BVPH 4XX1E 3P30H 1L6XA 5BXFB 1L9MA 3GRWL 3MLUL 1JNLL 5JQHC 4NKDB 4XC3L 1KCRH 2COQA 4F58H 4NM8H 3MNVB 4U1JB 3WIHA 1QYGL 1KPVB 3L7FB 4LU5L 5SWZE 4NRZB 3H9HB 4QYOA 5I2IB 4KZEL 1ORQB 1VADA 1W72A 3KXFA 4X6FA 2Z31D 3EYSL 4PRAB 3G6JF 3VFUA 5E2UH 2DQIH 3RL1A 5FGBA 4HKXA 4YHNA 3P4LA 1RJLB 3ILPB 1CGUA 4P2RE 3HCVA 5CEZE 2VERN 3VXRA 5FYJL 4D8PA 3IDGA 1CF8H 4YR6B 5DJ6B 1FL6B 2F19L 5F9OH 2XZQH 2PW2B 2FX9L 4V2BA 2YA2A 4R7DB 4OZGA 3TEUA 2I9LB 4GMTH 4PJ5D 3KDMA 4X83A 5GGQH 3T3PE 4L8SB 4EQ2A 4R7NB 2I07A 4RFEA 5HHMB 1LD9A 1HK6A 3D85B 3QQ4A 1QKZL 4JJ5A 1JV5A 5KOVC 2XN9D 4ZOEA 2AJYL 4H0IA 3WN5B 4HXBL 2J8OA 2VDRL 1J18A 4HUUA 4P2OA 3PQYD 5DJ0B 1ITCA 1S7RA 4M6OL 3WJLC 3AS2A 5HVGB 2CO6B 1QSVA 2XNAB 1X5ZA 5IW6A 4D9RD 5F7DB 5GJSL 3FB7B 5DWUH 2CIKB 5IMLB 1NDGB 1PY9A 5JIIA 4OIBA 4A6YL 2P24B 5H35A 5C0FB 1CGVA 1T5XA 5C8JA 3ULVE 3B9DA 2Y07H 4EDXA 5IG7A 1CBVL 4XAWL 4R4BA 5B4MC 5B21A 4FQJL 5KW9L 2BVOB 4R90L 5IW3A 1CZ8H 1KULA 3RZCA 4KTEH 3VXQB 2R0WH 4QOKD 3O8XD 4L1HA 4H1LB 5I1KH 3GKWH 5IKCA 2AJSH 2GSIB 2OTPA 3MLXL 2AKRA 4IHOA 4FQXD 1NGPH 3MUY1 2DQHH 3WHE1 2BVOA 1HSBB 4HUNB 2YPLA 4Y4KA 3MA7A 4M7LH 4QXTB 4Q6IA 4LPWA 4LHUG 4EDWH 3SJVE 5L2KA 1XMWA 5DVNA 3PQYB 4R8WH 1RIVL 4HV8A 4QHLB 3X17A 1GOFA 1NCWH 2AJSL 1U93B 3IYLW 2C4XA 2NY1D 4L5FL 4U6HB 5KG9A 4K94H 2W65B 4JRYD 1CD1B 2HMIC 1I7ZA 3EDDA 2B0SH 2HT2D 4R9HA 4WEUD 3EJZC 4PJGF 2FX9H 4PJEF 3RJQB 4ZOBA 3VXSD 4BUGA 3VXRE 1UKSA 3NIFE 1OTUC 2C26A 4L8BA 2HG5B 5IB5B 2DLTA 3QZWG 3SGKA 3VGDA 1I9JH 4I0PA 5AD0A 4F3FB 1BIIA 2BSED 1T83C 4XH2A 2BDNL 3BHBA 5CUSH 3D85A 4G42A 5IHUH 4JDVA 4S10A 1HIMH 2ID5A 2Q87A 4ZFZA 4PJ9D 1B4JL 4TVSa 3MJ8B 2CKBH 4U6VH 1B6UA 4KK8D 4TPRH 3WNLA 4GAYB 1RQ5A 4TOYL 3S37H 4Z7WA 1EZVX 4RDQG 2B8OT 4UDTB 2APVA 4P46B 3WJJC 3ZYOA 3RZWA 5EZLB 1EAPA 3BDBA 4PJCE 2XY1A 5EUOA 3RUGF 3U0PB 3MV8D 4JZNA 1ZEAL 1YPZF 1P7QD 4BUHA 4KMTH 3D2UB 3OB8A 3SKUD 1JYXA 4Y19E 5CAYB 1OAZL 3EO9L 1K8DB 2EDOA 1VKXA 5HYJB 5DFVD 4HPOL 4L4TB 3AY4A 4WJ5B 3RWCA 3WUZA 2CLZB 3TYFB 5SWZB 5BXFA 3D69B 2AGJL 1AXTH 3RIAK 2VL5A 1V3MA 4YPGA 2OS7A 1QPPA 1S5IH 3MOQA 3UAJD 3B9KC 1JTPA 2DD8L 4Z77A 1NBZA 1R5IA 4JKKA 1RIHL 4GBXC 5LCVH 1A5FH 2ICWA 4IDJH 1C16A 2FEEL 4HJJL 1YEHL 5EO9A 3RY5A 4Q74A 4M02A 4G8EB 1N3NA 4PRPD 2XXMB 1JPFA 5KZCB 2E6PA 4ODXB 1MREL 1KTLA 4JHWL 2HFEB 1IVLA 1V7NL 4ZUVA 4Z7VF 3PP3H 4ZFZB 1D5XA 2ARWA 1DQTA 2WZPD 3VH8A 1J11A 3LQAC 2OR8A 3IJSA 5E1AA 3GJFK 2X9YA 3WL9B 4F8TA 4PGCB 2IADB 1JZ3A 4RNRB 3QIWA 3O3DA 3MQIA 2BSSA 3IJYA 4EXPX 3BYTA 4WFED 2DLFH 4YHPA 3ZTJG 1VHPA 3N85H 1WITA 2VLRE 3O6FD 1MFEL 5SWSB 1S7UB 2V17L 1UZ8A 4QO1A 5DJZA 3RTQA 3K3QA 4NP4H 4YDVB 5I19L 2BXZA 1DVFC 3OKDB 5HSFA 4Z0XB 4JFDA 1UT9A 4O00A 1MEXH 4NQDE 2QQLL 4LNRA 4OFPA 2EXYD 4NHCH 4TRPL 1LO0H 5FECB 1NGZA 1BGXH 2CLZA 4BSVB 5TDPA 1C12B 1KPUA 3UPRA 3QWOB 2VLJD 4TNVK 4URTB 4WI8A 1NC2A 2X5PA 2F54A 4HMEA 3CSPA 1K8DA 4K8RD 2B1AL 1N2RA 1H5BB 4OT1H 5HBBA 3MFGB 3QQNA 5EPMA 5J7CC 5A16B 3EOAA 5IGXL 3GUTB 1SYVB 3QIBC 5L8JB 4UTBL 4GG6E 1X5XA 2NY2B 3UJTH 4XMKL 1BQHA 4BQ8A 2JIXB 2FO4B 1RZIB 4P46D 4MNQB 4PJGA 4JO3L 4ZFFA 3EO1A 3RPIA 1Z9OA 1WC7B 4GRWE 2VLKB 4ZAKD 4WTZG 3T3ME 3NGBC 3KYMB 3MV01 4Z9KB 1VACA 1UZ6E 4ZPTA 3OSKA 1FAIH 4KC3B 3R8BB 2B2XH 3UPCA 5E8EA 3MLZL 2BSRA 3Q6FA 5F1SA 1OSPL 4HBCH 3I6GA 5D7SH 5GGVY 3RDTC 5EO0B 4OV5A 3BAEL 1MJUH 2EE6A 4C4KO 4JAMB 1UCTA 5F7UA 4OLVH 4WGVB 3WDIA 3T2OA 3V6ZB 5D5MA 3DETD 5GGUA 1CU4L 4ZG1A 5BV7H 4XVJL 3VFGL 3UCRA 4WNQB 2XZAH 1P6FA 2AABH 2RR3A 5I15L 1Q72L 4TTDD 4R7DA 2BP3A 4UOW1 5EN2A 3MBXL 1DBKH 1IGML 4H26B 3AM8C 2EECA 3Q5OA 5IVZB 3O2DH 4LHUA 1DQMH 3QEHB 1JNHB 1MJ8L 4X7SL 5L2KD 4ODSL 3L3OB 3KYMA 1JPTH 4S1QL 1X9QA 2NY3B 1A0QL 1H3WM 1T2QH 1KBGL 5I1HL 3E6FB 1R0AL 4WUUA 4R90H 4C83A 4R4BB 5E94A 2P45B 2O93L 2NNAB 5FYJD 4F7EB 3NABL 3RZCD 2PN5A 4XPAH 3EW3B 4AEIH 3ARXA 5GGVL 1ZHKB 1BJ8A 3CVHL 1WSST 4L3AA 3WO3B 3Q1SH 4R4ND 3U9UB 5D72L 3BIKB 3MCLH 4N0FA 4OF5A 3ZDYF 4F7PB 2NZ9C 1RZKH 3RWJB 2VDNH 1NCCL 1AGFA 1QSFD 2HT3C 3F8UB 5I8KH 1QSEE 2DI7A 5DJ2B 4DTGH 3FTGA 1EA9C 1JMZA 3OXRB 1I4FB 4JGUA 3C08L 2DM7A 1HWGB 5DEZA 4IEFB 3SDXF 4IRJC 4CVUA 4MQXC 5T3XL 4NN5C 5C08D 4MNHA 1MCPH 3N50A 4LLYA 4NZRH 4YE4L 1ZVYA 2NY6B 1HHKA 1JPSH 1JTOA 4AEEA 4ONHA 1IE5A 2ERJB 4PJXF 5ESVA 3VGBA 1A5FL 1MVFA 3DI3B 3W0WA 5HD8D 1SVZA 2O26U 2P43B 4LPVA 4OCYL 2YD9A 5JOFB 4JQIL 3GZKA 1BPVA 2JIXD 5B39B 5MEPA 1EEYA 1UB6B 5I1JH 4JFEA 1T6WA 3QXDA 5C6WH 2CMRL 4KGLA 2BVPA 4PRAA 4NC0B 5KZCD 2FZ3B 5D5ME 5HHME 2WP3O 4YBQC 3MV9D 3HE6A 5CHNB 2X4PA 3PNWA 4MNGB 4JPIA 4YXHL 1CE1H 4N1EA 1YA5A 3DIFB 5FKAA 4M5YH 1RZ7L 1CR9H 1FZKB 1FP5A 1MCJA 3OGCB 3BO8B 5DK2A 3MZGB 4J6RL 4HIEB 3VI4F 1Q94B 3X14A 5CUSL 2CXKA 2QADB 4ZTPL 1TQCB 5FA4A 3L3JA 3DIFA 1AGFB 1ZVHA 4TPRL 4XP1H 1I8LC 3D18B 1KCKA 5C0RH 3FQNA 5SX4I 3GSXB 3IFOA 4KVCH 5IHBA 5ETUA 5JW5B 4UQ2A 4GH7B 2CIIB 1NCDL 3DROA 3QCUL 5FO8A 2LU7A 1KELH 3DVIA 3FO2B 4UAOC 1ZXQA 2AJVL 3QEQD 1WCBA 1YEGL 3S88H 1FPTL 4Z7UA 4U0QB 4BFIA 2A9MH 4KJYB 3KWWB 1H5BC 1ERNA 1EERB 3QB7C 2ENYA 2BC4A 1QQDA 1S7TA 4U6XB 4N8CH 4KI5C 3TA3B 4P4KD 5MERA 3BXNB 3QIBB 1RURL 2DTSA 1Q9KB 3I75B 4GQPH 1J12A 3DMMD 2HVKB 4D9LL 4E0RA 1NFDF 1QSEA 3WFCL 1IQDA 4RGNC 5D7LD 5ALCH 5CFHA 4KGJA 3OR7A 3WL9A 3EBAA 3UBXB 3SDXA 2QSCH 5E2VL 4JO3H 2X41A 3BHBB 4NIKB 1HQRA 2NY2D 3MRBB 5DZOA 5I6XB 4HLZG 4KXZH 5IVOA 1YJDC 2V2WA 1ADQH 1I8MB 5K93A 3RL2B 3OXRA 3MOAH 3CFIC 4NNXB 4Q0XH 1AC6A 4UZGA 1PQZB 4QF1A 3VXMB 1MVUA 5BO1L 3LQZB 5DMKB 4IS6A 3BWAA 2VDKL 5SX5H 5L2JA 1MF2H 3QCTH 3VCLA 2X4UB 4XVUC 4AEIL 1BD2A 4WHDA 3QIUD 4K3EH 1LEGB 5IM7B 4PD4J 1HHJB 4UIKH 3RWHB 5F88A 1U92B 5HGHB 3AREB 4CNIB 5BO1H 4I1NB 1UZ6F 5DYOA 3TO2B 5DUML 3KPSA 4X7TA 2YPLD 5EOTA 3V4UH 2AJ3B 2Q7YB 2R2CA 1EO5A 3KLAA 2W9EH 2VLKA 4KKCD 2P8MA 4QOKB 4AH2A 3QH3A 4DW2H 5C0DB 3MV8B 4ISVB 5FGSA 4JRXA 3BZEB 3V6FB 4KJWC 3BEVA 1N6QH 4KAQH 3WKMH 4EZMA 2ZJSH 1CWVA 5E1HB 3RWFB 5DFVC 1LK2B 2F53D 2KH2B 5H8DA 3RX5A 4DGIL 2RFXB 1MFDH 1T1ZB 3DV6B 3I85A 3IFNH 1DBMH 1SJXA 2F54B 2AJZA 2NY3D 3QJFB 4M8QA 5DJAA 3EO0B 1FN4A 1LO4L 5DD1H 2I60H 4HWUA 3VFWA 3OWEA 5I75C 2AJVH 1RFDH 4TUJA 1UWEH 2K7QA 4JFQB 5EZOL 2QR0B 4JFEB 4AIZA 3KPPA 3TVMA 2SEBA 4TULH 4X7CC 5I8EA 1FFOA 3BPNB 3KPTA 3R8QA 1NBQA 4ZTPH 2D2OA 2XQBH 2C3VA 3O41B 2QV2A 5I1DB 5KVFL 2X9WA 1I7RB 4RISL 2QEJA 4NNYB 3R0MA 5F93C 3B2UC 4LBEB 5MEOB 3I6LD 4BA8A 1R3HA 1QG3A 1YY8B 2SEBB 2GYSA 1XF2A 3QQ4B 3BUYA 4P2QA 4LSTL 2MCG1 1IARB 2BFVH 3QUZA 1BEYH 2DI9A 4OGAC 5BS0B 1KJMA 5FCSH 3RL2A 3EJJX 3VXOA 2Q3AA 1UH3A 3S98A 1MFBH 5DD3L 3PV6B 4Q97A 4G6JH 3MLVH 3O3UN 1CN4A 5DEGB 2PW2A 4I77L 3FZUC 5HYSB 4JDZA 3KPQA 2OP4L 1OSZB 3CFKA 4IHOB 3MROB 2X7LB 3FQRB 3D48R 4MJ6A 4I0KA 4IRZL 5DMIL 1H5BA 4HJGA 4XPBL 4ISVA 2HVJB 1DVFD 2VMFA 4YHOH 5LWYH 4NP4L 1MNUH 3WIHL 5KTEL 4ZAKC 1BD2E 2MWCA 3P9LB 2QSVA 3K2UL 1L0YA 4N0YH 1CL7H 4J3TA 3RI5F 4HIIB 4GRLA 2EXWD 4NDMB 3O3EA 1A3RH 2A6JB 3EIFA 4XPGH 2YD5A 3GSRA 4FQLH 1F02I 1C7SA 1J8HA 4OIIH 5E5UB 2P42B 3RQ3A 2IPTH 3SDDC 1NDGA 1WK0A 3PDOB 4GLRH 5DFWH 3U82B 4Y5XA 4UV4L 5KS9B 3CCHA 1OD9A 4YHIB 2OCFD 3T0EC 4MCYB 1EZVY 1X5YA 3E8UL 4M93C 5A3ID 1QFUH 2XN9B 5DUPH 5J1TC 4LHUB 5IMKA 2PTUA 1QD0A 4NHCL 5ECJE 2X4OB 3T0ED 1BMGA 3DO7B 1FAKT 3TM6A 5IFJA 3D2UA 3MYJB 3HC4L 3QXTA 1JFQH 3CAFA 3G5ZB 3SDXB 4GKZA 2RCSL 3ARGB 1CIUA 1FV1B 4L4VB 4Z8FL 2BVQB 3NCEB 2X6MA 4G80A 4IIQB 4XP5H 1A7OH 2CDFB 2WMPA 4Y89A 4I4WA 2GTZA 4PJBB 32C2A 1MCQA 5IIEA 4RAHA 3O4LA 4FQ2H 4F3FA 1U6AH 1NDMB 4U1SB 3VXRD 2Z31B 4JZJA 3KHQA 4Z7QF 3MCKA 2BNRE 3O2VL 5HYJD 2D03L 4XB7A 4KDWA 4RGNB 1NBZB 1OAKL 4F9PA 3W0WB 3RDTA 3QSKB 5CJBA 3HC0B 4KXZI 1UEMA 1ITBB 1MFCL 2HRPH 4PBXA 1TDQA 3OB0H 1MELA 2VXVL 1XGTB 1S9YB 2DQFA 1GGIL 2BNQA 4AT6B 5C0JA 3SKJH 4YHKL 1FDLH 1NUDA 1FN4B 5CCKL 3ZE1F 5GSRB 1PX4A 3ZE1E 1YMMA 4PJCB 4FTVA 3WIIH 1UJ3A 1QACA 5F96H 1Q38A 3WS3A 2YHGA 2YXFA 2BNQB 4AT6A 1MHHA 3D5OF 5T1MB 4NCC2 1QA9A 5EH1A 3QNXB 2RAMA 3QQ9D 1S9XB 2DB8A 5IFAL 2CDEB 1ULVA 3FQTA 4OKDA 1IAKA 3TVMC 1FRGL 1IAOB 1OB1A 2M2DA 2GTWB 5H94A 2LV4A 2QTEA 1JZ2A 1OCWL 2NY6C 3CPLA 4WHYH 3JV6A 2APBA 3MRPB 4XPHH 2CXGA 5ID1B 5AYQA 1J8HE 4JVPA 4S1SH 2H8PA 4R8WL 2KQNA 3S37X 5HHNB 3QDMD 1QR1A 1CLCA 1ZHNA 3LEXA 4DZ8A 3ROOB 1I1YA 1EAJA 3WHXA 5C07E 1IQWL 4WU5A 1JUFB 1SMAA 2DBJA 4F7TA 3FRPG 1CICB 3JV4B 3I3BA 5BJTB 2G60L 3LH2H 1IRAY 1JRHL 1YNTB 3PQYE 4NZTL 3L9RB 2R1XA 2I60L 1NFDB 4WEBL 1VENA 5EIIA 3MLRL 4MNHB 43CAB 1J0IA 5D4QA 1QLFB 1J1OL 4HUUB 4LVEA 1IKNA 5IEKB 4PLKC 5EBGA 2QSQA 3U9PH 4WW1A 3U6RB 3BPNC 4LF3A 2HFTA 4LNVA 2WIMA 1RZJC 4GAFB 1P7KB 3HB3C 1OP9A 3O2WH 2PYFB 3F58L 2I9LA 1MQKH 3MR9B 4G8IB 1I9RH 1EFXB 1TQCC 4OD3L 4OZFH 2XXCB 3MUZ1 4LHJB 2R9HC 4XRCA 3LEXB 2BNRA 5MP6H 2BC4B 2M26A 2YN5A 4IOFD 4D8PB 5JOPD 5EIVA 5KBNC 3TBWB 5C7XL 2EDTA 5C6TH 4P3WA 3JV6B 3MRPA 3H7LA 3BN9D 3HUJF 2LABA 3U30B 5FYKH 3BGFB 3DSFL 4QWWC 1HH9B 3IB4A 4N90D 1KJ3H 1CLOL 1CLZL 3NCJH 5K9QI 3UYOD 1WICA 1RHFA 5JNYB 2AS5M 2VDRH 3TYGH 1D9KB 4G8GD 3DUUB 4CMMA 1ETZA 4GW4B 5IOPA 2P5EE 3V8CA 3MV8A 3CDCA 1QBLL 3LV3B 1YEHH 4GUPB 3LPWA 4GKSB 4N68A 1IMHC 4GMTL 2F58H 1JWUB 4KVCL 1CICD 5C0JB 1KJMB 4G8GE 1OQOA 5CILL 4QRPE 1ZHLB 4GJTB 3QXVA 2D7OA 5E2JA 3ARBA 5F96L 2CRYA 4Y4KD 4M8VA 3HMXL 1YQVL 3TNNB 3GSQA 3KLDA 1K5NA 2VQUA 3HI6H 2QL1A 1P1ZA 1P53A 2CR3A 2R1XB 1RIHH 4GRLD 1T0NA 5GIRB 3QRGL 4HK3N 4ZNEE 3ZSTA 5ITFA 3NIDF 4LVOB 5F1NB 4F2MB 1OCWH 5KAQF 3D39B 3KJ6H 3MRCB 2YK1L 1KLGA 4J3VA 5IVNA 3AREC 3ARQA 4RAUB 1GZQA 1MCBA 2AP2A 1OPGH 3QG6A 4YDLC 1CDGA 4OCRL 3MOBL 5IESL 5BOZG 5HHNA 3OX8B 1CQYA 4P9HC 1QFWI 1LK2A 2C5DC 1NAML 4N9GA 4BH7B 2NY5L 1LP9F 3JV4A 5JDSA 3EKCA 1CFVH 4MDIA 2IAMA 1S8DB 2A9NH 2P8PA 5I74B 5A3IC 3KVQA 4LSRL 4NBZB 5GZND 2UWEF 1Z9LA 4NGHL 1QYGH 2LFGA 2A6IA 3PXHA 3BH9A 5ADOL 1ZGLP 3S35L 3REWB 3GBLA 3WS3B 3DVGB 3ZLQC 2E7LC 2BCKB 1KNOA 3AC0A 3TO2A 4LHQB 4Z77B 3CVHA 4LLWB 5JDJA 2NXYD 3EGSB 4JFPB 1UFUA 2AEPH 5EBLB 2WWKT 1VFMA 5DUPL 4LSVL 1KYOK 2PYEE 3QEUB 1MLBB 4HUVB 1FNAA 1ZWIA 5F9WB 2X4QB 1SBBA 1T7ZA 1T89C 2FIKA 2NY0B 3NPSB 1VESA 4RBPH 1MCWW 3BGAA 1UKQA 4OCSH 1M7XA 3BE1H 3H3PH 1MCHA 4J1UB 4WFFE 1G84A 4QT5A 4X6DA 1MHCB 4IBLT 3BRGC 3MROA 1MHPH 1LE9B 3ULVL 2EXWC 5CEYB 2PF6A 4B0MM 3IT8D 3VGGA 4JVWA 3PNWB 3MMEB 5BS0D 4Z78A 3CLFH 2WWMD 5IP4A 1I1FA 2OJEB 4I5BB 3LQAL 3HUJB 5FO9A 3TJHD 2Q6WB 5JA9A 5F7FA 4XPTH 4LCIL 1U58B 3K2MC 1T1XA 2EC9U 3QDJE 4GG8A 3RI5K 2FECL 1KB5A 4H8WL 1UWGL 3MCKB 3QAZB 4GG6F 3RVXD 1FZMB 1IQWH 2W0KA 2W0PA 3IS1X 3SN6N 1FGNH 3CU7A 2F5BL 4L8BB 3ILPA 3LS4L 5DEFA 4MJ2A 1GAFL 4ODUB 4ENEC 1FVCA 3KPRA 5ESVB 3GMRB 3F62A 3STZA 4XXCA 2C4FU 3GSXA 3IFOB 3TN0A 4G3YL 2OTUA 5F6HJ 3ZKXB 5JMOC 2OK0L 1AP2B 3GBNL 1I3GH 1KUMA 1KJ2H 3L5WA 5FAAA 1DBAL 4GKSA 3GSOB 3K0WA 2RBLA 1U8PB 5E8PA 1MRFL 1MCRA 1RZFH 2E7LA 1SEQL 1JYVA 1A3QA 1MRDL 4F33B 1F90L 2ZWLT 5IB4A 1AQDA 1FRGH 4MAUL 3GUTA 1IM9A 3IVKB 3REWA 3O4OC 3WBDA 3PGCA 3PL6A 3ZSSA 3G04B 4XCEB 4JKPL 1JP5A 3W39A 3O3BB 1FL5B 1KJ2L 4NCC1 5C6PB 4QNPF 2P7TB 3SO3B 3NA4A 2E8ZA 1S8DA 1A9EA 2W38A 2G2RA 2R2BB 1KCSH 4ACPA 4U6TA 4PRBB 5D1XC 1SJEA 3ZYZA 5JHDB 3B4NA 4QRSA 2C9AA 1G7LA 3KYOA 1X5GA 1ZT4A 1A7NH 5CIPA 4Y8DC 1PW3A 4CNIA 3VGFA 4G9DB 5C0CB 5DRNA 4P5TC 5D1XD 3VFNA 1LEGA 3MJ6A 2CRIA 2V5SA 3OXSB 5J0BA 5IVXB 5I8OH 3MACL 1TQBC 3WKML 3ALXA 3FB5A 2I9TB 2MOVA 1FYTE 3EYSH 3I2CL 4NKMB 2OX5A 2H6PA 3CSBA 3FT4B 4Z7UF 2W92A 4MD4B 4L8DB 3IFNL 3OGOE 1Y6MR 2DRUA 2V2WB 3LD8C 5DD5L 4OLWH 4KROC 5BCAA 2XKNA 2C7UB 3U4EB 4P46C 1KJ2B 3Q6GL 4QHUB 3TLRA 1MQKL 4GXUN 1BAFL 1EXUB 2WV3A 5E8DL 1EH9A 5DR5H 4W6WB 4TRPH 3GKZA 1RUKH 1IQDB 2R2EB 1JGLH 4PJXE 4FQ2L 4N0CD 5AWNL 4KVNH 2EO9A 3GIZH 4LVOC 3T4AB 5F3HB 3HNTH 3TT3H 2DMKA 5GRVK 4E41B 4K8RH 4YDLB 4LFHG 3IVKA 1IGCH 2GKIA 2H8PB 2ZPKL 4BFIB 5EWIH 1J9CT 4I0CC 3CPLB 4NZRL 2ZUXA 3GSOA 4PJGB 4LASH 1NAMH 3TBSB 2ATKB 4KRMB 1NCTA 1VEPA 1YEFL 3F58H 4M62L 4RFNB 2DYPA 5E2TH 1A3LL 2MPAH 1AI1L 1OAXH 2BOBA 1E0OB 3W39B 3V79C 5I74C 3C9NB 3PIQB 2Y5TA 5MI0B 5TF1H 1F6LL 2HN7B 4NZUH 5LGHH 3HHRB 1A7QH 5JIKA 3RWFA 3WNKA 1MREH 2XTJD 4OF7A 2A83A 4GG6B 3ESVF 4JFXB 2BVUA 3KPRB 4IRZH 3ZE2F 4R97B 4X98B 4I48A 5ADOH 2EIZB 1HINH 5T5NF 3LOWA 4NUJA 3IRZA 1HYRC 2Z92A 3VW3H 1FHGA 4G7VH 4BQ9A 3VCLB 4PPTA 3L6FB 3WJLA 1WAAE 1ZAGA 3CC5A 3BWAB 1OARL 3D9AL 5GGUB 2ZCHL 3B9KD 5DHYA 4P3CH 1HXMB 2UUDK 1K4CB 4KDTC 2D9QB 2GK0B 3GMOB 3VFGH 1QLRB 1KJ2A 5FDWA 3PWVB 3CDYA 3IDIA 4FZEH 1O7VA 2MQCA 4UQ3A 2UVFA 3EZ8A 1VFBA 4GOSA 5DHVA 3CDGA 4WFGE 1IGTA 1ZTXH 5CP7B 4XMLL 5MHSD 4R0LA 2EEBA 1RD6A 2I9TA 2OK0H 1WWCA 3DX8A 1LO5A 1D3CA 1XGPB 3E2HC 4TSBH 5FHBL 2J12B 5JR1L 1DE4A 4I9WD 1ZK9A 3BKCH 2QHRL 1SEQH 4X6CA 4G9DA 4Z7NF 4M3JA 1A14L 3MNVA 4U1JA 4WUUD 4NWTL 2EC9T 3TN0D 1JVKA 4JFOB 1AGEB 4V1DE 1BLNA 4S1RH 4PIRF 2EYSA 5D1QC 3VH8B 4XP4L 2EDHA 1P5VA 4KK9D 3PDDA 1YEKH 1EEUA 1NGQH 3GMLB 2JJSA 2IEPA 4P9HL 4HMDA 1P2CB 4I2XE 1QLRA 2R4RH 5CGYC 4XXDB 3FQNB 3ZKSD 4K8RL 1IKFL 3UBXG 5ALBL 4L5FH 3TBYB 1NEZG 2GSIA 3KYKH 1HI6A 3I84A 1H3PH 1KLFA 4K3EL 4N0UE 4X8JA 1P2CA 5J13C 4POZD 1RUKL 2RCSH 5F21B 3RIFF 1HDMA 3RUGA 5ILTH 3THML 3C9NA 3PIQA 1ADQL 4QLRA 4MCZB 2DQDH 5HHPB 3LCYA 3HNTL 5CHNA 3MLYH 2MCPH 1LDSA 1I9RL 2OM5A 2BHUA 4JY6B 3A6CL 5DI8A 2W60A 4OZHA 4YNYA 5GZNC 4YWGH 4DWHA 1KYOJ 2G75B 1MCFA 3QHFH 5F1NA 4F2MA 1EVUA 2C3HA 4HWNA 4OM1H 1R24A 4XBEH 1UYWH 5E1AB 1LVEA 5BRZA 2XWBB 3T65A 4LP4A 4KPHL 3CDGB 1XIWD 1RK0B 4JDTL 1DUYA 4H8WC 5CLWA 3JWOC 5C0GB 4I3GA 4HGMA 5ESAB 5DTFA 4ONHB 3MNWB 1KFAH 4KMQA 4Q9BA 5AZ2L 2E7HA 5AG8A 3KXFE 3RWEB 3ZHLA 4R7NA 2VLKD 1VPOH 5E8NB 1TJGH 3ZKMC 4GUPA 4JCMA 1QFWM 4PLKD 1NGXB 2FJHA 4FQJH 5KW9H 1WIOA 2EDDA 4JY6A 4PGDA 4RRPG 4LP5A 3MO1B 4WHTB 3O6MH 1RUMH 4ZODA 5EZJA 1F2XK 5J56B 2VZ1A 1WGOA 3SGKC 2J88L 1ADQA 4OZGF 3QEQB 5J4MA 4QYOB 1KN4H 1YEEH 2M1KA 3FOLA 3QPQD 1FORH 4LCWB 5I2IA 5DSCB 4JHWH 3RVWD 4XPHL 1ZT4B 1HI6B 1X5KA 3L1OH 5JR1H 1K9TA 4FABH 3ZZ1A 1TZIA 2OZ4H 3VJ6B 1NMCB 3WXVL 4P3CL 2A6IB 3QIWD 3D0VA 2YZ1A 2CGRL 1F3DJ 5FYLL 4EVNB 3W9EA 1IM9D 1C5CH 1YC7A 2IFFH 4G8IA 3U9UA 3MJ8A 4MXVE 2QQKL 3PF2A 3BT2L 4MJ5B 2FX8H 1E4JA 4F9LC 4F15B 3DV4A 3RIFK 5DQJA 4X6CB 4APQD 4K3HA 4JQVA 2F9BT 3C09C 5FYJH 3QEQA 5KSBF 3SCMA 2VQ1B 4XCFH 3ROLB 3MV7E 4U6VL 4AQ1B 2H2SC 4WFFD 3BUYB 4U6HA 1CQKA 1YEJL 5IV2A 3PWJB 5IHUL 4M61B 1S7XB 2WW8A 2VDOH 4PJHA 3TV3H 3MBEA 2DQCH 1FVCB 1DBJL 4ELMF 4LU5H 3ARRA 5F9JA 1LO3H 5EOCJ 3L3IA 4NBXB 3VG0H 1SY6H 3DARA 4MD5A 2UZYB 3VFVB 4UIMA 1QUNA 3ILQD 4NPYA 1JZ7A 1XEDA 3NCJL 3MRRA 4PB9H 4IRSA 2R2BA 2Q6WA 3VWKD 3VFWB 4OCSL 5C09A 1MCPL 3FO1A 2VSDA 5CEXB 2OQJB 4PRNA 1EHLL 4LPTA 1SY6L 3IDMB 3QA3A 4GW4A 3O4OB 5HGBA 1NLBL 1JHKH 5DD0H 4XCEA 5IT2H 3TZVC 1TVHB 2VABA 5D2LE 3DRTB 1NCAH 3HI1B 7FABH 2R9HD 1V5JA 5GJTH 4HGWB 1BVKB 5I73B 4M5ZL 2ATKA 4P5TD 1E27A 5DUBB 5HDLA 4LCWA 2R0ZL 4JO2H 2AQ3A 4U6YA 3EYQD 4NJAL 3C8KA 4HFUH 5INCA 1SBSH 1TCMA 1BOYA 4MX7B 4OSUH 1I7UB 4OAWB 1R5VA 4LLVB 5E6IB 1LMKA 1ACYH 2A2QT 3MGTA 1U95B 1CFSB 5TDOB 2MFNA 3QCUH 2E6QA 1QLEL 3OKDA 2A77H 3VRJB 5IB3B 1KB9J 3S88L 4R3SB 1E4KA 5J13B 5B39G 5I6XC 4JQVC 1RK1A 3EOBB 5DMGD 2FR4B 4Z95L 4I4WB 3PHSA 4KK8C 4NT6A 1RURH 1KIPA 4HWBL 4U31A 1VGEL 2HT4C 2VLJE 2PTTA 1EHAA 5C0RL 4UBDD 2FEEI 4PR5B 3G6AB 2AV1A 3P40A 1Q0XL 3T8XA 3RIAF 4JZJB 2IBZY 3X3GL 5DJZB 1KELL 2N7AA 1REIA 3K81A 4P57B 5GGSB 4FQHA 4NFCA 5ITBH 5FYKD 1E4WL 5MERB 1TJHH 4NQEB 1RZ8B 3QIWB 4KV5F 5DURD 4LCUB 2PYEB 4POUB 3WLWD 4E41D 3KJ4C 1G7LB 4WIQA 2D7MA 1D5MB 5C0AD 1R3JB 4FFVC 1I1AA 4W68A 1DLFH 4XCCH 4X5WA 1CDHA 2G5BB 3FO2A 3WKNA 1KB9K 4JFPA 3V2AR 2HTKC 1RVFL 1A1OA 4J6RH 3OAZK 1T1YA 2GSGA 4UTBH 4EI5D 3OKKB 4NT6B 2P47B 3ZHDA 1KT2B 1GIGH 1K4CA 3OKNB 3T0DA 4XP5L 3H42L 4ODHL 5C09E 5EC1A 3LB6C 3BWUC 4LRNH 4DKEH 4R97C 4X4XB 2FWOA 4OGAD 2FB4L 4NQCB 4PJ5A 5DGRA 5FFLA 1ZANL 5F3BA 2FD6H 4ZYKB 2YUWA 5D2LA 3FRUB 5D7IB 3BO8A 3OGCA 1F42A 3GMPA 4HZAA 4M9PA 1U8OB 2QKIA 3HPLA 4Z0BL 3IAQA 5DT1H 1R5VB 1BAFH 3DBXB 5T3ZD 3OB0K 3CXHK 1GPOH 1Q9WB 2BOBB 2FO1A 2EEDA 3VXNA 3BP7B 3WSQL 3WD5H 3RY6A 4HK0B 5HGAA 4WDIA 5DUMH 2XTJC 1ZS8B 3MRFB 1G0DA 2NXZC 3O45B 1E6JL 3T0AA 2XT1B 2ZG2A 1FIEA 3NIGF 3CSGA 1MWAB 1U8HB 2Z31A 5K9OB 3DGCR 1URLA 5JOFA 2HYMA 5GGSY 1FFQA 4YIQB 3CK0L 1JI2A 4R4FL 3O6LH 1NBVL 3C5JA 1N64H 1W0WA 4X5XB 5DC9B 3RGVD 2C3VB 3O41A 4LCCC 5TE6H 1YEIL 1DANU 2PYFA 1J05B 2CLRB 4X9BA 2Y5EA 3V6ZA 4NC1C 4PG2A 5ISZB 5EC2B 1CDUA 4JPWH 3U83A 2Y4SA 3HRZA 4PJEB 4OF0A 3M1BA 4PS4H 3TBVB 2NW3B 3DO7A 4N0YL 5C0GA 4Y1AD 4DN3L 4PP2B 3IXTB 1G9NC 5D70L 2NYYD 1NAMB 5I1DA 3WFBH 4Y4KB 5INDB 1I7ZB 3BQUA 1AKJD 1FZJB 4OAWA 4P3DB 3HCVB 3OR6A 2A6KB 2AJYH 5B3NA 3CFCH 1HH9A 4WHCA 1U8IB 3KR3H 4BZ2L 2VWEE 4LARL 3RZCB 3IU4H 1DQDL 5DLMH 4J3WA 4MJ5A 1OTUD 1GGBL 5DFTA 1IT9H 2EE9A 3G6JE 2YPLB 4K3DL 3PG2A 4MAYD 5ID1A 4HIIA 3WXWH 1UCBL 5EUKB 4HWEL 3QRGH 4LSUH 4XHJC 4PGBA 4LSSH 2J6EH 4FA8A 5IR1A 4XNYL 3MR9A 3NOIA 1IAMA 4J3UA 4LRIA 1YY9C 3VJ6A 4IOIA 5I18H 1C5BL 5INDA 1V3KA 2YD6A 4TULL 4XNMB 1AXTL 2A1WL 1MI5B 2HFFA 4WUUE 5I66B 4MD5B 1DFBH 1XIWB 2VITA 4YAQB 4AG4L 1GZPA 1E28A 3BN9C 3R4DA 5J1AB 1QLFA 1YEFH 2X1XR 1BFVL 4JFZL 5GS3A 2DIBA 2EIEA 3HC4H 2Z31C 2XTLA 2NMSA 2IMMA 2J8UB 4M61A 4WI6A 3AROA 1XF2B 4LCIH 1I1RA 3VFTB 1PD6A 1X4ZA 1NMAH 4X4YB 3LQZA 4KY1H 5DMKA 3DLQR 2WQRA 1A6WH 3AMLA 3HZVA 1VGKB 3NH7L 4Y1AB 4MLSA 4YXHH 5HI4D 3RVWC 3TNNA 4JHBA 4WO4A 1F00I 3CNKA 2KPNA 3HRZB 4PJEA 2X1QA 4I13B 1E4KC 3LKOB 4K94C 3AU1A 2ORBH 1IGFL 1N8ZB 1LD9B 2FSEB 2H32B 3BP4B 3HE6D 2NXYC 1I7TB 3MNWA 4X6FB 1EFQA 4M4PA 5D93B 3PGDB 4ZOAA 3QHTC 1VFUA 4DKDC 4Y2DB 4IIQA 3SE9H 1AHWB 4L4TE 1F4YL 1BQHG 3T0EA 1WWAX 3TA3A 4EBQH 3WFDL 3IDGB 4Y5YB 3U0TA 3HAEG 5FA4B 1TZIB 2DKMA 5I19H 2B4CH 2DICA 4RMRA 4Y8AA 3LN5A 3WHE0 4L1DA 2H9GB 1KIUA 4LDOB 2B7DT 3RFZC 1DQJB 2Z35B 3NABH 2CIIA 4JFEE 3OG4B 4YPGB 3UJIH 2X70B 1I1AC 2YWZA 4HS6A 2AXFA 1KENH 1FGVH 5CEZD 1ZWIB 5F1IB 1FO0A 4H0HB 1OM3H 5IESH 2OI9B 2VN7A 4LVHB 5DK0B 3C09B 4S1QH 1AR1C 1K8IA 1EO8L 1U3HD 5EU6D 1E27B 1YEKL 4PD4K 5DUBA 4KK6D 4LAQL 4D9LH 3GKWL 3CD4A 3I6LE 3BN3B 4YDKH 3PWPD 5MEPB 5SWQB 4M9OA 4EN3D 1BVZA 4JKPH 1RZ8A 3Q3GB 3G5VA 4JEGB 1T1XB 5F3HA 1L0XA 1UQSA 5B22A 1TVBB 2BSSB 3RPKA 1Q9OA 3HUJA 1N7MH 5JW4R 2H3NB 4HZLB 3STLB 2YD2A 3TJEL 3KLHC 3FAXA 3GSNA 2EDQA 1DL7L 3WE6A 1D5IL 3MRKB 3DURA 4K2UL 3U7YH 1V7MH 3AU1B 4OIAA 4RMUA 2CRMA 4OJFH 4YUEH 1YNTA 5DEGA 3SQOL 3MXVL 1RI8A 1MHCA 3D3VB 1UWXK 3T3MF 1AXIB 1N7ML 4CL7A 3RGVA 12E8H 1AY1L 3I3DA 2F5AL 4OGYL 4R26L 2VZ3A 4JN2A 2NX5E 2VLRB 3MXWL 2FX7H 3LSOA 3TCLA 2FHFA 1YY8A 4LVNB 1PZUB 5SX5K 3VU2A 2BNUB 1KJ3L 3T8XB 1SQ2N 2EICA 4JFZH 1BF8A 1OD7A 3LPFA 1HDMB 3RUGB 4HV8B 3SGEI 2FHBA 4AIXA 3GRWH 3MLUH 1FFPB 1AGDA 4MQ7B 4UINH 4BELD 4BQ6A 4TNWK 1EGJH 4Y4HD 3GI9H 4DVBB 2J8UF 4R0LC 3MLZH 1A9EB 5HYEA 1CGSL 4OQTL 4ZDHB 5EU7E 4YFDB 3DV6A 2YD7A 2L7UA 2B1HH 4AM0A 3FQUA 4QHMA 1BIHA 2Q8AH 4DKFL 4XMPL 5ICZB 1IGCL 1EBPA 4M1CD 5JNYA 3MA9H 5DJ8A 3VG9B 3FQWA 4FFWC 3F7VA 2ICWI 3H9ZA 1M4KA 1N5YH 2XV6B 4ERSH 5C0FA 4PRNB 3UBXI 3KPSE 3QI9B 4IOFC 3LQAH 3MUGB 1FYTD 4PJDF 2YPKA 3BX7C 3DJ9A 4YHLL 4RMTA 1A3LH 2HA1A 2MPAL 2R0KH 4PUBL 1L7TL 3HI1A 1IZJA 4XH2B 3N1QC 4JY4B 2QQQA 1BQUA 2DLFL 4XAWH 2D4FA 2AVGA 5I8KL 3FFDA 1OP3K 4E41A 1O0VA 3SGDH 4HG4J 4JPVL 2DM2A 1HNFA 3SOBL 1ROWA 1NC2D 1CD1A 4KU1A 2R2EA 5CS7A 2C1OB 3GGWB 3GSUB 4GRWB 5ISZA 5ICYB 4PJXB 5IFHL 1KXTB 5CEZL 4QEGA 3G5ZA 5TDNB 1U8MA 5I1CL 3MODH 3VWKB 3FOMB 3ULVC 1UH4A 3HMWH 3ECBB 2VOTA 1P4BL 3VFMB 2PO6D 3AM8A 4S0TD 3ZHKA 3TO4D 2PKDA 2VWEC 4GXUM 5A2JH 3C5JB 3ZT6A 1A7NL 4RGMC 4XPGL 1AO7B 3DX6B 2J5LC 3U9PL 3P0VH 4B41A 1YY9D 1A7BA 2V9QA 2VQ1A 6FABL 1DBJH 8CGTA 1C5CL 2ZUSA 3BIKA 3MRFA 3N1PC 1HHIA 4OCWL 5CZVH 3GSNH 1PG7X 3DV4B 5LKNA 4LAJH 4Z5RB 1CVSC 2XZQL 5D93C 5HHOA 1T80A 1UADC 4FZEL 4EI5C 2YSSB 5LGKA 4CJ0A 2XTJB 5DRXB 2FJFA 1CE6A 2VLMD 3MSPA 4NBYB 4Z76A 5I1IL 3QISA 4HDIA 2JLLA 5IUSA 2DF3A 2CKBL 4NKQB 2XWTB 4LIQH 3MRQB 1U8IA 5TPWL 4S2SA 4OGXH 4P5TA 1KC5H 1NC2B 4YC2C 1FFRA 5DO2D 1CFBA 5D1QA 3Q5TA 3RBGA 2VXUH 1TJIH 4NQEE 5MEND 3IF1B 1OAZH 4PGJA 4MA1B 3FFCE 5IEHB 4KMTL 3F6IA 5FECA 1NAMA 4QY8A 1B6DA 3HC3H 2K1MA 3P4NB 2XKNB 4HFWB 2NY4C 4TTGA 3LDBC 5FKAB 3BKMH 3QAZC 4IRSD 3VWKA 4YEFA 1EBAA 1M6OA 3HR6A 1KN2L 2L0DA 4LSSL 4KUZH 4YDVA 4LAQH 1DQLH 4RFEB 2DQJL 1JWSA 1KFAL 1CR9L 4LSQH 1CGWA 1ZHBA 25C8H 4YDKL 5EA0L 4UT7H 5TF1L 4G6MH 2NY7L 3I02A 2VXVH 3TO4B 3MGAA 1UM4H 3O3DB 4D94A 3BZ4A 3CDFA 1CLOH 3OHXB 5EO9B 4NN5B 1FL3A 3RNKB 5LGJB 3ZTNL 1P7QA 5F7EL 3W0WD 3ULUH 3CXDL 4OTXH 5KJRL 3VRLE 5IIEB 2IGFL 5DZNA 1IEAB 1SY6A 1DL7H 3RL1B 2N1KA 4WGWB 4F7CA 4ZUVB 3T3PF 5ISZE 3KXFB 1F58L 4PV8B 2J6EA 1UXWB 4UNTA 4PJDB 2DWDB 3MLYL 4OCYH 5T5FL 3O6FC 3RWDB 1CD8A 5FXCH 4MJIA 5SX4H 3PWUA 5GHWL 3R0NA 2ZUWA 3BMVA 3FAWA 1BQLL 1QFWL 3DWTA 4KTEL 2VDNL 4LVNC 5B38A 5GSRA 4NO2A 4GLRI 2IANB 4ZDHA 1FG2A 4M6NL 3CZFB 4PJDE 3T0VA 4MCZA 3HNSL 3F12A 1WQVT 4Z7VA 3LY6A 4KRLB 2HMID 4XXDA 5JA8B 2IQ9H 1HHGA 5I8CB 5C9KA 1JRHH 1ZHKA 4AIOA 4ODSH 1P7HL 1M05B 4X5WB 2P48B 5DEFB 1YN6B 1F11B 1CVRA 3RTQB 4Z7OF 2IPKB 2UZIH 3QP3A 3LN4B 3GNML 3UO1L 4NM4L 4NHUB 2HKFH 4K7PH 4NQEA 3IDMA 1DE4B 4PG9A 1OLLA 3RX7A 4Y1AA 5D7KE 4Y2DA 3G08B 5ITBL 5I18L 5FO9B 1W72L 2V7NA 2D0FA 3VG9C 5JIPA 1FNEA 3DUSA 4JFHD 3L3OA 5IBUG 1MFAH 4NGHH 1QNZL 3S5LG 4LOUD 4DCQA 1FV1A 4L4VA 4PLJD 1BJMA 3O8XC 5L0QB 2FYYB 4OI7A 5EU7C 2VR5A 2O5YH 3DMMC 5AD0B 3UX9B 3GI8L 4D9QE 4MQSB 3VXUE 4AEHL 4DZBB 4J2XA 1JMXA 4P23A 5IEKA 5KVFH 4JM2C 3STLA 5DQDL 1E4XL 1IEHA 4L8DA 3S37L 4TOYH 2ZUQB 3L5HA 4KY1L 5DHYB 1GHFH 4X4YA 2YD4A 3OQ3B 4KROD 1KSRA 2PR4L 3GSVB 1OGTA 1JUFA 5MEOA 2CLVB 1U93A 2D3VA 1QRNE 5T1DH 1DBML 4X4ME 1UWGH 5D7KD 4OLVL 3PQYA 3QO1B 4P2OD 5CZKA 5MENA 1ONQA 4P4RA 5FF6B 4KRNA 1LK3L 4LHUD 4C56A 2XQYK 4MXWH 1NBYB 5I8EB 1HH6B 3HPJA 4LLQA 2FGZA 4LMQE 4Q2ZB 4C83B 5HDOA 2D03H 3LKNB 4HFUL 3S96A 5H35B 2J5LB 4PS4L 5DVOA 1FNHA 4TUOA 3ZTJH 3LIZH 2R1WB 5FB8B 5IJKC 7CGTA 2ZCHH 3BD5A 4HIEA 4PGZA 4Y2OA 4GAGL 4Y19D 2EE2A 3QNXA 3V6OE 2DJUA 4GKNB 4WW2C 1OW0A 2F54D 1N5AA 4FZ8L 3X11B 5HHVL 3M17A 5LQBH 2Y5TB 2FATH 3CK0H 4PJ7B 4TNWF 1F4WH 4PJDA 4ZD3L 1H0DB 4XBEL 2XFXB 3IGAA 5KS9F 1YEIH 3DXAB 1U3HC 1JZ5A 1EPFA 2H2SD 5HYJE 3REVB 3MV11 3CU1A 4NQSB 3N06B 1NBYA 3MOAL 2APXA 2X9XA 5F89A 4M48H 5CBEA 3QWQB 5D7JA 3DUHA 3S4SA 4MA1C 3HNSH 4O5LH 4P23D 4CKVX 2HAZA 1FL6A 3VFPB 3WIHH 3N85L 3ARED 5I1KL 5JXEA 2V2XB 2BNUA 5I75B 1JPGB 3NZ8A 3WFHB 5IMMA 1I3RA 3MRDB 1NCCH 4MA8H 4KK6C 1U91B 4FQXC 4U1LB 2AK1H 3L3KB 1WTLA 2I07B 2O61B 4HG4K 3RVUD 5IMOB 4FFYH 4RMQA 1C7TA 1ORQA 3TIEB 4NKIL 1JGDA 1I1FB 2ZSWB 5ALBH 1IBGH 3TGXA 4PP1C 3TT3L 4XCNA 2FX8L 3F7VB 4X7DC 3KLSA 5BRZB 1LEIA 2VUOA 1P6AB 4Y16B 4P5KB 3VXRB 1Y6NR 4FQIL 4OCNC 3SDCD 1EEQA 2AK1L 1T20A 4JM4L 4X6DB 4GSDL 3P0YH 2HVKA 4WI3A 3AGVA 3RTQD 4OTXL 4NJ9H 3W9EB 1FL5A 4I18A 1J86A 1S7TB 4JRYE 5JXAL 2IPKA 5DRXA 4E42A 2OP4H 1Q1JH 4M93B 1G7PA 4DGVH 1B9ZA 2KZ1B 3H9SB 1T5XB 5T1KB 1JZ6A 3A6BH 3B2VL 1NGWA 5J1SC 3DHJA 4Q9QH 1NANH 5FUCE 5BV7L 3EYFA 4Z0XA 3VMPA 2CIKA 4LMQI 3VXSE 3P4OA 4CU7A 2ARJQ 5LQBL 5GZOD 2XKUA 4LCUA 5SV4A 1ZGLM 5C3LD 5D2NE 5MEQA 1PQZA 4QF1B 4CVZB 1P4IH 3W2DL 3HZKA 1QSFB 1DQLL 3ME0A 3QQ3A 4LEOA 2EDFA 5FYKU 3ARFD 3ZE0F 1CLZH 5I1IH 3BP5A 1VPOL 3U7WL 1R3IL 1HYSD 3BSZH 4GS7C 4DUXA 3SDCB 3T0EB 5K33A 4JAMA 3JWNC 2GT9B 4DCQB 3HG1E 2HFEA 3OAYH 5E08L 1NC4D 2YEZA 1JGDB 2OJEA 2VZTA 5L9DH 4RSVA 4G3YH 4Z78B 1FE8H 4LGSB 4U3CA 3ROOA 4PP1D 1ZHNB 1OGAB 2PXYD 1QQDB 4L3CB 3WFHA 3KGRA 5IMMB 1KN4L 1XGUA 1FZMA 1YEEL 3CH1B 4PG2C 5GRZA 4LLDB 1XF4A 5E2WL 1MH5B 4MGXA 3SCMD 4HLZH 2H26B 2D7QA 1H9VA 2ZG3A 1I9IH 4Y0GA 3DMMB 3DX9A 4M7KL 2WBJA 3NACH 4EI5B 4NJAH 4IMKC 1TCRB 2W65A 3MODL 3CUPB 2JB5H 3MMEA 4TYUA 4AEHH 3IDXH 5SWZA 3S6CA 3WYRA 1MLBA 1GVIA 3EYOA 3LZFL 3RWGA 4JFYB 4HX1A 4O9HH 3C60D 4DVRL 3FB6B 6CGTA 2I25N 4O2CA 3Q1SL 2M8XA 4KK5C 3P4NA 1ZLWH 4YDIL 2FHCA 3D85D 3P4MB 5D2LB 3SBWC 1CDCA 4GMSH 5GS2D 5DQ9B 3OG6B 1BHGA 5FUOH 1AXSA 3BD4A 2EYTA 1ZA3A 5DJYB 5CD3A 3NVQA 2EDKA 3TF7C 3BH8B 4CU8A 3UTTD 4HX1B 5D1ZD 5EZIL 1MF2L 2VISB 5KANI 5FYLE 1MCKA 4MJIB 1CXIA 1NUNB 5ICXB 5L88L 4Y88A 2WANA 3ULSA 5FEBA 2BHYA 2R39A 4Z7QE 5J12C 5AZEH 3IDJB 3DETC 2Q7YA 4QXGL 1IEAA 1N8ZA 1LNUB 4G42B 3NCCB 3LKOA 3JVGC 1G7HB 3KPMA 1QEWA 1OY3B 3E8UH 3H9SE 3TCLB 4FQCL 2WQ8A 1HHIB 4P23C 4WCYH 1VEOA 2Y06L 3I02B 3TO4A 4H1LH 2ADFH 2A6KA 3EFDH 4NN6C 2ADGA 2X7LA 2CKNA 3MRJA 1OSZA 3HC3L 5E8DH 3S4SG 1D9KD 5C0CE 3MYZA 5J57B 4KRPD 2A1WH 5HYQA 1FIGL 2PO6B 3FRPA 3ZE2E 3WNPA 1UWXH 1U8KA 4MD4A 5C0IA 4KUCD 2RB8A 3ZYJA 4HS8H 3AFLA 5IEHA 5E7FA 1T3FA 2DN7A 3BEWA 2B1HL 3ES6A 2NY4D 1RZ7H 5GQBA 2OR9H 2Z92B 3F7RA 5DRZB 2BY0A 1I1YB 3WHXB 3IDNB 2YPLE 1C5DB 4UNVA 1DLHA 5SV3A 3BAEH 3RGVC 3PWPE 4UUJA 5LGHL 3T2NH 3L3DA 4ALAH 2JJSC 2YA0A 4X9HA 2KQMA 5IBTH 1WTGT 3OAYK 1IM3A 4ZFFB 1RUML 5CGYD 4UQ2B 5JW5A 4Q9RH 4JCLA 1BVKA 3DXAE 5EWIL 3ET9F 5AZ2H 5D96C 4F9LA 2IG2L 3I50H 5HY9B 1GC1H 2GAZB 2V9TA 4JZNB 1J7VR 3ZKQD 1F45A 1I8KB 3EYQC 3UPAA 4R4FH 4J3OC 1F3JB 3QQ9C 4ZUTB 1EFXA 2IBGA 3VXOB 2EH8L 3IFLH 3TH4T 1D6VH 2O61A 2DQFB 1RPQA 2IWGA 5IB1B 3TJEH 1XCQA 4P59H 5IHZA 1A3RL 3CFBB 4WU7A 3AXLB 1AGDB 4J4PD 3DX9B 2DQHL 3B8SA 3WFEH 2GHWB 5EUOE 2B4CC 4OBRA 5D2LF 4YIQA 1H3VA 4RA0C 5I16A 4NQSA 4X6EB 3LZFH 5D1ZA 2IAMC 2IC2A 4IS6B 4HC1A 3ESUF 3EOTH 2VLLA 3LKPB 1XF3A 2EDYA 4J7RA 1U8LA 2FH6A 4YH6A 1CFTB 1EMTH 4Y4FA 3PABB 5DMGC 3PWLA 5B8CA 1QSED 3FQWB 2HFFB 5I66A 3FHQA 4A6YH 4PJIA 2ICEB 3D25A 3MA7B 5BOPA 5AWNH 1QO3A 3GHBL 2ESVE 4TUKH 1PG7L 1X3DA 2XACC 1EX0A 1CICA 2GI7A 2BJML 2YPVL 4QT5B 5H94B 2WBJD 1EGJL 4Y5VA 4EXKA 1DSFH 4WW2B 5TH2A 3SQBA 3RHWK 4QY8B 5I1AB 4AH2B 1BX2B 3G5VB 1NMAL 3CXHJ 2FR4A 1M7IA 1T7VA 4U1MB 3HE7B 9CGTA 5CP3H 1OAUL 2FWOB 1G7HA 3KPMB 4M7ZC 1EHLH 3GMMA 5KSBE 3B9EA 4X6CE 3QEGL 1HH6A 4H0GA 1UJ3B 2DQCL 3FQXA 1L0QA 4XMPH 3C8HA 3QULB 4GO6B 5FF6A 5KVEL 1KIQB 1U3HB 5EU6B 4CADA 4V1DA 4HJJH 4XBGA 4X8JB 1N0LA 1MWAH 1MJJB 4YBQD 4E42B 1PKQE 3MJ7B 4CN1A 1W8NA 2ZOKA 2KKQA 5KSVA 1DP0A 3DPBA 4XC3H 4UT9L 3LKRA 2VLRA 2X70A 4LCCB 1RZGA 1MRCL 4P2RA 2P5WA 2FLBT 2H9GA 3VDCA 2X4NB 4MA7H 1K6QH 3SE4C 3U0PA 3HS0B 3FN0L 1Z0MA 4U4BA 1JNHA 4M7LT 4MAYB 1FJ1B 4WO4C 5TE4L 5F1OB 1HKLL 2VR4A 3MREB 1YNLH 2CUMA 4U05A 3ZL4L 4P4KC 3PV6A 5ESAA 4JG1H 1KB5L 3MRRB 1RK0A 2PNDA 4HXAL 3Q3GA 3EOBA 1NGPL 1NQBA 1QFHA 1MH5A 5E56A 2F54E 5I16B 4I0PB 4XP6H 1R3HB 5LGJA 3B9VA 5BQ7B 2G75A 1A6VH 5HHQA 4OQ1A 3C6LD 2R56H 1BVLB 2IH3A 4ZFOB 3QNYB 2Q1EA 1N4XH 4F37K 4AENB 5JW3L 3BP7A 3QDMA 3QG7L 1Q9WA 4PJGE 3VRIA 2FEDD 4TUKL 2VXSL 3LS4H 3L5XL 4IJ3C 1NMBL 4PJIE 1CD9B 2V17H 5TE7H 1QSFA 3SO3C 2CH8A 1H3GA 4MWFB 5L2KB 4NRYA 1FNFA 4G9FD 3VFSA 1T0PB 2VABB 2ADJA 3P9LA 3CCHB 2GITA 1AQKL 3AY4C 1UB5A 3R1GL 3V6FA 5KS9E 1YYML 5KSBA 3VXUD 3D39D 4MDIB 3ZDZF 3CFKB 3VXME 3SJVA 3KS0H 3O9WC 5ERWA 4JDZB 1QVOA 1S5HB 4G43A 3MLSH 4ODVL 3LVEA 3U2SA 1EEYB 1UB6A 3BDYH 5CWSA 4N9OB 4Y4HC 4QRQB 1CFTA 3LD8B 3FOLB 1RULL 2DAVA 5KSAA 4KUZL 3GIZL 4CVXB 5F9JB 2W9LA 1D6EA 5D1QD 1QRND 3VWJB 2W59A 3PP4H 5CP3A 4UAOB 5D1XB 4PYHA 3ABZA 4LSPH 4JLRB 4N5UA 5E2UL 5D5MF 1EXUA 2QSTA 1KPRB 1BJ1J 1W0VA 4HPYH 5IVZA 3ZL4H 3IETA 4DGYH 1A7PL 3KS0J 4GRMA 4UV7L 5E8NA 1A64A 2VL4A 3C6SA 5KANG 4UMGA 1HQ4B 1FNGA 5B4MD 3B83A 3MUHL 4PRBA 5JHDA 1RZFL 4OZFG 4GW5B 5L7XH 4HPOH 4KJPC 3VRJA 4JFHE 4MAUH 3P11H 4LLMB 2B5IC 4AY0A 3B8YA 2WAHA 3S97C 3K4DA 4IOSD 1X6LA 1CGTA 4PJ7A 3GK8L 5IBLC 4HDIB 4OFDA 2WLZA 1A6WL 3KWWA 5C9JA 2VDLH 1I7UA 4LVHC 3B5GA 4XNXH 2VE6B 4FQXA 1RUPH 4MX7A 1IC4L 2YK1H 4X7EC 3U0WL 3T1WA 1KN2H 4ZS6D 5HHXL 1MCLA 1X5JA 4QOKA 5T33H 1FLTX 4OBSA 2HRLA 3BZFA 2HJFB 4Z95H 1ZTXL 4LLAA 2CGRH 4HT1H 1FO0B 2YUVA 2JJTC 1GYAA 2Y7QA 3W0WE 1JGEB 3GJEB 5DJDB 5E99L 3UTPE 2AJUH 4M7LL 3V0WH 3AREA 3HE7C 4Z8FH 3QRFM 1AXSB 4WI7A 5CKAA 3X14B 5EN2B 1S7RB 4ONFH 4ZYKA 5J6GA 1QBMH 3O81A 4RZCB 1RJZB 1NCWL 3GBNH 2P8MB 4X8XA 1AP2A 2VDKH 4RQQA 4JPVH 4PRIB 4OF6A 1CG9A 2GJJA 5IVXF 1LEKB 3BP6B 1UVQB 4PGEB 1HN1A 4O2FB 3GSWB 1AHWA 3KDMB 4GRLC 4MHHI 3STZB 4WW1B 3U6RA 5CEZH 3O8XA 4P2OC 3UJJH 1OHQA 3MREA 1NCBL 1QFWH 2XG4A 1T7YA 1ZLVH 3LPGA 4OLYH 3W9DA 3FL7A 1U8HA 4PBVC 5EOCH 2P4AB 1T04B 4JKMA 3TT1L 2W9EL 1FO0L 3K46A 2FL5B 4W4OC 4HUXB 3MC0A 1KOAA 5BMFH 1H8SA 1U8NA 2YD8A 4D0CB 3QCTL 4LQFL 1YECL 2VSCA 3L7FA 1NCBH 5A1AA 1T5WB 1JWSB 1MFEH 3VXNB 4NQDA 5K59E 1IAII 1WCQA 4B50A 4K3JH 3OKLA 3NA9L 1FO0H 3QUXB 3JV0A 3BP5B 4CW1A 3BIBX 4Z7UE 1LO3L 3IDIB 4ZUSA 5D6CB 1IGFH 2GIYA 2VUYA 4YDJA 1WZ1L 4PREA 3WD5L 1A4JB 2AXGA 4D0DB 2WNGA 4WWKC 3KPNA 3WFZA 3AMKA 3PE9A 2DL9A 4O2EA 3SE9L 4WUKL 1RJZA 1MIEH 5JORA 4F33A 1A6ZA 1L6ZA 4XNUL 4Y5VB 4LDLB 3EYVB 3T2QA 2XA3A 2Y23A 3MGOB 3K7UA 1I85C 2IGFH 2UZXB 1TZHB 1UKTA 4HS8L 4MXWL 2V9RA 5FCUH 3KPSD 4NOBA 4HC1H 1TCRA 1U36A 1UXWA 5A43C 1OQXA 25C8L 4PGDB 3WO4B 3GB7B 3IJYB 1DDHB 3GM0A 5E95B 5HGDA 3WUWG 5TE4H 1OT1A 5BQ7A 1JZ4A 4XWGH 1KIRA 2IANE 3B2UD 1QFPA 5T33L 5EUOB 3SDAD 4P5KA 1T0NB 5GIRA 3OF6A 2CK2A 3V7MA 4ODWB 1PSKL 4Y19B 1YN7A 1A14H 4RIRB 3O9WB 4OLZL 1F8TL 5FGRA 4KI1A 3PWVA 1AY1H 4WU7B 4M7JL 2BVQA 1UQSB 1I7TA 2A77L 1EHNA 2VLKE 3ARYA 3LN9A 2GFBA 4BKLB 3MRMA 3KNBA 5JZ7C 3MNZB 4B7IA 3BPOB 1MRFH 3BVNA 4JRXE 3WUWA 4NQCD 1DR9A 5HYIA 3QUXD 1FL3B 5IFJB 1G0XA 4K8RC 3SY0A 1DTUA 3PWNB 4NKOA 3K8KA 1CE1L 4HKBB 4XGZA 1LE5A 3E1F1 1C08B 2ADFL 2GJ6B 3MBEB 3ULVD 1T22B 1U9KA 4J4PC 4MCYA 4LPUA 4EUPA 2ZOKB 1A7PH 4K7FA 4EJ1C 4YK4B 2ZSVB 1AIFB 4YHZH 4F57L 2AXFB 5ADPH 1WEJL 2R0WL 3T0WA 4UOW0 4LLWA 4D9RE 3KHOA 5C2UB 2OBGA 2VAAB 4XI5C 1WBXA 2VZVA 4GQ9H 5HHOB 5IROC 3HPLB 2UY6A 3UO1H 2FGWH 2XN9E 4YQXL 4FTVD 4EDWL 1P5UA 3SKNB 2XICA 4JPKH 2Y72A 4NOFA 2F8OA 1RUQL 3SKOB 5FM5O 3I2CH 4ZTOH 1MHPL 5T1LB 3BP4A 2ADIA 2R0KL 2Q86B 3TZVD 5C7XH 2JK5A 2ARJA 2GJZB 3VFSB 5EU6E 4NUGL 3ZO0A 3MLRH 4DTGL 1K2DB 1GOGA 5D2NC 2MCPL 3QXAB 3NCFB 3UZQA 1U92A 1J1XL 4JO1L 4ZS6C 1AGBB 2Z93B 4YX2H 2OL3A 4NFBA 4P2RD 3QIUC 5TQ0H 1H3PL 1T4KA 4NN7C 3V9FA 4JLRA 4JFED 1LWRA 5BJTA 1JGVL 4P0DA 1S7QA 3W9DB 5CD5D 5IW6B 4S1DD 1F13A 5E6ID 4F7TB 5GS0C 3LMJL 3TIDB 3T04D 2NX5D 3NTCH 5CP7A 2X4TB 4EBQL 2BSTB 4HF5L 4I9WE 4CVXA 3H6JA 2GY7B 3BKYH 4MB4A 1U8KB 2DQDL 5D7JB 1U0QA 2NW3A 4O02H 1QR1B 5F89B 3WUWB 4BSJA 3GIVB 3DURB 4IJ3B 3FONA 5HHOD 1B2WL 1XGQA 1N6UA 4PR5A 3PP3K 4XNUH 2VDLL 1HCVA 2IBZX 1CFQA 4ZOCA 4AMKH