1BOGB

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-homologous peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
213
structure length
213
Chain Sequence
QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAYNQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
molecule tags Complex (antibody/peptide)
molecule keywords ANTIBODY (CB 4-1)
total genus 43
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1998-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bogB02
2DLGA 2KKQA 1FORH 5LWYH 1X5FA 1TCRA 1XAUA 4PJEB 5F7YC 4NNYB 5HHQA 2RJMA 3SDXA 4OIBA 5FF6A 1MOEA 1DDHB 3LN4A 3UJIH 2O5XL 1EO8L 4FQXB 1ZLVH 4D9LH 4P3DB 3QULA 4JJHA 3MRJA 1EK3A 3P77B 5BXFB 3UTSB 3OAZK 1OLLA 1TQCB 5CP7B 4MNGA 5EBLA 4M6OL 4C55A 1RI8A 2AK1H 4C54A 4Q9BA 1IE5A 1T1XA 1KCKA 4YBLC 3HI6L 5JO5B 1XH3B 3BGMA 4LVHC 1T7XA 1NCTA 4NQCD 5D9SA 1H3PH 4PJDE 5KSAD 3QEGL 1A7OH 3GB7B 1JPSH 3K2MC 2DM7A 1Z3GH 1LE9B 1QBMH 2GFBB 1YEFL 1IGYB 1DUZB 4Z7WF 2XA8H 3DGGA 3OB0K 3KYMB 3I75A 4HS3B 3VXSD 5IFJA 3FRPA 4HJ0C 1OB1B 1FNHA 3ZT5A 1FNGB 3LRSB 4YUEH 4MAYA 4P59H 5FA4B 5EC1B 4X6BB 4OF7A 2XZAH 2Z8SA 4Q6IB 5I2IB 3CUPB 4H5SA 2VTFA 4PS4H 3O9WD 1OQOA 3CNKA 1KUMA 3STBA 3VGFA 1Q0YH 3LKQB 3LEVL 4HUVB 1CZ8L 1CE1L 1ZVSB 4QHNA 2VRAA 4QNPE 2QKIA 3WYRA 1KULA 5BV7L 2QL1A 3C9NB 1Y18B 5GS1C 3QPQC 4K7FA 1YN6B 1G7QB 3HE6B 1V7MH 3DO3A 2DS4A 2BNUA 4YDLC 3D2UB 5MERA 3R06A 4N8CL 4U0QB 5HYJE 2EDTA 1TTGA 2FD6L 3L7EB 4TTGA 5K9OA 2BY2A 3WCYA 4Y2OA 1XF3A 4LLVA 3P0GB 3B5HA 4MX7A 1B2WH 3L3IA 1RUPL 4L4VA 4ELKA 2VXUL 4M6OH 4F8QA 2J8HA 1F42A 4KY1H 2MNUA 2JKXA 3QQ4A 1B0WA 2E7LA 5E94B 1UCBH 2NY1D 4PG9B 3PE9A 4U2YA 1SM3L 1SY6H 5MEND 2DQJL 2DMCA 5CBAA 1BFVL 1HI6A 1YEIL 2WUCL 1PW3A 1LO0L 5D5MF 35C8L 2ZCLH 3HI5H 4YDKL 3GSNB 4S1RH 4XX1G 5IHUH 3PG2A 4ELMB 3IJSA 3MBED 4HLJA 3S88L 1T5WA 5DDHA 4UNTA 2NY3B 1OWWA 1MCQA 3IFNL 3TP4A 1EZVY 1YMHB 2DKSA 3DURB 4I18B 2Q6WA 2FECL 1GOHA 1BM3L 3ZT7A 2V9QA 2Z31C 4PJ5D 2YXMA 3SDDC 3WIFA 4O2CB 3VH8A 5GGVH 1Y0LA 4PV8A 1I3GL 5BV7H 4Y2DA 1QSED 5EZLA 2OR8A 1ZHLB 1AKJB 1MVFA 3P0YL 1ES0B 1P6AB 1MRDL 5H8DA 2IQ9L 2ESVE 3MLZH 2AXFB 4GMSL 3PWJB 5ICXA 5I1GH 3P9MA 2R23A 3TYGL 1E0OB 3RDTA 4C56E 3I3EA 4HC1A 3L5XH 1I8MA 4MQXD 1P4BH 3N1GC 3GIVB 4JRXA 5B4MC 1S7UB 5C2BH 3OGCA 2VLRA 3PV6A 4V1DD 5DS8A 3RTQB 1NAML 3O8XA 1DZBA 3PABA 3KDMB 4F37F 1KBGH 2KUTA 1KB5B 2I9TA 5K9OB 4LMQE 1GZPB 2NY6B 5FK9B 2E7MA 5C0AA 4NHUA 5FB8B 1MRDH 5CIPA 4BKLA 3X12B 5T3XD 3QIUD 2YUVA 4PJ7F 4YR6B 4L1HA 5I1JH 3UBXG 1NAMA 3SDAD 3V0WH 4CGTA 1D5XB 1SEQH 5JPNB 3AXLA 1FLRL 1R3IL 3HA0A 1YNKH 1DTUA 5IVZA 5L9DL 3RVXD 4Y5XA 1ZAGA 3MLVL 3EJJX 4Y5VB 4Q6IA 4HMDA 2FEEI 5JIHA 3DMMC 4IDJH 5ISZB 5I1CL 4JPKL 4I48A 2VISB 5K9KA 1G6RL 2XZAL 1CIDA 1KJ3L 1MWAB 3I6GA 5JXEA 5I1DA 3O2DL 4E5XB 3RIFK 3NCBB 4NT6A 5F71A 1MCCA 2EH8L 2QQNL 4K2UH 5ENWB 2ADGA 3MGOA 3BUYA 4NSKB 2PCPB 3BAEL 5JIKA 4HS6A 4K07A 4TPRH 4WTXA 4ZUTA 3IXAA 4OQTL 4JG0H 2VE6B 1OAXL 4Y4KC 1C1EH 1NUGA 2E6PA 3MR9B 5DD5L 1RMFL 1WWCA 2AK4E 5KVGH 1K8IA 4Y4KA 3ZYIA 2X9XA 1JPSL 4HK3N 4BFEA 4QHMA 1F3JA 1T1XB 2CUIA 4KJWC 2JJTC 1C5DA 4HBCH 2OTUA 4G6JL 4OM0L 4JRYD 2JJTA 4I5BA 3MJ9H 5JXAL 3R1GH 2R1XA 1K9TA 3P73B 3V95A 4OZHE 4D0CA 3CPLA 3CMGA 1J8HE 4JFOA 4P2OC 4JFFA 4LASL 5ID1A 4TN9A 1YEHL 3PP4H 4FFVD 5E99L 3DX6B 3MRDA 4MQTB 1FL3A 4NGHH 3UZQA 5BRZE 3EGSA 4X99A 3H3PL 3GSVB 2FJGB 3V5KB 1S7WB 2EE6A 1YJDC 4FP8L 3K0WA 3U7YH 3RWJB 4A6YA 4BZYA 4HHAA 4EOWL 1U92B 4JFED 4OF3A 1XF5A 4HIXH 1GGCH 2HLFC 4TVPE 3HR6A 5KSBA 4PUBH 5DWUH 3CFBA 5E5MA 3MV9E 4PLNC 1LILA 1CXIA 1MRFH 2DWDB 2NY2B 4IMKC 4BH7B 3F7VA 3FL7A 3GJFH 3RHWK 2YEZB 5JPMA 4KZEH 3FN0L 4FFZH 5D1ZA 5IR1A 4UQ2A 4HWBH 2YN5A 2HJFA 1U8NB 1FNLA 4U1SB 3BPCB 4I0PA 4K9EH 5TE4H 2JELL 4E41A 2CKBL 4RMQA 3QXDB 4KK8C 2UYLA 4KJPD 2P5EB 1BZ9B 5HHVL 1U8PA 2NY6D 3ARVA 2DLFL 1KB9K 2A1WL 4CADA 3GJEA 4C59B 2OSLB 1CT8B 1J10A 2V5RA 4HBQA 4XRCA 1DBJL 3NTCL 4LRIA 4HF5H 4M1CD 1HHKA 2H2SD 3VCLB 3EOTH 5DVNA 1XIWC 4GKOA 1R3HA 5HJ3B 5A3IC 1AFVL 4MCYA 3TLRA 4F33B 1R3KB 3T0VA 4R4NC 4LOUD 1ZT7A 4NFDA 3R0NA 3RY5A 4HG4J 2CMRH 4H20H 4NZRH 4X6DF 4DUVA 2WWMC 1FYHB 4OF8A 4K3EL 5C0CB 2YHGA 5DEGB 1W2KT 3ZDXE 3NAAL 3IDNB 2A9ML 1FAKT 1KNOA 3SDAA 3Q2CA 2E27H 4P57A 4NOFA 1S9KC 1TLKA 3KPPB 4U1JB 4AT6B 5CJXA 3W9DA 5IBTH 1IC7H 5F7FA 3HUJE 2G2RB 4K7PL 5DO2C 2YKLL 3WV0A 5F7DB 2OX5A 3FQNA 1A9EA 2YD7A 3X3FL 4XMKL 1GIGH 3SGEI 4OCSL 2CD0A 2YS4A 2VLRD 4V1DA 5D5MB 3OKMB 3KJ4B 1S7TB 1DQTA 2DKMA 5EUOB 4D3CH 1PSKH 1N64L 2CUHA 4M7ZB 1IGIH 1WF5A 5B3JF 5I75C 1A7QL 3PDOB 3IDXH 2C3VA 4PB0L 5FGRA 5FYLL 3S88H 4OCXL 4PY7B 1IT9H 1IGFL 1NC4B 2C7UB 4YDLB 4LL9A 4M48L 1BQHG 1W72L 5EFIB 5IF0B 5MP6H 1P9MA 2C3VB 3C9NA 4J7RA 1DN2A 4WI9A 4RIRA 1PKQE 2LTQB 3QXTA 3E3QC 4TNVF 2Q8AH 3MX0A 4PJ5A 1QKZL 1BD2A 4QRTA 1RHFA 4ZSOB 1DLHB 2OP4L 4P49A 2P5EE 1MI5A 3D25B 5TQ0L 1FCCA 2F53D 5DVMA 5HSFA 1IGTA 2NY5H 5HI3D 3QISA 5EU5A 5CD5D 1HZHL 5LVEA 5HYEA 4CW1B 3ZYJA 4NPYB 5BW7C 5E99H 1P5VA 5GGSB 4W6XB 5EZIL 3C09C 2OMBA 1AC6A 5CILL 5E4EC 2BVPA 4ZNEE 4PJIE 5IEHA 3ARBA 1M6OA 1UQSB 1IGCL 1PG7X 3WDIA 5IB3A 1FRGH 3T3MF 5E4EB 3CZFB 5L7XL 1TTFA 1WVZA 4XZUB 1HKFA 1G7PB 1I8LC 2X4QA 2PNDA 2C1PA 4KTYA 2Y36L 3GJFA 3QPQD 8CGTA 1KJVA 3O3BB 4WEUD 1KF9B 3HPLB 4N0RA 5E8DH 2IJ0C 4X4XB 3G9AB 1FG2A 2C4XA 5ITFA 3U9UA 5KSAB 2XV6B 4LLQB 3IETB 5EZJA 2OZ4L 3K1DA 5JW4M 1J8HB 3ZTJH 3T4AA 1TFHA 4YBQC 5I1AB 3F6IA 3BWAA 3OJMB 5IP4A 4OZFG 3GSRB 2NY0C 5F1IA 4LKCB 3C8DA 4LFHG 4ZUSA 4TQEH 1E4KC 2AQ1A 3GM0A 1CWVA 4HKJA 1JMZA 2VLJB 5D72H 3CSBA 4RGOH 5CS7A 2UZYB 2BVUA 1AY1L 4RA3A 3WE6B 3OPZH 5GQBA 1NEZB 5I1JL 2VDLH 3ILQD 3LS5H 2B7DT 2VLJD 3ULUD 5D2LE 2ZUYA 5C92A 5TDNA 3PGCB 3HNSH 4GXUM 5EUOF 3QCTL 5L9DH 4CN4A 1E6OL 1TZIB 3QUML 3V5HA 1QLEL 3INUL 3DVIA 2D0HA 1YN7B 4PY8I 4QGYA 1INQB 5CKGA 5IW1B 2EYTB 2FIRT 3QDMA 3VXSA 3EDFA 4LCUB 4ONGH 4XBGA 2Q87A 3DXAE 4X6CA 3H42L 3P4MB 3WFBH 2RAMA 4JREC 3HI5L 5J56B 1XGPA 4NQCA 3AS2A 5GS0L 5GZNC 4OLUL 1U8JA 3KJ6L 3QI9D 3CXDH 1JF6A 4W6YB 1K4DB 4F3FA 5EPMB 5BCAA 1QLRB 4O58L 1P7QD 4ZUWA 1P4IL 1AFVH 2GCYA 2XKSA 1MCPH 4PRBB 2FH8A 3SKMA 5IHLB 5CWSB 4LSVH 4NBZB 1EJOH 3SE9H 1R3LA 4GAYB 4H20L 3RWIA 1BEYH 1QG3A 3FFCB 1RHHB 3I6KB 1X5GA 5LGHH 4F15C 5KSBF 1ZT7B 1DL7L 2XRAH 1U93A 3QPXL 1OTSC 1U91B 1MWAA 1EJ6A 1QSFD 4N0UB 2QHRH 1GZQB 2R0LL 2ADFH 4L1DA 4EI5C 1DBAH 4OLXH 1M71A 5FYJU 2VNCA 1BHGA 1HH6A 4ISVB 1FLRH 2HKFH 4EI5D 2A9NH 4B7LA 1CT8A 3EOYG 4WUUD 2GT9A 3RNQA 1ZT4B 4POZD 2AJUH 4FNLL 3G6DH 4P5TA 1Q9OB 4R0LC 1BZ9A 4PJ5E 4I3SH 1NAMB 3I6GB 4KI1A 4AM0A 1FO0B 2AEQH 1JYVA 5A16B 1GGBH 4P2CG 5AZ2H 4NQUA 3DMMD 3MRBA 2IFFH 4OLVL 3O2DH 3RIAK 2GW5A 5C0ND 3O2VL 4P2QA 1GL4B 3M8OH 1RZJH 3L7FA 5C07B 4Y1AA 3HB3D 3HRPA 4J3XA 5DJ8B 4IOFD 3KYNB 1ND0B 4LCYB 3OGCB 3P9WB 4UB0L 4L4TA 1NGYB 4JFXB 2FX9L 4Y1AD 2GTZA 2WUBH 4HKJB 4PTUA 2B2XH 3QFJA 2NX5D 2HFGL 3NFPB 5FB8A 1GZPA 4XB8A 4KPHH 1S7WA 2BSTA 1I1YA 4Y16A 5SWZE 3MBXL 3WNLA 1JPGA 2QSTA 2QADB 4NQDD 3NABH 3V0VB 5B8CC 2HJKA 3PP4L 1ZGLA 3CC5B 4L3EB 3DIFA 2MQCA 3WIFB 3X17A 4HAGA 1LO4L 4TPRL 3P73A 3WJLA 4NZUH 3L6FB 1AQDA 1W0YT 3IS1X 4KRMB 3KPQA 4UNUA 5HY9A 1QOKA 4L9LA 3V6FA 2GSIB 1ES0A 2VDOH 3S37X 4QCIA 3T0BA 1A47A 1CBVL 4FQQB 2A6DB 2MCG1 3QZWG 5DWUL 4CNIA 5JOFA 5GRJL 3UPCA 4ELMA 4I3GA 1M7DB 3NABL 1X3DA 2VLKD 4E0RA 4F7PA 4G7YL 2YK1H 2P8MA 1EGJL 5ENWA 3CFJA 1PEWA 1F11B 2BSRB 1E28B 3AM8A 1T04B 4E5XA 1T2XA 2AK1L 4WJ5B 4P23A 1S9VB 2BNQE 5FGSA 4YWGL 2YWZA 5DJXA 4JFZL 3AREB 3ZKND 1CFTA 2YR3A 3MCLL 5FKAA 3WIIL 2JJWA 3QI9A 2Y72A 5HHVH 2IPTH 5I0DA 3D3VE 3L3IB 3F7QA 1UG9A 5DD6B 2PYFB 3L1OH 4KDWA 3TO4B 2R69L 5FKPA 2EDWA 5JPNA 3MBEC 2A83B 5GGUA 4KKAC 1L6XA 3JBG7 1QNZH 3O45B 3HAEA 5A40E 3RL2A 5F3BA 1YEJH 4EXKA 3OSKA 1ED3A 3T2QA 4LLDA 3D0LB 3O6LH 5EN2B 4PS4L 5KVFL 5CHNA 4U3XA 2DIBA 1B4JL 1H3UA 2DQHL 2GIYA 1MAJA 1WTGT 5F3HB 4JKPH 4X9BA 3W0WB 1Z9MA 5CMAB 2YPLD 4LDOB 2FRGP 5D5MA 1HINH 1S7SA 3WFHB 3E2HB 3NIDF 1WWWX 2GK2A 5F7DA 2O61A 2G5RA 4XCFL 1JGVH 2DTSA 4PGCA 2DLEA 5ELIA 3T77A 3ARYA 4BA8A 1AXTL 3JV0A 1V3MA 4IHOA 4JFFE 3V6ZB 1EBAA 4Q9RL 2ARJA 1MFEH 5F70A 1OP9A 5L2JA 3HC4L 3KPSE 1FAIH 4F9LA 4KFZC 2XTJC 5GRUH 2XN9B 2VQUA 1BF8A 4X6EB 4V2BA 4XXCA 3DROA 1MY5A 2VAAA 4XVTH 5BS0E 3P40A 5DHYA 3VXNB 1EO5A 4KJQD 4YHZL 1EBPA 3ULVF 5CBEA 3UTSA 1E4XI 4P3WA 4M5YH 1R5VB 7CGTA 2IMMA 5HGAB 3M8OL 3M45A 4QRQB 4JZJB 4S2SB 4MDIA 3VG0H 4JN2A 5E6IC 1MJ7L 2P45B 1V8HA 3ARBD 3ULVE 1EA9C 1KGCE 3ZTNL 4OB5H 3VA6A 3VWKD 2RFXA 1RK0A 2HFFB 3OKDB 1F4XH 5EBWB 1KCLA 3HNSL 4BJLA 5CFHA 3ZYOA 5E8EA 3PQYE 2WP3O 1AQDB 1EEZB 1I8KB 4PRDA 2ZCHH 3VJ6A 4DGVH 1WGOA 2J5LB 4YHLL 1OAYH 1W8OA 4GG8B 4P3DA 4TSCH 1IC5L 3TYFA 4PRID 5BO1L 3L3OB 3FZUC 1MCFA 3QG7L 3NGBB 1DVFB 3UZVB 1OD9A 1EAPA 4L3ED 1DQJA 4UQ2B 3BQUA 3E1F1 4LF3A 2EDDA 3EYFA 5IVXE 3NFPA 3RUGB 2FWOB 5CJOH 5FFLA 4L8BA 1W0WB 1YMME 4TVPL 4XPGH 1HXMA 2E6QA 5GGSY 4F80A 5GRWA 1CLYH 3QXWA 4Z0BL 3B2VL 1FYTE 4TVSa 4KTEH 1U8IA 1KIRA 3A6OA 4P23D 4R7NA 1M05A 3JUYA 1FDLH 2WBWB 4K3GA 5FYJH 3KYAA 1BVZA 3AGVA 5FM5O 1U8OA 4P5KA 3BPOC 2AERT 1B0GB 1NFDF 5F72S 5D7SH 3BXNB 2H6PA 3IFPA 3TV3H 4U6VL 3VJ6B 1WUNT 5DQ9B 3FB5B 4LLWA 2HTKD 2GKIA 4BQ6A 1MH5A 1UWXK 3VXQB 4D9LL 4JHAH 2DYPD 1X5HA 1N0XL 1SBSL 1YDPA 5TJWK 3HNVL 4EN3C 3VFOA 1EAJA 4DGIH 3VGBA 3DHMA 1MVUA 1VESA 4GRLB 3GKWL 5D2NA 1E27B 2ZOKB 2WBJD 5BZWA 3MA7B 5C08A 5CEZD 2BOCB 3VG9B 1LK3L 5TE7L 2B39A 4PJEE 5IQ9B 1U8OB 2W92A 1A2YB 2R2CA 1ROWA 1AP2B 3B2UC 3IAGC 2WINB 4FQHB 4NN6C 4YX2L 4ODBD 2DI9A 4UDTB 4U1GC 5DHVA 3PQYD 3CFCL 1RPQA 2AGJL 1E4WL 4P4KD 3KGRA 2I24N 3C2AL 5IFHH 1XT5A 3EZJB 1TQBB 2ZSVA 3WKML 3BH8A 3REWA 5D93C 4EUPA 4R4ND 4CRPA 4S0SD 5DD3L 3ARTA 1F3DH 3QDGE 4MQSB 5GGQL 4L8BB 2G9HB 4UTBL 5FDWB 3HMXH 1N8ZA 5I74C 4E42B 4U05A 2XZZA 5HPMA 3VFGL 5HBBA 3JV4A 4RDQG 4NGHL 2B2XL 3W0WA 4TUKH 1DANU 2R1WB 4RFNB 4AL8H 3B8YA 2VIRA 5EOTA 2IPKA 4QHUA 3D0LA 4Y4HB 3L3OA 3RX7A 4X98B 2Q7YA 5JDSB 1LEIA 2EEDA 3HI1B 3HAEB 1OD7A 1N7MH 1I7TB 3GO1H 5FECB 4FXKA 3S3JA 4GRLD 3OJDA 3P9MB 2MSPA 4FXGA 2EXWD 2VDNL 3GI9L 3PWJA 4R2GD 3ULUH 3OJ2C 3MRNA 2VXVL 3D18A 4Y19B 2BVOA 3VI4F 1NBVH 2VB5A 4JN1H 1F8TL 4Z6AT 5CINH 4EN3B 5EU6B 2VABB 5IGXL 3MLPA 5B39B 1RQ5A 2AQ2A 2XA3A 3T0EC 1R5VA 1OGAD 4XAWH 5HYSA 3VGAC 4BH8B 5F9WC 1NKOA 3VXNA 1HILB 1EEYA 4J3WA 3LZFH 1JPTL 4BQ8A 3G5YA 5MEOB 4NM8H 4WWKC 2XZCL 1UA6H 3STLA 2AI0L 4M7LL 2PXYA 2KL6A 2QV2A 4ZAKC 1CICB 3CAFA 1HIML 5I8CA 2DQEL 1J7VR 3OR6A 4KKLC 5EU7E 5IB4B 2L7UA 4LGRB 3CZFA 4ZAKD 1MJ7H 4NCC2 4XCNB 3S96A 4RMWA 4DK6A 1OAUL 5DRZB 5JXED 2W0LA 5CBAB 5GISH 5JMRA 1GC1C 2Q86B 4YDJA 1TETL 3KPQB 1BVLB 4ODSH 5SV3A 3D87B 5D2LB 2NZIA 2NW3B 2Y25A 2ED9A 4K94H 1GGBL 3DI3B 2F8OA 2ZG2A 3MRQA 5CJQH 4M6ML 1HWGB 4LIQH 3CH1A 2IQAA 1QPXA 4RFNC 4GW4B 4MVBC 5J9PA 1YEKL 3DI2B 2GJJA 3DV4B 3RY6C 3QIWA 3RZCC 3DYMA 1DUYA 1PY9A 1NUFA 3PDGA 1SYSB 4LGPB 5K9QG 4YPGA 3RZCD 1QBML 5A2KH 1EXUA 3W39A 3QUXB 5D7JD 1C7SA 1D5BA 1XEDA 4QHNB 3IDJB 3QFDA 2PYFA 1S7XB 3TJEH 4JRXD 4FFYL 5TDOB 3D39D 2R1YB 4P2QB 3REVB 1KCSL 4JDVA 2ZUUA 4I9WD 4OAWA 2W9EL 5I2IA 1AP2A 4G9FB 4XH2B 3NIDE 4O9HH 3RL1B 4OD1L 3LV3A 1CZ8H 3VGHA 1U3YA 4ODTL 5I66A 3MNWB 4N9OB 4WJ5A 4XPBH 2G2RA 4WTWA 2CKBH 1YECL 2ZSWB 3GRWL 3E8UH 4O2EA 4KQ3H 3MV8B 5CLWA 2W59A 5IB4A 3QQ9C 1DQMH 3HC3H 2Y1VA 1FNAA 1TETH 1BBJA 3LS4H 1QUNA 4G6FD 4DVBA 2Q76B 4CVZB 1U58B 3ARGA 3MLYL 2EO9A 3GI8L 4ZOEA 2CDGA 4NRYA 4N90D 4R97B 1QA9A 4O9HL 3KPMB 3KVQA 1G7JA 3FFCA 1XGTB 5IOPA 4Y88A 1ZKAA 2VR9A 5I1IL 4AYFA 4TUKL 4G8GA 2J4WL 3SE8L 2APBA 5CWSA 1J0ZA 4XC1H 3EO9L 4DGVL 4GS7B 1QBLL 3CD4A 4G6JH 3TCLB 1JGLL 3FOLB 4HIIB 4KK5D 1E4XH 4PJEA 3V5DB 1ADQH 3QI9C 1INEL 2X42A 4U1LB 3EJZD 4H8WH 3QUZD 3P30H 3RPIB 2WLYA 1CQKA 5ICZA 2D4DA 5KW9L 4L3CA 1KCRL 4NQXB 3BKJL 3QXDA 1U6AH 4X6DB 1FL5A 3NH7L 4ODWA 1HXMB 2OZ4H 4LCUA 2ICWJ 4MQXC 5IKCA 4GBXC 3VXOB 4FQ2H 5IBLD 1CL7H 3VXME 1YPZA 1JE6A 1G9EA 1EPFA 1DR9A 5T3ZE 2PETA 4MNHA 4MZ2A 4G6AD 5IR1B 2ICEA 2XKUA 2ICEB 3KLSA 4JHBA 4F7MA 1GOGA 4XPBL 3SOBH 3S9DB 3WFBL 3ET9F 4DN3H 1SM3H 1KLFA 2WSKA 5SX5K 5M95B 4YLQT 1TJIL 3CFBB 3NPSB 5KZCB 3H7BB 4ZD3H 3KPLB 1Q9OA 1UXSB 1G1YA 2P43B 1UB6A 2YPVH 5ICZB 1CF8H 4PRDB 4BFIB 3ARBC 1RZFL 1HIMH 5I1EL 1FYTD 4LARL 3MLTB 4FQPA 4JCMA 2VKWA 1ZVYA 3I2CL 4FQHA 2VDRH 3V5DA 3CSYA 4HIIA 3FOLA 4U4BA 4XCYB 1IAMA 1BQHB 2CH8A 3CFDB 4GMTL 4YIQB 1YYLH 4Y1AE 5D70H 2D2OA 4YQXH 3RI5K 5DK3A 3QHFH 4JEGB 4OFVA 1AJ7L 4G8GB 5D7LD 3VDCA 4DK3A 2BSSA 1HEZB 1KJ2H 2CJUL 4IIQA 1QA9B 3F5WB 3V4PH 3HZMA 3LCYA 1KN4L 4RMTA 1Y6NR 1T1WB 4GMSH 4WGWB 3QRGH 1T2QH 5I1KH 1U8JB 2NW2B 3PGFL 1K4CA 2YSSB 3G04B 4Z7WB 1QFPA 5DQ9A 4PV9B 1T7ZA 4NFBA 1QFWM 4RWYH 2H9GB 1JYWA 3RWCA 5D1ZD 4QRPB 1QSEE 4Y8AA 8FABB 1TTUA 4NOBA 2WLZA 5K9KB 3LV3B 3DTXA 4NPYA 2BY3A 1N59B 2PW2A 1YN7A 1A64A 1T0MA 3C08L 1T80A 2BP3A 3LIZH 3IXTA 4M02A 1HYSD 4MJ2A 3KPOB 4PY8J 1Z0MA 2ILLA 1P1ZA 4RZCB 3PGCA 4RGMB 4NJ9L 4P5MB 1HHIA 1NFIB 4HCRA 4K8RD 3GBNH 4LSDA 1U3HD 2V2XA 3OKNA 1KENH 1FNFA 4H88L 1Q9WA 2Y9RT 3MO1B 3SO5A 4K8RC 3QA3A 3QNYA 2OQJB 3VFNA 3LS4L 4BKLB 5A43C 2RCSL 3EYFB 4OTXL 3IJHA 1WIOA 3O2VH 5CEZE 5FKPB 3N0PB 4YFLF 2HYMA 3NN8A 4NCDA 5DFTA 1RSFA 3Q5YA 3SDYL 3QCTH 2DQEH 5EZJB 4MSWB 3QFJE 5DJDA 3LN5B 3MRQB 3U0PB 3D3VB 5EU4A 1JZ3A 4ETQA 3BW9A 1LD9B 3VFWB 3WSQL 4W68A 2F15A 2V2WA 4LVEA 4WEBH 3ULUF 3WUZA 3G08B 3UP1A 5KS9B 2GTWB 4PGEB 3ALXA 1D6VH 1P5UA 1N0XH 2BSRA 2VDML 4U1JA 4XP4H 4AT6A 3OKLB 5E2WL 4D0BB 2GJ6B 1JVKA 1M7DA 3NZHL 5D7JB 4GQPH 3ES6B 4JZJA 1EO7A 1UA6L 4O58H 1CICA 4MMXC 3X13B 3V6FB 4LOUC 4AH2A 5LAXB 2DQIH 5HYJB 1CXEA 2Z31B 2ZUQB 2KZ1B 2Q6WB 3RVUD 1O7VA 3MUGA 4OIAA 3FCTA 3GSXA 4BH8A 5TPWL 1P2CB 1CGYA 4FTVD 1OT1A 2BFVL 3LHPH 3HAEH 3FFDA 3BD5A 3LSOA 5HGBB 5FO7A 1DLHA 2FO4B 2A6KA 1G1CA 2ENSA 5DURD 4X9FA 3CX2A 4HIJB 4IHOB 1A0QH 4PJIB 3QG6A 5IBUG 1Q1JL 4QF1B 2XQBH 2IMNA 3OQ3B 2XTJD 2OL3L 1Z9LA 4LQFL 1UADC 3MGAA 4ONHA 4C57C 5KW9H 3MOQA 3F58H 4HH9B 2GTZB 1BJ1J 1U8PB 3WFHA 4JO2L 1MCEA 2WMPA 4H1LB 2YA0A 1UB5A 5JDSA 1K5NA 2HT2D 1F4YL 4HMEA 3RKDD 1Q72H 2BOBA 4AIZA 4M61A 4KDTA 1TZHA 4XBEL 1F90L 4ELMF 2D7TL 3BDYH 4PIRF 1P1ZB 4WEBL 1PLGH 1RUKL 3RL2B 1VFAB 2Z4QA 4XNMA 1CQYA 1LNUA 3LQAL 1JYXA 2EIDA 4BZ2H 5GGUB 1PG7L 3IFOA 3KS0H 4PRIE 4OQTA 3PIQA 1DFBL 1KTDA 3MQIA 5BOPA 3G5VA 2CDEB 4YDVB 2DLTA 5I17B 4POUB 3PNWB 5EIVA 3TZVD 4U1GB 3H2WA 1BIIB 1AGBB 2HP4A 4NFCA 2VUOA 4ODVL 3MRDB 2APXA 4LSPL 4DQOL 4MNQB 4TUJA 5CCKH 1N5YH 3KLAA 1H5BC 1T04A 5C0CA 3JVGA 3WN5B 1QFHA 4GKZB 3MA7A 1KCVL 1MFBL 4LBEB 3TZVA 4MVBD 2B4CL 4YAQB 3W11D 5CZVL 3G04A 1J0IA 1DUZA 1S9YA 4JCLA 4PJ8C 4YGVB 1YNKL 2UY7A 1BREA 1XGRA 4YIQA 1QVOB 3CVIL 1V3JA 2P49B 2M2DA 4PJ8D 3L3DB 4BSVB 3WNKA 4LVNC 4QCIB 1VFBB 1MH5B 5KJRH 4P23C 2ADIB 4ODUB 1U8KA 3QXUA 3O8XC 2DQCL 1A6ZB 1QEWA 5DI8A 5F1SA 1MJJA 2LTQC 3VWJB 4NQCB 4QRUB 4LDEB 4TSAL 4UIKL 4B41A 3MRJB 4MJ4A 2NY5L 4MD5A 3WHXB 1ZGLB 2L7JA 1YQ2A 3NCYS 4E41B 1F00I 1YEKH 1FVEA 3FRUA 2EC9U 5J12C 1OP3H 1LO4H 1JWUB 1WISA 3VXRB 2CLRB 3B9VA 1YMMD 1NGWB 3G6DL 4I77H 2C1OB 2WBJB 4XC3H 1IRAY 4AY0A 4LLMA 3U2SA 3HUJB 3SJVA 4XVSH 5D1QD 4PJIF 4K3EH 4EN3D 1NEZA 4XP1L 3AXLB 1D6VL 4UV4L 3QJHA 4BM7A 4M1DL 4H0GA 1ODAA 4IDJL 1A1MB 3AAZB 3IU4H 3W9EA 4F57L 4FQCH 1KEGH 3MGTB 1NPUA 1MREL 2AJXL 4ZO9A 4OT1H 1KB5H 2C3XA 2D31B 3DRTB 1F4HA 5EG6C 2MOVA 3SBWC 3U82B 5CCKL 5LGKA 5T1LB 2O5ZL 3A67H 3S5LB 3SDCA 2AXGB 1NC2D 1JUFA 1GJIA 4LU5H 1LVEA 3ZKMD 2NY7L 2WAHA 1AGEB 2APTA 1FO0A 4CMHC 3PGFH 5KSAA 1JNLL 4OZFB 4N0CD 4NQDA 3UJTH 5ILTL 3JV5A 4JFDD 2NTFA 2R23B 3MRGA 5CSZB 4N0YH 4NRYB 2R56H 3MV7B 2WQ8A 4R4FL 4D9QD 1XZ0B 3EJZC 3TWCL 4G8EB 1S8DB 4AJ0A 1ZHLA 4LCIL 1GZQA 5IROA 2R8SL 1XGRB 3FQUA 5HVHC 5ALCH 5IROC 4QTHB 1RUMH 2NY7H 5DK0B 4O2CA 2X1WL 3MRHA 3VH8B 2IGFL 3HMWL 2XWTA 3D0VA 3VG9C 2C4FU 4YXLL 2C5DC 4L3AA 1ZSDB 3HC0B 2V6HA 2IBZY 3LQZB 3RL1A 4CVZA 5DF0A 4DVBB 1A14L 1T5WB 5HXMA 1W72B 5DD1H 1DJSA 5CIPH 2W91A 1SVCP 5DXWA 5JOPE 3GSNA 2OR7A 3D69A 3UTZA 2F74B 3EYUL 3HMXL 4XXDB 1L6ZA 1U3ZA 4E41E 5LBSL 5EWIH 5AWNH 2JIXB 4P3CL 3BP6A 1PKQB 1D9KC 3MXWL 5DJYB 3ZE0F 4YR6A 3S97C 4Z95L 1OSPH 4M62H 4JQIH 1CL7L 1YQVH 4PG2A 4LSRL 3ZE2F 4D94A 2DL2A 4K71B 3PDOA 4KH2A 2F54D 4LPWA 5FGBC 1QRKA 1FJ1B 4QHLB 5DQJB 4WWKD 2VLKE 4MCZB 2BCKB 2CXGA 2Z31D 4X7FC 1WJ3A 2BXYA 2D7TH 3BDYL 2ADJB 3ETBF 4JPWL 5C0NC 4LRNL 4OLZH 1WAAA 3SKOA 1ED3B 2HTLC 3BAEH 5ADPH 4Z7QF 1A22B 3EYUH 4XVUC 4Z18A 1NAKL 2BERA 4NZTL 1CVRA 2DQGH 3FQNB 3F8UB 4U1KB 2CK2A 5DJ2A 3RDTB 3BHBB 4IJ3B 4KXZH 3M07A 4XP9H 1RUQL 4X6FB 4GUPB 1SYVB 5ANME 3SGJA 2ENYA 3TNMA 2NXYD 4GXVL 4IS6A 2IANE 2F74A 2HN7B 2VZSA 5AUMB 1AIFB 5GRXG 4D2NA 1IGJB 1M7IA 2NR6C 3T4AB 4ENED 5C0EA 2NXYC 4Q0XH 2MJWA 4X5WA 4YXLH 5F8QC 1PZUB 3U4EA 1CDUA 2ZG3A 4O51B 4MHHI 3FCTB 4G7VL 5D96B 5IESL 3I6LD 4J4PC 15C8L 1MEXH 2YPLB 4CVUA 4MJIE 2C4FT 2XQBL 3ARGC 3BP5B 1GH7A 3EDKA 4D9RD 5D7SL 5DJ6A 2DI7A 5C71A 1MPAL 2DMKA 2VQ1A 3MRMA 5E4IA 4IRJB 4PRNA 4LCCA 5DEFB 5DD5H 1J05B 4S1DC 5DEFA 3TVMC 4EN3A 4ZFGL 4OFYD 4B50A 5D9SB 4XWGL 1IAIM 3OKLA 5KANI 1EUTA 3TVMD 5HGDB 1ACYL 1O5DT 2M1KA 4LPYA 4OZHA 1X4ZA 3ARBB 4ZFFB 5I15L 4JRWA 5DJ0B 4HULB 3HZYA 1R0AL 4PJBE 4PR5B 5TH2B 1YY9D 3PWVA 5FECA 1UM6H 3ORJA 3DIFB 2YXFA 5A2LH 2I60L 5H35A 1T89A 2YA2A 3U4EB 3K4AA 4NUGL 2A77L 1P7KA 3SGJC 1VKXA 4OLYH 4LLVB 1EUUA 4Y19A 4LLYA 4XP9L 5C0FA 5TF1H 4ZOBA 4P9MH 5DFVD 4B7IA 1D5IL 5HDOA 2XTLA 3PWLB 2LU4A 2G9HA 3JZ7A 1EGJH 3MRCB 4MJIA 2E7HA 4WCYH 1JTPA 5KS9F 5C09B 4U6HA 1YEEH 1FG9C 4LSUH 5TF0A 1CD1A 1NFIA 4HK0B 3KPRE 3UZEA 4LMQI 1NBQA 3NOIA 4P5MA 3FMGH 4LHUD 2VOTA 1MAMH 2A73B 4Z0XB 1J0JA 1A7PL 2VXUH 1RZ7H 3RQ3A 5F7UA 4UIMB 4ONFL 5HYQA 4KI5D 3LMJH 4KK5C 4DWHA 3FQXA 3TN0D 1CGUA 3QH3B 5ANMA 1S7VB 4P2OB 5FA4A 4UZGA 4IDLA 2ERJC 3QCUL 1A4KB 1DBKH 4JFOB 4JFQB 3HFML 3E0GA 2VDMH 5D71H 4FZEL 4ZS7H 2W07A 3TO4C 1JGUH 4NP4H 4FFYH 2J8UB 2UWEE 5HDBE 2Y06L 4UDTA 2Z0BA 4Z7WE 1HCVA 4ZFOL 3IKCA 4AENB 1VACA 3BI9X 2OXGA 5AD0B 3EHBC 3KLHD 4NQEE 1BPVA 4G9FE 5KVFH 5J1TC 2HT2C 5F89B 3WBDA 2IGFH 3DUSA 5IGXH 4YJZL 1IKFH 3ARSA 3FO1B 3RKDC 3I02B 4FXLA 4FFWD 5TPWH 1G9MC 2ESVA 1HINL 5AZEH 4BZ1L 3WFDL 4Z7VF 3HHRB 1BQHA 1QLFB 3TVMB 3O3DA 4HXBL 4X0KA 2J6EA 3QUXD 2DTML 3MREB 5IB5B 4RDQF 3MLZL 3V4PL 5I17A 4IBLT 3VXTA 3MRGB 5BVPL 2EYSA 1Y6MR 1XIWD 4ZXBB 5LCVH 2EZ0D 5DMJB 5GS0D 3M17A 3KYOB 5GISL 4IMLA 1URLA 5D96C 1D5XA 3X14A 1A4KA 2PYEE 1IBGH 4X6CF 1FFNA 1QFUL 2DQTL 2LVEA 5GS0C 1B0GA 4P5KB 1Q72L 4GKSB 4O02L 3QAZB 4U1SA 4KUCD 2H32B 4R3SB 1KLUB 1PDKA 2ZUXA 4OT1L 3V0AC 3DECA 1RZGB 4KV5E 3V4UH 5JPMB 4MA8L 3BEWB 4GBXB 2XTJE 5IW6B 2EIZA 2PUQT 3HCVB 3RDTC 3GZKA 3HNTH 2FZ3B 2DDQH 1RUML 5JQ6L 1UH2A 4NQXA 1PD6A 1UKQA 43CAB 4FFZL 3FB6A 5FYJD 4ZXBA 2ZJSH 4HS8L 1A6PA 1QQDB 1Q9LB 4AQOA 4MD0B 4KK9D 1KN2L 4U0RB 3VXTB 2X70B 3B6SB 1G7LB 4K23H 1WSST 2HFFA 1RK0B 4GT7A 5EBWA 1T1ZB 5FDYA 4JAMA 4KK9C 1Q38A 3QHFL 3CXHK 3FRUB 3TCLA 3I50L 1ERNA 4HWUA 2F54B 3VFUB 1FE8L 3ME0A 1VHPA 4PJCA 4K8RH 2BDNH 4YBLB 3U9UB 4P2QD 3WEXB 3QXVA 3GNMH 5C0RH 1ITCA 1I8KA 5LBSH 4HD9A 2YUWA 5H94A 1K8DA 4XTRD 3QDGA 2IPUK 3O4LA 4P5TC 2HWZL 1NFDA 3BGAA 3HS0A 3UTQA 2OTPA 3MJ8B 1GVIA 2G75A 4WU7A 2Y5TA 2XN9A 5FM8A 5KVDH 4P5TD 1CDIA 2VLME 2B20A 3T8XB 4JLRB 5JXAH 2VE6A 3PP3K 1JHKL 3ULUE 1T1YA 4X8JB 5HGAA 4PRNB 5FYKU 1T2JA 3BUYB 5DEZA 12E8L 4LBEA 4L8DB 1NH6A 3V6ZA 4L9LC 3D85A 3H3BC 1S5HA 4EEEA 1ORSB 3FB7A 4OJFH 1J1OH 2HVJA 5E8OB 1HSAA 1FC1A 1S7VA 4OF5A 2FR4B 1Q0XL 4XH2A 3MMEA 4GLRI 4P46A 2QSQA 2P47B 2GITB 2ZOLA 2D3VA 4QOKE 5L2JB 4APQA 4L4VB 2H3NB 5JQ6H 4LCWA 4JFYB 4NRZA 2CDEA 1S7XA 3TA3C 1U2HA 1L7IH 4XVTL 3BPNB 3IDMA 4FZ8L 5DVKA 4MNGE 1T7WA 1BFTA 1UZ6F 1ADQL 3NCJH 5IF0A 3D2UA 1GIGL 3Q3GA 5I8KH 1KB5L 3MRCA 3RVTD 4Z7UE 4YPGB 4H1LH 1NC4A 2C7UA 4B53A 5HHOE 2EDBA 2DQDL 3BKYH 2FL5B 1MFNA 4ALAL 1DUYB 4OCYL 3QIWB 4I13B 4XMPL 3RVUC 4PLKC 3V0WL 3P4NB 2F5AH 3RA7H 2VLRB 3PV6B 4LSQL 3GMLA 4OGZA 1KCUL 1WEJH 4OCRL 1F2XK 5H35B 1X44A 3TV3L 2V5TA 5E2TL 2ZCKL 3QNZA 4NC2B 2R0WL 4HUMB 1CBVH 3HZYB 2VITB 4NO2B 4NBXB 5ILTH 1RZKH 4NBYB 2AGJH 2E9WA 4YHIB 5FYKL 2ATKB 3IDIB 3R0MA 3BO8B 4GRWH 1AI1H 2DLIA 1CGTA 1AKJA 4KRPC 4LHQB 1KNOB 4WI2A 5BV7C 1LO5A 1NMAH 3A6CL 1KELL 1MIEL 4GG6E 2BK8A 3G5YB 3O4LB 4NYLB 1IZJA 2CKBA 5CZKA 3TBWB 3GHEH 5EU3A 3SDDD 4BQ9A 4YHLH 1JHLL 2X44D 3CFJB 5CGMA 3V4UL 5BXFA 2YOCA 4WFEE 1FN4B 2UVEA 4GAJH 1UENA 3CC5A 3EYOA 4LNRA 3CCHA 3O4OC 2B0SH 3H9SA 5IFHL 3O2WL 5JUEH 4M8QA 1MLCB 4JR9H 1A1OB 2OI9B 1UYWL 3MROA 3V2AR 1B0RB 4XGZA 2KBGA 4QXTB 3QBTB 2AAVA 1I7UA 1PG7W 4ZPVB 3QRGL 1TXKA 2EICA 1RVFL 3WUWG 4QXGH 5CEYB 4GBXD 4M62L 4NQVA 4X7TA 1NGYA 4L3EA 3WXVH 1WT5A 5DJDB 2ITCA 4Y2DD 1AGEA 5I18H 2BY0A 3LQAH 3O6FD 4A2MA 3X3GH 4OZGE 4EXPX 1RZGA 1X5IA 4DGIL 3SDCB 1MIML 4NZUL 3MJ6A 3ARGD 3GMMA 4G9DA 4KMTH 2H32A 1VSCA 3TYGH 4YK4C 4JY6A 1YN6A 1WT5C 3BVNA 1QRNA 1FL5B 4ODWB 1PKQA 4X4ZA 2IADB 3KXFE 1FGNL 1MELA 4IMLB 4CJ1A 5GJSL 5LGHL 1CS6A 5J11B 2NY4C 5JIPA 4HGWB 2CKNA 4ISVA 4XBEH 4FZEH 4ZS7L 3IU3A 1DBBH 2YMXH 4MWFB 5FO9B 4JZJC 1MIMH 3MCKA 1N59A 2DBLL 2FBJL 5J4MA 2KQNA 4WI4A 3K2UL 1U93B 5ID0B 4D0CB 3G5XA 1F4XL 3KJ6H 5HI5D 5DJCA 3HZVA 5FYLE 1A3QA 4GAYA 3FO1A 1CE6A 3VXMD 2WW8A 1CLYL 2NXZB 1ZT1A 4M48H 1JF5A 3ESVF 1Z6JT 4YGAB 1NCCL 1K3ZA 1JGEA 1S7QA 3NFNA 3IGAA 3SDDA 1ZHBA 3S98A 1KEML 5DFVC 3F6LA 1LO3L 3HZMB 2QQLL 4TRPH 2DQFA 2R0ZL 3QEUB 3ZKMC 1P84K 2F8XC 3L3JB 4IM8A 1HHGA 4FFVC 5IB2B 1KXTB 4FP8H 2HFTA 4JRXE 4RCAA 5EA0L 4FQJH 3SDXB 1DLFL 4XCYA 2W9DL 2A77H 2EDYA 2FJHB 1I3UA 3NACL 4Y5VA 4ZOAA 3O0RH 3SO3B 3IU3B 1NBZB 4OGYL 2HLFD 2H2PC 1WBYA 2EYRA 2QQLH 5E08L 1R6VA 1I9IH 1A6TA 1S5IL 1U0QA 3ZDXF 4O5LL 2E7LC 3U46A 3JV6B 2F58H 3SE4C 4U6YA 3TPKA 4X6CB 3UTSE 4PGBA 2IEPA 1U36A 1MAML 2FWOA 4KKNA 4M1GH 4F37K 1XF2B 3EHBD 3KLHC 4AQ1B 2VC2H 3MXWH 3GBNL 1JWUA 5IW3A 3OKYA 2A74B 4M43H 1EAPB 3LD8C 1WCBB 3QQNA 4MNHB 3K8LA 4HWZA 4ODTH 4EOWH 5IVOA 4KK8D 5ACMA 3WJJA 1X5LA 2BNQA 4UV7H 3RIFF 3VGDA 2IG2L 2XA8L 3WS3A 4H8WL 4Q9QL 5A2JH 3NZ8A 1ZLWK 2BHZA 1JGDB 1INEH 4M4PA 1OY3B 4PP2A 5FM5M 2DM2A 3FO9A 2ARWA 5GGQH 4ODUA 2RFXB 3OKDA 5HGDA 3UBXI 4HWNA 1Z5LB 2FIKA 3L3DA 4BSVA 5E1HB 3F12B 5DC4B 3FTGA 3S4SA 3V4VL 5I9QC 4UINH 5HHNA 1WQVT 2G5BA 1Z0NA 5I1IH 5FHBH 3MV9D 4M93C 1U8HA 1KSRA 5ICYA 2DLFH 3FQRB 1AHWA 1M6OB 1UQSA 1ACZA 4IOIA 4IOIB 2DRUA 2F9BT 3D48R 2EH8H 5CJQL 4QWWC 4B0MM 2FJFA 4YHOH 5EUOE 4HKZB 4QKXB 1MY7A 5IVXB 1T3FA 2VXQL 1G7PA 4QWWD 2NX5A 2NXZD 1RUPH 3IDYB 5IG7B 3BUTA 5I0ZA 2BVEA 4JO1H 2H8PB 2X4UA 1Z5LA 2FIKB 2BVOB 2VDRL 5DO2D 2FECI 2IBZX 2NXZC 1UC6A 2DQCH 4FXGB 1OAKL 3ZO0A 4UU9B 5EFIA 3QQ3A 5C07D 3RGVA 5JMOC 2B1HL 5D70L 5T1MB 1DBBL 2V5MA 2DQUL 4J4PD 9CGTA 4PY7A 5EU4B 4P2QE 4X4MA 2AV7B 2YC1B 3BEVA 1JK8B 1NSNL 5DD1L 3LN5A 2XZCH 3RJQB 1LEIB 1FZOB 3ARED 4NQTA 1B6DA 2V9RA 4LVOC 3E6FA 4MX7B 1F3RB 4PRHE 4F9PA 1HYSC 2K9UA 4YHML 4KKBC 2HWZH 1JZ6A 1IM3B 1ZLVK 6CGTA 1FZOA 3TBTA 4PRAA 4XC3L 3V6BR 5IMMB 4KVNL 2BNUB 1N6VA 4JG0L 1VENA 1U3HC 1LEGB 3MBEB 1JWSB 1NMBL 4AK1A 3QA3B 4DEPB 4Q97A 2JK5A 1ZS8A 5FEBA 3BH9B 3SDCD 3TBTB 3BRFA 3C8HA 4ONGL 4LAQL 3IB4A 5GHWH 3DXAA 4X6CE 1FQ9C 1NEUA 1L9MA 3SGEH 3SDCC 3MRFA 4JRYE 1ONQA 3F7RA 5JR1H 5EULV 1Q94B 1NBZA 4TULL 2GITA 2ZOLB 3FQTA 2H26A 5IUSA 1HYRC 3BKML 3V52H 1KJ2L 1T7YA 1N6QL 2FBJH 2JLLA 4UQ3A 3UBXB 5FYLH 3LQZA 3DX8A 4NQDE 2FYYB 3QQ3B 1HDMA 4J12A 4KGLA 1LQSR 3FB7B 4U31A 5B22A 5C0GB 1P7QA 3QUMH 5C08B 1WZMA 3EFDH 5HHXH 5DRZA 3EBAA 2FX8H 5JZ7D 3DGGB 4HS3A 1Z9OA 3PWPE 5IG7A 3OXRB 2VLKB 1GAFH 1WAAE 3P9LB 1E4XL 3N85H 3FQUB 5JZ7C 5JA8B 3IDUA 5DT1H 3H6JA 1UWGH 4J6RH 1N5YL 4WNQB 3STLB 4TULH 5CUSL 5DLMH 5JO5A 3SDDB 3UMTA 1MHCA 3QDGB 1J5OL 1JZ7A 5DEGA 5H94B 4KMTL 4MD4B 1C7TA 3N1MC 1SEBA 1C1EL 1FVDB 3B9DA 4OZHF 1Q0XH 1C5BH 3D3VA 1VGKA 1SY6L 5B8CB 4OV5A 4AEFA 5L6YH 1AXSA 1WZ1L 1JUFB 5BV7B 4I0PB 3OGOE 1DQML 1TCRB 2VDOL 5HDQH 3MRPB 2Z35B 4R7DB 3X11A 2GAZA 2OLDA 4KWUA 4HIEB 4BK5A 1NMCC 4OZIF 3VWKA 3OJDB 3W5MA 4P2RA 1J12A 2DWDA 5FIEA 4PTTA 5AWNL 1BVKB 3OKNB 3ULUC 1QRNB 3VXRD 2I5YL 2DD8H 1ND0A 1QSZA 1WCQA 3W0WE 2WBJC 1P9MC 2ORBL 5GGRY 3MNZA 4ORGA 5IK3B 1KPUA 1BOGA 2Y07H 4JO3H 5KAQG 3T3ME 3ULVH 4UV4H 1L7TL 3H9SE 4PJGB 5GRZA 5I1LB 1NJ9B 5I30H 3DTXB 2IFFL 3NCYP 5L8JB 1BQUA 5ID1B 3QJFB 1AC0A 2X09A 4P4KC 3KYOA 4WW1A 4XP6L 4CMMB 3RPIA 1SJXA 3EDEA 3EOBA 5TDPB 3T1FA 2EYSB 1ZT4A 3WHE1 4JKMA 3UJJL 4HLZG 4NO0D 2ED8A 3MREA 3T4YB 2VZUA 3INUH 2B1AL 4P2RD 2E8YA 4JN2B 3SEPA 5F1NA 3CSPA 3WIHA 4HT1H 5IQ9A 3TVMA 3MR9A 3CCHB 1KJMA 4O2FA 3BT2H 3MRRB 3UJTL 1JGEB 2Y4SA 4Q0XL 5I30L 3U6RB 4HS6B 2QHRL 5JQHC 1QD0A 2PCPA 1VFOA 3PL6C 3Q1SL 1JNHA 1RUKH 2AJZA 3LKSA 1KIPB 3MRRA 3CLEL 3BKCH 2A9NL 1BWMA 4KAQH 1WK0A 1DBML 3HG1B 4YWGH 4RISH 5AEAA 3O4OB 1D5ZA 4Y5YB 3ZDZF 1QLRA 2XZQL 4NHCL 4WI3A 1S7QB 3L5JA 3P4OB 4M43L 4Y5XB 5FAAA 3HG1D 4YDVA 3PHQB 3MV8A 3T1FB 5F6HI 1GGTA 1EHXA 3JXAA 3EOAB 1N5AB 3GSUB 3RU8H 1PX4A 4WIQA 4MA1C 4OTXH 4BZ1H 5C6WH 1G0XA 1EEUA 1CD0A 4ZG1A 5JW5A 4AEEA 3VFRB 2VYRE 2OS7A 5SWSB 3KJ4C 1U8IB 3JWDC 4XVUD 1FZJA 2BOBB 1DEEA 3QEQA 1WZLA 3WLWC 4HEPG 4UINL 3GGWA 2KQMA 3OR7A 2GK0B 3WLWD 3HPJA 4OD3L 2IWGA 2YZ8A 3B3IA 4HFWA 4Q7DA 2FEDD 4ZPVA 3GMMB 4G9DB 5K59E 5FUCC 5ICXB 5IV2B 3KPNA 3NCCB 3T2NL 2HT4C 3CVHL 4NKQB 1NDGA 4Y4HD 5J6GB 2J8UE 3LRHA 5ADPL 1A6VL 2AP2A 2DKUA 1MAKA 5J6HA 1FZMB 3O9WC 1RIHH 4OCYH 1F58L 3NGBC 5EA0H 5L8KB 3DX7A 3IETA 4DKDC 1H8OA 3GIVA 4ONFH 4QOKB 1RUQH 2DIJA 5BMFH 3KXFD 1A7PH 1OM3H 3JTSB 3N9GH 3TA3D 5D93B 4X4XA 2NW3A 3BPNC 3V7AG 5EIIA 5FUOH 5H37G 3H8NA 3AREA 3KPMA 5T1DH 3S36H 1RMFH 4GQ9L 1GOFA 1YECH 2BNRE 1F11A 2N7AA 1NAMH 4LVNB 3MROB 5MEQB 4P59L 2P24B 2Y5EA 5ALBH 5EOCH 1V3KA 4XZUA 4JM4L 4RWHA 2E6JA 4IRJA 4GKNB 4L8CB 1N64H 2VQ1B 3MJ8A 4LEXL 2XWBA 3AMKA 2ATKA 3IDIA 3A67L 2GY5A 3C09B 5IWLC 2YD3A 2FO1A 2BMKA 2Y7QA 3PGDB 2UWEF 4JDZB 3H7LA 5GGSA 1LD9A 2HJLA 4PG9A 5HI4C 3VE0A 4PBXA 5GRVL 2P8LB 1IGTB 2JCCA 3PWNA 3MOAL 5TGBA 3AY4A 5CZXD 2HJKB 4TSCL 5HHPA 4N90E 3ZSSA 1WC7B 1A5FL 1DE4A 4N0UE 2EDFA 4P48A 1OGTA 5C6PB 4KJYA 3U36A 4KKAD 3PUCA 4MD0A 1OSZB 4NO2A 3B3IB 4JFDE 2O61B 1ZEAH 4FXKB 3BGFB 1F97A 3FB6B 3HMWH 1I9JH 1SYSA 3QDJA 1QSFA 3MO1A 2XXMB 4JKPL 5E94A 2NCMA 4TVPH 1CFSB 4XPGL 5HYIA 4QEGA 2Z9TA 3QDGD 3OAUH 4G5ZH 4JKKA 5JDJA 4ZO8A 5EUOA 4PJHF 3FT4B 3QIBB 3IAPA 5L0QB 4QRPD 4HUXB 3CUPA 3HE6A 4E42A 4GKSA 1KJ2A 5T1MA 5ESAA 5DJYA 3KWWA 4OZ4B 1IAKB 3CLEH 3LS5L 3N1QC 1I75A 1NEZG 5CZVH 4WW2C 3QHTC 1BD2E 4KMLB 3GBLA 5C3LD 2D9QB 2X1PA 2QR0B 5B4MD 1FH5H 2M8XA 4ENEC 3QDMD 3H9ZA 3PJSA 3SCMB 5J89A 4XMKH 4DUXA 1BAFH 1YC7A 4MDJA 4G6AC 3SQOL 5EC1A 3ARWA 1VA9A 1KIPA 2EIBA 4MA7H 2QQKL 1A0QL 1WIPA 3QDHA 3DX9A 4FRWA 3P77A 35C8H 1I3RA 1S9XB 4K3HA 3MRHB 1U8QB 5F89A 1X5ZA 4R8WH 3T1WA 1VEOA 3SDAC 4FA8A 1DP0A 1HH9B 3GBML 1R24B 4KKCC 1IJ9A 1AD0B 4N5UA 2HA1A 1BZQK 4LKXB 4BSWB 5EU7C 1KG0B 4BK4A 1K8DB 2BVQA 5CSZA 2OSLA 3GIZH 4OUOA 4OIIH 3RY4A 5BO1H 4YHZH 1QLEH 1UXWB 4AG4H 4TSBH 1YY9C 3GMPB 3P2TA 2FD6H 4P2OA 3DBXA 3VXMA 1BECA 3PXJA 3ARXA 2BDNL 3BPCA 4R90H 1UH4A 2IAMB 4OB5L 2C3HA 2GQHA 4RFOH 3BWUC 5F9JA 1M1SA 5HVGB 1N2RB 4MXQD 5DZNA 5HHMD 3RDTD 3G6AB 1C16A 4RFEA 4EIGB 5T3XL 1JV5A 25C8L 2QTEA 4KVCL 4XNYH 2VERN 4XWGH 1WBXB 2MHAA 1I8IB 4U6HB 3NCMA 4ZFGH 1TZGL 2Q8AL 2RR3A 4LSPH 1OP3K 1XF4A 4DQOH 4N0YL 1FCGA 4DCQA 3TIDA 4PRHD 5DA0B 4ZUSB 4P2OD 1LDPH 2NQCA 1NGWA 2GAZB 3LEYL 2DQIL 2X4TB 2XQYK 4RMSA 3SBWA 3GK8L 3WLBA 1MEXL 3RZCA 3P11L 2AKRB 3N1PC 4PJHB 5JW3L 3OZ9L 1KCUH 4RRPG 4Y19E 3GMPA 1NKRA 4QRRD 4FNLH 4P99A 1K2DB 2BOCA 5ITFB 1BD2D 3M17B 4H1LG 3O41B 4XTRC 3IDYC 4DAGL 5E1AA 4HJGA 3DUSB 2QJDA 1G7MB 3QO0B 3DRQA 1NBYA 4D8PB 4JRYB 1TJGL 4OGAD 4CU8A 3H9YA 3W5NA 4R96B 3L3HB 3GJFB 5MENA 3FONB 2EDRA 1HH9A 4MJID 1NMAL 3A6CH 1YYMH 1YZZA 1FSKB 3T08A 1I3RB 4NSKA 4O2EB 3MC0A 1RD6A 4P9HC 1NDMA 1NLDH 1MCSA 5IJKA 2R2HB 4EUPH 1I85C 4LSRH 1TENA 4UQ3B 4U6XA 3UBXA 5H2BB 2AKRA 5AD0A 3EO1A 1PAMA 2O5YL 4O51A 1CG9B 4PGZA 5ISZD 3NA9H 5DR5L 2PTVA 4G8IA 1DQQA 2GJZA 2ICWI 1PG7H 3UPAA 4R7NB 4M1CC 1SJEA 4UOJA 5AUMA 1BX2B 2VLLA 4NZDA 4LEOB 1GPOH 3VFPB 3CX5K 1I1CA 2XIDA 5ABDE 3BX7C 1OGAA 1KCRH 1AE6L 3HMXA 1UYWH 2YRLA 5CJ5A 5DMKA 1ZLSH 3ELAT 2WANA 1PQZB 4L29B 1MHEA 5FO8B 5I73B 2A6IB 1EMTL 4YZFE 3U0TA 2APFA 5TDNB 5IVXF 1AO7D 3IDGB 5F9AC 3RTQC 3BE1L 1VGEL 4JFPA 4ZQKB 4NQSB 3MYZA 1D3CA 3MJ9A 2G60L 5SWZD 2IQAB 4XPTH 4V1DB 4H1LA 4GW5B 1U95A 4EIZC 1JFQH 4R2GC 4XCEB 3LB6D 3DVNA 2CRIA 4MA3B 4QOKD 4N5ED 1FBIL 4PJIA 1IKNA 3MFFA 4KRPD 5ERWA 5T1DL 4ZFZB 2NY0B 5IHZA 5FCSH 5AG9A 3SGKA 4FQ2L 2AK4B 1CICC 4QXGL 6FABL 2EC8A 3H9SB 4PJGE 3MA9H 1UEYA 3FQWB 1U8QA 3WIHL 5DUBB 4GAGL 1FZKA 3KHOA 5DHYB 1TQCC 4RX4A 4NC1C 3G6JE 2Z31A 3GFUA 4WO4A 4X6EA 3O3BA 4JM2A 4LCCC 2ID5A 1INDH 4RFOL 1R3JA 2W65B 3SE3C 4DZ8B 1IEAB 5GS1A 1HQ4B 5DGQA 2BNRD 4RBPK 3IYLW 3QUKA 3FTGB 4H26A 2X4PA 3L5WA 3S4SB 1R5IB 3VI3F 5I1KL 5HJ3A 1MLBB 3DO7A 2VWEE 3QZWB 4JFEA 4NKDA 3JTTA 4XRCB 3W2DH 3BP5A 4M6MH 5IEHB 5GZOC 5IIEB 3KWWB 3L6FA 1OW0A 1A7RH 4OZ4A 4GAGH 5CD5C 3S35L 4M7JH 4Y2DC 5GZOD 1KIQB 4MZ3A 1XMWA 2P5EA 3O4LD 2ZUTA 1QR4A 2COQA 4BQBA 4LCWE 2VXTL 5ACLA 4KZDH 2QSCH 4WFHD 2AJVL 1MCRA 5D8JL 4NM4H 4G42B 5L2KA 3W11C 4LLDB 2CR6A 3U0TB 3WO4C 3HE6C 4YXHL 4BH7A 4CDGC 1G7QA 1QFOA 5GRVK 1Q9KB 1U2CA 2JTDA 3OX8A 2F58L 4KI5E 4RMRA 4F7EA 4ZFOB 4XAKD 2DQUH 3MYJB 1C12A 4ZD3L 5F88B 1DE4B 1RJLB 3GSWA 2EYRB 1WC7A 2JE8A 4QHLA 5DQJA 2V9TA 2HLAB 4MNQD 4Q6IC 3QUZA 5TGBB 5GJTH 4Y4FC 5I1EH 2NLJB 4OI7A 2VC2L 3NA4A 3WS6A 5A16A 3ZTNH 3RAJH 4HCRL 3HC0A 4J23A 3QO1A 4PD4J 1YY8B 1AHWC 4PJXB 3QQ9D 3VFSB 3MODH 1CFQA 1BJ1H 2R4RH 5D1QC 1SVZA 4IRSA 1KV3A 4YFLI 5DK0A 2LVCA 1S5IH 1QNZL 4NWUL 4CUCA 3CSGA 1PZ5A 3T8XA 3FONA 4LDLB 4PJ9B 1YDPB 4HAFA 3HS0B 2DDQL 5C0AD 3QDME 3NFNB 3I9GL 2VN7A 1ADQA 5D1QA 4ZUTB 3AFLA 3EO9H 5EU6E 5EBLB 3UDWA 1JNHB 2AJZB 1CR9L 2BSSB 1FRGL 1C08B 1YMMA 1JHTA 1A6AB 1NCWL 3EUUA 4C4KT 4PJXE 4DZBB 1G9ML 4TUJB 5BVJB 5C0JB 4MCYB 5FF6B 5DVLA 4TRPL 2IBBA 1JGVL 3SKNA 1NANH 5LGJA 3LEXA 2VDLL 3CDCA 3BD3A 2OL3H 5C0DA 3B5TA 5IHUL 5JHDB 3TBVB 3BP4B 3G5VB 5I8EB 3KYKL 5JTWA 4UAOB 4L4TB 3BOVA 1A7NH 3L5IA 1INQA 3MACH 4OLWH 4UDUB 4HUUA 1CGVA 1JV5B 1A6UL 1HSBA 1T5XA 3H42H 1HWHB 4Z78A 3QIWC 5FYJE 2DJ4A 4TNWF 5FYKE 3VXRA 4PRPE 4GG6F 4PJDB 2D0GA 5JW5B 1MCIA 3QIWD 3LDBB 4MAUL 3O8XB 3PABB 4UDUA 1OAZL 3W81A 2VDPH 1UM5H 1EHLH 1UT9A 3MSPA 2JJVA 3BN3B 4NDMA 4X7TB 3GKWH 2CIIA 4JZOB 1BGXH 4HMCA 5I8EA 4TVPD 4X8XA 4LLMB 3RPKA 1EEZA 3PHQA 5INDA 2R4SH 4CDHA 3VD4A 3FT2B 3K4ZA 3EYVA 5BRZB 2CLRA 1BBDL 4GAFB 2ORBH 4XMLL 4Z7QE 1B0RA 4XGZB 3MOBL 3RJDA 4UV7L 5J13C 1OAYL 1FL3B 4M8QB 1J8HA 3ZE1E 4EDXB 3BKMH 5I18L 5HGGS 1EGJA 5BOZG 3OG4B 4JGJA 1JHTB 1NUDA 2VDPL 3HB3C 1AQKH 5E6YA 4WW2A 5KSBE 4NM4L 5ESVB 4FQIL 3ZE0E 1A6ZA 2QSCL 2CKBB 5DI8B 1IFHH 2DI8A 4NO5B 3TBYA 2P48B 1ULVA 3TH4T 2P46B 4YHNA 4KTEL 2VLJE 2XACC 3EAKA 5CJXC 5KVEH 5D1ZC 1FFQA 5E2WH 5CGYD 1T22B 3RY6A 4NWTH 1FNEB 2O26U 2AEIT 4XPAL 4HXAL 1J5OH 2K7QA 3P0YH 4XPTL 2AABH 1MJUL 5CGYC 3SPVB 4PGCB 1U8LA 2CIKA 3OPZL 1OL0A 3WHE0 5ESAB 3QH3A 5HYFA 4J1UB 5I1LA 1G7HB 1X6LA 4PJGA 1GGIH 3SKJL 4NCC1 3DXAD 2XZQH 4NHCH 3REVA 3NPZB 4UMGA 1KELH 1VCAA 3DJ9A 3RWDA 3X3FH 3IFNH 1AGDA 2OTWA 3KAAA 1WITA 2C26A 4M9OA 3ZMRA 4Z7VA 5ESQA 1U42A 1NL0L 2CLZB 5JOEA 1DQLL 5C0BD 5DTFA 1KEMH 4RGNB 4XPHH 4F7EB 3AB0C 2UWEA 4NIKB 4G43B 4P4RB 3Q6FB 1JIBA 3CFEA 3QNYB 3FOMB 2F5BH 5IMMA 5C0IB 2I9LB 3A6BH 3TN0B 4PRAB 5FYKD 4LSUL 2GUOB 2Z35A 3GSRA 4ODXA 1OGTB 5HI4D 2JB6A 5JW4Q 1OM3L 4NJ9H 3QFJD 2Q3ZA 4OCXH 1P7KB 2NY2C 5GGTL 4APQB 4OV5B 1KFAL 2X6MA 3M1BA 4P4KA 2VN4A 4NN7B 2JCCB 4ONOA 2FR4A 4RGNC 3P0VH 3W2DL 2AEPL 1U8LB 4WFFD 3RGVB 1GGCL 5KOVC 1UACL 2W0FA 4MD4A 3SPVA 12E8H 2H9GA 4L4JA 3AS0A 5E6IB 3ROOB 2CLVB 1I1RA 4L8DA 2OJEA 2Z93B 4FQCL 4JFEB 4NKDB 3K74B 5FHAL 2FO4A 1MLBA 3DO7B 5C08D 4PLOB 5BW7A 1HQ4A 3GMOB 3AC0A 3PL6A 5D6CA 7FABL 2LU3A 2DLHA 2Z93A 4FABL 1YEDB 4KTDL 4QRSB 4F7CB 5C0GA 1MFAL 1ZHKA 2BVPB 1YMHA 2ICCA 2V2WB 5HYJA 2J8OA 4KI5C 4R97C 4Z7NE 3NA9L 5DR5H 3TN0C 3V6OC 5C9JA 1QYGL 5DDHB 4UT9L 4WGVB 5CP3A 4YDKH 5D7KE 3FQTB 3TT3L 4OLVH 3LPWA 1R3KA 4N8PA 2V2TB 4LSTL 4JM4H 2FHBA 1KN4H 1UKSA 3Q0HA 2NX5E 1ZWIA 1BD2B 1I85A 5TQ2L 5ITBH 3UYPA 3LB6C 4M6AA 3K2UH 2BJMH 3EJYC 3MLTA 4H25A 3TNMB 2LABA 4WFGD 1F4YH 2PW1B 4LVOB 5K9JL 3CFEB 3MPCA 1CGSL 2RBLA 3EJYD 4YDIL 4KY1L 4EDWL 1UH3A 3WS3B 4O4YL 2PTTA 1HHJB 4JFDA 4X98A 3LQMA 1VGEH 1DQDH 3LZFL 3MUZ1 3KYNA 4X9GA 1SJHA 3HKFA 3HNVH 4CN1A 4TSBL 2AEPH 5T5FH 5FOJA 5C0BE 1ZTXH 4WTZA 3OF6A 4MGXA 4Z78B 3MRBB 5E6ID 5F9OH 3NPSC 3UTPE 1KYOJ 3C5SB 2CIKB 1VADB 3VXUD 1T4KA 5MHSD 3BP6B 2JJUA 4YK4B 3REWB 1QKZH 4EUPG 5CKAA 5I8OH 4LEOA 1SBBA 1ZVSA 2CXKA 1B4JH 1A7BA 3WFEL 2WNGA 3Q5TA 3ARFC 4U1LA 1RJYA 2JJSC 4NKIH 1UJ3A 5AG8A 3SKUD 3IF1A 1ZA6B 3H9HB 1CG9A 2QQKH 1D5ZB 1JGLH 4Y5YA 2FJHA 3E6HB 4KRLB 3O3DB 1P84J 5DJZA 15C8H 2UV3A 4FS0A 2MFNA 4MXQC 3DPBA 3VXRE 3BIKB 5BQ7B 5ECJE 4OBSA 1N3NA 5L7XH 3VFGH 2E9JA 4X6DE 5CEXA 1E4JA 2AW2A 5C0BB 3U6RA 4NC0B 3NCEB 5GIRA 1WAAF 3SHSA 3SGKC 4KHTH 2X4RA 4IRJC 3ARGB 3LPFA 2CRMA 2V7NA 3GKZA 5C7XH 2XFXB 4RQQA 4CBPA 1VACB 2XWJB 3IKCB 4AENA 1I1AD 3OBAA 1NGXB 4ERSH 1BOYA 1YEGL 2HH0L 3SCMC 2J8UA 2R0KH 4HQQL 2VUYA 5F96H 3GJEB 4UBDC 5E1AB 4MXVE 4BFIA 4HPOL 1W8NA 5LG1A 3SCMD 2ED7A 1NANI 2W0PA 4PJ9D 3VFSA 5D2NC 2UYLB 5ID0A 2F19H 2NNAA 2D7OA 2H6PB 3GSNL 2CDFB 5EU6D 5EDXA 3B9KA 3GBMH 2AEWA 4OD1H 3I84A 4R8WL 3MCKB 3GMQA 4KI5F 5D8JH 4OCWH 4OAWB 3S6CA 4MXWH 1MCDA 4PB9H 4OZIE 3MRIB 2X4SB 4JHZA 2JJSA 4D0DA 1RJLA 3GSWB 5HPOA 4J6RL 5B3JE 1NL0H 5GGVL 3A0OA 4ZO7A 3MGTA 5E24E 1D5BB 4TTDD 2J2ZA 3WE6A 3NZHH 2LFGA 2A2QT 4AG4L 3DV6B 3CX5J 3BP4A 4JO2H 3KPSB 2OXHA 1ZANL 3HI6H 3RKPA 1DLFH 2FHCA 3MRPA 3WFZA 1T2QL 4G42A 3VXSE 4EKXA 3DX6A 4KK6C 1AXSB 4N0CC 4JRXB 5JORB 1V05A 2W0KA 5HDLA 3QCUH 2X10A 4RWYL 2BFVH 3LHPL 3QNXB 3VD5A 3PWVB 4QRUA 1SEBB 3D39A 2XKNB 2R8SH 4KZEL 5D1QB 5J1SC 2BVQB 4XNUH 4NKMA 3KR3H 1OWRM 3JTTB 1NFKA 1KIUA 3TJHC 1LK3H 3ISWA 2HRPL 1FH5L 1BMGA 1H5BA 2X4RB 1KC5L 4Y2DB 2VLKA 4X83A 4DOHB 3TNNA 3NACH 1IT9L 1IGFH 1T6WA 2MPAH 1JNLH 3ULVL 2W9DH 3TZVB 1HXYA 4CN6A 4RGNE 5J11C 5GGRB 2ZWLT 1IEBA 4MB5A 1CXLA 4Z5RA 2VAAB 5BS0D 3F62A 5JHDD 1JZ2A 3FT3A 3HFMH 1OW0C 4KU1A 3IF1B 1YUHA 3IJSB 2IANB 1MCJA 4I3RL 2R1YA 4JFHE 5DD3H 2ZG1A 1ZMYA 3RWHB 4ZSOA 3MV7D 3MCLH 5LWYL 1D9KD 4IS6B 1CICD 4G8FB 3GIZL 4FQ1H 4X6FA 3T0ED 1A3LL 1Z2KA 2SEBA 4ZAKA 1LEGA 2ARJQ 4YXKL 3O81A 3MNVB 5C0AB 3TEUA 2BXZA 2E5EA 2B8OT 1BLNB 4RMVA 3WFCH 5KOMC 2F5BL 3DWTA 3U48A 1H0DA 2VDNH 3D1MC 4NNXB 3ULUL 1ZK9A 3B43A 3WDJA 2MCPH 5GSRB 4XCCL 1RK1B 5BS0B 4C83B 3O6KL 4LHJB 5JXEC 1J18A 4I0PD 3DMMA 3JVGC 4LCWD 5IM7A 2P42B 2DJUA 1UJTA 4QXTA 2QKIB 4I0PC 3S37H 1SY6A 3TBSB 3K8KA 4OCSH 3OG6B 1A9BB 2OZ4A 4U1MB 1EO8H 4WDIA 1MLCA 2YBRA 1R5IA 3JWOL 4NM8L 3FFDB 3LSOB 5HDBF 4TYUA 2O93L 1U3HA 1JZ5A 4H5SB 3T0EB 2P8LA 1J11A 3ECBA 4EI6A 3BISA 2FJFB 4F2MB 5D72L 4OSUL 4B5EA 1GC1L 4U1NA 5CEZH 1LK2B 3BMVA 1JNNL 2N7BA 4P23B 1ORSA 1G0YR 1FBIH 4V1DE 2EDXA 5LAXA 5JNYA 4WO4D 3ZTJG 1LO2H 4KKCD 5IQ7H 1ORQA 4X4YA 4HS8H 3TNNB 3F7PC 5D7JC 4M5ZL 2PXYC 4PYHA 5SX4H 4LFHD 3F12A 4XPFH 4UT9H 1KJ3H 4YHKH 1J1XH 4FTVB 1UM4H 1P4LA 3HUJF 3KPSD 1DBAL 4OLXL 3T2NH 5E9DE 2VR5A 5C3TA 4Y4FD 3VW3L 1EVTC 4LLWB 2FATL 1SHMA 4HUWB 3PQYA 4U3CA 1CFNA 4QOKA 1A4JA 1I1AB 2VSCA 3ZLQC 2XTJB 1JPFA 4EDWH 2C3GA 4IMKA 2FSEA 1A14H 2W60B 1MCPL 1FL6A 4U1IA 1REIA 5CZXC 2C3WA 3MRNB 1OTUC 1I1YB 1G7LA 1U9KA 5I8KL 2GUOA 4ZPTA 3BESR 3CVHB 5MERB 3NCJL 1II4E 3RBGA 5SX5H 1QQDA 4LPXA 1BEYL 1F6AB 3WUWA 1D9KA 1PQZA 4NNPH 5EBMA 3BZEB 1Y18A 3E2HC 3KR3L 4FMKA 2P7TA 2V2XB 2X4NB 4M7ZC 3S3PA 2IPKB 4Y4HA 4Z7VB 1J87A 3RWDB 1NFDE 1WBYB 2PTUA 2HMIC 2R15A 1JI2A 4LSQH 1ZHNB 3C6LA 4G80A 2AVGA 5D7LE 5HPMB 1D5IH 1G7HA 2GJ6D 1XIWA 5KN5A 5EOCJ 4UIKH 5DLML 3TO4D 2WP3T 3ABZA 4P5TB 1UWGL 4WHYH 1J0KA 5D2NB 5E5RB 1MVUB 3RNQB 4QTIL 5SWZB 1J9CT 2GFBA 1HKLL 3ARUA 1VEPA 3WDHA 4LEXH 4HWEL 2J7LA 3L3HA 5DK2A 1OP5K 3MFGB 1YC8A 5DK2B 3DSFH 3DUUB 4CU7A 2ZUQC 5C07E 5GIRB 1RZIB 2ESVB 1S9YB 4UTAH 1S9XA 3MA9L 1FYTB 1JTTA 3G5XB 4WV1A 3AU1B 3WN5A 4JHWH 4PJCB 1IQDA 5I9QB 5TFSL 3C5JB 5IMLA 1ZV5A 3QCVH 5GS0H 1WFUA 1RIVL 5DRWA 4J3UA 3S3SA 3TGXA 1X4XA 3B4NA 3E6HA 1RULL 2EIEA 5CSGA 4W4OC 3JWDL 4YH6A 5DHXB 4O00A 1IFHL 3UO1L 1IC4H 2J6EH 2OYPA 2D03H 4ZODA 3WD5H 1A7NL 1KXVC 2F53A 4PJGF 4GMTH 3TIDB 3ARFB 4N0FB 1T0PB 1CYGA 3TT1L 2VAJA 4CU6A 3FKUS 1F13A 1QO3B 3BXNA 3U1SL 1IAKA 3VRLE 4XBGB 1I8IA 4L8SB 2IH3B 3FJTA 1HE7A 5DGRA 2XRAL 3QPXH 4Z7OF 4PJ7E 1JHLH 2QBWA 1M4KA 4GBXA 5D4QA 4KROB 4F7TB 4LF3B 3B9KD 2IAMA 1IQWH 3O3AB 4G6MH 4DVRL 2W60A 2X2YA 4M61B 3O6LL 3IJYA 2ZKHH 2X9YA 2CGRH 2EDEA 2ITCB 4U7SA 3JWOC 4CL7A 3TT1H 4L3CB 1CFNB 1FORL 4GQ9H 4DW2H 1RIUL 3LKOA 4GOSA 3RI5F 1ETZA 4LP4A 2PN5A 3MLXH 3I50H 5D7LB 1CDBA 5D1XA 1CU4L 4Q9CA 5AZ2L 5HGHB 2GHWB 4QRPE 5IB5A 3TO4A 5ALBL 4UBDD 1FL6B 1JN6A 1TPXB 2A6KB 2EDQA 3S35H 3K3QA 4Z7VE 1JPFB 2ICWA 4QRQA 4RA0C 1LE5A 1JZ8A 1EHNA 3ZSTA 4PRPB 2JB5H 4WV1B 3RFZC 5TH2A 4KKBD 1H3PL 4R0LB 3G5ZB 4PJAA 5EU3B 4OD3H 2YKLH 3DGCR 1P4LB 2ATPB 3O9WA 1U58A 3GHEL 5KZCD 4XP1H 2ERJB 3HLAB 4AEHH 3ECBB 2OM5A 4XPAH 1BBJB 3BZFA 2E8ZA 2DF3A 1LO5B 1J05A 1TPXC 3VFVB 4CNIB 5JOFB 1FDLL 3K1KC 2ARJB 3QIBC 4IRSB 1H15B 1CFQB 1KXQE 5E6IA 2ZSWA 5C6TL 1G6RA 4K3JL 2GTWA 4PGEA 4HJJL 2OR9L 4OD2A 4JANB 3DMMB 3EIFA 3MRLB 3DX8B 4LLAA 3ZHKA 4RGND 3FQXB 3LOWA 1VFUA 4EI6B 1MFDL 1G9NL 5GRJH 3QQ4B 5L6YL 3QUZB 2F53E 2W1NA 3U4BL 2Z91B 3BMWA 3D2UD 3ULVC 1F5WA 2DOCA 1ZLUH 5C0EB 5TE6L 3HE6D 1JPGB 2HFEA 5A2FA 4Y16B 3DXAB 3MODL 5SWQB 5GGTA 5C09A 5IV2A 4O5LH 3LD8B 4OGXH 3LKRA 4WHCA 3BHBA 3BZEA 1VB9A 2K1MA 3NIGF 2KZWA 3TJHD 4W70A 4J3SA 2AXJA 4PLKD 5E00B 1F4WL 2HKHL 3MV8E 4G8FA 4YHMH 1RFDH 4K3DH 3IDMB 4LARH 5CMAA 3SKOB 2CLZA 1XCQB 1HHIB 3ZDYE 2OJZH 5DJ8A 5K93A 4GW4A 5DD6A 5CHNB 4IJ3C 1KPRA 4OM0H 5AAWA 3S7GA 4FHBD 2IANA 4OIIL 1MRCL 3I85A 3O45A 1T0MB 3LRGA 2FEEL 1TVHB 5JIIA 3QDAA 3LVEA 2Q86A 5EOQL 4GS7C 4PJHE 5F9DC 4XVJH 1NBVL 4JN1L 5HYSG 2ZJSL 4X7DC 1OAQL 3DVFA 5D7IE 1RZ7L 1T22A 3MLWL 4P57B 1XGYH 4FQ1L 2VZ1A 1T03L 5SWSE 4QY8B 3VFVA 4HCRH 4KGJA 3P4LA 1UCTA 2D7MA 4XWOC 5BRZD 1JF1B 2GSIA 2MQ0A 3BN9D 3D39E 4L4TD 4DN4L 5IT2H 1SBSH 3I3BA 5HY9B 4Z8FH 5ETUB 2ZPKH 1RHHA 3I6KA 1CGXA 4JPVL 5LQBH 2H1PL 5F7HA 1QSVA 2P8MB 4PRPA 3H0TA 2IF7A 4YEEA 1A02N 3O6KH 4F33A 4EDXA 4NO3B 5MI0C 3VA2C 3CLFH 1IC7L 1EFXA 1A9BA 1S7RA 3MFFB 1TCMA 4P9HL 1MIEH 3MV7A 3TZVC 4ODVH 2NTFB 1OAKH 5J7CC 3DYOA 1XFPA 5D7IB 3NZ8B 2AS5M 3CFCH 4WW1B 1B90A 2Q3AA 5ISZE 5HHOA 2R2BA 1XR9B 3HI1A 3O6FC 2RCSH 1HK6A 1A6WH 2VKXA 1DANT 4NNXA 2VL5B 4ZDHA 1DFBH 3QEHB 3QIUA 4OLUH 5DMIL 2F8VA 3MRKB 3LDBC 5FUOL 3KYKH 4ZTPH 1GHFL 4AZ8A 1HSBB 3CH8A 4OZFH 3ULSA 1L0QA 2ZKHL 3NH7H 3V8CA 3TF7C 1I1AC 3WO4B 4JFXA 3O8XD 1NCAL 3V79C 2JIXA 1ZXQA 1G6RH 2NY4D 1FLTX 1OF2B 2IALA 1FVCA 3U2SB 2IPUG 2OK0H 4MA8H 3Q5OA 4DTGL 3SDXE 1B9ZA 3X11B 3V52L 1H3WM 1M71B 2FGWL 5HVHB 2MTPA 3CXHJ 4UNVA 5LJYH 4U6XB 2DTMH 3HG1A 4IRZL 1N26A 5EH1A 1GCFA 4K7PH 5HI5C 4I8DA 5BVJA 1ZLSL 1IC4L 2J6EL 4XVSL 2V7HB 5CEXB 1KFAH 3G6JA 1HXYB 3KLDA 5LCVL 1YJDL 2O5XH 3OHXB 1NMBH 1XR8A 2EO1A 2GT9B 1CN4A 4QTHA 1QEWB 5AAMA 1ZVHA 1I9EA 3C8KA 5TFSH 1VFBA 4ZTOH 3H9HA 2A6JA 3THML 1I9JL 5C0CD 4R90L 2A38A 2ADGB 5J0BA 1S9WB 4XT1C 3U9PH 4PJXA 3RX8A 1IAII 1VPOH 4FABH 1I7ZB 1T4KB 4KVCH 2HAZA 2VDKL 4BQCA 3MLUH 3NBNA 1NJ9A 4QXWA 1LHZA 2PR4L 4ODHL 4ZUWB 5IB1B 2H26B 3CK0H 5EPMA 4JDVB 1KEGL 3S5LA 4J2XA 3ZKQD 1M05B 1KPUB 1RJYB 5EO0B 3L3GB 5E6ZA 3RWGA 2D4FA 3O2DA 4LPVA 3IT8D 1WBZA 3IFLH 1CTNA 2Q7NA 3LEYH 4TUOB 4WU5B 5CILH 1AO7E 2R0ZH 4HZLA 2P7TB 4U2ZA 3GMNA 2AV1B 2NYYC 1JWSA 2PYEA 2F19L 4JKLA 3P11H 4D0DB 3V5HB 3X12A 5KSAC 4PJFA 4HC1H 2Z4QB 3CVHA 4HIEA 4ZPTB 4LKCA 3VWJC 5I73C 2RGSA 1IARB 1LP9B 4AIZB 1ZTXL 3UTTD 3CH1B 3ZKXC 5C08E 3OKMA 1HHJA 2J5LC 3SGDI 3TYFB 4ZSOE 1TVDA 4PJFF 3PXHA 5IEKB 2R2BB 5IMKB 2HG5B 3ZT6A 1MREH 3CLFL 3PWUA 1IAOB 2APVA 3GMRA 1HQRB 3VD3A 3VWJA 4Z77A 4UOW0 5AYUH 1BVLA 1JZ4A 3V7AE 1ZHKB 3K7UA 4JPIA 3SN6N 1OVZA 1R3IH 3D3VD 1INDL 3WXWH 3SJVE 1NGXA 3WKNA 1MHPH 4FTVA 5IVNA 4OZIA 1A1OA 1X5YA 3LPGA 4RQQB 2XNAB 4YNYA 2ZCHL 3C60B 1R24A 1CDJA 2N1KA 4MS8D 5DMGC 5JLZA 1JWMB 4YAQA 3KG5A 3MJ9L 3MRMB 1N3NB 4MS8C 5D7IF 5DMGD 1AD9A 2HTLD 2CRYA 4OGXL 3L3KA 4LLUA 4MA7L 4HV8B 4MNQA 4XNUL 5D2NE 1LK2A 5EOCL 1RJCA 2CK0H 1H3VA 4LPTA 1U8HB 5HYSB 4ETYA 4S1SH 3FQWA 2VABA 1E6OH 1R3HB 5T33H 2NY1C 4ZFZA 4J8RA 3MLRL 1MF2L 5I8OL 3ZL4H 3ZHLA 2Y23A 4MA3A 5J1AA 1GRWA 4PRIB 5BZDB 1IAOA 1A7QH 1I3GH 4M7LT 5DJ2B 4PJCE 3LIZL 4KQ4H 3C6LD 1IGIL 1CLOL 4PD4K 1I7TA 1S7SB 4F58L 3D25A 4Y5VC 4PG2C 1KPRB 1T7VA 5F3HA 5ESQB 4HG4K 2EC9T 4ZO6A 4KAQL 2ZP0T 4QRTB 1OARL 2VIRB 3MLYH 4JJ5A 3SE4A 4DOHE 3E6FB 4ODXB 4K9EC 4JQVC 4GXVH 5AYUL 1OCWL 2J88L 5FYLD 3JV4B 1C5CL 1UB5B 1JK8A 3FOMA 1A9EB 5FDWA 2XPGA 5F93C 2UWEB 3EYQD 1Q9WB 3C2AH 3QG6B 4J4PA 4HXBH 4XXDA 1S78D 4WU5A 3V7MA 1HN1A 2HFEB 1T83A 2VXTH 2H8PA 3FN0H 2OR9H 3RGHA 5EO0A 3RWGB 2X5PA 4FG6D 3T0XA 4EZMA 3PV7A 2EE2A 4OCLC 1E4KA 4PRHB 3PWPD 1JNJA 4JR9L 5TE7H 3VGEA 3VE0B 3FT3B 3GSXB 5INCB 3L1OL 4WI5A 1G84A 3QUMA 1HSAB 4P9HH 4TOYH 4L9DA 4WUUE 3L3KB 5DYOB 3O0RL 3CPLB 1NCWH 2V5SA 1E28A 1KPVB 1L7TH 3LKPA 4QRRB 2ZOKA 3T2OA 4APQD 2R1XB 4EBQL