1BOYA

Extracellular region of human tissue factor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
TTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN TISSUE FACTOR
publication title Crystal structure of the extracellular region of human tissue factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Class 2 cytokine receptor
total genus 44
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 1996-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1boyA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1boyA02
5CP3H 5B8CB 2EYTA 4QRPE 2A6IA 1K4DA 5HDQL 4XMLH 1CIUA 1F6FB 2CJUH 2Q86B 2DQEH 1HE7A 3H0TB 4M1CD 1HHKA 1T5XA 5K93A 4NJ9H 3VRJB 2Z91A 5DZNA 3O6FD 1HYRC 4K94H 4L4JA 4Z7NE 1B0GB 4GKOA 1F4WL 2C26A 5DYOA 4LGSB 3BE1L 4AT6B 4PJEE 4BFBD 4KDTA 2DD8H 1RHHB 3D85A 4PRNA 4PJXA 2ZKHL 4G8IA 4KUZL 5GS1B 4IMKA 5IQ7L 3STLA 1EUUA 3CXDL 4NQSA 4YEEA 4P99A 4XPHH 4MAUH 5HYJD 5C0IA 2APVA 4Y19E 2BNQD 1J1OL 5B3JF 1KEMH 1JRHL 4KRMB 4ZTPL 2PCPB 1I1YA 3BQUB 4HG4K 1CL7L 2EYTB 4MNGB 1K4DB 4PB0L 3TT1L 1BAFL 1YYMH 1PGRB 3S3JA 3FOLB 3VWKB 1DEDA 1AKJD 3HI1A 5C08E 2G75B 1ZEAH 1D9KB 1EJ6A 1WIPA 2Q8AH 1OLLA 2ICWI 3MNWB 3D85B 4JFEA 2NY1C 1U2CA 1MJJB 5GZOD 1GGCH 3UJTL 2VZ1A 2P47B 5DUPL 3HE6D 5IB5A 2XZCL 2J1KA 1AGFB 4TVPH 1WBXA 1MFBH 1G9NL 1FYTA 1I1YB 3ZDZF 3D39D 5FYJE 3B4NA 5HHXL 4N9OB 4QXUL 4N8CL 4ZYKA 4LSRL 5CEYA 5ACMA 2J8UA 2FLBT 4YE4L 4P5TC 1A3RL 1ODAA 4K07A 1BFTA 2X4PA 1RULL 3L9RA 4MZ2A 5CBAB 4LCWB 4OF3A 2CDEB 3X11A 4XVTL 5D7IB 5EU6A 4K8RH 1A7PL 5EOQL 1GHFL 4GG6A 3NCEB 1WJ3A 4XTRC 3NCJL 4ODTH 3VXSB 5I1KH 2OP4H 1T2XA 4D9LL 4TNWF 1CE1L 1HINL 4TUJB 3EOTL 2EYSB 1FVDA 5CEYB 4FA8A 2J8UB 1KJVA 3V6ZA 1JI1A 4E41E 4R4FL 3RUGF 3B9KC 5KAQG 5JR1L 1FIGH 5DA4A 4CNIB 4NQDA 4I3SL 4X9IA 3GRWH 3MA9L 4I3GA 1UZ8A 5FYJL 4OCMC 4PJIE 2WWKT 4WWKA 4QWWD 4UUJA 5I1AB 4WW2F 2MCPL 2ED8A 3HMWH 5CINH 3ABZA 4MD0A 4L3EA 2WK2A 4LSUH 5IBTL 1XIWB 1RHFA 3N9GL 5FKPB 4Y5YC 4ERSH 3BPLB 4PJAA 1RK1B 4NUJA 1BBJB 4WO4D 3CDGB 1AGDB 3BAEL 3O45B 4X80L 4XBEH 2Q6WA 1KJVB 2HN7A 3MLPA 5DURD 3I50L 2X40A 1P7QA 1WZKA 3NIGE 1SMAA 4MJIA 1F58H 2E9JA 2I26N 3L3KA 2NR6D 1XZ0A 3VFGL 3BJ91 1NBYA 1DBAH 3HB3D 4EUPG 1XGQB 2UWEA 3RAJH 4G7VL 3QNYB 4GBXC 1PJ9A 5IOPB 4HXAH 1Y6KR 4P9HH 4OD2A 4Q6IB 4OM1L 1EX0A 1VEMA 2HYMA 1SVZA 4WFHD 1VPOH 4Y0GA 4S1SL 4F80A 4ZMAT 3UTPE 3VGGA 3DTXB 2Q7YB 5BRZA 2BFVH 4HK0A 1YEFH 4G8EB 1P7QB 3RY6A 5E56A 2VZOA 2PYEE 1FJ1B 1DL7L 5J12C 3G6DL 5CKGA 2BK8A 4MJ4A 1WV7T 1PLGH 3I6GA 3LN9A 4ACPA 2XN9D 3QUYA 5ICXA 4OCYL 5DS8A 4ODHH 4X6CE 4GKSB 4KTEH 4NDMB 3SY0A 3HR6A 2ATKB 1F11B 2DB8A 4QCIA 3GSRB 3PDOA 5BZWB 2W07A 3F58L 4RGOH 4YEFA 4UT7L 5KSVB 3C9NB 1FORH 4JPKH 4JREC 3OF6D 4X83A 3V0VB 2Z31D 4OD2B 2BHYA 3O2VH 5EH1A 3EDDA 3QPQC 3RIAK 8FABA 4IRSA 4CVZA 2NZ9D 2A2QT 2NY6C 1INQA 4P23A 4IMLA 1F4HA 2CKNA 3IDGB 4N0YL 4V1DA 1RJLB 3JZ7A 3VH8B 3T0XA 1QHPA 3WJJA 2F15A 1CFTA 2ICEB 4EN3A 1S9WA 3WNPA 3CFIC 5ID0A 5F96L 4BZ2H 3B43A 2HVKB 4LGPB 4D0DA 4NWTH 4HUXA 1Q9WB 1YNKL 4NM8H 1XF2A 1LO4H 3VWJD 2R0LL 2QHRL 1QTYT 3KHQA 2ZUQC 1J8HA 4IJ3B 2AERT 4JDTL 3W5MA 4KI1A 3T0EE 4N0FB 3HRPA 3GUTB 1CBVH 1IEAB 4FQHA 1A2YA 4IRSB 2AXGA 4LCCB 5T3ZE 4J3WA 2XQBL 3GM0A 2P8LA 25C8H 2I25N 1I1AD 1QO3A 1IVLA 4EEEA 1JF6A 4QNPE 1FNSH 5KVEL 1WBYB 1FNGA 4EN3B 3HE7A 1Y0LB 2EE2A 2KZ1B 4XNUH 3JTSB 3EDJA 2DJUA 2HRLA 2I27N 4JPVL 1FAIH 4XVSH 4P9ML 4O02L 1VACA 3MV8A 2FSEB 4UTAL 5DMGD 1HIMH 1EGJA 2HJFA 2XZQL 1J8HB 5HHPA 4OLYH 2BSRA 4QRSA 3Q5YA 5E7BA 4CMHB 4DTGL 5KG9B 4TNVF 1JNNL 1C5CH 2VLRD 5ITBL 1DQJA 3QH3B 4ETQB 2EKSB 1UWEH 4KZDH 1ZA6A 3CD4A 3CUPA 3MBXL 3MZTA 1NMBL 3GSOB 1VFBA 5T3ZL 1IGFH 1NCAH 3VJ6B 4U1KB 1UACL 1RUKH 2NY7L 3RJDA 5FA4A 4HC1H 1GIGL 3VFRB 4ONFL 4XNYL 4HZAA 2J6EL 5K9QG 3CFKA 2WAHA 2AV7A 3BRGC 3LPGA 2IPUK 3MV7D 3PJSA 2YSSB 4ZAKB 4R9HA 3WD5H 3P4NA 3WFCH 3WFHB 1SY6A 2O61B 2NLJB 5HYSB 3VXOB 2WBWB 1A7NH 3Q6GL 3BP6B 5GGSA 1EIBA 2AQ2A 2C1OA 2X4SB 4NNYB 4NM4L 1I4FB 4G6AD 4Z7UA 1F6LL 3PP4L 2G5RA 3MRBA 5GSRB 5T1LB 5B38G 3B8YA 5F1SA 1Q9LB 1ZV5A 4Z78A 5J1TC 4I2XE 3LPWA 3ULUC 4IOIA 2R0KL 2R39A 1AXTH 1FVEA 2G5BA 3KPRA 4IDJL 4LRNH 5T1KD 1JZ4A 1QSFE 5CILL 5EIQA 4B7IA 1MHPL 1GYAA 4K3JL 1FLTX 1NMAL 1LEGB 3DMMD 4LCYA 4WJ5B 2FGZA 4R0LA 4LLMB 2PW1B 4NQCA 4CN6A 1OD9A 4BQ6A 1R5IA 4F7EA 5FGRA 5CWSA 4NZRL 3N1FC 2YBRB 3UJIL 2P5EE 1JCKA 5FCSH 1ADQL 1E6JH 3EAKA 4KKLD 5LXGH 1NAKH 1MAKA 3FFCA 5H94B 3TWCH 4F37F 2LAGB 1KLGA 4I18C 2YRPA 5A2JH 5F7FA 4NCDA 3ZHKA 4KK8D 3U7AA 1OSZA 2G5BB 1HI6A 1N0XL 4NC1C 3WO4C 5MEQA 1X5XA 5ISZE 3P9MA 3UTSB 5FUCC 3OR7B 4NOBA 4JFZH 4HCRL 4KGLA 1NDGB 1GOGA 1D5ZB 4C56D 2ZOLA 1UADC 3TA3A 3P0GB 2FIRT 1OT1A 4DFIA 5CWSB 1RZ8A 3O6LH 3SDAA 1V7NL 3PWPB 4UOW0 3QUZD 4YQXL 3WFBL 4XGZB 1DP0A 4XCCH 2GTWB 4OSUH 1YDPB 4Y4KB 5MHSE 3DECA 5BW7A 4FZ8H 3T08A 5EUKA 5AZEH 4MCYB 3HI5H 1EDQA 3K81A 3RZCB 1SJVA 2WWMD 5JXAL 4FG6C 4KU1A 5FUOH 3ARDC 2P42B 5MEPA 2NY3C 4U1NB 5EB9A 1HCVA 3REVA 3VFVA 5E8NB 2VYRE 5AZ2H 3SDAB 5IP4A 1AJ7L 1EHLL 2XXCB 2WQRA 1TQCB 3V8OA 5F9AC 3DO7A 1EEZA 2BNRB 3SCMB 1CDCA 3QHFH 2BVOB 4XRCA 3WJLC 1KELL 4PJEA 4N9GB 1LEIA 3SBWA 3IRZA 3AB0B 1ZHKA 4NBYB 4Y8AA 3QEGL 5M95B 3D85D 3DVGB 5F88B 4RGMB 1KIUA 4G7YH 4WFGD 3UTQB 4NKQB 5D2LE 3BKMH 2JIXA 4Q6YA 1KENL 1VFAB 4S1RH 3QBTB 4QRPB 2FHCA 1BLNA 1UCBL 1HHHB 3JWOC 4X4XB 1OCWH 2BCKA 3C08H 4TNVK 3VGDA 1P5UA 4WU7B 3RL1A 3EYOA 3CMOH 2HT3D 1LDSA 2VDPH 5C08A 2XIDA 3L6FB 3RPIA 3HI6L 2ZPKH 3ARXA 2JJTC 4XRCB 1KB5A 4WWID 3S35H 1U6AH 3EYUL 4PTUA 3MZGB 4ZFZB 4JZJC 3IVKA 4WIQA 2YZ8A 5I1EL 2DM3A 4JFED 1QFUL 4Y19B 1DN2A 5HGBB 4NRYA 4R8WH 4YZFF 1NL0L 3QEQE 1NLBH 4P4RA 3UPRB 5IMLB 3LHPL 4HJGB 2HT2D 3JSSA 4XP9L 2R1WA 2E7BA 1FYTD 2X4TB 1WEJH 4L29B 1KCUL 4XPBH 3RL1B 1HZHH 1N2RA 5C08B 1D5IH 1YEJH 2H32A 1SQ2N 4XMKL 1OAYH 2QR0A 3SGKA 3CSGA 3PF2A 2FYYB 2D4DA 1NSNH 1SBBA 3TF7C 1EO5A 4J4PA 1GOHA 1QFWM 1IEHA 2WNGA 1P4LB 3B5HA 4FFZH 4ZUTB 3DARA 5DLMH 5DRZB 5IV2B 5EU6D 5B22A 4QRTB 1BZ7A 1DANU 3CPLA 1S7XA 3G5XA 4E41A 2VDOL 4QTIL 4MA3B 2LU7A 4DWHA 3VXNA 4M7KH 4AENB 5DD0H 5EZIL 3MRRA 3BMVA 2YXFA 3MNZA 3CFDA 4NQDD 1AD0A 3EGSB 5IVZB 5SX5H 3P11H 4NN7C 3SKJL 1S78C 3VD5A 1AI1H 4OCXH 4WWKD 5ICYB 3RZWA 1DVFC 5H2BA 3ZMRA 1J5OL 3AM8A 4XWGH 1EK3A 3L5WA 4JFOB 2C1PA 3AREC 4L3ED 5C71A 3CPLB 1ZANH 1DJSA 3IDNB 5F1OB 2YPVL 2HJKB 4LKXB 3EIFA 5C0CD 4OCSL 2H2SD 5GZNC 2IPTL 2Z35A 5GPRA 3ZE0E 4XXCC 1FPTH 1OAXH 2VZSA 1OSPH 1P7QD 3BGAA 3N1GC 1T3FA 4PJIB 4NRZB 5FA3A 4MJID 2QKIB 5J56B 2D31B 2J4WH 3CK0H 1F4YH 5HHOE 5BVJB 3BP7A 2BDNL 4F58H 3MJ7B 1N4XL 4ZUWA 1IAII 3T2OA 4XNZC 1JMZA 4Z0XB 5CGYC 1KEGL 3ARGD 1SJHA 2Z92B 3LKNA 1B4JL 1TXKA 1MLBB 2EIZA 1BFOA 3FO1B 4GO6B 1ZGLM 3O3AA 5BRZD 3VXPA 2YKLL 1T3FB 3JV4A 1YY9D 3ZKSD 2VDLH 3L5JA 1LO2L 2Y5TB 3D0LA 5IHZB 2CGRH 3QUYD 4G9DB 4LU5L 1BGXL 2EXWC 4KTDL 2MKWA 1N26A 3KR3H 3LPFA 5EFIB 5T1DH 3QIBC 4X99B 1PBYA 1IRAY 2GUOA 2NY1B 1CLZH 3WUWG 3LKNB 2ESVB 2OTUA 3DYMA 4K3DL 1BJMA 2FX9H 5IIEB 2EIZB 3GZKA 1BFOB 4M6OH 4G43A 2JCCB 4XAWL 5HDBF 2PYEB 4XC3H 3I02A 1HILA 5IQ9A 5GJSL 2FWOA 1KJ2B 5EORH 3JV4B 4P23D 2YD8A 3SDDA 1KCRL 4X6CB 4OAWB 5F6IC 1YEHH 1FH5H 4V1DD 2OZ4H 4YH6A 1IGYB 3EFDH 3FQNB 4EN3D 5I1CL 2E7LC 4OZHB 4OF5A 1UEMA 5BXFA 3MV01 3CU7A 4X7FC 3T0EA 5FV2A 4K23H 3BPCA 5FYKU 4ELKA 2AK1L 3FB8B 4H5SB 4Q7DA 1MCQA 3TO4C 4XBPB 2JJWA 5JDJA 5LVEA 4UU9A 5FYKD 2VE6A 5GRZA 2J8OA 3IJHB 3BDYL 1QLEL 2FWOB 4NWUL 1LK2B 1MNUH 2EDEA 2J6EA 3QO0A 3Q6FB 3V5KB 3M1BB 2EE6A 3L7EA 3R8BB 3IDXH 2K1MA 4Y4HA 4AEFA 3B9KB 3S34L 4JEGB 5IHLB 4G8GE 4HJ0D 5L2KE 5F7KC 3HE7D 4WY7H 4LARH 2ZSVB 5DK0A 1P6AB 3GSQA 5AYUL 1HWGB 3MV8D 5H35B 4OGYL 1OTTC 1WAAF 1KTRL 1FO0B 3QPXH 5CZVL 4L8DB 3BWUC 3QCVH 4K71C 2RCSL 2I60H 3K0WA 3L95A 4J6RH 2VDNH 3MO1A 3LEYL 3GBNL 2Z8WC 4D9RD 3DI3B 1A7QL 4Y4HB 4PJXF 1F2QA 1CFVH 1ND0A 4Y5XB 1UB6A 2R8SH 1YQVL 3MRPA 4NZUH 2IH1B 4GRWF 2VLJB 3U83A 2H9GA 3P4OA 4CBPA 5CGTA 2YPKA 3M8OH 1XEDA 5ESQA 1WFOA 4Z5RB 4FRWA 1TCRB 1IGIH 2J88L 3D3VB 8CGTA 1ADQA 1AXSB 4JPWL 5IB1A 1FL3B 3D0VB 1GOFA 4GBXB 2GJ6E 4JY4B 3IF1B 2NQCA 3D18A 4JR9L 12E8L 1GGIL 3VMNA 1I1CA 4YBQD 1K8DB 3D1MC 1EFXA 1TMCB 3H9SA 2UVEA 4QGTA 2ARJA 5F9WC 3SGDH 1KPVA 4IRZL 1EHXA 1RUAL 1ND0B 4HCRA 1A6TA 5J12B 1BM3L 3FTGB 4M3JA 2IALA 1WITA 5F9JA 1U8QB 3H3PH 2ZUSA 1GXEA 4I2XA 5I1GH 1E6OH 3G04B 2V7NA 2YPKB 2Y5EA 3U1SL 4ODSL 1WFTA 1F02I 1AE6H 1GC1C 4HUVB 4RIRA 2B4CH 4W81A 1Q9OB 4HSQA 4J8RA 1EHAA 3LDBC 1QSFA 5CD3A 5IB1B 1YJDL 3KPRD 2H8PA 4KTYA 4G3YL 3FT4B 4JREB 1UWGL 3TCLB 4S1DC 5DJZB 1YY8B 3FQRA 1AC6A 2FCBA 3OKKB 4GRWH 4HPOL 5ETUB 4P4KA 4NQCD 5FK9A 2P5EA 1EFQA 1JPFB 5DTFB 1N7MH 1I7TB 4GKZB 2F5AH 4UDUB 1MVFA 4GW4A 3NH7L 4GG6F 3QDME 1U92A 5CUSL 1PZ5A 5E2UL 3FFCD 2DLFH 2V7NB 3S36H 1CGUA 2ZUWA 1KOAA 2NY2D 3LKQB 4GMSH 2J3SA 4PS4L 5ISZA 2GY7B 4K9EH 1RD6A 1RVFL 3O8XC 2ATPA 5KSAC 2DL2A 2H8PB 4HQQL 5DO2D 4F8TA 2APXA 1CDUA 2GKIA 3FB5B 4URTB 2ZUQB 1S7UB 1JGEA 2GYSA 2MNUA 1EH9A 3QSKB 3TA3D 4JRXB 4UIKL 4POYA 5C1MB 5JA9A 3QZWG 4ODUB 3RL2A 4MCZA 4O2EA 4I48A 4NQEE 5CLWA 4RAUB 2X10A 3SDAD 5BO1L 3MRIB 1W0YT 1GAFH 1UJTA 2FB4H 3LZFH 1MY7A 4YDLC 2BVTA 4NN5C 1DLHB 1NQBA 1TVBA 5DC9B 3SGJA 3UC0H 2ZNWA 3MUZ1 3WV0A 3GMLB 3ZE2F 4PJAF 5ISZB 1HYSC 3G6JE 1U3HA 5MENE 1GPOL 1J0HA 3RGVA 1RJZA 4XBGA 3MJ8B 4ZFOB 5TDPA 4Y5VC 3RP1A 1SBSH 5EU4A 1JGEB 3BPOC 1TJGL 2NX5B 1JGDA 2YA2A 4NP4H 3BZEB 3HMXL 4NRXA 5C07B 4O2EB 2DL9A 3MUJA 4I0PC 4W70A 1MSPA 4Z77B 3CLEL 3B3IA 1UVQA 1DLFL 4CRPA 1A64A 4DK3A 2UWEF 1W0VA 4M1DH 1UXSA 1MUJA 3UXFA 4EOWL 2MTPA 3E6FA 2FO1A 2ZOKB 4PLJC 5HD8C 4GW5B 4YXLH 3EOAB 4G6JH 1S7SA 1BZQK 5DD5H 4M43L 3TV3H 3DO3A 3EFFA 3UAJD 3WBDA 3ZTNH 2QLVB 2RHEA 3TZVB 4ALAL 3W11C 1G7PA 4X7TA 1T21A 3MLZH 3B2VL 4YC2B 1RJZB 5D9SA 5DD1L 4PR5A 5I66B 1QD0A 3WNOA 1EXUB 3SHSA 1IQDB 3EZ8A 3LV3B 3L7FB 2Q1EA 3BSZH 3FMGH 1ZSDB 2CUMA 2EC9U 2JIXD 1N0LA 4LK4A 5BV7C 4EI5C 4OZ4A 3GI8L 3VGBA 1P4BH 4AYFA 4YX2H 1IZKA 4Z8FL 3BYYA 4GAGH 3OX8B 4UILL 5IFAH 3HG1D 2ED9A 1J8KA 1VGEL 5C08D 5HGHA 3LQAC 4AIXA 3HNSL 5I76B 1TJHH 2F53E 3K4AA 1KIRA 1F4AA 3RVWD 5ADOL 3IYLW 5C09E 4EUPA 5I9QC 2YK1H 3QG6A 1ORQB 5CJXA 4P2QB 5HHMD 5D2LB 2AP2A 4C83A 4H20L 1MFEH 4WCYL 3EYQD 4N0UB 1XF1A 4JM4H 3TH2T 2OMNA 1YEIL 1GGUA 4K55A 2PTUA 4R3SA 5JMOC 5TDNA 32C2B 5FYJD 5SX4I 4KKCD 2F8VA 3ZSSA 3P73A 4EIZC 3PDGA 5H37H 2WBJC 2UV3A 1RZIB 4PV9B 3WNKA 1NEZA 4MA1C 3QQ4B 4PJ5B 2VTFA 1AD9A 3TJEH 3BO8B 1FNLA 2IQ9L 3BD3A 2F54E 1AQDA 4YR6A 4EUPB 3AXLA 3OJDA 4J4PD 3P3YA 2X44D 1VADA 4OCNC 1OTSC 3JV6A 1GZQA 3QQ3B 4JLRA 2WP3O 4PLKC 3WKNA 3QEQB 3PHOA 3OWEA 3OMZA 1BIHA 3LRSB 5K59F 3VXRA 1AO7B 3O2WH 5TDNB 4TYUA 4FXGA 2VXQL 3P4LA 1LEKB 5C0AE 3WIFB 1CYGA 3ARFC 3NN8A 3AVEA 4E41D 1YA5A 4HLZG 1NFDA 1ZVSA 3G6AB 3CDCA 3C09C 1WWAX 3EZJB 4ONHA 3MJ9L 3RIFF 1CGXA 1LE5A 1VFOA 1H3XA 4RFOL 5GRUL 1KJ3L 4KK6D 4KJQC 3E6HA 1BJ8A 2JE8A 4M7ZC 3RDTC 3QISA 5GGSY 3WYRA 3QULA 5DDHA 4PRDA 5JZ7D 2UYLB 5DUMH 3SKOA 1VHPA 2W0KA 3QCTL 4HKXA 3VI4E 4Y2DB 4WHCA 1L6XA 4YHZL 4UQ2A 1FP5A 1T1XB 5E6IA 2C3HA 2DI8A 5DJDA 1NGQH 3GIZH 2MHAB 3ARDB 1GGYA 5KTEL 3CCHA 2NY3B 4PUBL 1FN4B 4QXTA 5I8KL 5FYKH 1TQBC 3FFDB 1BVLA 1LE5B 5TDOB 1P69B 2WIIA 4CADA 1KJMB 2FZ3B 5F7HA 4GAJH 5ERWA 2RJMA 4MLIA 5HHOA 3FO2B 3WXWL 2VABB 3RWHB 2IQAA 3FRUB 3LKRB 1BVZA 5C0GB 5E08L 3LD8B 5I1LA 3B6SA 3EHBD 2YD7A 1XGTB 1OARL 1WWCA 2AJVL 4ORGA 2V2TA 2X4QA 2DS4A 1NCBH 1EGJH 2CK0L 4L4TB 3UTZA 1SJXA 5ACZA 1IBGH 2EH8H 3PHSA 1A6WL 4ZFGL 1U8LA 1J11A 3PDDA 4Z7UF 3TH3T 1PX4A 4ODXA 1SMOA 4OTXL 3FHAA 3L3DB 3UJJL 1WTGT 3U0PA 2ITCA 4CADB 1HNFA 4LOUC 4U05A 4ZSOB 3QEUA 5TGBA 3U9UA 2HKHL 4KMQA 4LPWA 3WL9A 3TBVA 4PFEA 1S8DA 4PJFB 4POZC 1U91B 3FN9A 4JZJB 2BC4B 3JUZA 3LIZL 5JHDA 5FO8A 3ULSA 1A0QH 5IW6A 2GJZB 4XCEB 1K6QL 4ORGB 4M7LH 3NZHL 3VU2A 4PY7A 2VXSL 1NBQA 1B2WH 5DGQA 1K4CB 3KXFE 5GRJL 4ODXB 1UG9A 5DD3L 1E28B 3KWWA 2AJ3A 2R1YB 5KZCB 3HFMH 1DE4A 3SDDD 5ADPL 5DRNA 2QSTA 4AL8L 3TBVB 4HEME 4IS6B 2WUCL 4HS8L 5B38A 1UFUA 3Q1SL 4F7PB 2XA8H 1A6UL 1ULVA 4NZTL 2PXYA 1QOKA 1OP9A 3MNVA 1UT9A 3T0ED 3BP5A 3FQTB 4UOW1 1EAPA 4PRPB 4X5XB 5T3ZD 3VRIA 3MACH 5KVFL 4NKMA 3ULVL 4KK5C 3FN0L 2MKLC 1KPRB 4QHNA 3CH1B 4G8GA 1N8ZA 4BZ1L 5L2KA 1U9KA 3BW9A 3CAFA 4YHLL 5KVGH 5HY9A 1CLYH 1QUNA 1LDPL 3X3GH 4M5YL 2V6HA 2EDOA 1FGVH 4ZO9A 1WTLA 5C0RL 3EO0A 1G7MA 2BJMH 3RVXD 4Z95L 4MHHG 4GSDL 3HTLX 1AGBA 2MQ0A 5F93C 1XF5A 2P5WB 1EAPB 2XRAH 2D0HA 2PETA 3S37X 5EBLA 1NBVH 4Z7NF 1EO8L 3ZL4H 3LB6D 4PJEF 5BQ7A 3DV4B 2JB5L 2EIEA 5JOFB 4BQBA 4G8GB 5IKCB 5L2KB 5ID1A 1NC4A 5D1QA 2QQLL 3IJYB 1DQTA 1JWSB 5HI5C 4Y16A 1OAQL 5CIPB 1MI5E 4F7MA 5IQ7H 3JTTA 1JPTL 3CXDH 5CHNA 3D69A 5C0DB 1OM3L 1H15B 3RIFK 3GI9L 2RFXA 3QUXC 1A1NA 3DVIA 4XVJH 1A5FL 2GJ6A 4M5ZL 4HWUA 4HIEB 1F3RB 4DGVL 1RIVH 4QRUB 5DHVB 2EDJA 3PWNB 4H1LH 2FJHA 3V6OE 4P2RE 5C86A 5F7MC 4XHJD 4K2UH 2X4RB 4WFEE 3R8QA 5F9OH 1CGTA 1I7RB 1EFXD 3H9SD 3T4YB 3ROLA 3HKFA 4KMLB 3MCKB 1CXEA 1QFWI 1SJEA 4J2XA 5CHNB 4E0RB 2RFXB 3HUJE 4YGVB 3LH2H 3CGTA 1A1NB 4HPYH 3MOBH 3FJTA 2XZCH 1RZKL 3PABA 3ARYA 1DN0B 1A6AA 4U33A 1LE9A 2VDKL 4XP4H 3MRKB 1IGTA 2DBJA 2HKFH 3QIBB 1QSFD 3EO1A 5E8OB 4LSRH 2FJHB 3V7AG 2R9HC 5D6CA 1A3RH 4KK9D 4Q74A 4X7SL 5TF0A 3P0VL 4KROD 1I3GH 4D0CB 4WI5A 2D2OA 3OXSB 2NY0B 1E4XH 4P4KD 2G9HB 2VUOA 4QRRB 1H5BC 2P5ED 3DLQR 1HDMA 4FQLH 4JRYB 1MVUB 2OLDA 1A7PH 3GMNA 1O0VA 4XPFL 4F33B 5IJVA 2LVCA 3VXUE 2FEDC 4LQ1A 1M71A 3HMXA 4MAYA 5IW3A 3MGTA 1DUYB 1AGEB 4ZPVA 2A83A 1KB5H 1NPUA 1I3RB 3GGWB 3M17B 4HX1A 4XPGH 5ISZD 1G9MH 1IGTB 3O6KH 1OGAE 2GAZA 3H7LA 3MXWL 3EO1B 1HINH 5HJ3A 3EUUA 4DGIH 3RWEB 3KS0J 4R4FH 3UTTA 5C8JB 1KSRA 4HUUA 4OLUL 4NQEA 5DRXA 4L4VE 2A6KB 1HWHB 4GXVL 3MA9H 5L88H 4KHXH 1ZLVH 3QDMB 5J11C 4GQ9H 2F5BH 5HYIA 2W60A 2MCPH 2DOCA 2ITDA 2W59A 6FABH 3GMNB 4MXQC 4HWZA 2FLRT 1C7SA 4QHMA 2AQ1A 1MCWW 3G6JA 3ZLQC 5DVOA 5MENA 2OMBA 3NFNA 3MRGA 3R0MA 2MPAL 4O51A 2AABH 3RU8L 1U3HD 3NIGF 5I15H 3SKUD 4PJ8C 1LO3H 3RGVD 2X4OA 4G8FB 1T2QL 5B4MC 3FO0L 2Y7QB 1UM6L 3T4AA 1NEUA 3UEZA 5DRXB 5FB8B 1CLOH 3VD4A 2YD5A 1JUFB 4KUCD 1H8NA 2R2BB 4HS6B 1LK3H 4DKFL 4ZFFB 1P6FA 1A7RH 3FQXB 1I85C 4D0BA 4F3FA 4KZEL 4TUOB 3W39A 4LNRB 5E7FA 1DANT 7CGTA 3RWJB 2R0ZH 4OD3H 2W1NA 4S1SH 5C2UB 1ZK9A 4OJFH 3P9LB 4M93B 2UY7A 4CJ1A 1FC1A 3DURB 4H8WL 2R56L 5IR1B 1MFAH 3HZYA 3O41B 5IF0A 1MRFL 4JN2A 1AP2B 4Q0XH 4KJPC 2IBGA 4CVWA 1KYOJ 3OSKA 4PJGB 2F53A 2DDQL 1SM3H 4ZUVA 1SEQL 5C09A 1D5XB 4D0BB 4F3FB 4NQXB 4P49A 3IAQA 4RWHA 2OL3H 3SEPA 1BQHB 4MS8C 3MJ9A 4XP5L 3QUML 1WT5C 4HUWB 3VE0A 3S4SG 3RFZC 3BGFC 1DQDL 1UENA 4LCIL 5JXEC 3BPNB 3T65B 4E5XB 3P77B 1FL5A 4U1MB 2FGWH 3OAUH 2OI9B 5FUZL 3IETA 3C5JB 4FQIL 2EDBA 1YMHB 3L1OH 1NDMA 1FZKA 3ILPB 3TNMA 2R0LH 3B9VA 3DVNA 1SVCP 2CJUL 2OJEA 1GCFA 2DQEL 4JDTH 4F9LC 3MLTB 3HAEH 1TIUA 1D5MA 4K94L 1JIBA 4QOKA 4TVPE 3SKMA 5GS0H 4WW2C 5GS2D 2DD8L 5C0AA 3WUWA 3MFFA 4P46B 3VXRD 4U1LA 3IKCA 4LPXA 3SDYH 3SGEH 3JWNC 5KVEH 3OR6B 4XPHL 2WUBH 4MAUL 2YHGA 3P4MA 1KBGH 3HS0A 3DGGA 4J1UA 1KYOK 1KEML 4HGMA 2D0GA 3REWB 4M8VA 2W0PA 2C3VB 3AS1A 4YHKH 2A0LC 3UBXI 4X4ZA 2CKBH 2F54B 5CCKH 5B3JE 4LLYB 1YYML 4FMFA 1S7RA 1I7UA 4IBLT 4ZS6C 1IEBA 4NN5B 1ZGLP 4GW1B 5CZXD 1ONQA 3GSNH 3NVQA 1NCNA 3ZKMC 5DMKB 3QJHA 4QF1B 5ITBH 1NUNB 3BEWA 3GJFA 3UX9B 2VAAA 2Q7NA 2C3GA 5K9JL 1GGCL 1SYSB 4Y5VB 3ZKXC 4U4BA 5DJ0A 3LKSA 4WV1A 1X5YA 5E6ID 3S96B 4JQVC 1CR9L 1WBZA 3ZDYE 1HSAA 2A9NH 4TVPL 1HNGA 1S9KC 3OG4B 1MFBL 1P53A 4I0PB 3P0YH 5C0EB 4P57B 2I9TA 3KYNB 1E4WH 3L3OA 4BSVA 4XNYH 3TBSB 3NFPB 2HFGL 4H25A 4R4BB 3ZDZE 2D9QB 2EO9A 3U9PH 1LNUA 2K7QA 1M7DA 5HHOD 3VG9B 4TTGA 3QXWA 5D96C 1AR1D 1T1WA 1HHIA 4RQQB 1ACYH 1MELA 2Y23A 3IFOA 4APQC 4R7DA 2GSGB 3Q6GH 4WHYG 1N3NB 1PVHA 4K8RL 3B5GA 4M7JH 3WS3B 3UTOA 5JOEA 1WCQA 4ODTL 5FYLH 5IK3B 2CQVA 2OP4L 1WBZB 5BV7B 4EI5B 3BKYH 2NXYB 1DTUA 3LEVH 2DLGA 3BVNA 3ZHDA 1U8MA 3V6FB 4W6YB 2OQJA 1YYLH 5E5UB 4EI6A 2IH3B 5F7EH 3TYGH 1FIGL 4L8SA 4XNXH 5CILH 1I1FB 1QEWA 4OGAC 4TTDC 3RUGE 3GRWL 3RVUC 1C12A 5CEXA 3BH9B 4HGWB 5JHDD 3VMPA 2LTQC 1DZBA 3MA7B 2PN5A 4NZRH 3KXFA 1LD9B 4HS3A 1IM3A 2DIBA 3HMWL 5CINL 2CRZA 3CIQA 5D5ME 3GSVA 4LSUL 1J0ZA 3IDIA 4PD4K 1TITA 3AS3A 2DKMA 4UIMB 3Q5TA 4M7LT 4GRLC 4XBEL 5F3HA 1NCUA 3V4PH 3OB0K 1S5IH 1QLFA 2VC2H 2D9CA 4RBPH 5FOJA 1F58L 3H3KA 1U36A 1CF8H 2R4SL 2D4FA 1C12B 3ES6B 1DBAL 2NYYD 2PXYD 3H2WA 3VGAC 3B9AA 3QQ9D 4NKDA 4PJCE 3KXFB 5I74B 1V7NH 1IM3B 3QYCA 5EOCH 1FNFA 3DOSA 4HXAL 1LP9E 4M1CC 3V7AE 3KLAA 1G7LA 1RJYB 1EZVX 3ARFB 1S5HB 3UPAA 1R3KB 4KQ4H 3FB6A 4JAMB 4HFWA 5DJ2B 43CAB 2HG5A 2BFVL 2Y6SD 3C09B 4FNLL 1YEFL 3GIVA 1SYVB 5CP7A 1PLGL 4HHAB 4M7ZB 4ODHL 2GSIA 2DLEA 3V5DA 4KTEL 2HVJA 1A47A 4KUCF 3T2PA 2D7QA 3BXNA 5FGCB 3V4UH 5KAQF 1X6LA 3W0WD 1H9VA 4RGOL 3RA7H 1JV5A 2APFA 4JPKL 4PBVC 5DEFA 1JF1A 3ZTJH 3O2VL 3ORJA 3NIFF 4X4ME 3O4LA 5LGJA 5E6ZA 2HG5B 1BBDH 1MI5A 1F2XK 1TQBB 4YDVB 5HHQB 1NC4D 2DTML 5D1QD 2DBLH 5DZOA 5CEZH 5GZOC 1YNLH 5CP7B 4Y16D 3HE6C 3TIDA 1V3KA 1QRNE 1CFSA 2O5XL 4J3TA 5GGVH 3S5LB 4JFHE 1UJ3C 4NPYA 3V5DB 3MLVH 4HKBB 4V2CB 1MAJA 4NQVA 4NSKA 1GL4B 4BZ2L 3BXNB 4JFYB 1U8JA 2GJ6D 4JZNA 1I8MA 4NWTL 3V6OA 4KFZC 3NFSL 3MROB 4YHNA 4GS7C 5FO9A 4NM8L 4CMMB 3SE8H 1LO4L 4P5TA 1GVIA 3RVVD 1YN7A 1KLUA 3QZWB 3DX9A 4JGMA 4LLDA 5DJXA 5I17A 5EU5A 1JN6A 1CBVL 5I30H 3QA3A 3ARRA 3V0WH 1WUNT 3JWOL 5EUOB 1FSKB 1MWAB 5AYQA 2FBJH 25C8L 3HUJA 4DN3H 4KKAD 4DW2H 1FNSL 5EU3B 1JTOA 1NAMB 2NY4C 3OPZH 4X0KB 5TE7H 3QEHA 2IG2H 1RZGA 3LHPH 4OGZA 1FAIL 4XVSL 3BIBX 1NCTA 2OR8A 3O81A 4Y1AB 4YHNB 4P2RB 2BHZA 3QCUH 1RZJH 1JMXA 1FQ9C 4WRLA 5ESVA 1VCAA 1HIML 1NCCH 1MCEA 1YN7B 5LGHH 4G6ML 4I5BB 2XACC 4OLYL 4XVUD 3JBG7 4RBPK 3CZFB 1MIMH 1ROWA 1C5CL 5JPNB 3WFDH 4MX7A 1QR1A 4HBCH 1BIIA 1T5WA 3G5YB 4HT1L 3KPMB 3STZA 4QWWC 2EIDA 4AIZA 1UWEL 2YUXA 1IMHC 4HF5H 3CMGA 4NQTA 5EDXA 1T7VA 5ITFB 4MAYD 1OGAA 1IGFL 4XXDB 1NCAL 1T4KA 2AEIT 4PREA 4NO5B 4WO4C 1SEBB 1JWUA 2VDOH 3RKDC 1KTKE 1NFDF 3ARBC 4HC1L 2ID5A 5HYJE 1HOCA 1EJOH 1GZPA 3U46B 1FFPA 5DRWA 3CJJA 2BNQE 4L4VA 4D3CH 1U41A 4FQXA 1P4IH 3UTTD 4G6FD 1MEXL 5FF6A 1VGKB 2NR6C 3ZYIA 4NQED 4LLWA 5F1NB 1QR1B 4E42B 3H6JA 3WD5L 5HI4D 2JLLA 3WFCL 4OKVB 4QY8A 5EBWB 3SKJH 3HB3C 4KAQH 3VXUB 5M7QA 2FATH 2JJSC 1A7NL 3HCVB 3MLYH 4H88L 4Z7VE 3A6BH 2DWDB 1CK0L 3T04D 5IBUB 4JO2L 3KPSB 1CCZA 5JPMB 1X5KA 5DFWH 4HIIA 4FQ2L 1T4KB 5MEND 1NC2B 3STBA 4HKJB 4X98B 5D1ZB 3ZE0F 4OCSH 2Y07H 5ECJE 4RMRA 1UH3A 5GRVL 1FG2A 3QDGB 4JANA 2VDRH 4L4VB 1AXTL 4FQXB 4LRNL 5L8JB 4ZXBC 1P1ZA 5FF6B 3AC0A 5DI8B 3FONA 1CXKA 1HQ4A 4PTTB 4U49A 1H3GA 3QAZC 4BSJA 5CJQH 2YOCA 1TZIB 4WTXA 3QUMA 5DEGB 3VFWA 3OB8A 1L7TH 2EDNA 5FOBB 1FE8H 1E6JL 4NN6B 2DQCH 2Z31C 5LXGL 2P7TA 1NAKL 3TWCL 5CMAB 2XOTA 2YPLB 3WLBA 3JWDH 3QUXB 3AU1B 3J8F7 4DCQB 5CP3A 4FN0A 1Q0YH 1KCSL 4JANB 4JB9H 4HD9A 3T2QA 3AMLA 1KT2B 2RGSA 3C6LB 3VXTA 5E8DH 1LO2H 1MRDH 4JFZL 3OHXA 4UT6H 3BP4A 1R3HA 4LU5H 4XX1G 43C9B 4CN1A 4KTDH 4RFNB 1KG0B 5D7SH 1KPUA 5FM5O 3QUMB 5LG1A 2YD6A 4UOJA 1HEZB 1MJ8L 2H2PD 4HZLB 2CLVB 3O6LL 3VFWB 2F53D 3VWJC 5BVPL 4PJDA 5C09D 3DROA 2P7TB 3PGFH 4OLWH 1D5BA 3TH4T 3OKEA 4KKBD 3GSXB 1EVTC 4XCCL 4OSUL 1JBJA 2CLRA 2VIRA 1BJ1H 4UMGA 3QXDB 4FZ8L 1NUGA 4G9FD 1I1AC 5GJSH 4B7LA 3UP1A 1J1XL 15C8H 5AZEL 5D2NE 4DVRH 3HI5L 3KPQB 4BELD 3LN4A 3EYFA 5E00A 1KPUB 4F57L 3OKDB 2HFFA 5E2JA 1H5BB 5FGBC 4AEHH 5HPMA 5AZ2L 4XP1H 3KDMA 4YNYB 2YN5A 1QSVA 3W9DB 4W6XB 5IM7B 3I6KA 2ADFH 3QHFL 3DBXB 1HN1A 3LQZA 1OY3B 3QNZB 1ITCA 5FO7A 1OT2A 4QOKD 4MMZC 1UQSA 4NC2B 1QLEH 4FQPA 5EZOH 1XGRA 2BY1A 5C0AD 4WFHE 2W92A 3IFNH 4NC0B 2B1AH 3MRMB 3L5XH 2R2CA 1L0QA 2X2YA 4PRIB 3BKML 5B39G 3EYFB 4LSQH 5E00B 4S1RL 2AS5M 1QHOA 3CFJA 2AK4B 5AEAA 5I2IB 1A4JA 2FX8H 4P5KA 4Z7WE 3BIKA 5AYUH 1OCWL 3C08L 5J11B 1AIFB 5D7LE 2EH7H 1BJ1J 1HXYA 4QHLA 1RU9H 1XH3B 2OSLB 3CMOL 4LVHC 4PG9A 5J8OA 3HNVH 2ADGA 3I6KB 4U6VL 5CZVH 2ZPKL 4U1IB 3R0NA 5DJAA 5CAYB 1R5WB 1F00I 4XI5D 1TZHB 3S35L 1U6AL 1Q1JL 3MODH 1KCKA 2Z4QB 2GCYA 1RIHH 4X5WB 3LEYH 1ZHLB 4PJ8B 4KJWD 2VAJA 3DX6A 4P3CH 5GGUA 2C4FU 2IADA 1UGNA 1NJ9B 3TM6A 3RVTD 3N50A 4PGDB 4R8WL 4M48H 1C5DB 5INDB 3GRWA 1NLBL 4G6AC 2APTA 3BUYB 3CFJB 1H3VA 4P5KB 5BS0B 4YZFE 1G1CA 4JFDB 5F89A 4XPBL 1HZHL 2J88H 5DJYA 3IDYB 3GB7B 1AFVH 1D5IL 2OJZH 1YEJL 3RKPA 1OAYL 4RNRA 3K4DA 5A2FA 1IL1A 1Y18A 1NSNL 3KPNA 2Z9TA 1T83A 5I1DA 1KXTB 2FIKA 2P44B 5ICZB 3X3FH 5TH2A 3DX6B 2QSVA 4FFZL 3PQYB 3QIUB 5IB4A 2IADB 4YHMH 3T0VA 4IRZH 4BA8A 1NGZB 4KKLC 1KNOB 3GJEB 2AJXL 1LILA 5HVHB 2Z8RA 2DLHA 1P7KA 3H8NA 2BSSA 1G0DA 4M7KL 1L7IH 5DD0L 2Q3ZA 3WS6A 4PLNC 1YJDH 4K7PH 1U8OB 3ULVD 4P2OC 1N59B 4MDJA 2M1KA 4MSWB 5FAAA 1V7MH 1Y18B 1HXMA 3G9AB 3MRJB 3A6CL 5I1DB 3P11L 2V5MA 4RISH 5CKAA 2VL4A 1AI1L 1RZ7H 5H37G 4NHUA 5D5MA 4LHJB 3BKCH 5IB4B 3UPCA 2DI7A 4OV5A 4XWGL 3KXFD 3QUZC 3U7YH 3BGFB 3OG6B 5DVMA 3K1DA 1TZGH 1IGJB 5D4QA 1IILE 3DSFH 4A6YB 2PYFA 1P7KB 2V7HA 4X9GA 3F7YB 3I3BA 3C6SA 5EZJA 2L0DA 2DYPA 3ROOA 1RVFH 2DTSA 1U95A 5ESAB 3B5TA 2NY5H 4MA7H 4JN1H 3RUGB 1FPTL 1OAXL 1OSPL 4MWFA 2XPGB 3OGCB 4XWOD 5GS1C 2NXZD 4ZOAA 5AAMA 4HH9A 4PGBA 1JYXA 5EIVA 4PJCA 1K3ZA 3MYJA 3CK0L 5IB2A 1JPGB 1F4YL 3C2AH 5JTWA 3CZJA 3MV7E 1LP9A 4OQTH 4WW2B 3MTRA 2A38A 4F58L 1T1YA 2CMRL 1KTLA 3RI5F 1JGLH 4I3RL 3WJLA 2XT1B 1T20A 3G6JF 4R7NA 1NGXB 3PV6B 2PYFB 2YD4A 3WE6A 1MHHA 5L9DH 4OZGE 5GISH 5L2JB 4KDTC 4MWFB 5EA0H 3IAPA 4P48A 4IMKC 4HH9B 1CXFA 2VDLL 1NUDA 2CGRL 4MGXA 2EYRA 3VXQB 3IJSB 2V17H 3KR3L 3H9HA 1FBIH 3HPJB 5T1DL 4WEBH 1JZ3A 5EC2B 1ZTXH 4ODVH 2E7MA 4X4MA 4AZ8A 2XWJB 4DZBA 3I6LE 1C08A 1ZLUK 1CLZL 1J10A 1T20B 4D9QE 3LQMA 4KI5C 1BMGA 4NO3A 1JRHI 3SKNA 2FX9L 3ECBA 1KV3A 4M6OL 4BFIA 1CL7I 5E2WH 3O4LD 4XC3L 4ALAH 1MI5D 3FOMB 3Q2CA 5HGDA 1KTDA 2FJFA 2EDDA 3B2VH 1QRNA 2F19H 1X7QB 3DUUB 1YEHL 1WWBX 5EC1A 2DLTA 1FH5L 2BXZA 4ONGH 3RPKA 4C55A 2OZ4L 2XWTA 1EEYB 4KXZH 4KDWA 1WLHA 1R24B 3OKYA 2OS7A 1DQMH 4ZO7A 5D96B 1YN6B 2LFGA 4JHWH 3AY4A 2R29H 3DV6A 4ZQKA 1ED3B 4Z8FH 2HJLA 5SWZE 2XTJE 1C08B 4P5TD 4WUKL 4NZJA 4K23L 3O3BA 3RNKA 1QFHA 1XGYL 2VLLA 2ZCKH 5ADOH 3BD5A 4HC1A 1HKFA 2PO6A 1J88A 5JIKA 4FS0A 1KTDB 4PGEA 1QRNB 2QQQA 2JTDA 3MLSH 4YAQB 3IDXL 3GO1L 4WCYH 1XF4B 2P43B 5JIHA 1YEIH 2EXYD 2H6PA 1XIWC 5I8EB 4MQXD 4WY7L 4LARL 3DV6B 1T22A 3K2UH 4XCNA 3KYOA 4MNQB 4JY5L 3WNLA 3NMEA 4PJ9A 2HJLB 2YEZA 1OP5H 2V2WB 2R0WH 2JK5A 3QPXL 4DGYH 3WN5A 2I60L 3GMMB 2XI9A 2VDNL 2DQGL 4U6XB 5GGQL 4AY0A 4PV8B 4XX1E 1DVFA 4GRLB 3SN6N 4BH8A 4YXKL 3AREA 2J7LA 1HKLH 3NZ8B 1CFVL 2H6PB 1OW0A 2R8SL 4NZUL 1OGAD 5F8RC 1URLA 3H7BB 4MB3A 3VGEA 4NKOB 1T22B 2H2SC 2DLIA 4LQFL 2BNQA 3M8OL 1IFHH 4C57C 4GRWE 4L3CB 2ZUYA 3S4SA 4RAVB 4J3SA 1IGIL 2JK5B 2ZUTA 1HH9A 3UYPA 3MJ9H 4FQXD 1A7OH 1KC5L 1IGCH 4RFOH 5TQ2H 3K2MC 1Q38A 4Z7VA 3O6FB 1AKJA 3M45A 3SDXE 4M9PA 5ILTH 4ODWB 3TVMA 4FQQB 5JLZB 5KOMC 3TGXA 2EE9A 4LASH 3IT8D 3NA9H 1QZ1A 4FXKB 5EIIA 5H8DA 4JY6A 2HMIC 5BJTA 4X7DC 5HYJB 1B6UA 1ZA3A 2BVYA 3I75B 3LKOA 5I1GL 1E6OL 1WICA 1CFQB 2BNQB 1XGPB 2FJGA 3PGDA 2B4CL 1INDL 2BRRH 2DICA 5SWQA 1MPAL 1P2CA 3ZKND 3RY6C 4U6HA 5D70H 1XCTA 1YY9C 4X7EC 1ZVHA 4O5LH 3GMOA 3QUYC 4OZIE 1N5AB 5EO9B 3G5ZA 1CDJA 1AKJB 4WUUE 3RI5K 4FZEL 3TVMB 4GRMA 5DD6A 4OF8A 3KYMA 2FH6A 5GGRA 3TJHD 5CBEB 3D2UD 4R4NC 2BVQB 3RWDA 2F5AL 1OARH 2NW3A 1FL6A 4H1LG 3HE6B 4JY6B 4L8BB 4A2MA 5I19H 5IWLA 3IU3A 3QPQD 4IJ3C 2AKRA 5C70A 1J1PH 4YDJB 4H0IA 3S36L 1BOYA 1NGYB 4IRSC 5F7DB 4LCCC 5E1HB 4GMSL 3D39B 1ETZA 4K9EL 1MCJA 4P23C 1EBPA 4BH7B 3ULVF 1QBMH 2XWBA 3WJJC 3QXAA 5ANMB 4LFHD 4GXUN 4EN3C 1CXLA 1LQSR 4GRMB 2Q76A 4I4WA 5DD6B 5JQHC 4NT6A 5JW5A 5J6HA 2DAVA 4NQDE 5D71L 1FL6B 4LCUB 3BN9C 1OP5K 1GAFL 2VITB 1CT8B 2FB4L 3LZFL 1NGWA 4KQ3H 3QJFA 4ZPTB 3UC0L 1CG9A 4HUMB 1ZS8A 5AD0B 4L3EE 3C5SB 1KIPA 3IDJA 2NNAA 5DJ8A 4HIJB 4O58H 2I24N 5D2NA 3F7VA 5C0CE 4TPRH 1SBSL 2CK2A 3FQWA 1DUZA 1JPSH 1ZGLB 3NPZB 3HC4H 1ORSB 3HE7C 1J05A 4NP4L 4PG2A 4PP1D 5J6HB 4AK1A 3ARPA 3GNMH 3QWOB 5L7XH 1CE6A 2VKWA 1G7HB 4M1DL 2QTEA 1FFOB 1FZMB 1NGWB 1JYVA 3QJFB 4YXLL 4LLVB 1NBZB 1M4KA 3ULVH 2KL6A 3TV3L 5DD5L 3ZTNL 5I8OH 3CX2A 4TVPD 1HQRA 5IJKA 3CX5K 1A9EB 4WO4B 3X12A 3MLZL 3OJVC 1I7ZA 5DURB 3N85H 1E27A 2P1YA 1U8HA 3BSZL 3FMGL 4GG8A 4Z7WA 5IUSA 1LDPH 2X09A 1YUHB 3QO1B 3KJ6H 3DUHA 4X5LA 5D7LA 3WIHH 3D25B 4WDIA 3WLWC 3K8LA 1P4BL 3JVGA 4YX2L 4GAGL 4K8RD 5F7LB 5F7UA 5IFAL 2AVGA 4S2SA 1I3UA 2Z0BA 1R5VA 3PE9A 5E1AA 6CGTA 4YBQC 1WQVT 2IAMA 3LKPB 3L3JB 2XZAH 3VFMA 3X12B 1DQLH 5JMRA 4LSSH 4W6WB 1MFEL 5JNYA 4JM4L 4DVBA 3QHZH 2MQ3A 4OFYA 1I9EA 3EYVA 2XN9B 4U3XA 4M6NH 4WDIB 5F1IB 4V1DE 4M61B 1A5FH 5EBMA 1KN4H 1RZFH 3O4OC 4S2SB 3RWFB 3UYOD 3K1KC 3KPPB 5C0BE 5M94B 5KSUA 3GJFK 3TJEL 1F6AA 4YWGH 4LSVH 3W81A 3MRNA 4R0LC 5F3BA 1UKTA 2W91A 3MRFB 4G6KH 1IQWH 5J1AB 1YECH 2ZCHH 5FYKE 3HUJF 3O2WL 2O5YH 2GIYA 2QV2A 3QNXA 4LLQB 5EO0B 2J12B 1RK0A 1TETH 3O8XA 2EDWA 4Y4KC 5DJCB 5KSAA 2CXGA 5CLTA 4TVSa 3V8CA 3VWJB 2CH8A 1C1EH 3HC3H 4X6BB 1K5NA 2ICES 2W9EH 5KSUB 4GKNB 1VEOA 3MRLA 3GBMH 1J0IA 4LP5A 5LBSH 1MFDH 2UVFA 5DUML 2AJSH 2E6PA 1I9IH 1QVOA 2Y4SA 5JIPA 1I1AB 3SDAC 1S9VA 3MXVH 4P0DA 4Y2OA 3G9VA 1DQQA 3PGCA 3BHBA 1J9CT 1A22B 1TQCC 4XPFH 3MBEA 3QNXB 4MJ6B 4N90E 3SCMC 1S9YA 3HAEG 2DJ4A 4PY8I 1NGQL 3GIZL 2CRIA 3AB0C 4UDTA 2X05A 2N56A 5BW7C 4LPCA 3SOBH 3E8UH 2DYPD 5I6XB 4UTBH 4PRBA 1RUQH 4RGMC 3TIEA 3ZHLA 1T0MA 2O93L 3QIWA 2OR9H 3HZMA 3G08B 4GAJL 4X4YB 3MV7A 2W65A 5FXCH 3ZT6A 5GS3A 3V5HA 2I07B 2VLRB 4X6FB 3ARSA 4ISVB 3VA6A 5C9KA 3HNTH 3C60A 3GMQA 2OZ4A 3OTTA 5KS9E 1NCBL 1EGJL 1D6EB 2X70A 1S9YB 3UAJC 4OZGA 1IBGL 2EH8L 3ETBF 3SDCA 1G9NC 3SBWC 4UDTB 4LVOC 3FT3A 1ES0B 3TIEB 4IHOA 5A43C 4LVHB 1FO0H 4YJZL 2V5TA 5KN5B 2YC1B 2VSDA 3MV7B 3TPUB 1IC7H 4AM0A 2EDFA 1ZLWH 3KPRE 5GRWA 3D9AH 3RWGB 1NLDH 1HH6B 4DEPC 1B4RA 1IZJA 3CVIH 3C60B 3GSUA 1YEEL 4GJTB 1YPZE 4M7LL 3L3GB 5T1MB 1B2WL 3L3IA 4J3XA 2P8PB 2I5YH 1H0DA 2VR9A 3AAZA 2RIKA 3GKZA 3OKMA 4O2CA 3RVWC 5LGKA 4YFDB 3BWAA 3OKOB 5EOTB 1S7WB 4IHOB 1BPVA 5CD5D 5T1KB 3FCTA 4XCYA 4P3DB 4NO2B 1A6VH 5C2BH 4JDZB 1MRFH 4KKCC 4WFFE 2N4IA 3T77B 5SWZA 2XA8L 3DMMB 3KPOB 1PG7H 2WBJA 3WHXA 2IFFH 1G6RB 3T1FA 4PJDF 7FABH 5EO1A 3SGKC 3MACL 4M6MH 3DIFB 1M6OA 3BEVB 3BWAB 4EKXA 4DZ8B 2PO6D 1H3WM 5FKAB 4HLZH 2FO4A 2R69H 3KPLB 1S7TB 1VSCA 3FCTB 4UBDD 4XCYB 3S37H 4CW1A 3DJ9A 4RGNE 3CFBA 1MF2H 1ZT7A 5KVGL 1CLYL 5J89A 5INCB 3X3GL 4C56B 3CU1A 5E03A 5F21B 1CGSH 1FGVL 3IB4A 4D8PB 1IC1A 3KYAA 4WI6A 3T1FB 2QQKH 4PJ9D 5J06A 4K7FA 3QUZB 4GAYA 2XRAL 3ET9F 4LSPH 3QXVA 4NKIH 4KK6C 2ZZUT 1NBVL 3NCFB 4MD4B 3RDTA 3ZE1E 3U4BH 2ARWA 4XPAH 5GIRA 5HI3C 1A9BA 3ZL4L 1U8NB 5JZ7C 1T80A 1C16B 1FV1B 1AGCA 1DVFD 2W0LA 3AM8C 2QBWA 4LAJH 4YO0B 1U2HA 3ARED 2HRPH 4OV6F 3RIAF 4RZCB 4WHTA 1WIOA 3QI9A 5FDWB 2GTZA 4KGJA 1CI5A 4XPTH 5K9KA 1BFSA 3MR9B 4XVJL 4TSCH 3U0TA 3DRQB 2CDFA 1S7QA 3BT2H 1T66D 1RIVL 3NGBC 4GAYB 3WSQH 3NTCH 2A6IB 2R4RH 1FVCA 4XAKE 3SDXA 1ERNA 5KSBE 1PDKA 1HHKB 1T5XB 2L7JA 3HG1E 3QUKA 4K2UL 2Z91B 4E9LA 5F9OL 1ZLWK 3TVMD 1ZWIA 5DYOB 3LN5A 2EICA 3DETD 3EO9H 3EHBC 3QRFM 4PRNB 1UH4A 4MXVF 2VN4A 3EYSL 3KAAA 4PJXB 4G8IB 5JW3L 5K9JH 3STLB 4NNXA 3QI9B 3ZDYF 4NQSB 5LCVH 3IFPA 5HHME 3RWCA 4GRWB 3WHE1 3ZTJG 5C0IB 3TCXA 3LH2L 4HPYL 3MOBL 1CR9H 1NH6A 2D7PA 2SEBA 1Z2KA 2JJUA 2HH0H 3AMKA 4XP4L 3V4VH 2HKFL 4OZIA 3TBYA 4Z0BH 4MQTB 1TVHA 4WUUA 2HFGH 2H26A 5B39A 4OM0H 1RJCA 4YUEL 1I3GL 3GM8A 5DVLA 1VKXA 2P4AB 3AGVA 3HI1B 2IANE 3VFTA 1E4XL 1ZWIB 1BOGA 3V52H 5DMJB 2B7DT 4JFEB 4FQLL 4GQPH 3OBAA 5HTSA 2BNUA 3N1QC 3CVHH 5IB5B 2EKJA 4BJLA 2A77H 4HXBL 2PW2A 2SEBB 2GT9A 1KB5L 1WBXB 2B2XH 5ALBH 1FYTB 4XPGL 1G9ML 3O6KL 3IDMA 3AROA 1NFIA 3MLRH 4ZYKB 3SDDC 2ZCLH 3K8MA 4DGIL 1UXWA 2H26B 3A67H 1M7XA 4NYLA 3DI2B 4ZUUA 3VFTB 2X4PB 2LV4A 5D7JA 4UINH 5L88L 3L9RB 4JKPH 4KHXL 5GRYA 2GFBA 4YHPA 1YNTA 3CLFH 5D5MF 4GQ9L 1R0AH 2ADJA 2F5BL 3T0EC 3X11B 2CDGA 3ULUH 5EU6B 1CD0A 6FABL 4GG6B 5MEOA 2C4FT 4KMTL 4J3UA 1BWMA 3E2HC 3EKCA 1UKSA 4G42A 4WW1A 5C0CA 2AABL 2DQUL 3MRHA 4JM2A 5I15L 3CDFA 3FB7A 1FVDB 1LO3L 1X6NA 1UM5H 2JJVA 4JQXA 4J12A 4Y4HC 3V6ZB 5SWSE 2ZSWA 4PJHE 4Y5XC 1F97A 4NQDB 3NCYP 2R4SH 2F8XC 1CLOL 4PJCF 1UZ8B 2GFBB 2IMNA 3RVXC 3OXRA 4YHPB 5K9QI 4WWKB 2ZJSH 4UUJB 1JPST 1LP9F 2ENYA 1LK3L 5IFHH 5AWNH 4GT7A 4MD0B 4L3EB 1A7RL 5HGAA 5GHWH 3ARGA 3S98A 4Q9CA 3BI9X 3LB6C 1RFDH 4WW1B 5C92A 2R0ZL 4PJAB 5HYQA 5C0CB 4OD3L 4NUJB 1UEYA 3IDUA 4H0HB 5I18H 2Q6WB 2HN7B 3TC9A 3JV5A 3AFLA 4FNLH 4PJBE 1G6VK 4OJFL 4P5MA 4I9WE 4MJIB 1MFAL 1NEZG 3L3KB 4Q0XL 5D7LD 1XZ0B 4NCC2 1T0NA 4EIGB 1FIEA 1NBYB 1QQDA 2IJ0C 2AAVA 2UWEB 1PG7W 1IC4H 2I9LA 1SM3L 2FHFA 3ARGB 1X5FA 1AXIB 3KVQA 2R23A 2IAMD 2Y36H 2BSTA 4XNMA 2DQDH 2OL3L 1DBJH 4FQCH 4JG0H 5BRZB 4HK0B 2DTMH 2F74A 2NW2A 3MLXH 2DMKA 4OFYD 1JWMA 3I6GB 2ORBH 4GOSA 2O5XH 3F5WA 3QUYB 4U2ZA 5ICXB 5HPOA 4NFBA 5DS8B 1HCFX 1B0RA 2FGWL 3DWTA 3OAUL 4DQOL 1U8KA 1S7VA 3DXAE 3SY0B 5B21A 3PG2A 3L1OL 1ZT1A 5C0BA 4QCIB 3PDOB 3NFSH 5IHUH 4ZS7H 3U36A 4OFVA 2APWA 4TULH 5KJRH 2ED7A 2BSTB 4EDXA 8FABB 4P4KC 1EA9C 5L6YH 4CVZB 3JWOH 4LIQH 5GS0L 1MCOH 3U79A 2VR4A 4Y4FA 5IB3A 1INQB 4GUPA 4P23B 1QYGH 4IMLB 5FEBA 3CSPA 2YR3A 3RNQA 4O9HH 1A4KA 1QKZH 4V1DB 3SDYL 4M8QA 3VCLA 4CUCA 2WUBL 3BUTA 2ICWJ 3C87A 1CFTB 1LHZA 1KBGL 3CXHJ 1B0RB 5D1XA 3WFZA 2PTTA 1S9WB 2WINA 4OLEA 5ID0B 4PRAA 4KRPD 4NO0A 3O8XD 5KSAD 4D0DB 5DEZA 4YHKL 4HUXB 1XF2B 3U36B 5CCKL 2CKBL 1BFVH 3WNMA 4LF3A 4Y89A 1OOAA 5DC0A 4G6MH 2UY6A 3Q3GA 4FQHB 3GSNL 1A2YB 2AXGB 5FYLE 1J86A 5FCUL 2P8LB 2CIIA 1MY5A 1QBAA 4HT1H 5I8CA 1QO3B 1MFCL 2VISA 4HMDA 3RNQB 1X9QA 5J3HD 1C5BL 1T6VN 5E9DE 3SGJC 5HHNA 1G1YA 2EIBA 3MBED 3HR5A 3U6RA 1FNGB 3HE7B 3OKNA 2A6DA 2A9NL 5IGXH 3TZVC 1U3HC 1VACB 3MV8B 3P0YL 4YC2C 1E4WL 1QFPA 3QIWD 4U0RC 2HJFB 3O3DA 5HHPB 3U9PL 5C9JA 2BSRB 4QRSB 1MEXH 5GGRY 5DHXB 1FZJA 4Z7VF 5FM5M 4ZUSA 5DK2A 3QG7L 1ZLSH 4F7TA 4PB9H 1DQJB 3WFEH 1ACYL 5I8CB 4ELME 5KS9A 3DRTA 4H88H 3C60D 5K9OA 4L5FH 4EVNA 1CK0H 3DX7A 1I1RA 3MRCA 1CGVA 1ZA6B 4HKZA 3H9SE 4M7JL 3CUPB 4JO2H 3U6RB 5FYLL 1VFBB 5FHAL 3CXHK 2XKNA 4FQ2H 3SDCD 3BKYL 3W11D 3LEVL 2NTSP 5FA4B 1U8IA 1U58A 3LSOA 2BOBA 3T3PF 1YYLL 3U4AA 1T89A 1TPXB 4JFXA 3CFKB 2AV7B 5F7EL 3TYGL 3PWUA 3PJSB 4XNXL 2GK0A 4HWEH 3O6MH 3FQUA 3P4NB 2BSED 5IEHA 4F9PA 1YPZA 3I6LD 2GEEA 3VFUA 4BK5A 4LPYA 4D9QD 5GGSB 3OAYH 1KFAH 4JKWA 2C1OB 3S7GA 2D0FA 5MERA 5CIPH 1NCDL 2B8OT 3HZVA 3KNBA 1CFNA 4Z7UB 4U1GB 4RFEA 5I16A 1NFKA 2VLKE 3SPVA 3MRBB 2AW2A 5JHLH 1JGVH 2E8ZA 5CJXC 4Z78B 2E8YA 4S1QH 3O9WA 4TOYH 5J1SC 2W9DH 1KCSH 3O4OB 3PNWA 4IOIB 3V4PL 1FVEB 3KPRB 1S5IL 3OZ9L 5DHVH 5JXEA 2VC2L 1A8JH 3QFJE 1CF8L 1V3LA 4LDLB 2Q20A 3W9EA 4M3KB 5DGRA 5SWZD 2BX5A 2XTJD 4LCYB 1CDIA 4PRHE 4R0LB 2WBJD 4NQCB 3MRQA 1DDHA 1R5IB 4F7EB 1MJ8H 5C0ND 4L9LA 4LRIC 1JHTA 5EOCL 5MERB 5BVPH 5F6HI 5CEZE 4H26A 3HZVB 1I75A 3FFCB 1CFNB 4G80A 1KLGB 1OTSD 1P9MA 4OGXL 4Z9KB 2NY2B 2E7CA 1BREA 1OB1A 1R6VA 4EZMA 2Y25A 4KQ4L 2YZ1A 4JHAL 2XNAA 3V0AC 1OSZB 1HI6B 4H1LA 4Y2DC 4F15C 3MV9E 1WISA 3AS0A 2DQFA 1J1XH 5MEQB 3OKLA 5J6GA 3P9MB 5T33L 4JE4B 3WNNA 1JZ8A 2ZOLB 3TA3B 2HT4C 3X13A 4C4KT 4C59B 4X8JA 1T1ZA 4U0QB 4F57H 1DDHB 1NKRA 1RZ8B 1N5YH 4L9LB 4QYOA 4JGUA 1YEKH 3V4UL 1CDYA 3RA7L 2FL5A 5F9DC 1YEDA 1F13A 3EOYG 5J9PA 4G80B 3VFOA 5CZXC 5DQDH 3RDTD 4EXPX 1W72L 5BZDA 4YDKH 3EDEA 3NCMA 5ENWA 1YC7A 1BBDL 3NIFE 3S97C 2VQTA 3LD8C 4H1LB 5HVFB 2DBLL 5CEZL 1YNLL 5EUKB 4R97C 2V5RA 5B3NA 5IEKA 3BH8A 3QI9D 4Z7WF 5E6IC 5GGVL 2A73A 1MJUH 5JW4N 3FRPA 3MLVL 1MCCA 1OAKH 1T1ZB 4MDIA 4HDIA 4P59H 5MEPB 2IF7A 3HZKA 4OCLC 3REVB 3VFVB 1A1MA 1X5JA 2QSCH 5KSBA 1KCLA 3S6CA 1OAZH 4WHYH 3SE8L 4MNHA 1P5VA 3HG1A 5GRVK 5EBGA 5J9PB 3DO7B 2ADIA 1EEZB 2HLAA 2GY5A 4U6VH 1X5HA 3VXME 1UA6H 4PJEB 5AG8A 4FFYL 1Q1JH 5I30L 1LEIB 1Z0MA 4BYHA 1AR1C 1ZHKB 3V0WL 3BGMA 3P30H 2FBJL 4LVOB 2E6QA 3I2CH 4DN3L 3OAYK 4DW2L 1F3DH 4KVNH 3OPZL 2JIXB 5TE7L 2IG2L 1BLNB 1RIUH 3SQOH 2BCKB 4DEPB 3QCUL 5T5FH 5FDYA 1RZJL 3EYOB 3HG1B 1NCCL 5EN2A 2IANA 4WUUD 3RPIB 5LGHL 4YK4B 1KB5B 3KPTA 3HLAA 3MREA 4PTUB 1MIML 2Y9RT 3WFDL 4HBCL 5TPWL 3IVKB 5HHMB 2UUDH 5HYSG 5JW4Q 4HF5L 4K3EH 4N1EA 4NRYB 2QHLA 1IC5L 4WI4A 3ZO0A 4QT5A 2AJXH 2FX7H 4P4RB 1XGUA 2NTFA 3VXRE 3PL6A 1CICA 1TNMA 5C0FA 2R1WB 1WIUA 1CD1A 2M8XA 5CJ5A 1EJOL 2MFNA 1N2RB 2O26U 3VFPA 3BDXA 4AG4H 3GKWH 4JPIA 4BSWA 2H32B 1NFDE 4D3CL 1P4IL 2QR0B 3O3UN 5I75C 1AH1A 2AEWA 3BISA 4XH2A 2R2EA 1M7IA 3GSWA 2C7UA 3PWJA 5D7JD 3A6CH 2AQ3A 2PXYC 2ZNXA 3PWVA 1GC1H 4HIHA 2C3XA 4KAQL 3TBTA 3QQ9C 2FATL 2VXUH 4BKLA 3MLYL 3ZT5A 2HWZH 3A6BL 3DUSA 3UZVB 3OJMB 1BZ7B 4MNGE 5E95B 1B6DA 3K74B 4K7PX 5DWUH 1S7XB 1CICB 3G5XB 4E41B 1A1OA 1Z5LA 2Y07L 4JM2D 5SWSA 2BMKA 2ERJC 3VXNB 2Y6SC 4PJHA 3M07A 2FR4A 3MRRB 2VDRL 4JPIB 3U0WH 4N8PA 4RRPG 3S8WA 3MNZB 2R2EB 3CFDB 1G7JA 4F2MA 1AD0B 1XMWA 4RMVA 2OL3A 5CJQL 2D7MA 2XY1A 3T8XA 4HIHB 5EZLA 4XNQA 4QXGH 3EJZD 3ESVF 3PWLA 1IM9A 5H2BB 5GRXG 3L5WB 2CMRH 4U1HA 1L7TL 1MLCA 4LDEB 2C1PB 4PPTA 1FE8L 1I8KA 2DQCL 1CQYA 4EQ3A 4I3RH 4YPGA 4HIXH 4M02A 4X6DA 3TN0A 4OZGF 4CAGA 3LCYA 3JWDL 1BD2A 4PJBA 4O2FA 2Z35B 1Q0YL 1AR2A 4JB9L 3OL2A 4CGTA 5HI5D 2FHBA 3O11A 3NGBB 4LCWE 3L3HA 4U1JA 2YWZA 4S10A 1T0PB 2CO7B 4Y16C 4Z76A 3PIQA 5FA3B 4QHUA 1UJ3A 5E8DL 1MRDL 1G7IA 3HAEA 2R2HA 4UT6L 2EDXA 4FABH 3VXSE 5D7SL 2P46B 2VWEE 3BP7B 4LNVA 2DQIH 4ZUWB 2VL5A 1WCBA 3RVVC 1YMMA 2BY3A 4MD5A 4UB0H 3PGFL 5DQ9A 4OLWL 2VDQH 1DCLA 1SJHB 5JHDE 1U93A 4U1SA 2BOCA 2NY0C 1Q94A 4QTHA 2YD9A 3O3AB 2CKBA 4HV8A 4LEXH 1FLRH 3VXPB 4OF0A 3TESA 1W0WA 15C8L 3ARVA 3D0LB 3HAEB 4DVRL 3DXAA 2X1OA 3GSNA 2JB6A 4NGHH 3GHEL 1BVKA 1IAKA 1DEEA 3U2SA 5E94A 2AEQH 4JZOA 4PJ7A 4AEHL 5C0BD 4I77L 4XP1L 5JQ6H 2D7NA 1VEPA 2GUOB 5IMKA 3D48R 4WUKH 4WI9A 2OTUB 2ADFL 4ZOEA 5KANG 1UZ6E 1XGYH 2X5PA 5IESH 4G43B 5BV7H 4QTHB 4U6TA 3G5VA 3I02B 1MIEH 4OFPA 1HILB 5IQ9B 4HV8B 5SX5K 1YQ2A 4Y4FD 3DSNA 5EZOL 1W0WB 3SDDB 3IFNL 3GO1H 4MA8L 1MHEA 2FEDD 1TJIH 1U0QA 2B1AL 2CRMA 3L5XL 1FZOA 1TFHA 5A3ID 4MAYC 3LQAH 4LSQL 4S11A 5D1XD 1DEEB 3ARBA 5E94B 2FX8L 4JZOB 4NO0D 5BXFB 4FOMA 1D3CA 2XKSA 4JY5H 5ELIA 2YS4A 3T0EB 1BP3B 3ARZA 1MHCA 2EH7L 3I85A 5IMKB 1RU9L 4N8VG 1K2DA 2X9XA 3HNVL 3BPCB 4LHUG 4ELKB 4F7CA 1MH5A 3B83A 3E2HB 3MODL 3W0WE 1RIHL 3DX8A 4UU9B 2VE6B 2DQGH 5GGQH 5HYEA 1KCVH 3INUL 3FZUC 3QO0B 5E9DA 4KY1H 4YXKH 3L7EB 4P3CL 1HHJA 4N90D 3BZFA 5DHYA 4M48L 5ABDE 1EHNA 1HSBA 4JFQA 4KJYA 5DK0B 3GSQB 4LQFH 5IVXA 1UH2A 1JK8A 5A1AA 1CDGA 4ZXBA 1K2DB 4FQ1H 1AFVL 4M93C 2OJZL 4NNPH 3VFSA 5CSGA 1KC5H 3SDXF 1IAIH 1CU4H 4ZDHA 3L95B 4ELMA 3TFKC 4Z6AT 2D3VA 3UDWA 1DFBH 3MO1B 3X3FL 1U3ZA 3NPSC 4LEOA 2KH2B 4U7KA 3THMH 3DVFA 1EMTH 4I0CC 4JDVA 1FFNA 5CJOH 5DHYB 4N1CA 4DOHE 4YHML 4UV4L 1BQUA 4IIQA 5DQJA 1UB6B 1WZ1H 3MRPB 1DBKH 3VD9A 4XCFH 1Y6NR 1CQKA 4JFPA 2H9GB 3P4OB 2PR4L 1JNHA 5ESQB 2CR3A 4BM7A 5IMOA 1INDH 1S9XA 1MPAH 5IG7A 3EJJX 1L7IL 1K9TA 3TNNA 4OZIF 4K7PL 5CSZA 3BPNC 3D18B 1V7ML 3PXJA 5EU7E 5EWIH 2HFEA 4RISL 4FZEH 3MUGA 2OI9C 1EFXB 3H9SB 2Y72A 1RZ7L 2H2PC 3C8KA 2ARJB 3BKCL 4IRJA 1KPVB 3UBXA 5E2TH 4KDVA 3U7YL 4IIQB 1A6TB 2VLKA 1TZGL 2IALB 5F9JB 4HGKC 3UYRH 3HC0A 4I2XB 3DSFL 1IAOA 2GI7A 3RTQA 4RIRB 5IMOB 1PQZA 3QFJA 4HMCA 2DQJH 1NANI 5IG7B 3RBSA 4J8RB 4NFCA 2FEEL 3O9WD 1QSFB 5CD3B 5ALCH 2NY5L 4MA7L 4JN1L 1KUMA 2R15A 1X5LA 4WFFD 5JXED 4P46C 3F12A 3OAZH 4PRHA 1PKQA 4OF6A 1W72A 4KROB 4MQ7A 4OLXH 4A2LA 3FQRB 5A40E 4P4KB 3T0WA 3UTTE 3C2AL 1AHWA 5FK9B 2P5EB 4UQ3A 1O7VA 4OQTL 4IRJB 1MWAH 5I1IL 4QXWA 1V8HA 2EDRA 5D71H 5AUMA 3CFEA 4GW4B 1U92B 1JGLL 2DWEA 4CVXA 1PZ5B 1IAOB 3MGAA 4KHTH 3MV9A 5L9DL 4RGND 4QRQA 2CLZA 5GISL 3I84A 2ATPB 3IS1X 4JM2F 4RDQG 5KW9L 2DQTH 1PYWA 5EA0L 1UB5A 2YXMA 2EDTA 1MJ7H 3U30B 4OCRL 1U8PA 4MQ7B 3WDJA 4OB5H 5E8EA 3HPLA 3PUCA 1AHWB 2V17L 5EPMA 3RL2B 4MCZB 4I48B 2O5ZL 1FBIL 4JO3H 4WEBL 1G0XA 1NMCC 1ZTXL 4LP4A 4ODVL 1BEYL 4ZS6D 5E8PA 2XYCA 1Z9SA 4XP6L 1TVBB 4ODBD 4XI5C 4YBLC 3VG9C 3ZKMD 4LVEA 2VB5A 5E2WL 1U3HB 2BVPA 3U4EA 5HYFA 1PYWB 4KJWC 3RGVB 2F19L 5DR5H 4XBGB 3EDKA 1V05A 4QHKJ 5TDPB 4U0RB 5EU4B 1U8PB 4MB4A 2D03H 4ONGL 4WV1C 1JGDB 5FECA 4NRXB 1DQML 2NXYC 1GRWA 4JHWL 4HK3N 2WMPA 2R29L 4XAKD 3B3IB 1UVQB 1ZKAA 2G60H 3GMRA 4ZNEE 1W0VB 2ZP0T 3VXMA 1UXSB 4HLJA 4I13B 4X6EA 2DM2A 1MUJB 3E6FB 3DGCR 4LKCA 5D6DA 2NMSA 4XC1H 1S7SB 5I71B 1QPXA 3EFFB 1S3KH 3UTSE 2ZCKL 1OP3H 1K8IA 4JG1H 1A6ZA 1G7PB 4X7TB 1T21B 2B0SH 5JO5A 4LPTA 5D9SB 4PR5B 3MLSL 1FFQA 3LMJH 4G9FE 2A6JA 1R3LA 3PWPE 5FECB 1XCQA 4OZ4B 2XFXA 5J0BA 1OQOA 3K2UL 2IBZX 3ALPA 3MRDA 4P2OA 2R0WL 5T5NF 4CJ0A 2IAND 5HGHB 1BZ9A 4AEIH 3GMPA 1WFUA 4DGYL 4MVBD 1F5WA 4TTDD 1KIRB 3OAZK 4CDGC 3S88H 2YD3A 2QSQA 4YHIA 3QG6B 2IPKA 5DK3A 5B8CA 4C83B 5I74C 1OD7A 4NUGL 1HKLL 4QOKE 2Q86A 4R3SB 3H0TA 4GAFB 4B53A 3F65A 4CU7A 3VRJA 3EJYC 4JO4H 3P73B 1B0GA 1CICD 2BNRE 3PL6D 5D7KE 2X4UA 5JORA 1IFHL 4HEPG 4AT6A 1DBMH 1RHHA 3DNKA 1GJIA 3IAGC 5GS1A 2B1HH 2E9WA 1NEZB 4AIOA 1A7OL 1IGCL 4BFGA 5TQ2L 1AD9B 4UAOC 4MHHI 1AQDB 4YR6B 3AXLB 3OJDB 1VADB 3JV6B 1GZQB 2PCPA 5ILTL 4JLRB 1LO0H 3BQUA 3PHOB 4ZODA 4MNGA 4LASL 4F15B 3NA9L 3VXRB 3FOLA 5C6WH 4XZUA 4FXGB 3VWKA 1IAMA 1INEH 3CH8A 1MCRA 2G75A 1JE6A 2EZ0D 1D9KA 1WWWX 3NN8B 2X4UB 5JORB 4LFHG 4YHYB 1NFDB 1ZVSB 2DRUA 2BRRL 3MLWL 3MNWA 5SWSD 5HDLA 1MJJA 2JF1A 4ONHB 5D70L 4DUWA 4OZFH 2VQ1A 4O5LL 2LU4A 3E6HB 1AGFA 4ENED 3QULB 2HTLD 1Z9OA 1RUML 4PRDB 5DDHB 3SKOB 1F90H 4HKXB 1CVSC 4OIIH 5KS9F 5TF1H 1IM9D 4WTZG 4UQ2B 4R97B 4EXKA 4XZUB 3RY4A 5I19L 2VRAA 1RZKC 5E6IB 3TN0D 2ILLA 1BF8A 5DJDB 1J1PL 3VG0H 1BD2D 2VDML 5CBAA 4LCWA 4UI2A 3CCHB 4W4OC 4I9WD 4N5EC 4QXTB 1OP3K 2KQNA 1F8TH 2CDEA 3HHRB 1FSKC 1X5GA 5D7IA 1BVLB 2WIIB 1II4E 1AC0A 1QBML 2VQ1B 4J3OC 5ERWB 3VXSA 5HHOB 3DYPA 3B9DA 5IFJA 1CN4A 3ULVE 1OF2A 2IQAB 5GS0D 4TUJA 2EYSA 1YPZF 3V6OC 3B9EA 5I1LB 3D6GA 3B6SB 1B90A 1YEEH 2V2TB 1YMMD 2X4QB 2PKDA 3UTZB 4KQ3L 4CNIA 5ACZB 2D7OA 1U8LB 3GK8H 5SX4H 1X4YA 4U3HA 4WHDA 4O58L 5I1AA 2RAMA 3U0PB 2ITCB 1OPGL 2BVEA 4TPRL 3EW3B 2EXYC 3QEUB 2NY4D 4NIKB 5TGBB 3U9UB 1XIWA 3WL9B 3DXAD 5FKPA 1JPSL 3HC4L 1S8DB 4MQXC 5IFJB 1OF2B 1RK1A 1VDGA 1BBJA 3T2NH 3CDGA 1AGDA 2VH5H 3O45A 4BK4A 1T03L 4NCC1 5JHDB 3GNML 3ULSB 5FO8B 5L7XL 5TQ0H 5IW6B 1T04A 3LS4H 4PY7B 2YMXH 4JKMA 3OQ3B 5I8OL 4JQIH 4UT9H 3RGHA 1ZE3C 4MZ3A 1XGQA 4BUGA 3KWWB 2AJ3B 2X6MA 1DE4B 1PG7X 3N85L 3QNYA 1NGPH 5IOPA 4OLVL 4LVNB 2EDYA 5DRNB 5I75B 4Q6IA 5B38B 2IGFH 3KJ6L 4FMKA 1E4KA 3WIHL 1B3JA 3LAFA 3ARBD 3RKDD 2BY0A 5D1ZC 2PXYB 3Q5OA 3DTXA 2Q7YA 3TO2A 3ELAT 4G8EA 1T04B 3MNVB 3BP5B 3ZE1F 1FJ1A 3W0WA 4FQXC 4KWUA 5FYLD 2AGJH 3VRIB 4NKMB 1PSKL 1RMFH 4GKSA 3H9ZA 4A6YH 4NDMA 2XZAL 2ATKA 1DQLL 1F11A 4LSSL 1KACB 1MQKL 3GSRA 2EEDA 2ERJB 4QHNB 5E9DD 3KYKH 5BZWA 4H8WC 1N8ZB 1OAUH 2XTLA 3BW9B 5KSVA 3C9NA 3O4LE 3QHZL 3V0VA 5HY9B 2CR6A 4NN6C 4CDHA 4EBQH 4M6NL 4TSBH 4N0CC 2ESVE 1G7MB 3EO0B 1PFCA 3TO2B 1AGBB 1KN4L 4CN4A 2JCCE 1RZFL 3ZKNC 1XF5B 5KSBF 3IDGA 4ZXBD 3W0WB 4AQ1B 1H3UA 1RJLA 4LAQH 3VH8A 5EBLB 3C6LC 3RRQA 5LQBH 4JHZA 5JOPE 4YWGL 2ICEA 4LSVL 4EQ2A 2OXHA 5BQ7B 1RSFA 2HVKA 5J4MA 4RFNC 1K3IA 1PEZA 2QADD 3KJ4B 3TJHC 5GJTH 5JA8B 4G6KL 1Q9WA 1IQWL 5ID1B 1NC4B 5D1QB 5J13C 4OZHE 2FECL 1YECL 2MWCA 2ZCHL 2XG4A 3EYSH 4Y16B 5JW3H 4F7MB 4IM8A 5DT1H 2O5YL 3JTTB 1MCWM 4U31A 4N0FA 3D69B 3GUTA 1IEAA 2WANA 4LCCA 1X5AA 4OQTA 1TETL 2GJ6B 3SE4A 1JFQH 1MREH 5I1HH 3ZZ1A 1C1EL 3HC3L 1V5JA 5FM8A 5SV3A 1WBYA 2W9EL 4K94C 1F3JA 1Y0LA 4YUEH 3GBML 3JTSA 4JVUA 5LBSL 4DOHB 3E1F1 1MFDL 4DUXA 2FSEA 2AJSL 4DKEH 1I9IL 4I8DA 3ROLB 2PNDA 4C58B 3MXVL 1KJ2L 4IRJD 1WC7A 4UV7L 1SJEB 2CIKA 1B0WA 2VLKD 5CFHA 4WU5A 2IC2A 1J12A 5KG9A 3TT3H 3F7RA 4HXBH 3PABB 2VERN 2B20A 1A6AB 3RTQD 4M1GH 1LE9B 3QH3A 4ETQA 3QFJD 4XB7A 3SOBL 2EKSA 1QG3A 3E8UL 4R2GD 4LMQE 4UTBL 1RUQL 2OR9L 5CJ8A 3GSOA 5D6CB 4PRHD 1F3JB 3I3DA 4Y8DC 4ZO6A 3VJ6A 4U1KA 4PP1C 5D8JH 3VFRA 2VLJE 1CWVA 5CEZD 3WMSA 4N5UA 1WC7B 3O2DH 1HDMB 3HNTL 2CIKB 3L5IA 1T7XA 5IJVB 4WU5B 2X9WA 1M71B 3D3VE 4KMTH 4MAYB 1MFNA 2X7LA 1N6QH 1KF9B 3MGTB 2YSSA 4ZAKA 4ZPVB 2A83B 1CXHA 3WFHA 2J5LB 3MV9D 5HXMA 2O61A 4HX1B 2NLJA 5HYSA 3VXOA 2DQUH 2GAZB 3BP6A 5HJ3B 1UWXH 4PJHF 4TNWK 2JELH 2IWGA 1ZHNA 1FO0L 2X4SA 2UZIH 4NNYA 3UTTB 1I4FA 4FFWD 4G6FB 1IC7L 4HUUB 4NQEB 4LDOB 5GSRA 5T1LA 4UNVA 4PGJA 2WWKO 3D9AL 1K85A 1Q9LA 1NLDL 5SV4A 5E5MA 3CVIL 2X1QA 4K8RC 2W60B 2ITDB 4Q9RH 3IDYC 4HWZB 3LY6A 4QHMB 2V5SA 3BDBA 2X7LB 3G6JB 3N1MC 5MENB 5C6TH 2I5YL 3GHBL 4X6DF 3NFNB 2K7PA 3MRGB 2LAAA 1LEGA 4PJBF 4WJ5A 4O51B 4LLMA 2PW1A 5TE4H 4J3VA 2X4OB 2YBRA 3QIUC 1R3IH 1ZHNB 3N1PC 4WI8A 1KLFA 1A6VL 3T4AB 5H94A 5C2BL 4JKLA 1HHGA 4ZNEA 4FP8H 5HVHC 2K9UA 1PG7L 2IFFL 5E5MB 3NPSB 4RRPA 3FN3A 3VXMD 3TPKA 3UTSA 3OR7A 7FABL 1NDGA 3W39B 1D5ZA 1QFWH 1GGBH 4U2YA 3IFLH 4M6ML 2VZ3A 1T83C 4PJDE 4X7CC 4JRXE 2R69L 4G9FA 3BZ4A 2DQHH 3PWPA 3S37L 2PUQT 1MF2L 3HZYB 2VZVA 1HHGB 4XGZA 5IF0B 4TRPH 4JN2B 2GTWA 1YDPA 1BQLH 1CGSL 2AJUH 4Y4KA 2CPCA 4DQOH 1F42A 1H3PH 2QQKL 1JNLH 4PJ7F 5JUEH 2MCG1 1MCBA 2F53B 3WS6C 2P8MA 4P2OD 3T0AA 4ZUVB 5C09B 2VR5A 4MCYA 4P9HC 4LSPL 4NKIL 2BXYA 4R90H 3RZCA 4RWYH 3U4BL 4DAGH 4XPAL 2NX5E 3C8HA 4NJAH 4U1NA 1W2KT 3RY5A 5E8NA 2RBLA 4G9FB 1EV2E 3ZDXE 2OK0H 3BZ4B 5C07E 1ZLVK 3VE0B 5LJYH 2HRPL 2BNRA 2DMCA 3QDHA 3SCMA 2BVOA 2F58H 1FL5B 2M26A 4NHCH 4N9GA 4NFDA 4XPTL 3IETB 1KB9J 1J0YA 4TSCL 1NDMB