1BOYA

Extracellular region of human tissue factor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
TTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the extracellular region of human tissue factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Class 2 cytokine receptor
molecule keywords HUMAN TISSUE FACTOR
total genus 44
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 1996-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1boyA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1boyA02
1C12A 4QXGH 4WW2C 2OZ4A 5IB2B 1UM4H 3CCHB 2DI8A 2EDDA 4LCYA 4LSTH 1CVRA 3DMMC 1LK2A 3ORJA 1CU4H 2E7BA 1CDUA 3QEHB 3IDYC 3HC3H 3TA3C 2DLTA 5I1KH 2FYYA 4NNXB 4X5LA 5HHOD 2A6IA 5MEOB 2X41A 3D2UB 3VGEA 3QXTA 3THMH 5F9AC 3LZFL 3WE6A 3G5VA 4GW4A 4ZQKB 5F8RC 1DBBL 4X4XB 4JHBA 4JFDE 4U1GC 4B50A 2A9NL 1HHIA 2GJ6D 1C08B 4OI7A 4XP1L 4QRUB 4HWUA 3MRKA 1LEIB 4YDIH 4UB0H 3CGTA 1V3MA 4NZUH 1IC4L 3MOBL 4WO4A 1H5BB 2LAGB 4RFOL 4ESKA 1R3HA 2VXQL 2B20A 4X99B 1I8IA 2NY3B 4Y4FB 4K3JL 5BXFB 1I3RA 4G7YH 4UMGA 3OMZA 4XWGH 1CF8H 3MYJB 3SOBH 4XXCA 3MRFB 3QIBD 3ZSTA 1QSFE 5DHVB 1R3HB 2OS7A 3ALPA 2RFXB 2Y5TA 2MOVA 3QUYD 4XMLL 1M7IA 3RWDA 3HE7C 4YAQB 1JPTL 5F1IB 3L9RB 1DTUA 3CD4A 3LD8B 4YBQD 3D3VE 3CIQA 2EYSA 5C08D 4NQCB 5CILH 3EW3B 3MBEB 1XCTA 1JN6A 1YEFH 5FA3A 4BZ2H 1KB5A 3SDAC 1EJOL 5TQ0H 5DHYA 2D3VA 4PJGF 5AYUL 2PN5A 1J05B 2XXMB 2IH1B 1YNTA 3KYNA 3RL1B 4F7PB 2HVKA 4DOHE 5IR1B 1TMCB 1ZLWK 3U36B 2ZSWB 4HLZH 4BH8A 1RZFL 3VDBA 3JV6B 4ZAKD 5C0IA 3VH8G 3EIFA 2FJHB 3OXSB 3V6FA 1OTTD 1FFOB 5CUSL 4S11A 4NQVA 4U3HA 3HE7A 2YEZB 4UDTB 3OJ2C 2B39A 3V6OE 2ED7A 5L2KB 2HKHH 3HB3C 1WISA 3GSOB 5C0ND 1WZLA 4K2UL 1MHPH 1NAKH 2BNUA 5HDBF 1XAUA 2R23A 4AY0A 3BIAX 5H8DA 3G5VB 4XPAH 4ZQKA 4YC2B 4LCCB 3FQXA 3ARSA 2Q7YB 5IMKA 4U1KA 1UZ6F 2XFXB 4P2RE 1ZHKA 4CGTA 3VD9A 4LP5A 4QXGL 3KWWA 1F97A 4H0HB 3ROLB 2YPVH 1N59B 2Y36H 3VG0H 1ED3B 5CGYD 3LKSB 5DVLA 3PWJA 4KDVA 5KBNC 1BFVH 4N0UB 3HZYA 3RWIB 3NCBB 4LVEA 3GJEA 5C0NC 5JLZB 1F4AA 5KSAC 3JWDC 4JR9H 5ALCL 2DMBA 3HB3D 2R56L 3HUJA 2F15A 1UM6H 5HDLA 5CCKH 3N0PB 1RJZB 1TVHA 2EH7L 3FFCA 3CFBA 5ANME 4LGPB 2D9CA 2VABA 4WTXA 3U7YH 2XV6B 3JV0A 5EN2A 1OF2B 4X6CB 2CIIB 5I8KL 1N5AB 1HILB 4Z95L 3SGJA 3ARQA 4XWOD 5B38G 4RISH 1LO2L 1FRGL 4FQXA 3UTPD 3KR3L 4HIJB 1OAKL 1B90A 1DN0B 4L1DA 3OKYA 3DYMA 3H2WA 3CUPB 1JRHI 1TVBB 4LSSL 5ALBL 1OM3L 3SDAD 1OHQA 1D6EA 2CRIA 2VLKE 2APVA 2OL3H 5ID0A 4ZAKA 1A6VH 1QFWH 4O58H 4PGCA 4MB5A 4YBQC 4KRMB 5FGBA 1EAJA 5DEFB 1CCZA 1RJYB 3KXFD 5GZNC 3MPCA 3HE7D 3VCLA 4LAJH 3QUYC 2KBGA 5DFVD 4O4YH 1KCSH 1UXSA 4U1JB 4BQ6A 4L8BA 1HHIB 3VXUD 5ANMB 3X14B 4L4TE 1M71A 4M6OL 3AGVA 1T83C 1D5ZB 1GGIL 3SJVE 2EDLA 3C6LC 4PJGE 1MIML 4X6CE 1LEIA 4WHDA 5AWNH 1N64L 3IRZA 4L8SC 2D0FA 5JOPE 2NY1B 4NSKB 2J4WH 3QEQD 3BPOC 4D9LL 1WZ1H 2B5IC 1G6RL 4KQ3L 1LP9F 1XF2A 3V4UL 3GK8H 4DCQA 4ZDHA 1IKNC 1C5CL 4EUPB 1KJ2H 1UWGL 1BEYL 1HN1A 5FM4A 5T3ZD 5ERWA 1G1CA 3QDMD 3L3JA 4TPRL 4K2UH 3SDCD 5I71C 1U91B 2AJYL 5JIHA 3MUGA 5L2KE 1OPGH 4WV1C 3WS3B 6CGTA 2CUHA 2ICEB 3BPCB 4AK1A 2M2DA 1F3DH 4JFEB 5IWLA 1KXVC 3IKKA 2HRLA 4Y1AD 1C1EL 1NSNH 2ZP0T 4P2OD 4XPFH 1FBIH 4ODTL 4A6YL 3C2AL 3OG4B 3GSVB 4TOYH 3DMMD 1EHXA 1RJLB 4OSUL 2EDXA 2GITA 2NY2B 3MREB 3FN3A 1RUAH 2MQ3A 5DQDH 5JHLH 2EE9A 2IBZY 1CDHA 4I5BA 1R0AH 2WWMD 1JNHA 4JPVH 2ZG1A 3MV8D 3CPLB 1S78D 4DGIL 1KG0B 1KCUL 3WHXB 5FECA 3DARA 1UGNA 4Z7VF 1AD9A 3VH8A 4G43B 1HH9B 3H9SB 3B9KB 4UTBL 4ZUWB 5I1AA 4F7TB 1MCPL 5D1QB 2AJUL 2PNDA 3MLVH 3SKNA 2AEPL 3VXUA 3OPZH 4DKAA 3EDJA 4K3EH 5EBMA 3GMNB 2DKUA 4UAOC 4ZSOB 3LKQA 4XNZC 3VXTA 1A4JA 3MRNA 4AIOA 5JTWA 2XA3A 2VQ1B 1BQHB 1ZHBB 4XPHL 4UB0L 5FKPA 3I3EA 3ZKND 5ESVB 2I60L 2XA8L 5J13C 1QEWA 2Z93A 5DQDL 3OAUH 4ZO7A 1WCBB 3MUY1 1MCDA 2X6MA 3RVUC 4FQIH 5IKCA 3EO9H 3OR7A 1MHHB 2NZIA 5LVEA 3C87A 2WBKA 4RAHA 1NFKA 1EJ6A 3KDMB 2ZG2A 2N56A 2NX5D 1QFOA 2VDNL 4U2ZA 3SDCA 2AV7A 3H0TA 4ODBD 5BS0E 2LU4A 5IT2H 2BY2A 2FWOA 3QH3A 4PJEE 4XVJH 1KIPA 1DSFL 5SWZB 5GGQH 1HQ4B 3HZVA 4W68A 3S3PA 5F9WB 4GBXB 3RVXD 1AXSA 1TZHB 4HG4K 5GRUH 3ESUF 4GAYA 4YO0A 3S4SB 4CNIB 3T65A 1NKRA 3P0YH 1S7RB 1KPUB 4JPIB 4F7MB 3HAEH 4W6WB 5GS3A 3NCJL 2IADA 1BGXH 2R15A 3P40A 4EQ2A 4D9QD 3KAAA 4QCIB 3RDTA 3RGHA 2XFXA 2HLAA 3OXSA 3VGFA 3UMTA 3RP1A 4IRJB 1M1SA 2BY0A 1E6JL 4LBEB 4X9BA 3CX2A 3MCLH 4ELMA 5MEQB 4K8RL 1Z3GH 3DWTA 3OG6B 3TT3H 3O2VL 1UENA 4CU6A 1A8JH 3SCMC 4NC2B 1U8QA 3TJHC 1L7TH 2DB8A 5ISZE 3JWOC 3WFDH 1CFNB 4HEME 5C0RH 5FO9A 3F58H 3RUGA 5FO8B 4DK6A 1N59A 3VDAA 5F1IA 2AAVA 3O41B 4RA3A 2B5IB 5IQ9A 3VXNA 2EC8A 3MUHL 1I1AB 4LHJB 3B6SB 3DXAB 3IXAA 5B21A 2YK1L 1NJ9A 3SKUD 1RVFH 1JF5A 4Y2DC 5TFSL 3MV9A 1MQ8A 4EI5B 4D8PA 1HQRA 1DLFL 4LSRL 1Z9SA 1M7DB 1JK8A 2PYEB 3V6ZA 1WK0A 5JXAL 1CQKA 1T03H 5A43C 1WSST 1A7RH 2ADFL 1NLDH 2W91A 5HYQA 3BIBX 3MRLB 3BKCH 2NX5A 3ME0A 3PG2A 2DLIA 4ZAKB 1QSEA 2HA1A 3UAJD 2ZCHL 2QBWA 4HXBL 1IZJA 1AGBA 2OJZL 1DBML 3PWLA 5DHXB 4YPGB 2DQTL 4PJAB 2IALB 5A2KH 5E2TL 3U7WL 5D70L 2FNBA 1AHWC 1RD6A 4ZMAT 5ACZA 4PG2A 3QUXC 5ADPL 3IKCA 4WTWA 2CKBA 1I85C 2COQA 5K9OA 1CLCA 1G0YR 4PTUA 4N0UA 4PJXF 3RWIA 3VG0L 2YPVL 1GL4B 4GBXA 5TJWK 2HT4C 2Y72A 1EFQA 5GHWL 3WNMA 3WHXA 1B6UA 4K7PH 3SKMB 4PJ8B 5GQBA 4Q97A 3MRKB 1FE8L 3TIEB 3I2CH 4JFDA 2Q7YA 5AUMB 4P9HC 5C3TA 3TJEH 3RWHA 5EO9B 1QLEH 4NZTH 1RUKH 2V2WA 4J7RA 2E7CA 1SYVB 3L1OL 3KLSA 2ZUWA 3U2SA 1Z2KA 3DVGB 4J4PD 4N0FA 2AJ3A 5C09D 5AUMA 5JXED 4R0LB 4R26L 1OP9A 1UM5H 3HPLA 3NFPB 5INDA 5FF6B 5FUCC 1TJGL 3VI3F 4LLAA 4ZUSA 3EYQD 3DO7A 1KIQB 4P4KB 5J0BA 1QLEL 1YPZE 4NZTL 5C0AB 1U3YA 4XPTH 3D39E 4DZBA 2VDRL 4LCCC 1G7PB 1S7RA 2JIXA 2Q86B 1PQZB 3V52H 1A14H 1OP5K 3STLA 2XWBA 3I6LD 2PW1A 5DGQA 2VXUL 5T3ZH 1PKOA 1EAPA 4JB9L 4OT1L 1U8NB 4PRDA 2KDGA 1UKTA 4Y4KD 3BZ4A 4ZUTA 4JJ5A 2R69L 2FX7L 2I5YL 2VITB 4ODVL 3GJFH 2NZ9C 1LNUB 5KW9L 5CEYA 5TH2B 4PRDB 1BLNA 5C8JB 1KLGB 5GRYA 4Z78B 3I9GH 4RA0C 1A6AA 1K4DB 1CR9H 2UYLB 3L3GA 4P9MH 4K3JH 1KNOB 1TQBB 3RIFK 1UB5A 5HVGB 3CCHA 1B9ZA 4DAGH 5CIPA 4N9GB 3FHAA 2PKDA 5GS2H 5B4MC 3UPRA 5IM7B 5FDYA 4IHOB 5TE7H 4JFFE 4RWHA 3Q0HA 5J1AA 4P2QE 5ID1B 3B9EA 5IROC 2P8MA 4MNHA 2ZUXA 3VFMB 1HWGB 1PD6A 3DGGA 2J8HA 3MLZL 1V7NH 2EDYA 5DR5L 4NUJA 2AXGB 5GRXG 2EIEA 2R1YA 4O00A 3UBXG 5ESAB 4FZ8L 4P2QD 2VH5H 3JWOL 4X4XA 4J4PA 1G7IA 4CADB 2JJTA 3DGGB 4JCMA 3T77B 4NPYA 4C58B 1L7TL 4F57L 1WFUA 3D0LB 1X6NA 2F53B 3NIDE 4O2EB 5T3XL 1K9TA 4KK6D 3MLRH 1I4FB 1SMOA 5BOPA 1QBLH 1JNHB 3LN5A 2D2OA 1XGRB 4PJCB 4I2XA 5KTEL 1W72B 3PWPD 1QPPA 1LK2B 1N26A 3S36L 1E6JH 5ITBH 2DI9A 3N9GL 4H8WL 2GTWA 3TT1L 4LCWB 4P5TA 1GGCL 4E41D 5EC2B 2AJXH 3GI9H 4XCEA 1YEGL 5EU4A 1BGXL 2X2YA 3BISA 1X7QA 2YSSB 4HWZB 3D0VB 2CXKA 5MEPA 2LTQB 3L9RA 3VXTB 3G6AB 4HS3A 4L3EA 2Z91A 3QHTC 1I1YA 5E5UB 1FIGH 5GGQL 2BOCA 3DETC 4FQCH 3HC0A 2F8VA 3B9KD 3U46A 1NUGA 4N0UE 1TJHH 5SX4I 1DQDL 2R29L 3RBGA 2OK0H 4GSDH 3ZYZA 1A7NH 1F58L 2HTLC 1GZPB 5HGGS 1XR9A 4WDIA 2XN9B 4AH2A 3O11B 2R0KH 4BH8B 5KS9E 3RWGA 5DMJB 5BRZA 1FC1A 2AEWA 5J3HD 4JO3H 4QRUA 1S7SB 3T4YB 5FOJA 1JHLL 4MDIB 1GCFA 1D3CA 4BSVA 1KELL 4MQSB 1BWMA 1R3KB 4YGVB 1A9EB 4S1SL 1MJUL 3DOSA 2AKRA 1MI5D 1IARB 4BFEA 1GOHA 3ARFC 3MBEA 4KV5E 5FGCB 1MRFH 3BKML 5IMMB 5E94A 1NC4B 4CBPA 1KJVA 3HG1B 3KDMA 2HFFB 2QQNL 1F90L 4LAQH 4B5EA 5HHOA 4UNTA 2RFXA 4JB9H 4IDJH 4AEEA 1VB9A 3DUUB 4LASL 3MRCA 1MCIA 2VSDA 4M1CD 4K94C 1UJ3B 3GIZL 2QLVB 3QAZC 5CP7B 1L7IH 2RGSA 4TOYL 4X6BB 3R0MA 4PJAF 2ESVD 4LLDB 2KL6A 4PGBA 2H2PD 3VA6A 5GRZA 2A73B 4HULB 3MXWL 4HJ0C 4G6AD 1WVZA 1TETL 1CI5A 4NZDA 4MS8D 1FL5A 4U1MB 1OTUC 1RIVL 2C3VA 2BRRH 3O3DA 3MRGB 5D96C 4YHNB 1R24B 3SKJH 4XPFL 4P2QB 1CG9B 3FRUA 1E6OL 1A1NA 4HKBA 3B9KA 1NCDL 1A6ZA 3WUZA 5KS9B 3HTLX 4HV8A 1CLZL 2NY3D 2B1HL 3DV6A 4EDWH 3D85D 5J11C 3NTCL 1ACZA 3FQNA 4W70A 5JQ6L 5HHQA 3BZEB 1BFOB 1H3PL 1PSKH 5GRWA 4HWBH 3GK8L 3LH2L 4KK8C 2LTQC 1CFBA 4KRNA 3ZKSD 3P11H 4MA3A 4NKDA 4R2GB 4WWKA 3OGCA 5HHPA 4KMQA 2XWBB 1J5OL 1MVFA 2P8LA 1G0DA 1SY6A 4ODHL 4GRLB 4NZRH 3T2OA 1N7MH 1RU9H 1JVKA 2CDEB 4LSQH 1N5YL 4X7SH 4Q6IC 1DEDA 3TO4D 3ULVF 4QO1A 4ZUSB 2WV3A 1EUTA 3FFDB 4TYUA 3P30H 4IRJD 3L6FB 4EDXA 1I7ZA 2BVEA 3GHEL 5DMKA 1NMCC 1T7YA 4NM8H 3PXHA 5DF0A 3NCCB 1A6VL 1QFWL 3PWVA 3X3FH 4O51B 3AM8C 1NBZA 4GAYB 4LVHB 1AXSB 4XBPB 2Q76A 1RHHB 5BW7C 4PJXB 3GKZA 2XPGA 2VO5A 1EO8H 4HWBA 3H9ZA 2AV7B 5TGBB 1LO2H 4WJ5B 1EEYA 1RUPL 1D5XB 4NFDA 3H9YA 3E3QE 4V1DD 3TBSB 3ZT7A 2PXYD 3VXPB 5HI3D 2R39A 4K94L 3BD5A 3WN5B 4XP4H 3C5ZB 4P99A 5MENB 5JORA 5CIPB 3G6JB 1EIBA 2V5SA 4K8RH 4QRPA 4LDLB 3ROLA 3IJYA 4V1DE 5CCKL 4OF7A 4P5KA 5E6ZA 3ULVE 3MFFA 1N7ML 2ED9A 4UV4H 3A6CH 3CH1B 1QBAA 2V7HA 1NGQL 4YHLH 5I73B 3HNVL 4ONGL 4OD3H 1REIA 5JIPA 1RZJH 4FFVC 1IEBB 4KDTA 5D7LB 1JF6A 3FT3A 1S9KC 1I9IH 5E5MB 4XCFL 4P57A 3RWFA 4R4FH 1Q9LA 2HKHL 4QHMB 4P2RA 5IFHL 4JKWA 5HHME 2YD9A 3FN0L 2VLJB 3LD8C 3STLB 1CXLA 5CUSH 3WLBB 3DPBA 3FT3B 4NM4H 1Q9OB 2HJKA 3DRQA 3MRGA 4LKXB 1MCWW 3VMNA 4F9PC 1Q9KA 1OLZA 3G9AB 5HGHB 3DJ9A 4F80A 3GMPB 2DYPA 1A6WL 2R2BB 2BOBB 1KB9K 3KXFA 2VUOA 5K9QG 3F7YA 4KI5F 4CU7A 2UY6A 4MQTB 1QYGL 1FLRH 4PJDB 4M61A 2J8UE 2P5WB 1A6WH 3SHSA 4LDOB 2W59A 1NEZG 3RVWC 4Y0GA 1MCBA 2WUCH 4OF5A 5F7FA 5HHMD 3AS2A 3RNQB 4POZC 3EJYC 3P9LB 5E8NB 3ILPA 4UV7L 4ZUVA 4PB9L 3QEQA 3GSQB 4MVBD 4ZXBC 2Q8AL 4K7PY 1YEFL 4BZ2L 2HRPH 2VDOL 2PXYA 1VEPA 3RVTC 3HMXH 1Y0LA 3DSFL 4NDMB 1CDGA 3BGMA 4X8JB 2PF6A 2A2QT 5IESL 4QRPD 1KBGL 2R2EA 4PP1C 3TA3B 4QF1B 2F8XC 3QZWB 2F54B 4LARH 3TYGH 4LOUC 2O93L 3P0GB 1P4IL 4EDXB 1N4XH 3MJ8B 2Y06L 1I85A 2AQ3A 4L3CB 5EZJA 1NC2D 3P73B 4PRAB 4PV8A 4Z77A 1QLRB 2BHUA 3NZ8B 3U4BL 3V5KB 3GB7A 3L3HA 1FNGB 3ARPA 3GM0A 4P2RD 1QRND 4X6BA 1LDPL 2DWDB 4YDIL 5FM5M 2SEBA 5F1NA 4ZFFB 2X4RA 3EDDA 1A7NL 2CLZA 3GHBL 3QFDA 5KVFH 3DXAD 5I1JH 1TPXB 6FABH 3E3QC 1IRAY 4XNUH 2A9NH 5CJQL 5DJZB 4MNQE 3T65B 1HHHA 1PLGH 4HIHA 4F8TA 5A40E 4MX7B 1BWWA 1MJ7H 3DBXA 1ZE3C 3OKMB 4MJID 4YXKH 4JFFA 1I9RL 3IJSA 1MJ8L 3DXAE 1MSPA 4LHQB 4D0BA 5EO0B 5D2NA 2D03H 2DYPD 4P4RB 3RL1A 4F7PA 1DUZA 3KHQA 3VXUE 1QRKA 4OLYH 1MI5B 4J8RA 3S3SA 1U58A 4R97B 5C9JB 1R3KA 1AD9B 4WCYH 1TVDA 3D69A 1FO0B 4CN6A 2BNRB 1CGWA 4J2XA 1QOKA 2IMMA 5BS0D 4WFHD 5HYQB 2J4WL 4I0KA 3KYKL 1NL0H 4H88L 3DVFA 4NQXB 2EDTA 2C1PB 3QXAB 5FDWB 3ULSA 3O11A 3STBA 4ZTOH 3ULUC 3V0WH 5KTEH 3ZDYF 4PY8J 1ADQA 1A0QL 4M6OH 1IILE 2LV4A 4XCYA 4BKLA 1AD0A 2I5YH 2R69H 1F02I 1F4XH 1YQVH 4JM4H 4XPBL 4RZCA 4YDKL 5LGJB 5K93A 1XCQB 1MUJA 1JGDA 3OKNA 1WZKA 1LO4L 2EDJA 2NW2B 5CLTA 5I1EL 1IAIM 2WAHA 1QO3B 1WITA 4XP9L 1NC2A 2FGWH 1KG0A 2JELL 1OQXA 3SDCB 1WIPA 4MQXD 5FAAA 3O2DL 3RTQC 3RTQD 3SN6N 4HUVA 4U1LA 3OXRA 4MWFB 1HEZB 3T0BA 1FZJA 3HR6A 5EOCJ 4PJEA 5D5MB 2KPNA 1A6ZB 1CLYH 5MENE 1MFNA 2BDNL 5AG8A 4FQJH 1J8HB 2E7MA 3JV4A 1O5DT 5T3ZE 4JPIA 4ZPTB 1ZA6A 3L1OH 4M6ML 1U8PB 3QIUB 4LVHC 8FABB 1BQHA 4G6KL 4OAWB 3FB6B 4I2XB 4NQSB 1WZMA 2IPUG 1BOYA 2V9QA 3WXVL 3T8XB 3DURA 2I25N 4MXQD 4PJGB 1F13A 3ULUD 4ZXBA 4NNPL 3JWNC 1NMBH 3PGDA 3RTQB 4X4ME 4GRWH 4YDLC 5E8NA 1BJ1H 4HD9A 3FN9A 3VFNB 1F90H 4LAQL 4OQTL 4NYLA 1ETZA 1UB6A 5HHQB 4ODXB 5HHXL 2BMKB 1LO5B 5KN5A 4G6KH 4LGSB 3ZZ1A 1PFCA 5C92A 5C0CD 1DBMH 1R5VB 1RK1B 5F7DB 4JM2A 1XF4B 3G5YB 1I1AD 1P7KB 3MCKA 4OZFA 4MA8H 3GUTB 3E6HB 3KPRE 5H2BB 3QB7C 2AXJA 2BDNH 4TUKL 5CINL 1A9EA 4FNLH 5DTFB 1ZSDA 1G9ML 3OSKA 1D5XA 1JGVL 5HYIA 5HVFB 3ULUE 5IW3A 3QHZH 3UCRA 2E9BA 3EZ8A 3RWJA 4DGVL 1FFPB 3NH7L 5AZEL 1GHFL 3B43A 2EKSA 4M43L 4Z76B 3FFDA 5KJRH 2F5AH 3HC4L 1UKQA 1RZ8B 2L7JA 4HBCH 3SE3A 1E27A 5MI0C 3VWKA 1RZIA 4WU5B 3WIHA 5BMFH 4PJ5E 4PG9A 4JVWA 5B3NA 1FE8H 3HPJB 2X1XR 3M45A 5FA3B 4X9FA 4M61B 1FSKB 5D1ZC 3TZVC 5INCA 5E6IA 1F45A 3O2DA 3D87B 1QO3A 3GEWB 4N8CL 4U2YA 3MRHB 3QO1A 4RGNB 5FHAL 3WS6C 5D71H 5J6HB 3PHQA 2B2XH 4GBXD 3LRSA 4JDTL 4WTZA 3OB0K 1PG7W 2Y5TB 1ZTXH 5C0CB 1HSBA 3UC0H 3P77B 2JLLA 2NQCA 2HFFA 4PP1D 4EBQL 3FO2B 4A6YA 2VNCA 5J6HA 1F00I 2ZJSH 1KENH 1INDL 1WEJL 3ZHLA 5FO9B 3F12A 5DJYA 5C6TH 1CF8L 1RURH 3O4LD 4N90E 5E1AA 3RVTD 2X1WL 2GK0A 7FABH 5DMYA 1YJDC 3UTSE 2R0WL 1QFWM 4FXLA 4WCYL 4GG6F 2FH8A 2R8SL 3QNZB 1Q9KB 3MLXL 4XH2B 5D7JB 4O2CB 3WFEL 3C6LA 1CZ8L 4X6DB 3RVWD 3DVGA 1XGUB 5DGRA 3VFPB 1I1FA 2OTUB 4RMWA 4MAYC 2WW8A 1BF2A 1ZHKB 2ICWI 2PCPB 3M17B 3T3ME 2X1PA 5IW6B 4ALAH 3VXSD 1LGVA 3X13B 1S9VA 1YDPA 4JM2D 1U8IB 4PBWD 1P5VA 3WFDL 2X09A 5C0RL 3LSOA 1NCTA 3T2NL 3VFUA 1OWRM 2KZ1B 3THML 2ITCB 4RDQG 1I1FB 4ALAL 2VJXA 3KPPA 2DIAA 4RAUB 3CVHL 4ZUVB 3OZ9L 2DLGA 1QFUH 3GSQA 4MX7A 4I3SL 4Q6IA 4N9OB 4F37F 3QPQC 4NQCD 4WEUD 5CZXD 3NCMA 2A0LD 2DQDH 1IAII 1RUQH 2XQYK 4L8BB 3X14A 2YUXA 5JZ7D 2DMKA 1FPTH 1CICD 4C56B 4F7EA 4TNVF 3DURB 4PJGA 4N5EC 2R2BA 1TJIH 4M7JL 5I19H 4BQCA 3EOBB 3HE6D 2EDQA 5I66A 5E6ID 4MLIA 1NBZB 3BPNC 5HVHB 1PY4A 4JO2H 3TNMA 2OSLA 4U6XA 1I8KB 3KPLA 1DFBH 1M05B 3CVHA 4DK3A 1G7LA 3WDHA 4HPYH 2OP4H 5IVXF 5SWSA 4KJQC 2CQVA 3CSGA 2HT2C 4NT6A 5I1LA 2J7LA 5T3ZL 4LKCB 5I2IB 1KTDA 1MLCB 1XEDA 4L29A 1FV1A 4X6FA 3PDOB 2JTDA 1VFMA 4O51A 2UV3A 5T5NF 4OB5L 1UXSB 4U1JA 5KANI 4KJPC 5DHVA 2X4PA 5HGBA 4Y5YA 3PQYE 3KPMB 4TTDC 2Q86A 1QLFB 1EEQA 2R0LL 3G08B 4CVZB 5A2JH 4QRRA 2YPLE 2P4AB 1M6OA 9CGTA 1LK3L 1LWRA 5IG7A 1T89C 2CLRA 3CH1A 1TJGH 3ZL4H 5GRJH 4TUJB 3PJSB 4NBXB 2C9AA 3BEVA 1JGVH 4H1LA 4PJFA 2WWKO 1DQLL 3NN8B 4HJJL 5F7UA 5MP6L 1ORQA 2OZ4L 1YYLL 3RWCB 3UJIL 3HN3A 1NBQA 5GGVY 3ZKQD 5JW3H 3NA4A 1J0KA 1ED3A 4PUBL 5GGSY 4MA8L 4EI5C 2QKIB 4XAWL 3AREC 5HHVL 1RZKH 3MLPA 3C5ZA 1VA9A 3V5DB 2K3TA 3Q1SH 5ELIA 2D7NA 3NACH 2LABA 3KJ6H 5TE6L 4QHUB 1UH3A 3O41A 2W38A 2ZUSA 3ZE0E 2BCKA 1MFEH 3CFEB 3ARFA 3MBEC 1NC2B 4P2CG 3BZEA 5DI8B 2BNRA 3CFBB 5B39B 5LG1A 5HYEA 3O6FD 2QHRL 5EU4B 1C7SA 4OD2B 1LE5B 2YBRA 1CICA 2DTSA 3HE7B 4UOW1 4ODSL 3LB6C 1I75A 4ENED 1MRCH 4Z7WB 2FBJL 1KT2A 2EE3A 1T1XB 4HUWB 1OCWH 3ZDZE 1OGTB 1HHKA 1NFDA 4KK8D 3UX9B 4AZ8A 4LPWA 1HXYA 2VN7A 4XNZB 1AD0B 5ENWA 4KROB 4FMFA 4F7EB 4LLVA 1QEWB 5IGXH 3GKWH 3PWLB 3LN4A 1AGBB 3C8DA 5FO7A 4XRCA 3P9LA 4FN0A 5BRZD 1DQQA 4Z18A 1XF5A 4MAUH 2BNQB 3IU4H 5SV4A 3QI9C 2H26B 5F7DA 1NGYA 5CBEB 2XXCB 4HC1L 3MLWL 1RUPH 3MXVL 8CGTA 3IXTA 3HZKB 4O5LL 3F7YB 2W65A 4WO4C 1G6RB 4FG6D 4KTYA 5DJXA 2DMCA 5K33A 2W0FA 3DI3B 4ETQA 4GW4B 43CAA 4XC1L 3O81A 4KRPD 5GGRY 4AT6B 5FIEA 4JFDB 4MDJB 1C5CH 2H2PC 2FCBA 1KCRH 1WTLA 2DDQL 5DWUH 2FJGA 5GXBB 4JKKA 1QFPA 5F7EH 4JLRA 3WHE1 1PY9A 4GKNB 5FYKL 3BX7C 5E8DL 4YDKH 4U1SA 5K9KB 4L9LA 4M48H 4BUHA 4WU7A 4JDZB 4NDMA 1HDMA 4PV9A 4P3CL 4WUUB 5IFJA 2ZOLA 4MCZB 5F1NB 4ZFFA 4TULL 5DK0A 5FA4A 1AKJD 4M3JA 1SEBB 1LE9A 1IT9H 1D5MB 3G6AA 1WCQA 1CFQB 4RFNC 3ARFD 4GLRI 3OAZH 2YPLD 3BRGC 3BAEH 5E8DH 5D1ZB 3TZVB 1IEAB 4HKZB 3B3IA 2YC1B 3T0ED 2VXVH 5L6YH 4Q9RH 5JUEL 1J0HA 3PHQB 5DYOA 1N6QL 1OM3H 1BVKB 3DX7B 3E2HC 2CKBH 1VGKA 5GS1A 4YX2L 1G9NL 2H8PB 5DJ0B 3WDIA 1EGJL 4JVPA 1J05A 4Z7WA 5IQ9B 2MTPA 5GSVB 4GRLC 5A1AA 3LQMA 2CD0A 4IMKC 5HY9B 1BVKA 3DX7A 3VWJC 3SEPA 5TDOB 4NQEE 6FABL 1VENA 2AK1L 4FQ2L 2XPGB 5BQ7B 3PE9A 4LFHD 2NXYD 1RIUH 3V6OA 4PJFF 3NMEA 1R3LA 5DZLA 4UQ3B 4PYHA 5KSUA 3BDYH 5ISZA 4NQEB 5D2LE 1TETH 2VL5A 3RA7H 1ZHNA 4PJDA 3MR9B 3BFOA 3QO0B 2B4CL 3IRPX 2XN9D 3FAWA 5EZOL 4OQ1A 4P4KD 4Z7VB 5ALCH 3GSUB 5EOCL 3O8XA 4MAYB 4BFGA 1S7TA 4XMKH 4ZFZB 3Q5TA 3HMWH 4BFIA 2CK0H 2YRLA 1F4WL 4BZ1L 2VZUA 5BRZE 5KAQG 1SVCP 2H32H 5C2BL 2H3NB 1UYWH 2KKQA 3VFRA 3MV9B 5F9JA 3BH8B 1MFAL 5TE6H 1NEUA 5L2JB 1AKJA 1A9BA 3LQZA 5EBWB 2FZ3B 5I16B 4KGLA 3D2UD 5DJ2A 5I6XC 1NFIA 5DEGA 3L95B 3S34L 3RUGB 3RKPA 3L3IA 1MREL 1ZGLM 4ISVA 1RJZA 2DQGH 1DVFC 2QTEA 5GS2D 1T0PB 4HH9B 5I16A 4FZEH 2Z35B 4UILL 4Z77B 5KSVA 3G04A 2KQNA 4UV7H 1ZVSB 2WUBH 2WLZA 5C0FB 1ZVYA 4NFCA 4P3DA 1VPOH 4PGDB 5JW3L 3O9WB 1MPAL 2DL2A 3K7UA 2AJZA 4FMKA 4ELKB 1PX3A 1B0GA 4J1UB 4UU9A 5AYUH 2CPCA 5HPOA 1S5IL 1IAIL 2X4TB 3BKYL 1FGNL 3O6FB 5EU6E 1U8HB 4K7FA 4NJAH 4LSUH 1AHWA 2VXSH 1OAUL 4OCNC 5J1TC 3HNTH 4HPYL 3VD4A 4ODUB 5ACMA 3OKDA 2ZSVB 1CGSH 3KXFE 3QG6B 3QEQB 4NZJA 4XTRD 2ESVB 3PHOB 3L3DA 3BP4B 2IAMA 2XN9A 5I1GH 4LPYA 4BM7A 1J1XL 1ZMYA 3O8XD 1QP1A 5I19L 4Q58C 4KY1L 5FK9A 4H8WH 4LL9A 4I8DA 4OUUB 3IVKA 5BZWB 5AWNL 5HDOA 4YR6A 3GSUA 2VDKH 5ICXB 3U30C 1NMAL 3GMQA 2JJSC 4XMKL 3VA2C 4PP2A 1WBYB 4Z78A 2QSCH 5J1SC 3OV6A 4JG1H 4XTRC 2J6EH 5IMOA 2BRQA 5CEZD 1VDGA 3W81A 2H1PL 4LP4A 2LU7A 3NCYS 1HQ4A 3HZVB 3O3EB 3PWNA 3BIKB 1W0YT 1U8MB 4P4RA 1G7JB 2ADIA 3MODL 1DBBH 3RQ3A 3KPMA 3Q6FB 1ZT7A 3F8UB 4GO6B 1JGLL 1S9YB 3QWRA 3O9WC 4R4NC 2EEAA 1UJ3C 3QCUL 1PAMA 1QQDA 4JN2A 4MCYB 4ZTPH 3ZO0A 1UWEL 4JFPB 3LQZB 5EBWA 4NJ9L 2Z8VC 4GXVH 4LIQL 2XZCL 3KG5A 3T3MF 2OXHA 2LAAA 5L2KA 3LMJL 1IGIH 2C4FT 1PQZA 4RRPA 3W9EA 4QTHB 1RULL 3MLXH 3F7PC 4EI6A 5A2IH 5E6IB 1OP3K 3T4AB 2GFBB 2EIZB 4JANB 1MRDH 7FABL 1DVFD 3PWUA 2HT4D 3S7GA 3OJVC 1CG9A 5FHBL 2ITDA 3QHFH 3EDEA 4X6DA 5FKAA 1WEJH 5HDQL 5CFHA 3DO3A 4PRID 4ZUUB 5FUOL 1S7XA 3NIFE 3WNKA 1MY7A 4HFWB 2J6EA 4NQEA 3BI9X 2D7PA 5FGCE 3CFKA 1AR1D 5GS0L 2RCSL 2V2WB 3UC0L 4GQ9H 4C4KT 1SYVA 4JRWA 4NWUH 2NNAA 5TDNA 5C9KA 1HH9A 4ZUWA 3H3PL 2HJFA 1WBXB 3DXAA 3IXAB 4ZUUA 4QRTB 2P1YA 4P9HH 4G8GA 2JJSA 2X05A 3DIFA 5GGTA 2WZPD 4OM1H 4X7TA 3JTTB 3WSQL 3S96B 2ZOKB 3GSRB 5JR1H 5T5FH 3JWDH 4X98A 4JFFD 4MSWA 3CUPA 5I9QB 3ARBD 4PBXA 4Y2DD 3M17A 2WBJB 4P4KC 5DJXB 4NGHL 5ACZB 4DZBB 1JRHH 1IFHH 1Y6MR 4UT6H 3QJFB 5BMFL 5E9DE 2PYFB 4XVSL 4RFNB 4WHTA 3LEYL 2BRRL 1T1YB 4WIQA 1RMFH 3FMGH 3RWEA 3RX8A 1UXWB 4HH8A 5JDJA 1EEUA 5EH1A 4KPHL 4QHKJ 2YZ8A 1JWMB 3VWJD 1XF3A 4LIQE 4R3SB 5EOQL 3O3EA 2VLKB 4AM0B 4CUCA 2VISA 1D5BA 1M71B 5HJ3B 2VB5A 4Z7UA 5EO1B 1MLCA 2RB8A 4JVUA 5I2IA 2W0KA 4OLXH 4PRNA 1DBJH 4WUUD 4K7PL 4ONFH 4FS0A 4ZS7H 1NKOA 1T5WB 1T4KA 2XZAL 2VQTA 4J3UA 2ICWA 1DVFA 5F44A 2PTTB 3AREB 4X5WB 4JGUA 1JYNA 3GIZH 4NFBA 5H94A 5CJ8A 4QOKB 2FIRT 2AJVL 4C56D 4D9RE 3RUGE 5L9DL 5EZLA 2WBWB 2DQFB 5T5NG 4G6ML 5IW1A 5E1AB 3DGCR 4G7YL 2PR4L 4ELMB 5IWLC 2W1NA 4I3RL 1S7WA 1MRFL 2HFEA 4JO3L 5IVNA 5HY9A 3U0PB 5AYQA 1T03L 4S1SH 2XT1B 2ZUTA 4LLQA 2EYRA 2L4OA 1F6AA 2CLRB 2OZ4H 3OKEB 2HFEB 1YEJL 2JJUA 3T0XA 3O6LH 4GXUM 3RVUD 3LV3A 3MR9A 3QO0A 4P3DB 3QNYA 5IF0B 5J8OA 1FVEA 4HDIB 3B3IB 1JPSL 4YFDB 2IANE 1KT2B 4GSDL 1FIGL 1R3LB 1E4XI 3AMLA 3IDNB 2ZCLL 3DRQB 3EAKA 3BPNB 4KZEL 4XAKD 3QCVH 3U9UA 3QI9D 5F1KC 4JZNA 3SJVA 3VGBA 4G3YH 4KGJA 3MNVB 4LSPL 1EA9C 1UG9A 2NLJB 1A0QH 3LRHA 5DD3L 5F89A 2R1XB 5C09B 4NO0B 1UQSB 5IM7A 4P48A 3RNKB 4P3WA 4KTEL 1KIRA 4NCC2 3M8OH 4U1IA 2GHWB 5L0QB 5TDPA 2FHCA 1H3UA 4QLRA 3KPRB 3PGCA 4MXVE 1HINH 1MVUA 3KWWB 3NIGF 4W4OC 1I7RB 1S78C 3EOYG 3OR6A 4KUZL 3EDKA 1GGCH 3SBWA 5DC4B 5J13B 3M8OL 2XQBH 3P0YL 3O6FC 3P4NA 5C08B 3PUCA 2HKFH 3MRMB 3KPRA 4FQXC 2X7LA 5CZVH 4FQQB 4AIZA 1W0VA 1U42A 2XG5A 3VWKD 5F7YC 2OMBA 3I50H 1ZLSH 3VRJA 5EU5B 2K7PA 4WI9A 2X42A 3BPLC 1AQKH 3TBWB 4WU7B 1N3NA 2CGRL 3ARED 4EI5D 5IW6A 1J8HE 4WUUE 1ZT7B 4Z7OF 4M5YH 2VH5L 3IF1B 2WQ8A 4OZGB 4HGWB 1D5IH 1B6DA 3VU2A 3MRDA 4U4BA 5DR5H 5IBTL 3U4BH 5CZVL 3BP5A 3MLTA 3MLZH 1SYSB 3QUMB 3SDDA 1B2WH 3INUH 1NUFA 2VQUA 2XA8H 5DDHB 1J1OL 3QDJE 4MNGE 5HYSA 2C5DC 2NY5L 2NY2D 5MHSD 2Z35A 3PL6C 5HYSG 3T1WA 5JW5B 4JFED 2A6JA 3P0VL 3A0OA 2MCPH 3PABB 2VSCA 3F12B 3BPCA 1KBGH 5IESH 2MSPA 4ODVH 1RZJC 5HD8D 1DEEB 1TQCC 4NCC1 4JFZH 1KJ2A 5FYJH 1P4IH 5HXMA 3I9GL 3UTTB 4E5XB 3BVNB 4GFTB 4GOSA 5F7KC 4X4YA 5I1DA 2G5BA 1DUZB 3WJLA 4JFOA 4H5SB 3U0WL 3V8OA 3R06B 2HG5B 1JNLH 3P4MB 3QNXA 2FX7H 5IB3B 3VXMA 5DD0L 4OZFG 4R96B 5IEKB 5E00A 4M4PA 3FL7A 1F3JA 2VLRE 1NJ9B 3HE6C 4DQOL 1E4WL 1DANU 1U2CA 3MLYH 1GXEA 2PCPA 5FECB 3WFHB 3JTTA 1AFVL 2AGJL 3VXOB 4NO0D 2ZPKH 1UB5B 2XRAH 3ELAT 1S7XB 1X3DA 2CR6A 5CZXC 4Y5YB 3QPQD 4UINL 3T0AA 3HRZA 4ODTH 3VXUB 4JO1H 5FYKE 1K6QL 4QT5A 4XWOC 1CGVA 3LKPA 3W82A 35C8L 4HWEH 2GFBA 1IBGL 2EXWD 4NQDE 2IPKB 1CD0A 4WVRA 3KNBA 1H3VA 2Z8WC 2WWKT 4I3RH 3ZSSA 3TJEL 3MNWA 5D2LA 4F9LA 5HGAB 4IBLT 1JF1B 3K4DA 4WTZG 1CDIA 1MAKA 4YEEA 4FQLH 4PJHF 3OJDA 2FZ3A 3FN0H 4FQ1H 5IMKB 5ABDE 5T1LA 3RPKA 3T4AA 4DN3H 3Q5OA 1PZ5B 5GHWH 3TNMB 3M07A 3HCVA 3TIDB 4OZGA 5F6HJ 1KIRB 2DWEA 3UBXI 5HDBE 5TQ2L 3UBXA 4KVNH 2W60B 4O9HH 3NABH 5D6DA 5DA4A 4G42A 5JW4Q 4FXKA 2BNQA 1UXWA 4WI5A 3MLUL 1JV5A 2GY7B 3S96A 5CEZE 1JNNL 5I1LB 4HAGA 1QFWI 3FFCB 3CXDL 1ZA6B 4YLQT 1ZKAA 1KCSL 2X7LB 3MRQB 2APXA 3BSZL 5FM8A 3P9MB 1MFCH 1YNKL 2MNUA 3QXDA 4QRSB 1TZIA 1HQRB 4OGAC 2Z92B 3MRJA 4G8IB 1X5IA 2VLMD 2FX8L 1IL1B 3VXMD 1QKZH 5K9JL 2WM0A 4PJ7E 5MI0B 2LE9A 2EH8H 1RVFL 4FFWC 3CU1A 2YK1H 5HTSA 3FB5A 4HGWA 3NOIA 4K3DH 4QRTA 3UZEA 3FO0L 4NGHH 4P23A 2VQ1A 3V0AC 4IIQB 3O2DH 5JO5B 3BDBA 3DX6B 5D7LD 4JPWH 3SGEI 2BFVL 5D1XB 5E8PB 1NQBA 4L9DA 4ONOA 5I0ZA 4RIRA 3SBWC 3WD5H 3PHSA 3V7AG 4R3SA 4HK0A 4IOIB 1ZWIA 5JOPD 2X10A 3H9SE 1F4YH 2EEBA 3L3HB 4OCYL 2X89A 1U41A 3IB4A 3VFSB 1P4LA 4QNPE 1I1AC 3WE6B 1JPGA 1WAAF 5BV7C 2FATL 2EKSB 2RCSH 5DRXA 4Z8FL 4C4KO 4AENA 3BIKA 4MAYA 4NSKA 1T4KB 3HFML 2E7LA 3QIBC 3RGVC 5C07D 1LQSR 1KCLA 1Z9MA 5INCB 5I8EA 4NHCL 3LKOB 1VACA 1HWHB 4HG4J 2VDQL 1TZHA 4ODHH 4OD1L 4R4BB 3WJJA 4Q2ZB 1UH2A 3ARBB 1K4CB 5F88B 2IPTH 2BSTA 4WUKH 4MXQC 3B5GA 4L5FH 4M8QA 1P6AB 2VDPL 4LPUA 4PJHE 2YPLB 1ZGLB 4EDWL 3DROA 4EJ1C 5CSBA 5D93C 3MUGB 3PGFL 4FQ1L 4JRYB 4NJ9H 1RV6X 4Z5RB 4DN4H 2D31B 4LLMA 2V9RA 3WYRA 3BXNB 3PWJB 5EORL 1YUHA 4LLYB 5IT2L 1O0VA 1NPUA 1DUYA 1Q72H 5BCAA 4XNUL 1SEQL 2GITB 1IC1A 3QDHA 4QRRE 1JIBA 2J6EL 1ND0A 4G5ZL 2CDFA 4HZLA 4PR5B 1NANI 1KTLA 3B4NA 3U0PA 3JZ7A 5EO9A 4PJXE 3W9DB 4FQIL 2E9WA 1FLTX 2YMXH 4EXPX 2VC2H 4HFUL 3LSOB 3HRPA 4U3XA 3WNPA 1HI6A 2IGFH 5DUPH 5EUOE 3FO9A 4F7CA 1IKFL 2EIDA 3WXWH 1IGFH 3TYGL 3TP4A 2AS5M 3RZCA 3QZWG 2Q20A 1FH5L 3MQIA 4I4WB 2NMSA 4HGKC 3MRMA 3GMLB 3IDNA 3MFGB 1LO5A 5KN5B 5LJYH 5C0DA 1GGBL 4HPOL 3K8LA 5I1DB 5IP4A 4FFZH 2G60H 1NAMH 4MB4A 2CH8A 5H37H 1Q8MA 1GAFH 1NGZA 4Y4FC 2ZOKA 3GSRA 1QVOB 2FX9L 5EFIA 1BOGA 1BJ1J 5DVMA 3HMWL 1KTRL 3HZKA 3MJ7A 4YXLL 2VLKA 3F7VB 2NY5H 1LMKA 4H1LH 4Z6AT 1R0AL 4X6DE 4MQ7B 1C1EH 2XTJE 5TF1L 3NA9H 3ARRA 1AJ7H 1D6VH 3S37X 3QBTB 4KDWA 5GJSL 3MLSL 3MA9L 5DK0B 2R4RL 4GKNA 1EEZA 4PRPD 2N1KA 3G5ZA 32C2B 4R2GC 2OK0L 2F54A 2F5BL 4JDZA 2VLLA 4QOKA 4OJFH 5I1IL 1OTSD 1YEIH 1QHOA 3C60A 4KK9D 3VFSA 1XF4A 3G5YA 2WBJD 1V3KA 4LPXA 3W11C 1C7TA 3IVKB 3QRGH 1P69B 2FHFA 5J4MA 4RMRA 2DBJA 5ECJE 2DLEA 3S3JA 5D1XA 1LP9E 3WL9B 4LBEA 2ZUVA 4NHCH 2BNUB 4F58L 1CDBA 1WAAA 3BP4A 4YE4L 2CRYA 4XNMB 1NDGA 4LOUD 1U8KB 4G42B 4OF0A 1XH3A 4ONGH 5E8EA 3W0WA 5A3ID 4W81A 1N0XL 5KG9B 3H9SD 3MLRL 4WHCA 5EZOH 4PLNC 5DK2B 1GIGL 3PF2A 3DNKA 3QQ3B 2E27H 3DTXA 4GG6E 2AI0L 4JY4A 4UNUA 4YIQB 4PJCA 1FO0H 1UZ8A 3QUZB 3VXRA 1CICB 5SWSE 2C1PA 3QXAA 2ZSWA 1FYTB 4S1DC 5CJXA 3EOAB 5E99H 2EDEA 1GOFA 1Q9OA 3O9WA 2X4SB 2HJKB 1OGTA 3KYNB 4HV8B 1ORSA 3CDYA 2I27N 1FNFA 1Q0YH 2AVGA 4PLJC 3TPUA 3SGKC 5BZDB 1BFTA 2W07A 5FGRA 2O5XL 4JFYB 1FORL 2IAMD 1YQ2A 3LS5H 3DYOA 1N6QH 1AXTL 3OKDB 5E08L 1F2XK 4IOFC 1B4RA 1OAQH 3I75B 2NNAB 4CJ1A 1YC7A 5L2JA 4MD4B 3SDXB 2FGZA 5E5RB 5E6YA 4YZFF 3ARWA 1KB5L 4PJIE 4WI3A 4OZHF 4D2NA 3KLAB 4JFQB 1R5VA 2BY1A 1BFVL 4DWHA 5C6TL 2PXYB 3U83A 4D3CH 3MX0A 4EKXA 5FV1L 1WT5A 1CBVL 1ZT4B 1TTUA 1U6AL 43C9B 2EDRA 3QXDB 4LCUB 4QRSA 1CIDA 3PIQA 5DJDA 4NT6B 2GSGA 1JZ3A 3V52L 4NN5C 1PJ9A 4ODSH 5H94B 4YHKH 2B2XL 1JUFA 1G7LB 1G9NC 3VFGH 4CNIA 2AABH 1KGCD 5CGTA 4F7CB 3DUSB 2XQYG 3T3PF 2CUIA 1YDPB 3W2DL 5KOMC 3MSPA 3PDDA 1KIPB 1G7HA 1P2CB 1T22B 2VIRA 3NACL 5CMAA 1A2YA 3KS0H 5KJRL 2VISB 2PXYC 4HXAH 3O6KL 3EJZD 4LSVL 4OBSA 1G7HB 1T22A 3ZE1F 5JHDB 5I0DA 5F72S 1AC6A 1WBZB 1RK1A 5EZIH 3G6JA 5CIPH 4MA7H 5JNYA 4KHTH 3UTOA 1JPFB 2CDGA 5HPMA 3D1MC 4LCWD 4Y19B 1NBVL 5ACLA 4TNWK 5DJ6B 4D0BB 3A6OA 1WV7T 1HZHL 4JO4L 3ZTNH 4TSBH 4DQOH 4YHKL 2AK4A 3C08H 3NZHH 3VRLE 4CVZA 2CR3A 3KYMA 4X7CC 1EJOH 1FAKT 2CIKA 5D70H 1MI5E 3IGAB 2OQJB 2NY7H 1OQOA 5BRZB 2RQ8A 3PP3H 4LASH 2ZCKL 3SGDI 1PG7H 1OW0A 1NUDA 1A3RH 4GG6A 2OP4L 4YNYB 2P5WD 1NFDF 4R8WL 3DV6B 3NIFF 3DV4A 3RWCA 2GT9A 1HIML 2WSKA 5I8EB 2VDML 5F21B 3VGAB 3UEZA 1HYSD 3GMMA 1RZIB 4WU5A 3ZKMC 4ZFZA 5JHDD 1EEYB 1S7TB 2X4NB 3V6OC 2EZ0C 5DUBB 3FONA 3QUZA 2N7AA 3LEXA 3SOBL 5H35B 4KDTC 3UO1H 4NC1C 5CD5C 3QQ4A 3C5JA 4K8RD 4LDEB 3VWJA 1LD9A 1SVZA 2CK2A 3BOVA 4PJCF 5IBUB 1YPZA 5D7SL 3LDBC 4LLDA 2NX5B 4RFOH 5JPNB 4NN7C 5KG9A 3EYVA 3S8WA 4P5KB 1SJXA 1MQKL 1T3FA 3SDYL 5DRWB 3V4PH 1A5FL 2EDKA 5C0EA 3IAGC 5TFSH 1L9NA 2NY3C 1AY1L 2XWJB 1B3JA 4HK3J 4B7IA 5CJ5A 2CGRH 2R29H 3GSNA 4ZTPL 3PXJA 1G9EA 3G6JE 1I8KA 2WMPA 2HTKC 1WIUA 4LLVB 3K8KA 1FL3A 2E7HA 4KK5C 5IEHA 1XGTA 4E41E 4EUPH 4LLUA 4AEFA 1I8LA 1QUNA 2D7OA 2J1KA 1YEDB 2WP3T 4TSCH 1KXTB 4R90H 4N90D 4RMSA 3ESVF 3C60B 1S9VB 4YUEH 1YC8A 3EFDL 5FYJE 4JJHA 4NN6C 3FB7A 4XBGA 4LCWA 3EJJX 5F1OB 5IV2A 2QL1A 2J12B 3GI9L 2XKUA 5F7NC 3FT2B 1I7TB 2V2TB 4H88H 2M8XA 3OHXB 1I3GL 4I0CC 2PYEA 1YMMB 2QADC 4OKVB 2NTFB 4HZLB 5DRNB 4PY7A 2W0LA 1RUQL 4KUCD 1JYWA 3MYZA 1NDMB 5CHNB 4MD0A 3LKQB 1GGYA 2H32A 1T04A 3VXMB 1ZTXL 5E7BA 4HK0B 4IOIA 2BMKA 1U2HA 2NX5E 3DRTA 2VXSL 4MNQD 3QEHA 5FHAH 5BV7L 1OLLA 2R4RH 2FD6H 3QUZD 3DHMA 4G8FB 5GJSH 4WFGD 3FFCE 4Y5VC 2Q3AA 3EOBA 3SJVD 4RGOL 4LHUG 1Q1JH 1N0LA 3DRTB 4FQPA 4KMTH 5D8JL 4R7DA 3GBLA 1PZUB 3U36A 2YR3A 3ARDC 2V9TA 3VWKB 5C3LD 4QXWA 3FZUD 4KVCL 4RBPK 2BNQE 3B9KC 3AC0A 4NC1E 4PJIB 2BSRB 2P5EA 3IETA 2BXZA 2MHAB 3CXHK 4NRXA 1CE1L 2Y06H 3EOAA 4NQXA 1KJVB 5DA0B 3U9PH 4XVTH 4V1DB 2IBGA 5DRXB 5EU3A 4Z7WE 2RIKA 5GSVA 3RPIA 5I76B 1JHTB 4H1LB 4PJFB 1MCPH 3VMOA 4I0PD 3KPRD 5IOPA 3OF6A 5MEND 1FG2B 5FYJD 5K59F 3P4LA 4PJHA 3FT4B 4AEIL 2HJLB 2BXYA 3DSFH 2W60A 4OLZL 4M6AA 2XZAH 3LOWA 1JPST 4PJAA 3MRBA 3MRRB 5A16B 1U36A 2JB6B 4N8CH 2NY1D 1CTNA 1FYTA 1VKXB 3FKUS 4U0RC 4QXUL 3QA3A 1WWBX 1U3JA 3NZHL 2B8OT 2GJJA 2YXMA 5L8JB 4QOKE 2DLFL 1VADB 1X4YA 3DV4B 5EOQH 3SDDD 1RUAL 5AZEH 4J23A 4PJ8C 1UA6H 3RY6A 1S5HB 1RMFL 2RBLA 2HJFB 3FMGL 4U33A 4KK5D 2I26N 3HNSH 2YUVA 4QRPE 4OCSH 1X5GA 2JK5A 4OCWH 5BS0B 1J0JA 4JCLA 2I9LA 3N1GC 1JWSA 3L7EB 1P7QD 1NFDB 2A6IB 2YD4A 4MYWB 1EHLL 3QIWA 1A6TA 4RGND 4YHOH 3ABZA 3RIFF 4B0MM 5B4MD 1BVLB 2A6KA 1JRHL 1IM9B 4LPTA 4JZJC 4OM1L 4L4TA 2GQHA 3D25B 5IVXB 4YHPA 1YY9C 5C0AA 1I9IL 2JKXA 4Y5VA 3TVMC 1IGML 4AL8H 1NGYB 2L7UA 1WZ1L 1M7IB 2EZ0D 1XF3B 3KYMB 2OR9H 3WXVH 4KRLB 4KROD 2D7QA 4HUUA 4LRIC 3F6IA 5IVXE 1F6FB 2NZ9D 2JB5L 1A6UH 4PJ9C 4KI5D 3FRPA 1S7UA 3QDGB 2IQAA 3F6LA 1FQ9C 5I18H 4Z0BH 3D5OF 2Y9RT 3V9FA 2QQLH 1CE6B 5ALBH 3TYFB 3WD5L 1K3IA 3HAEB 4ZO6A 1LO0L 3HRZB 5E95B 1AH1A 1DANT 1DL7H 3R8QA 3NPZB 3FO1B 3VGHA 1UEMA 1BF8A 5KVMC 3GGWA 1ZT4A 3L7FB 4Y2DB 3C6SB 4PJBB 2WIIB 5T1LD 1XGQB 4DUXA 4N9GA 4XGZB 5HHNB 3A6BH 4F8QA 4EOWL 1HSBB 4FTVE 1CYGA 1X5FA 1U0QA 4YEFA 5JDSA 3G6JF 3ARUA 3ZE2E 2A1WL 5CEZL 4KKAD 4LVNC 1HNFA 1T80A 3GSOA 4JFEE 25C8H 2VR5A 2MHAA 3MJ9A 5E99L 1FVCB 2GSIB 3GHBH 5KVFL 4NO2A 1FL5B 1JGLH 5I8OL 4PR5A 4ZOAA 5ESQB 1P7QA 2Z9TA 1FFOA 4L4VD 15C8H 4U1LB 3B5TA 3BD4A 1RU9L 3IDYB 1DQJA 1MCJA 1RJYA 1N0XH 3I3DA 3NIDF 1NDGB 3E2HB 3CFCH 4KKNA 4U1NA 5DTFA 4X80H 2B7DT 4L4TD 1X5HA 4LLWB 1IC7H 1UZ6E 3ES6B 4G7VL 4LLMB 5E9DD 2GT9B 4I48A 3MV8B 3IFLL 4CL7A 2N4IA 4Z9KB 3GMLA 5AZ2L 1G84A 1BQLH 2P24B 1DQMH 2DM4A 1DLHB 2F53A 4NP4H 2WQRA 5HI4C 1BX2B 5CHNA 3ROOA 4NJAL 4IRSB 5JW4M 1GVIA 3C5SA 4ELME 2AERT 1BBDH 1OD7A 1PLGL 1OW0C 4L4VE 3MRRA 5A16A 4OIAA 5KVDH 4PJ5B 4OCWL 3MV7D 4OZGF 3MRIA 5D7IB 1S7QA 3VD5A 4B53A 2E9IA 1IAIH 4ZOBA 4YXHL 3RNQA 3GMOB 5F3BB 3OKNB 4FP8L 3PWUB 4P46D 3D39B 1AFVH 1T0MB 4PLJD 2NY0C 1U9KA 1MHCB 1XR8B 3KPQB 3GZKA 4HCRA 5CILL 2J88H 1MCEA 1Y0LB 4HPOH 4FQXB 5EU6A 3EGSB 3TJHD 5EUOB 5TQ0L 1I1CA 1A1MA 3X12B 5D2LF 3I6GA 4HH9A 3QI9B 1B0RA 1MFAH 2A74A 2QHLA 4NP4L 4XBEL 4K3EL 5HVWA 4KXZI 1A7PH 2P44B 3RAJL 2FIKB 3QPXH 5SWZD 3Q6FA 3REWB 2DQCH 2FWOB 2EE2A 4G9FD 3FB5B 1CDJA 2GSGB 3ISWA 5A3IC 5FA4B 4JQXA 4OV5B 3WFBH 1QLRA 1DE4B 3BE1H 4GKZB 3P73A 4PRAA 4JRXB 3DECA 1UYWL 4OAWA 3T09A 4JQIL 2R2HB 4N0RA 4MJ6A 4TSBL 1S7SA 5FYLD 4JZJB 4M3KB 1IZKA 1W2KT 5HJ3A 1JE6A 4PG2C 3OAYK 5F7MC 3G5ZB 4PFEA 5EOTA 3VXQA 4A6YB 4H0GA 1F2QA 1WT5C 2MPAL 2ICEA 2CDEA 3C2AH 4OZFB 4YHYB 4KK9C 2A73A 4UAOB 5D5MF 1OTSC 4KMTL 5D8JH 4PPTA 4R96A 4XP1H 3QNXB 3HUJF 1A7BA 25C8L 5I75B 1NCCH 3CFDB 4R2GD 1NBYB 1XMWA 4WW1B 3MNZB 3V79C 4J3SA 3STZA 1JMZA 4AJ0A 3O45A 4LNRA 3SQBA 5IIEB 3TBTA 4X0KB 4XB7A 1CXKA 1E27B 3UTTD 4DGYH 5FB8A 4AIXA 3O0RL 3E0GA 3QUYB 1NC4A 3FT4A 1F5WA 2R8SH 1FFQA 3LS4H 3TN0C 1RZJL 3H42L 2YPKB 5ITFA 4ACPA 3VXSE 1RJLA 3IDIB 1XGPA 2R4SL 3N85H 5D93B 4Z5RA 5IJVB 4Y4FD 3TN0A 2VLKD 1C8PA 2YD6A 3LV3B 3TPKA 1V8HA 1BAFL 1P4BH 5DQJA 4LEOB 2NY4D 4HBQA 4C83B 5IB2A 1S9XA 5DRWA 1GSMA 5C0EB 4BFBD 3B83A 2GYSA 4RSVA 5CP7A 4G9FE 4OLUL 4DVBA 1BBJB 3QWQB 1KXQE 4F15B 3UJTL 2FATH 3VRLF 1Z9LA 1ND0B 5D7KD 4TQEL 3CMGA 4PRPA 1S7VB 1X5KA 2R2CA 5GGRB 1FZMA 3LQAH 4PJ7B 4AIZB 1MOEA 2F74A 3C60D 2O5XH 3ARGB 4LU5H 1CFSA 3GBNL 2E8ZA 4ZYKA 1EHLH 4P2OC 4X7TB 5FYJU 4G6JH 1R6VA 2ICWB 4DGVH 4LRNL 5D1XD 2UUDK 3C6LB 3RX7A 3C9NB 1LE9B 1TVHB 1WBXA 1PEZA 4Y5XB 1MH5A 3S98A 3AROA 3TYFA 5DD6A 2VR4A 5IHLB 2X4QB 4G6MH 3TNNB 2VR9A 5I18L 2AP2A 1KB5B 3H9SA 5I1AB 4QGTA 2G9HB 4JHAH 4HEPG 3VCLB 4WFFD 1SJEB 1YNKH 5KSAB 1KN2L 4UTAH 3MO1A 5F7HA 4M6NL 2O5YL 1OCWL 1RHHA 1C16B 4NRZA 3CXDH 1NGZB 1GPOH 3EO1B 5JW4R 4X5XA 1UB6B 1TVBA 3N50A 2QQKH 1YMME 3O2WH 3UJJL 1IGYB 1MCCA 1SMAA 1X5AA 1KCKA 3RGVD 1NLBL 3OKMA 1MRCL 4MD0B 4Y8AA 5SV3A 2ZZUT 2GJZA 2R0ZH 2Z4QA 3DVNA 5DFVC 2DQHH 5GZND 1P7QB 2EKJA 3OKOB 2WP3O 1XCTB 3ARTA 1EVUA 1FFPA 2PTVA 3GSXB 4RMUA 3FB8B 1DZBA 1RUMH 3PWNB 4PRPE 1FO0A 4XBPA 1RIVH 4M9OA 4OF8A 4XVUD 1ZV5A 2H9GA 1UQSA 4Z0XB 1JZ6A 4G80B 5TF1H 3SQOH 3UTPE 4B41A 1IE5A 2CMRL 4N0YH 3AB0C 5MHSE 4HLZG 4WRLA 4LLQB 2C3XA 4NNYB 2MQ0A 3QA3B 4XHJD 5BV7H 5JIKA 1SHMA 1E4WH 2HLFC 1JTTA 5CSGA 3QNYB 4NUJB 2CRMA 1DQJB 1R3IL 4B7LA 3U0WH 3EUUA 4ZO9A 3TIDA 2HJLA 3C9NA 5DUML 2GJ6A 1P5UA 3CFIC 1KTLB 1JJUA 4JO2L 1I8MA 3V6FB 4S1RL 5C07B 5DVNA 5LKNA 3VFWA 1Q0XH 4PRHB 4POUB 2X4SA 4WY7L 2NY0B 2CLVA 3TCLB 2NTFA 5D72L 3WJJC 1FNHA 4JQVC 5EC2A 4PV9B 3L5WA 4L8SA 3TN0B 1OAQL 3BT2H 2ATPA 3QIBA 1BVLA 1T83A 4KJYB 1AGFA 2LVCA 2XZCH 3BJ91 1CFTB 1FFNB 4FFYL 3QIUC 4DKFH 2NY6D 3PABA 1A3QA 1N6UA 3SKMA 3MJ6A 2VZTA 1OTTC 4M1DL 4OZHB 2EXWC 3LZFH 4FFYH 4P2OA 1D6EB 1PZ5A 4P23B 1JGDB 2PYFA 1HHHB 2QSTA 4AG4L 3H8NA 3PGFH 3PQYD 2H1PH 4OTXL 2P5WA 2JIXB 2V2XB 1VGEL 4YHYC 2AJSH 2NCMA 4PJ9A 2D0GA 3VW3H 2E27L 1TCMA 5KZCD 3ZDXF 5FYLL 1AQDB 1CZ8H 4WWKC 1JPGB 3ZYIA 4D0CA 4QHKI 1T66C 2O26U 3K1DA 4PJBA 3VGGA 5C2UB 1LO3H 3HI5L 5IHUH 2AKRB 1U8JB 3CLEH 4JZOA 3CMOH 4PGDA 4NN6B 3OB8A 4EBQH 2IAND 1FG9C 3BMVA 3PDOA 1CGSL 4TVSa 4DCQB 3S88H 1PKQE 3RWHB 2X1OA 4JDTH 5HD8C 3BW9B 3QP3A 3S5LA 3T0EE 4JJ5B 2BSTB 1KPVA 1YEIL 3CDGB 3V2AR 4APQB 3GNMH 1FZKB 3H9HB 4GAJH 3L7FA 4X83A 2VDRH 4U1GB 4HIHB 4M5ZH 3L5XH 1LHZA 2HVKB 3I6LE 4JO4H 4GMTL 2YUWA 3FQWB 4S1QH 5C0BD 3U4EA 1VGKB 3ZTNL 5GS1B 4U7MA 3IJYB 3W0WE 3WCYA 3W9EB 2QKIA 3FQUB 3SE9H 3GSVA 1D6VL 3NVQA 2A9ML 3GO1L 4H8WC 3GRWL 4ZFGH 5C7XH 1IEHA 5CS7A 3D6GA 4IS6B 1YEJH 5CBAA 5LGHL 4HW6A 2AK4E 4R26H 3D0LA 1MREH 2FSEA 3UO1L 3ARDB 3E8UL 4HQQL 4XNYL 1ZS8B 2P8PA 3FQTB 2PYED 2DQUH 1UC6A 5FUZH 2AJVH 1Y6NR 4FNLL 4KKLC 3VFOA 5CWSA 3TA3D 3JUYA 3WFCH 4WW2B 2R1WA 4WHYH 1R3IH 4G9DA 5DT1L 4WI7A 2VWEE 3I2CL 3TPUB 3J7HA 3FQRA 4FQXD 4BZYA 1J0ZA 5D4QA 1YNTB 3HG1E 2FLRT 4OM0L 3ZE2F 1ERNA 3QCTH 5EUKA 2A38A 3O3BB 4Q9BA 3MV01 3RDTD 3NABL 1T21B 3WXWL 1U3HD 3QWOB 1S7QB 1NCWH 3C09C 4U7KA 4PD4K 3HG1D 3B2UD 4HS3B 1IM3A 2HAZA 3DX9B 3JXAA 4ONFL 3TNNA 2KZWA 4Y19D 1YMHA 4APQC 2WINA 4KPHH 3QXVA 4OSUH 2Y6SC 4MA7L 5EBGA 3WJLC 1OGAD 1MCKA 2IALA 4OZHE 1TIUA 1YEDA 3F7RA 4Y2OA 1BMGA 5DJYB 4ZNEA 4YZFE 3KPSD 4RWYH 4NHUB 2AK1H 4FQ2H 3RWEB 1FAIH 3MGTB 1UACH 3ARZA 4LRNH 1A9BB 5GIRA 4G6JL 4W4NA 1T2XA 4CW1B 4ORGA 4Y4KB 2AJYH 4P2OB 3GMOA 3WIIL 2DF3A 4LEXH 4X4ZA 5DQ9B 1D9KD 3QH3B 5D5ME 2P5EB 3IETB 1WGOA 4YHML 3W2DH 3ARGC 3WV0A 1JWUB 1RSFA 1NGXA 5JMRA 4KKCD 3QEQE 3T2PA 4M62L 4CKVX 3QDMA 5HYJB 4L3CA 5EZJB 3K8MA 1QRNE 4DUWA 2EDHA 1T0NA 1FVCA 2GSIA 4HS8L 1D5MA 4GG8A 2XNAB 2A6JB 1U6AH 1M4KA 3ZT6A 1F11B 4OZIA 3CMOL 3BQUD 4OCXL 3BKJL 2Y4SA 4HHAA 4DEPC 5I8CA 4AYFA 3MCLL 4JY5L 3SE8L 1GGIH 1HHJA 1F4XL 1ZHLB 3MRFA 3X11B 1MRDL 3GRWA 1HE7A 1MCOH 4H5SA 1VADA 5A2LH 2NR6C 3QHFL 1CK0L 1QNZL 4RIRB 4XPGH 1JWMA 1YMMD 4LSRH 4DKEH 1FFRA 4ODXA 5DWUL 4W4OA 1RFDL 1KCRL 3X3GH 1NL0L 2H45A 4RAVA 1H3GA 2NXZC 4WFED 3RY4A 4UIMB 5F9DC 4XXDB 1JGEB 3B8YA 4HS6B 2X70A 4YC2C 1KJMA 4FXGA 2JCCA 2DBLL 2FB4H 2BVQA 1T2QL 2BFVH 3KPNB 1T1XA 4HUWA 5E4EB 2XKNB 4RMTA 2FO4B 2D4FA 3U6RA 2YRPA 4ZD3L 3FOMB 5I1IH 1FG2A 4OD2A 1LE5A 2DTMH 4Z0XA 3UJTH 3C8KB 5H35A 1P7HL 5DZOA 1FO0L 5EU3B 1LDPH 1HSAB 3TO2A 2FX8H 4PJFE 4Q2ZA 1ZEAH 4HUXA 1IAOA 3LKRB 3SKOA 3AMKA 4XC3L 4BSWB 1DBAL 1GIGH 2R56H 3WLWC 5DK3A 1D9KA 5GZOC 1MFCL 3OJDB 5KSBF 1W8OA 4PREB 4JFPA 5D2NE 1AGCB 3ARBC 2XWJA 4XNQA 3LN5B 2OL3B 3AB0B 3Q6GH 1T7XA 2VTFA 1K8DA 4EN3C 4M02A 4Q0XH 5ESVA 1WAAE 5FKAB 3C8HA 5GZOD 3B2VH 1T5XB 4OM0H 3WLWD 2AXHA 4GQPH 2GKIA 4CADA 5DD5L 1IMHC 3HAEG 3MLVL 4XP6H 4XP5L 3HNTL 4YHIB 4LRIA 1JTPA 1X7QB 2YSSA 3GMNA 1SBBA 1FVEB 5EU5A 5JOFB 3KJ6L 2FR4B 4UUJA 1LEKB 2AXFB 2VDOH 1JTOA 4LSPH 1MJJA 1WWAX 4N0CD 4DVRL 2AW2A 1JYVA 1OL0A 4FQLL 3HUJE 4HQQH 4XNYH 3ULVD 2XICA 2YOCA 3SPVA 2J88L 3KYOB 1LEGA 3MMEB 3BN3B 1MPAH 4ZPTA 2J8UA 2R9HC 3CDGA 3MLSH 1DQLH 1X4XA 4APQA 1YMMA 4OKVA 5DRNA 4M7KH 5IBLD 3CPLA 1B0GB 4K23L 5TGBA 3QIWC 1U8JA 1JHKL 4AQOA 4TRPH 4UILH 3RHWK 2AV1A 1AE6L 4HMDA 3KPLB 2WUCL 4PGCB 1TLKA 1W72H 4M93B 1JI2A 4JO1L 3UTZB 4U6HB 1DEEA 2J8UB 2P5WE 3BPOB 4Z7QF 1AHWB 4TRPL 3MGOA 5B3JF 1NGXB 1AGDA 1Q72L 2JJWA 4IS6A 3NPSB 1BBDL 4U6VH 5F9OL 3WFBL 4R4ND 4MGXA 2HFGL 1A1OA 1DBKL 5EG6C 3VI4E 4PJ8A 1GAFL 4QNPF 3U46B 4I0PB 1NLBH 1PG7X 3O4OB 4K7PX 2B1AH 1DQML 2Z4QB 5DMGC 4FA8A 1UWGH 4YIQA 1FH5H 3Q3GB 4XMLH 4EQ3A 1SY6L 5DURD 3UPRB 2CKBB 4XCFH 4PRHE 4OZHA 3D9AH 2EC9U 3VE0A 4XP5H 2M26A 5IB1B 1Z0MA 3IS0X 1FC2D 3X11A 3MROB 1MAMH 2BP3A 2O5YH 3S9DB 1R5IB 3HNVH 3QAZB 4P59L 1NUNB 1U92A 1X44A 2OR8A 3BP7A 5JPMB 5EOCH 2X1QA 3MCG1 4PJEF 1RPQA 5D7LE 4P5MB 1DBJL 1RZ8A 1BQUA 4AEHL 4PJ7F 5I76A 1U8MA 2VKXA 4LKXA 4G8EB 4IMLA 2XI9A 1JGEA 1NGQH 4HS6A 4CDHA 4L3ED 4KQ4H 5T3XH 1EBAA 2WINB 1FV1B 4X6FB 2W92A 4I18A 2WK2A 4HZAA 4NO3A 4ZDHB 4J3TA 2Z31D 1MVUB 1P9MA 3HI6H 1NGWB 5GGTH 4D0DA 1T2QH 2Q7NA 5MERB 3RKDD 3S37H 3IU3A 4UT6L 3RY5A 1BQLL 5FXCH 4APQD 4NC0B 3BEVB 5E4IA 1KJ2L 4JY4B 1I3UA 4CW1A 2YD7A 1KIUA 2K9UA 3D48R 3T0VA 1E4XL 1MHEA 5DJDB 4G7VH 3MFFB 4Z95H 1U3HC 4HT1H 3GI8H 4NQDD 4Y89A 2L0DA 1KACB 5D72H 4OD1H 5T3XD 3HE6B 3MC0A 4LPCA 2FLBT 4M03A 5KSBB 1PDKA 2C7UB 1I8IB 2GTWB 4KKBD 1J1PL 3EYFB 4QYOB 1N5YH 1MNUH 2BVPB 3BAEL 1U8PA 4QY8B 3IDUA 1J8HD 2CKNA 4P3CH 2O61B 4JR9L 2WLYA 4MJIB 3MJ8A 3K0WA 4ZPVA 4PRHD 2ZOLB 1T21A 3HUJB 1JYXA 4Z7VA 5HYSB 3MV11 1TDQA 2A6DB 3LH2H 4NPYB 4ZG1A 1PVHA 1OGAB 3WUWB 3PL6B 3PQYB 4LSSH 4O02L 3DX8B 2ESVA 4OFYD 3M1BB 2ILLA 1ACYH 4M62H 5FOBA 2DJ4A 2K7QA 3SGEH 3H0TB 3UTTA 1I8LC 4E5XA 4PTTB 4UIMA 1JPSH 1CS6A 2NY6B 3PIQB 4JQVA 5CJBA 3AUVA 5GISH 3PV7A 1QZ1A 2ERJB 4GT7A 4RWYL 1H5BA 4LCYB 2VZOA 5I66B 1W0VB 4O5LH 4EUPA 1RZ7L 2EH7H 1NCDH 1ZANH 3RJDA 3SDXE 4GRMB 1IEAA 2XTJC 1FVDA 3IDMB 3NIGE 4MDJA 4GRLD 2VLLB 4IDLA 1KPRA 1TENA 4WO4B 3MLTB 5BOZG 4CN4A 4C56E 3PV6A 4OFKA 4PJBF 1VFAB 1MFDL 3JV4B 4AEHH 2GIYA 3T4YA 3AS1A 1T66D 4X5WA 3IU3B 3OTTA 3UJJH 4WWKD 4E0RA 1WWCA 3T0EC 2HWZH 2IG2L 1MFEL 3CDCA 3VXRE 1U92B 5TQ2H 4OF6A 1ES0B 5E5MA 5I15L 5D1QD 2G2RA 1A1NB 1WICA 2BC4B 4GMSH 3EYSL 3TO4A 4HKJA 3MA7A 5FCUL 4JHAL 4U3CA 3KPSE 2UWEE 3Q3GA 2NW2A 4N8PA 1QACA 3O6MH 4JN1L 1QTYT 4PRHA 2GY5A 1ZS8A 3BKMH 3H9HA 1S5HA 1BVZA 4QTIL 4WV1A 5DYOB 3Q1SL 1NLDL 3JTSA 5J06A 3GIVA 3ZYOA 2HH0H 3P9WB 4F37K 3L3IB 2IFGA 4YWGH 2IANB 1A21A 3FQUA 4PJBE 5BO1L 2BOBA 2FGWL 4YFLF 1KYOJ 2P45B 4XP9H 4HCRH 1IC5H 3MOAH 4ONHA 4N1HB 3REVA 1I1RA 3TESA 3HLAB 3SE9L 1X5ZA 1D5IL 4L1HA 1FCCA 1S9XB 4WO4D 1ULVA 2Y07L 4BQ8A 4JFYA 3L3KB 3TVMB 1HSAA 3HMXA 3IDIA 3FB6A 4DKDC 2P5EE 3S88L 5AZ2H 4RCAA 4OZIE 1EX0A 1K4DA 2UYLA 2VLME 1G6VK 1NCAH 4YK4C 4QXTB 3VDCA 4MD4A 5I74B 5ICZB 1MWAA 4OIIL 2FO4A 3LKNA 4PJ9B 4XCCH 3I50L 1JCKA 1KEGL 4ZO8A 1A7OL 3CXHJ 1IC7L 5HGDB 3H7LA 1B4JH 2MJWA 5DD5H 1I1YB 2HLFD 4XWGL 5F6HI 4PGEA 5L8LB 5KVEH 5CBEA 3RVVC 3N9GH 5DVOA 5GIRB 4KZDL 3BYTA 1F4WH 4BZ1H 5C08A 3VFMA 3QR2A 1PBYA 2BJML 5IHUL 4AM0A 4PGBB 1XF1A 3SPVB 3LB6D 5EB9A 1QBLL 2CO6B 3ILQC 2OBGA 5FYLH 1QFUL 3F62A 5DEGB 5D1QA 3MBED 4QHNB 3WN5A 3D25A 4U6YB 1MEXH 1IAMA 1I3VA 3BHBA 1E0OB 2DQDL 4HF5H 2IF7A 4PD4J 3QFJB 1MWAL 5CSZA 3OX8B 4JPKL 1N2RB 3IDXL 4YK4B 1J0YA 1MJ7L 4PJDF 1DQTA 4OV5A 4MJ5A 1A02N 3MYJA 4PJIF 4HF5L 3OZ9H 2DTML 3UXFA 2ZCLH 4X9GA 1NDMA 3X13A 1IQDB 3DX8A 3P2TA 1A5FH 3DUHA 3SDYH 3U2SB 1EZVX 4P5TB 2VL4A 3K2UL 1U95A 1G9NH 8FABA 3O6LL 1CFQA 5AD0B 2VABB 3IDJB 2GTZA 2MWCA 3BO8B 2V5YA 5IVZB 1U8OB 1BQSA 4TTDD 5IB5A 4OF3A 2FEDC 3WIHH 4KJPD 1HHGB 3DO7B 1INDH 4WHTB 1KENL 4OCRH 4OUOA 1I8MB 2HYMA 2ITDB 3P4MA 2UY7A 5IB3A 3E6FB 1MF2L 3KPNA 2DYPB 4TULH 1IGMH 3BMWA 3CLFL 3D85A 2G5RA 3BZFB 3S6CA 3BKJH 4AL8L 5LXGH 3L3OB 3SKNB 5IMLA 2A83A 4G3YL 4CVWA 1EK3A 3ZE1E 4PB9H 3FFCD 1B88A 1KYOK 4F9LC 3TM6A 1QFHA 1KCUH 5T1MA 5D1XC 3QEGL 4UT7H 1QA9B 1QD0A 2YUZA 5DSCB 2Y07H 1RHFA 5IJKC 3PQYA 4J6RH 3A67H 1QRNA 1CICC 1U8IA 1AIFA 4A2MA 3GMPA 3EYOB 1IC5L 1KOAA 5FYKU 1H8OA 2R1WB 2IQ9H 4YWGL 4MD5A 3SDAA 3BGFB 4FTVB 4S10A 1I7UB 2BY3A 3MLWH 3U82B 3NCFB 4ZFOA 3MJ9H 3TC9A 2DQHL 3GJEB 1EZVY 1O7VA 1JZ5A 1ZHBA 3C5ZC 4MAUL 1CT8A 2F19H 4JE4B 5I15H 5KSBA 5HHXH 4U0RB 2W0FB 4ETQB 1RIHL 1C12B 2VAJA 1YEHL 1LP9A 4QXUH 2NY4C 5DD1H 3UBXB 1VFBB 2ZCKH 4Q6YA 1FJ1A 2X4OA 3LIZL 1WQVT 2QQKL 1H15B 4OLZH 2JK5B 5BS0A 4DZ8A 5BV7B 5D7KE 2BVOB 3C08L 2KUTA 1CQYA 3QYCA 1JL8A 3QDAA 5E2TH 3FTGB 3G6DL 2ADGA 1CFTA 1FFNA 1YN7A 5HSFA 3QCTL 1XGQA 1SJHA 5GS0D 3GM8A 5IB4B 1NMBL 5C0BA 2H2SC 4X6CF 1T7ZA 1YEHH 2F58H 3I85A 3MV9D 1X5LA 3KPQA 3QIBB 2YD2A 3RUGF 5KS9A 1L6XA 5DT1H 1HHKB 3TCXA 5KANG 1BZ9A 4O4YL 4XI5C 4YO0B 1EPFA 1D5BB 4Y1AB 4Y16B 3G08A 1TCRA 1EO5A 4LVOB 2OX5A 4O58L 4OBRA 3O3UN 3MZTA 4RGMB 5EULV 3ZKXC 5BVJB 1EO8L 3LS5L 3T0WA 1ACYL 3ECBB 1E28A 1CLYL 3QDMB 4Y16D 4I13B 3KHOA 3NAAH 2GEEA 5DJ0A 3QJFA 1WJ3A 1OP5H 4LCWE 3V5HA 1UFUA 5E00B 5GRVL 2ZNXA 3MJ7B 5IB1A 1FL6A 5GJTH 4FQQA 4K71B 3NGBB 4F33A 4Y8DC 4GRWB 4MXWH 4JFOB 4YX2H 4OB5H 2EE6A 1LO0H 1RY7B 3GNML 3MV8A 3IDMA 4RRPG 3SGDH 5T1DH 3F58L 2FJFB 5FF6A 3W39B 4O2FB 5I1CH 3IF1A 3V0WL 5M95B 3MUZ1 2X4RB 2AQ2A 2Q87A 1IGTA 3VI4F 4G80A 1A6UL 5K59E 1KB5H 5C6WH 5JOEA 4NO3B 1OT1A 5C09A 4QKXB 1MNUL 4LKCA 2D7MA 4ZTOL 3HHRB 2IC2A 3QUMH 4NNYA 3V4VH 2V17L 1PSKL 1INQB 2BSSB 1Q94B 4M8VA 4OI9A 4P46C 3GDBA 3U4AA 4BQ9A 5L88H 4NRYA 5E8OA 4RNRB 2PO6C 5C0CA 4JDVB 3EOTL 1AIFB 1A47A 4IJ3C 3AY4A 2VZ3A 5JHDE 2ZUUA 4YHZH 3O0RH 4LLUB 1NCCL 1FZMB 2VLJE 4ETYA 3S37L 2ATKB 3QDME 3RNKA 3BQUB 5SWZE 3BPLB 3OGOE 3SCMB 5MEPB 3I02B 5IV2B 5HI4D 3MXVH 3UTTE 3EHBC 4WEMB 1FNEA 2HVJB 1RZFH 4XNXH 5BJTB 3U48A 4Y1AE 3REWA 3MXWH 5C0GA 4Y16A 5M7QA 4MQXC 3V6ZB 3BYYA 2AJZB 3ETBF 2HN7A 3KS0J 4OLWH 4JQIH 5DS8A 4HUKB 4KJWD 4F2MB 1CXEA 1J86A 4MJ6B 3QUMA 1KN4H 3ROOB 4PLKD 4X98B 2Y7QA 2I60H 3LCYA 1JZ4A 3QWOA 1H9VA 3VMPA 4EIGB 1RZGA 2DQCL 4OFIA 2Z93B 4P59H 1RURL 3RWGB 1Q0XL 1N4XL 5B8CB 2XY2A 4S1RH 5IBUG 1OAYL 3KYOA 1OSZA 4UTBH 1DCLA 2NY7L 1MCQA 1BM3H 3GJFA 4X6EA 1BQHG 3O3AB 3O4LA 4WGVB 1ONQA 5I75C 1MH5B 4XVTL 3BZFA 4WFFE 5EUOA 4HGMA 5F9JB 3QG6A 5D6DC 4JPVL 1QR1A 4OI8A 5JOFA 1G7PA 2FR4A 4IRSD 3RY6C 3BKYH 4MJ5B 1XT5A 1MY5A 3P4NB 1F42A 3MBXL 1CE6A 4K23H 1J0IA 3QT2A 3IFOA 3IYLW 3GMRB 3SO3B 4HBCL 3EYUL 1M6OB 5MP6H 1FNAA 2IADB 1DQDH 4R0LA 1H3TA 1FL6B 3QHZL 5HHMB 2BHZA 1T1WA 5FCSH 4E41A 1W0WA 3IFNL 1L9MA 4BSWA 4NM4L 1T2JA 4QT5B 1QQDB 4JN2B 4MCYA 3MRDB 3PP4H 2XNAA 4NBZB 1GGBH 4HKJB 4CDGC 5BVJA 5LBSL 1IQWL 4NQCA 1QSED 4KI5C 2HT3C 3MRBB 5FCUH 5AAMA 2FECI 4U7SA 2CDGB 4JREB 5HPMB 3BGFC 1U58B 4KROC 4YAQA 1IGJB 1UCTA 4OGXH 5L88L 1Q9LB 2CKBL 2VOTA 3K80A 5C2BH 1MUJB 1BEYH 5IFHH 1CVSC 1QSEE 1YY9D 4N8VB 3UPCA 5J6GA 3OQ3B 4FXGB 1BZ7A 3LPFA 3R06A 3QFDB 2YD3A 1MIMH 1KIQA 2CLVB 1GPOL 2V7HB 3BVNA 4X4YB 4OLWL 2EIZA 1WTGT 3REVB 3RL2B 4BELD 3BESR 3EFDH 3I84A 1P7KA 3MCKB 4OCLC 4YUEL 3MV8E 1UT9A 4J3VA 5E94B 1HEZA 4OCMC 4GKOA 3O45B 3WO4B 4Q6IB 4CVXB 5C86A 1G7MB 3TBVA 5I1CL 2Z8RA 1PKQB 1ZANL 1JZ7A 1UWXH 2GAZB 3WNLA 1VFBA 5CEZH 4FQHA 4K55A 4K9EL 5GSRA 4XP4L 4MVBC 4ZXBD 4M48L 1MI5A 1EUUA 4EOWH 1MCNA 4IRSA 4W6YB 1W8NA 4PJ8D 5ID1A 3EJYD 3MNVA 4QRRD 4POZD 2YPKA 3B6SA 5ITFB 3SDDC 3EO0A 2OI9C 5C0DB 2QQQA 4Y4HC 5IB4A 4WI4A 4LU5L 2DBLH 1CK0H 2FB4L 4K3DL 4MB3A 3T8XA 5MERA 1NCBH 2F9BT 5EDXA 1KNOA 4PREA 4O02H 2FL5B 3FQXB 3U7YL 3PWVB 3WNOA 2NY1C 2JIXD 3T04D 2IBBA 5KS9F 3LQAL 3L5JA 1TQCB 3V4VL 4Y5VB 1TZIB 1QRNB 3FRUB 5ADOH 1MFBL 1MCSA 1DDHA 2R0WH 5CAYB 4TQEH 3BRFA 4OCXH 4ORGB 4Y4KA 1ZT1A 5CJOH 4I9WE 3D3VA 3QEUA 3ECBA 1WFNA 4I0PC 2BNRD 1HIMH 1JV5B 2P42B 3WKML 1XIWA 3D0VA 3KLHC 1AKJB 1QHPA 1OAXL 2ICES 2AJ3B 4I2XE 1Y18B 1CD9B 1C5BL 2ZSVA 2R4SH 1CGTA 1H3PH 1UCBH 3FZUC 5HBBA 2Z31A 5E03A 4MA3B 4NKDB 3HC0B 4FFVD 1KTDB 5IK3A 3B5HA 3QDGE 1ES0A 2X9YA 4L9LB 4DTGL 4LEXL