1BPNA

Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
484
structure length
481
Chain Sequence
TKGLVLGIYSKEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUCINE AMINOPEPTIDASE
publication title Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(alpha-aminoacylpeptide)
total genus 150
structure length 481
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1993-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1bpnA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1bpnA02
4OKOA 1XMBA 1XBUA 3NH8A 1AYEA 4LQGA 4FBEA 3PB9X 1Y0RA 3B3WA 1CP7A 5HVGA 1CBXA 2PJ8A 2BFQA 3WC6A 4P44A 2GU2A 3SJXA 4UMLA 1JQGA 1Q7LA 4RUHA 1LANA 2Q43A 2QYVA 3D4UA 2AFSA 3B7IA 1YW6A 4ABLA 4F9VA 2IMOA 1ZG8A 3K9TA 2ANPA 2PJ5A 4P6YA 5LYLA 1CP6A 4OC0A 2EEEA 3WABA 2AFCA 4ZI6A 2IQ6A 4TU0A 3PBEA 4F9UA 2PJ9A 1YSJA 3SIIA 2AFMA 1TF8A 4MCQA 4NGNA 4F8ZA 5LRKA 1NJRA 4OIWA 5J1QA 3RAMA 4X2TA 2PE3A 5FSUA 2PIZA 3HLPA 3CPXA 1TKHA 1R3NA 1HDQA 2V8HA 4P4JA 1AMPA 1DTDA 4Q7AA 2PJ1A 4O23A 3D66A 2XD7A 4WJBA 2L8RA 2PIYA 3WC5A 4PXEA 3S9LA 1DE4C 4P4EA 3CPAA 1TXZA 2FVGA 2O53A 4K3NA 4MHPA 1LCPA 1CPSA 2XEGA 2WZNA 4MCPA 3GQEA 2LGRA 1HDUA 4NGPA 2PJ0A 1ELLP 3B3CA 2ZEDA 3S9NA 3MRUA 3V45A 4H2KA 3EW5A 5FSVA 4X8IA 2PCUA 3IEHA 1ZG7A 5CPAA 4ZX8A 4NGSA 5E3BA 2RFHA 4OC1A 4PPZA 5HVHA 5I4MA 4FWUA 1R43A 3BI1A 4NJRA 1CX8A 2WYRA 4B6ZA 2VL1A 1UWYA 4GUAA 3K2KA 3KHZA 1H8LA 1VHOA 1EE3P 2ZEEA 4TWEA 1XJOA 4OC4A 7CPAA 5FSZA 4IK2A 3SI1A 4A37A 4PXBA 1BLLE 4EMEA 2BOAA 1F57A 3D7FA 3D68A 1TKFA 5FSYA 2EK8A 2ZOFA 2NYQA 2PJ3A 3DGVA 2V8VA 2PVVA 3LMSA 2XEFA 4ONWA 3PEIA 5JGFA 2NSMA 2V77A 3WT4A 5HVFA 3IIFA 4JZ0A 3V7ZA 1XFOA 3ISXA 3KI9A 1VHUA 3VFQA 2JBKA 5LRGA 2AFZA 2ZEOA 4JCAA 2POKA 3ETIA 4UIAA 3RBUA 5CMSA 4IQYA 3FF3A 2ZEGA 1ELMP 2QJ8A 2C6GA 3CDXA 2F7VA 1FNOA 1ZR5A 1VIXA 4A39A 4NGMA 1M4LA 2OOTA 1CPXA 3D7HA 3SJEA 4NGQA 2PJBA 1Y7EA 3IWWA 2C1CA 4FUUA 4ETKA 2PRQA 4MCRA 4ZY0A 4FAIA 4R7MA 3KR5A 3Q71A 4ZX9A 3NFZA 5D8NA 4R8FA 3DLJA 5K8OA 6CPAA 3IFEA 4JVVA 2V8GA 2ZEHA 1HEEA 4PXDA 2DX6A 1Z2LA 5DUSA 3KASA 4MMOA 1F2PA 2C6CA 4ZYQA 3FEDA 2PJ7A 4JGKA 3PB4X 4W9YA 4EWTA 2JBJA 3BI0A 5K8PA 3ISZA 4PQAA 2XEJA 5AILA 2AFWA 4NJQA 3SJGA 3IIBA 3FJUA 4X3RA 4OC2A 3H8GA 1YMEA 2Q51A 2CIJA 4UEFA 3LWUA 3FX6A 5HOLA 4R76A 3JRUA 2EK9A 2J9AA 3V38A 2FG1A 5THWA 5K8MA 2PJAA 3FH4A 2BCOA 1LFWA 2IJZA 3QNVA 2FAVA 3PRTA 3KHXA 4A38A 3L2NA 4GVWA 3NH4A 1BPNA 4A94A 2BO9A 1LAMA 3KQXA 3FVLA 3GUXA 5D29A 4AXVA 2QVPA 3SI2A 2ACFA 4NFRA 4J5RA 2C6PA 3SIJA 5ELYA 4IHMA 4GVVA 4MXUA 1KWMA 3VARA 4P4FA 3EWOA 4OMEA 4D86A 4G1PA 2ABZA 4UIBA 3V2BA 3TX8A 1SPVA 4R6TA 3VH9A 5IB9A 3EJFA 3GPGA 3PB8X 4IAVA 5LYDA 5F09A 1PCAA 4J5QA 4NGTA 1YD9A 1BAVA 3GLJA 2ZEMA 3JZTA 2EWBA 1ZG9A 4J5SA 4UEEA 2GREA 2HB6A 2CF4A 4DYOA 4J4ZA 3GQOA 3B3VA 4P4BA 4ZY2A 4YU9A 2PVWA 3KL9A 4DJLA 2Q4ZA 2CTCA 3IO1A 3PBBA 3B3TA 5K8NA 4KYBA 4Z65A 4EFDA 1YLOA 4P10A 3KZWA 3GB0A 2JEWA 3HUVA 2CTBA 2XEIA 4TNUA 2ZELA 3KR4A 2ZOGA 1NSAA 3WC7A 2G9DA 2V8DA 4ESSA 2F8HA 4MHYA 4OIDA 2I3CA 5CB3A 3FMCA 1GYTA 1CG2A 5HXDA 1TXRA 4MHNA 4OP4A 4MHZA 3I1UA 5LRJA 3SIGA 3IC1A 1HJZA 1ARLA 4P4DA 4P45A 3H8EA 3KQZA 4GM5A 2GLJA 3T8WA 3FEEA 3BXMA 3H8FA 1PYTB 1RTQA 3MN8A 2ZEPA 4CPAA 3EWPA 2AFXA 1QMUA 1TKJA 3FECA 3PFEA 1ZR3A 4P4IA 3D67A 3D7GA 4YWYA 2OR4A 2PJ4A 2PJ6A 1VGYA 2O4HA 3EJGA 2ZENA 5DS0A 4ETJA 3B35A 1ZLIA 1OBRA 3NH5A 1VHEA 3CT9A 4BD9A 4OC5A 5CB5A 3TC8A 2FXKA 3EWRA 5CBMA 4PXCA 3RZAA 1TF9A 1FT7A 3PB6X 3SI0A 3GPQA 1XRYA 1TY8A 1LAPA 4JLLA 1ZLHA 3VATA 4K0CA 1Z8LA 1QQ9A 1LOKA 3SJFA 3KGQA 2PJ2A 2AFUA 5JM6A 5LYFA 3PFOA 4UF4A 3Q6ZA 2ZEFA 3IIDA 5JH9A 1F2OA 4NGRA 3N5FA 4UEZA 8CPAA 4OC3A 2BFRA 3B2YA 4WWVA 1IY7A 3EWQA 4ZY1A 3BHXA 3EKEA 1Z5RA 3B3SA 5FSXA 2HC9A 3S9MA 4DUKA 2DEAA 2RB7A 2X47A 2VRIA 1Y0YA 5HIHA 2AFOA 2PJCA 3IJ3A 1IGBA 5LYIA 4JYWA 3D7DA 4ABKA 2GLFA 3GPOA 3SIHA 1BPMA 4MRIA 4MCSA 3PB7X 4KSIA 3NA6A 1ARMA 1YW4A
chains in the Genus database with same CATH superfamily
4OKOA 1XMBA 2BL1A 1XBUA 1LRZA 3NH8A 1K4JA 1AYEA 3G3SA 4CGOA 3H4QA 4LQGA 2P6EA 5AGEA 5F49A 2I00A 3H5ZA 2DPSA 1M44A 4UFWA 4FBEA 2Q44A 3G8WA 4KOXA 3PB9X 4KLWA 3RO0A 2FIWA 4UCMA 1YX0A 1Y0RA 3B3WA 2REFA 1YREA 1TIQA 2JZDA 1CP7A 5HVGA 1CBXA 2CNTA 2PJ8A 4QUSA 2BFQA 2Q0YA 4BINA 3WC6A 4KOTA 5JQ4A 1IICA 4P44A 1M4GA 2GU2A 3PP9A 3SJXA 4UMLA 2B5GB 4B5PA 1JQGA 1S7FA 4LX9A 3FBUA 2BSWA 3TFYA 2VZZA 4JD6A 1S7LA 1Q7LA 4RUHA 1LANA 5KTDA 2Q43A 2YNEA 2QYVA 4A32A 3D4UA 2AFSA 2EUIA 2PC1A 1YW6A 4ABLA 3B7IA 4XPDC 3FRMA 4CYNA 2A4NA 4M6IA 3PZJA 1Y7RA 1A2ZA 4F9VA 3TTHA 5AG4A 1RO5A 2IMOA 2EBJA 1ZG8A 1FY7A 1GHEA 4J3GA 3K9TA 2ANPA 5J8CA 3EXNA 2PJ5A 4P6YA 3DNSA 5LYLA 1CP6A 4RI1A 4OC0A 2EEEA 1P0HA 1BO4A 2FL4A 4NXYA 2B5GA 3WABA 3GIUA 2R7HA 4PSWA 1S3ZA 2AFCA 4KOVA 5I0CA 2ZPAA 4ZI6A 4JXQA 2IQ6A 4KOUA 4TU0A 3PBEA 4F9UA 4CRYB 2Z11A 2PJ9A 1Z4RA 1YSJA 3SIIA 1B6BA 2AFMA 1TF8A 1SQHA 4MCQA 4NGNA 4F8ZA 5LRKA 2QECA 1NJRA 4MFJA 4OIWA 5H84A 2GANA 3ZJ0A 3RAMA 4X2TA 1Z4EA 5J1QA 3S6KA 3T9YA 2ARHA 2PE3A 5FSUA 2PIZA 4L8AA 3CXQA 3GKRA 3HLPA 3CPXA 4QC6A 2QMLA 1TKHA 1R3NA 1HDQA 2V8HA 4P4JA 3R9EA 2JZEA 4AB7A 1AMPA 1DTDA 4Q7AA 2PJ1A 4ZBGA 4CYOA 4O23A 3D66A 2XD7A 4WJBA 2L8RA 2PIYA 2Z3OA 3WC5A 4PXEA 4KSAA 3S9LA 1DE4C 4P4EA 3NE8A 4H89A 1IOFA 3CPAA 2RC4A 1TXZA 2FVGA 2Q04A 2O53A 4OADA 4K3NA 4MHPA 4PSXA 2PR1A 4C68A 4U5YA 1LCPA 4LUAA 4HPSA 1CPSA 1MJ9A 2XEGA 4UBRA 2WZNA 3TT2A 2HQYA 1AUGA 4CGLA 4MCPA 4XPDB 2PDOA 4MFZA 3GQEA 3N7ZA 2LGRA 1HDUA 5EC4A 4NGPA 2PJ0A 1ELLP 3B3CA 2ZEDA 3S9NA 2HUZA 4HKFA 3MRUA 3V45A 2O28A 4H2KA 3EW5A 4CAVA 5FSVA 3FNCA 3F5BA 4X5KA 2PCUA 4X8IA 3R95A 1KUYA 4CAWA 4NSQA 3IEHA 4R87A 1ZG7A 3ZZIA 3KKWA 5CPAA 3C26A 4ZX8A 2ZW5A 4NGSA 3W6XA 3TCVA 1WK4A 5E3BA 2P0WA 2RFHA 4FD5A 4OC1A 4PPZA 5HVHA 3D8PA 5I4MA 4FWUA 5IB0A 2PRBA 1R43A 1NSLA 2EO8A 3BI1A 3T90A 4NJRA 2B4DB 1CX8A 2WYRA 3D2MA 2FXFA 2YGWA 2YNCC 4DNCA 1NE9A 5AG6A 4B10A 2GFQA 4KUBA 4B6ZA 2VL1A 2IL4A 1UWYA 4GUAA 1QSRA 3F0AA 1H8LA 3K2KA 3KHZA 4Y49B 1VHOA 4BBHA 1EE3P 2ZEEA 1NMTA 4TWEA 3JTKA 5KTCA 1XJOA 3SXNA 5HMNA 4OC4A 4R57A 1XOVA 7CPAA 5FSZA 2FS5A 2X7BA 2WCTA 2JDDA 3DR8A 4E0AA 4H6UA 4OAEA 1YR0A 1X10A 1IIDA 3FB3A 4IK2A 3SI1A 1S7KA 4A37A 4KZTA 1XF8A 2WPWA 4PXBA 4Q36A 4EVYA 1BLLE 2B4DA 3LODA 4EMEA 2BOAA 1F57A 3D7FA 4F0YA 3D68A 1TKFA 2K5TA 5FSYA 2NMTA 2D4OA 2EK8A 3IWEA 2ZOFA 2NYQA 4M6HA 2PJ3A 4BMHA 4CGNA 3DGVA 2V8VA 2PVVA 3TE4A 3LMSA 2XEFA 4ONWA 3PEIA 5JGFA 2NSMA 5F46A 2V77A 2ZW7A 3WT4A 4CYQA 3BJ7A 5HVFA 4AVCA 2WPXA 4NF1A 4F6AA 3FYNA 3IIFA 4JZ0A 3RNZA 4ZGYB 3LACA 3V7ZA 1XFOA 1S7NA 1N71A 4KORA 5AG7A 2FE7A 2ZW4A 3RYOA 3ISXA 3KI9A 1VHUA 3VFQA 4MFPA 2JBKA 2R98A 2AFZA 5LRGA 1Q2DA 4IF5A 2ZEOA 4FD6A 4JCAA 2POKA 3ETIA 4K30A 4UIAA 5CMSA 5E96A 3RBUA 5A27A 4MY3A 4IQYA 3FF3A 2ZEGA 4KS9A 1ELMP 1QSTA 2QJ8A 3QB8A 2C6GA 3CDXA 2Z10A 2F7VA 2Y0MA 4KLVA 1FNOA 4GXHA 4E8OA 1ZR5A 1VHSA 3NE7A 1VIXA 4HNYB 4A39A 4B14A 5IV0A 3A9LA 4C2ZA 1Y9KA 4NGMA 1M4LA 2Z3KA 2OOTA 1CPXA 3D2PA 3D7HA 3SJEA 3I3GA 4JWPA 4NGQA 1BOBA 1XMTA 2PJBA 4XNHC 1Y7EA 3IWWA 1I1DA 2C1CA 2CXAA 3TO6A 1QSMA 4FUUA 4ETKA 2FIAA 2PRQA 4MCRA 5IX3A 4NCZA 2YNCA 4ZY0A 2ZW6A 4ONUA 4FAIA 3K9UA 3W91A 1U6MA 4R7MA 3KR5A 1YK3A 2DXQA 2OH1A 3Q71A 4ZX9A 3NFZA 4KOSA 2B3UA 5D8NA 3SHPA 3TO9A 5GCNA 2F5IA 4R8FA 4UFVA 1YGHA 3DLJA 4MFKA 3R9GA 5K8OA 1IOIA 6CPAA 3IFEA 3P2FA 4JVVA 2V8GA 2ZEHA 4CAFA 1HEEA 1XEBA 5G21A 4KVXA 1KUVA 4KUAA 4UWIA 4PXDA 2DX6A 2H5MA 1Z2LA 4UCPA 5DUSA 3KASA 4MMOA 4MFLA 1F2PA 1L0CA 2C6CA 3FXTA 4Q38A 3TO7A 4B11A 4ZYQA 2REEA 3FEDA 2PJ7A 3VWDA 4KVOE 2W2GA 1I12A 1KZFA 4JGKA 3PB4X 4W9YA 4EWTA 1MJAA 2JBJA 3E0KA 3BJ8A 3BI0A 5K8PA 1KUXA 3ISZA 4PQAA 5DWMA 2XEJA 4H6ZA 5FVJA 5AILA 4R3LA 4C2XA 2HV2A 2AFWA 4NJQA 2J8NA 3SJGA 3IIBA 3FJUA 4X3RA 4OC2A 2YNDA 4JXRA 3H8GA 1YMEA 2B4BA 2Q51A 3R9FA 3TOBA 4UA3A 2CIJA 3DR6A 4UEFA 3TOAA 3LWUA 4XNHB 4F0XA 3FX6A 5HOLA 4R76A 2Z3PA 3CXSA 3JRUA 4A33A 4II9A 2EK9A 1MJBA 1MK4A 2J9AA 3V38A 5C88A 3P2HA 2FG1A 2Q4YA 4MHDA 3SXOA 1Z8WA 5THWA 2KQVA 2Q4VA 5K8MA 2BEIA 2PJAA 2GE3A 2VBQA 4KOYA 4XPLA 3W6SA 3S6GA 3FH4A 2BCOA 3EO4A 2PR8A 4MBUA 1VKCA 1LFWA 1JWQA 2IJZA 2G3TA 2AJ6A 1OZPA 1CJWA 2DF5A 3QNVA 2FAVA 3PRTA 3KHXA 2Z3LA 4A38A 4C7HA 3BLNA 3L2NA 4GVWA 3MGDA 1QSOA 3NH4A 1BPNA 4A94A 4M3SA 1UFHA 5KTAA 2AE6A 5H86A 2BO9A 4OLLA 1LAMA 3KQXA 5F47A 1YVOA 3FVLA 4PK2A 5HH1A 2D4PA 2PQ8A 3GUXA 5D29A 4AXVA 2QVPA 3F8KA 4QVTA 1Q2CA 2CY2A 2VI7A 3GYAA 2KCWA 3SI2A 1WWZA 2ACFA 4NFRA 3IU1A 4J5RA 2C6PA 3SIJA 5ELYA 4IHMA 4GVVA 4KSFA 1KWMA 2OZGA 4M85A 2Q7SA 4MXUA 4QB9A 4P4FA 3VARA 3EWOA 4OMEA 4D86A 4G1PA 2ABZA 2Q7BA 4UIBA 3V2BA 3TX8A 1SPVA 3JVNA 4R6TA 2B3VA 2VZYA 2OZHA 3IWGA 3VH9A 3WR7A 5IB9A 2J8RA 3EJFA 3GPGA 4JLYA 2FT0A 3PB8X 2Z3NA 3QAYA 4XPKA 5JPHA 4IAVA 2B58A 5LYDA 5F09A 2GIVA 1PCAA 4J5QA 4UCNA 4A95A 4FD4A 1YD9A 4NGTA 4CGPA 2VQYA 4KOWA 1BAVA 5DWNA 3GLJA 2ZEMA 3JZTA 2EWBA 1IYKA 4J5SA 1ZG9A 4UEEA 2GREA 4QBJA 1M4DA 2G3AA 1CM0A 4AG9A 2HB6A 3R1KA 2CF4A 4DYOA 4J4ZA 3GQOA 3B3VA 4P4BA 4ORFA 4ZY2A 4E2AA 5G20A 1XIXA 4YU9A 4U9YA 2PVWA 3KL9A 4DJLA 3D3SA 2Q4ZA 3IGRA 2CTCA 4CYPA 2BUEA 1Z9UA 3IO1A 3PBBA 3B3TA 4L89A 4R9MA 3QAHA 4GS4A 4KYBA 3OWCA 4CS0B 5K8NA 4Z65A 1XE4A 4EFDA 1YLOA 4P10A 3KZWA 1ON0A 3GB0A 2JEWA 2FCKA 3HUVA 2CTBA 2XEIA 5A28A 4TNUA 3LD2A 2ZELA 3KR4A 2R1IA 2ZOGA 5J8FA 1NSAA 4M6GA 2ODFA 1RXTA 2Z0ZA 4JJXA 3UY5A 3WC7A 2PSWA 2G9DA 2V8DA 4B5OA 4ESSA 4R3KA 2F8HA 4MHYA 4OIDA 2I3CA 3EY5A 4FD7A 4YFJA 5CB3A 3FMCA 4HNXB 4MJ8A 1GYTA 1Z8XA 2EVNA 1CG2A 5F48A 2JDCA 5HXDA 1Y9WA 1PU9A 4U9ZA 1TXRA 3B8GA 4MHNA 4OP4A 4B12A 5EBVA 4MI4A 4MHZA 2VEZA 3I1UA 3SIGA 4RS2A 5LRJA 3IC1A 1HJZA 1ARLA 2OB0A 1M4IA 4P4DA 4P45A 3H8EA 3KQZA 1B87A 1YLEA 3EC4A 4GM5A 4UFXA 2GLJA 3T8WA 2C27A 2P6FA 3FEEA 3BXMA 4A30A 3H8FA 1PYTB 1RTQA 3PGPA 3MN8A 4Y49C 2ZEPA 4IUSA 5AG5A 4C7IA 4PV6A 4CPAA 4CGMA 5CNPA 4C2YA 3EWPA 2AFXA 4CAEA 1QMUA 1TKJA 3FECA 3PFEA 1ZR3A 4P4IA 1Q2YA 3D67A 3D7GA 4YWYA 2CNMA 3DSBA 2OR4A 2PJ4A 2PJ6A 1VGYA 2O4HA 3VWEA 3EJGA 2ZENA 2RNKA 4ETJA 3B35A 4UWJA 5DS0A 4CRZB 2JEVA 1ZLIA 4B13A 1OBRA 5G1ZA 3NH5A 1VHEA 3CT9A 2CNSA 4HNWB 2OZUA 4OC5A 1R57A 4BD9A 5CB5A 3TC8A 2FXKA 3EWRA 5CBMA 1YQEA 2VXKA 4NEXA 4PXCA 3EFAA 3GY9A 2P6GA 3R96A 1TF9A 4RN7A 3RZAA 1FT7A 4A31A 2G0BA 1J4JA 3S6FA 1PUAA 3FIXA 3PB6X 3SI0A 3GPQA 1XRYA 1TY8A 4AG7A 1LAPA 4JLLA 1ZO0A 1ZLHA 3VATA 4K0CA 1S60A 1QQ9A 1Z8LA 1LOKA 3SJFA 3KGQA 2R8VA 1V0CA 2PJ2A 2AFUA 5JM6A 2JZFA 1M1DA 1P4NA 4I49A 4A2ZA 5LYFA 3PFOA 4UF4A 3Q6ZA 3V8IA 2ZEFA 3IIDA 4KVME 1I21A 3CZXA 5EMIA 5JH9A 5C82A 1F2OA 4NGRA 1QSNA 3N5FA 4UEZA 8CPAA 4OC3A 2BFRA 3B2YA 3CXPA 4WWVA 5ISVA 1IY7A 4LQ6A 4YRHA 5G22A 3EWQA 4ZY1A 3BHXA 3EKEA 1YVKA 3IU2A 1Z5RA 1Z8TA 1S5KA 3B3SA 3I9SA 5FSXA 2QIRA 2HC9A 2JLMA 3S9MA 4YGOA 4DUKA 2DEAA 2RB7A 4MY0A 2X47A 2VRIA 1Y0YA 5HIHA 2AFOA 2PJCA 2ZXVA 2WUUA 3IJ3A 1IGBA 4MFQA 5LYIA 3S6HA 1IU8A 4JYWA 3DDDA 3D7DA 2FSRA 4AVBA 4ABKA 2GLFA 3JUWA 3GPOA 2DPTA 3SIHA 1BPMA 5BWAB 4MRIA 4MCSA 2ATRA 2WSAA 3PB7X 4AVAA 2OU2A 4PK3A 2I79A 4KSIA 2Z3MA 4CAXA 1IYLA 2J8MA 4B5PB 3NA6A 1ARMA 1IB1E 1X12A 1YW4A
chains in the Genus database with same CATH topology
4OKOA 1XMBA 1XBUA 3NH8A 1AYEA 4LQGA 4FBEA 3PB9X 1Y0RA 3B3WA 1CP7A 5HVGA 1CBXA 2PJ8A 2BFQA 3WC6A 4P44A 2GU2A 3SJXA 4UMLA 1JQGA 1Q7LA 4RUHA 1LANA 2Q43A 2QYVA 3D4UA 2AFSA 3B7IA 1YW6A 4ABLA 4F9VA 2IMOA 1ZG8A 3K9TA 2ANPA 2PJ5A 4P6YA 5LYLA 1CP6A 4OC0A 2EEEA 3WABA 2AFCA 4ZI6A 2IQ6A 4TU0A 3PBEA 4F9UA 2PJ9A 1YSJA 3SIIA 2AFMA 1TF8A 4MCQA 4NGNA 4F8ZA 5LRKA 1NJRA 4OIWA 5J1QA 3RAMA 4X2TA 2PE3A 5FSUA 2PIZA 3HLPA 3CPXA 1TKHA 1R3NA 1HDQA 2V8HA 4P4JA 1AMPA 1DTDA 4Q7AA 2PJ1A 4O23A 3D66A 2XD7A 4WJBA 2L8RA 2PIYA 3WC5A 4PXEA 3S9LA 1DE4C 4P4EA 3CPAA 1TXZA 2FVGA 2O53A 4K3NA 4MHPA 1LCPA 1CPSA 2XEGA 2WZNA 4MCPA 3GQEA 2LGRA 1HDUA 4NGPA 2PJ0A 1ELLP 3B3CA 2ZEDA 3S9NA 3MRUA 3V45A 4H2KA 3EW5A 5FSVA 4X8IA 2PCUA 3IEHA 1ZG7A 5CPAA 4ZX8A 4NGSA 5E3BA 2RFHA 4OC1A 4PPZA 5HVHA 5I4MA 4FWUA 1R43A 3BI1A 4NJRA 1CX8A 2WYRA 4B6ZA 2VL1A 1UWYA 4GUAA 3K2KA 3KHZA 1H8LA 1VHOA 1EE3P 2ZEEA 4TWEA 1XJOA 4OC4A 7CPAA 5FSZA 4IK2A 3SI1A 4A37A 4PXBA 1BLLE 4EMEA 2BOAA 1F57A 3D7FA 3D68A 1TKFA 5FSYA 2EK8A 2ZOFA 2NYQA 2PJ3A 3DGVA 2V8VA 2PVVA 3LMSA 2XEFA 4ONWA 3PEIA 5JGFA 2NSMA 2V77A 3WT4A 5HVFA 3IIFA 4JZ0A 3V7ZA 1XFOA 3ISXA 3KI9A 1VHUA 3VFQA 2JBKA 5LRGA 2AFZA 2ZEOA 4JCAA 2POKA 3ETIA 4UIAA 3RBUA 5CMSA 4IQYA 3FF3A 2ZEGA 1ELMP 2QJ8A 2C6GA 3CDXA 2F7VA 1FNOA 1ZR5A 1VIXA 4A39A 4NGMA 1M4LA 2OOTA 1CPXA 3D7HA 3SJEA 4NGQA 2PJBA 1Y7EA 3IWWA 2C1CA 4FUUA 4ETKA 2PRQA 4MCRA 4ZY0A 4FAIA 4R7MA 3KR5A 3Q71A 4ZX9A 3NFZA 5D8NA 4R8FA 3DLJA 5K8OA 6CPAA 3IFEA 4JVVA 2V8GA 2ZEHA 1HEEA 4PXDA 2DX6A 1Z2LA 5DUSA 3KASA 4MMOA 1F2PA 2C6CA 4ZYQA 3FEDA 2PJ7A 4JGKA 3PB4X 4W9YA 4EWTA 2JBJA 3BI0A 5K8PA 3ISZA 4PQAA 2XEJA 5AILA 2AFWA 4NJQA 3SJGA 3IIBA 3FJUA 4X3RA 4OC2A 3H8GA 1YMEA 2Q51A 2CIJA 4UEFA 3LWUA 3FX6A 5HOLA 4R76A 3JRUA 2EK9A 2J9AA 3V38A 2FG1A 5THWA 5K8MA 2PJAA 3FH4A 2BCOA 1LFWA 2IJZA 3QNVA 2FAVA 3PRTA 3KHXA 4A38A 3L2NA 4GVWA 3NH4A 1BPNA 4A94A 2BO9A 1LAMA 3KQXA 3FVLA 3GUXA 5D29A 4AXVA 2QVPA 3SI2A 2ACFA 4NFRA 4J5RA 2C6PA 3SIJA 5ELYA 4IHMA 4GVVA 4MXUA 1KWMA 3VARA 4P4FA 3EWOA 4OMEA 4D86A 4G1PA 2ABZA 4UIBA 3V2BA 3TX8A 1SPVA 4R6TA 3VH9A 5IB9A 3EJFA 3GPGA 3PB8X 4IAVA 5LYDA 5F09A 1PCAA 4J5QA 4NGTA 1YD9A 1BAVA 3GLJA 2ZEMA 3JZTA 2EWBA 1ZG9A 4J5SA 4UEEA 2GREA 2HB6A 2CF4A 4DYOA 4J4ZA 3GQOA 3B3VA 4P4BA 4ZY2A 4YU9A 2PVWA 3KL9A 4DJLA 2Q4ZA 2CTCA 3IO1A 3PBBA 3B3TA 5K8NA 4KYBA 4Z65A 4EFDA 1YLOA 4P10A 3KZWA 3GB0A 2JEWA 3HUVA 2CTBA 2XEIA 4TNUA 2ZELA 3KR4A 2ZOGA 1NSAA 3WC7A 2G9DA 2V8DA 4ESSA 2F8HA 4MHYA 4OIDA 2I3CA 5CB3A 3FMCA 1GYTA 1CG2A 5HXDA 1TXRA 4MHNA 4OP4A 4MHZA 3I1UA 5LRJA 3SIGA 3IC1A 1HJZA 1ARLA 4P4DA 4P45A 3H8EA 3KQZA 4GM5A 2GLJA 3T8WA 3FEEA 3BXMA 3H8FA 1PYTB 1RTQA 3MN8A 2ZEPA 4CPAA 3EWPA 2AFXA 1QMUA 1TKJA 3FECA 3PFEA 1ZR3A 4P4IA 3D67A 3D7GA 4YWYA 2OR4A 2PJ4A 2PJ6A 1VGYA 2O4HA 3EJGA 2ZENA 5DS0A 4ETJA 3B35A 1ZLIA 1OBRA 3NH5A 1VHEA 3CT9A 4BD9A 4OC5A 5CB5A 3TC8A 2FXKA 3EWRA 5CBMA 4PXCA 3RZAA 1TF9A 1FT7A 3PB6X 3SI0A 3GPQA 1XRYA 1TY8A 1LAPA 4JLLA 1ZLHA 3VATA 4K0CA 1Z8LA 1QQ9A 1LOKA 3SJFA 3KGQA 2PJ2A 2AFUA 5JM6A 5LYFA 3PFOA 4UF4A 3Q6ZA 2ZEFA 3IIDA 5JH9A 1F2OA 4NGRA 3N5FA 4UEZA 8CPAA 4OC3A 2BFRA 3B2YA 4WWVA 1IY7A 3EWQA 4ZY1A 3BHXA 3EKEA 1Z5RA 3B3SA 5FSXA 2HC9A 3S9MA 4DUKA 2DEAA 2RB7A 2X47A 2VRIA 1Y0YA 5HIHA 2AFOA 2PJCA 3IJ3A 1IGBA 5LYIA 4JYWA 3D7DA 4ABKA 2GLFA 3GPOA 3SIHA 1BPMA 4MRIA 4MCSA 3PB7X 4KSIA 3NA6A 1ARMA 1YW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OKO A;  1XMB A;  1XBU A;  3NH8 A;  1AYE A;  4LQG A;  4FBE A;  3PB9 X;  1Y0R A;  3B3W A;  1CP7 A;  5HVG A;  1CBX A;  2PJ8 A;  2BFQ A;  3WC6 A;  4P44 A;  2GU2 A;  3SJX A;  4UML A;  1JQG A;  1Q7L A;  4RUH A;  1LAN A;  2Q43 A;  2QYV A;  3D4U A;  2AFS A;  3B7I A;  1YW6 A;  4ABL A;  4F9V A;  2IMO A;  1ZG8 A;  3K9T A;  2ANP A;  2PJ5 A;  4P6Y A;  5LYL A;  1CP6 A;  4OC0 A;  2EEE A;  3WAB A;  2AFC A;  4ZI6 A;  2IQ6 A;  4TU0 A;  3PBE A;  4F9U A;  2PJ9 A;  1YSJ A;  3SII A;  2AFM A;  1TF8 A;  4MCQ A;  4NGN A;  4F8Z A;  5LRK A;  1NJR A;  4OIW A;  5J1Q A;  3RAM A;  4X2T A;  2PE3 A;  5FSU A;  2PIZ A;  3HLP A;  3CPX A;  1TKH A;  1R3N A;  1HDQ A;  2V8H A;  4P4J A;  1AMP A;  1DTD A;  4Q7A A;  2PJ1 A;  4O23 A;  3D66 A;  2XD7 A;  4WJB A;  2L8R A;  2PIY A;  3WC5 A;  4PXE A;  3S9L A;  1DE4 C;  4P4E A;  3CPA A;  1TXZ A;  2FVG A;  2O53 A;  4K3N A;  4MHP A;  1LCP A;  1CPS A;  2XEG A;  2WZN A;  4MCP A;  3GQE A;  2LGR A;  1HDU A;  4NGP A;  2PJ0 A;  1ELL P;  3B3C A;  2ZED A;  3S9N A;  3MRU A;  3V45 A;  4H2K A;  3EW5 A;  5FSV A;  4X8I A;  2PCU A;  3IEH A;  1ZG7 A;  5CPA A;  4ZX8 A;  4NGS A;  5E3B A;  2RFH A;  4OC1 A;  4PPZ A;  5HVH A;  5I4M A;  4FWU A;  1R43 A;  3BI1 A;  4NJR A;  1CX8 A;  2WYR A;  4B6Z A;  2VL1 A;  1UWY A;  4GUA A;  3K2K A;  3KHZ A;  1H8L A;  1VHO A;  1EE3 P;  2ZEE A;  4TWE A;  1XJO A;  4OC4 A;  7CPA A;  5FSZ A;  4IK2 A;  3SI1 A;  4A37 A;  4PXB A;  1BLL E;  4EME A;  2BOA A;  1F57 A;  3D7F A;  3D68 A;  1TKF A;  5FSY A;  2EK8 A;  2ZOF A;  2NYQ A;  2PJ3 A;  3DGV A;  2V8V A;  2PVV A;  3LMS A;  2XEF A;  4ONW A;  3PEI A;  5JGF A;  2NSM A;  2V77 A;  3WT4 A;  5HVF A;  3IIF A;  4JZ0 A;  3V7Z A;  1XFO A;  3ISX A;  3KI9 A;  1VHU A;  3VFQ A;  2JBK A;  5LRG A;  2AFZ A;  2ZEO A;  4JCA A;  2POK A;  3ETI A;  4UIA A;  3RBU A;  5CMS A;  4IQY A;  3FF3 A;  2ZEG A;  1ELM P;  2QJ8 A;  2C6G A;  3CDX A;  2F7V A;  1FNO A;  1ZR5 A;  1VIX A;  4A39 A;  4NGM A;  1M4L A;  2OOT A;  1CPX A;  3D7H A;  3SJE A;  4NGQ A;  2PJB A;  1Y7E A;  3IWW A;  2C1C A;  4FUU A;  4ETK A;  2PRQ A;  4MCR A;  4ZY0 A;  4FAI A;  4R7M A;  3KR5 A;  3Q71 A;  4ZX9 A;  3NFZ A;  5D8N A;  4R8F A;  3DLJ A;  5K8O A;  6CPA A;  3IFE A;  4JVV A;  2V8G A;  2ZEH A;  1HEE A;  4PXD A;  2DX6 A;  1Z2L A;  5DUS A;  3KAS A;  4MMO A;  1F2P A;  2C6C A;  4ZYQ A;  3FED A;  2PJ7 A;  4JGK A;  3PB4 X;  4W9Y A;  4EWT A;  2JBJ A;  3BI0 A;  5K8P A;  3ISZ A;  4PQA A;  2XEJ A;  5AIL A;  2AFW A;  4NJQ A;  3SJG A;  3IIB A;  3FJU A;  4X3R A;  4OC2 A;  3H8G A;  1YME A;  2Q51 A;  2CIJ A;  4UEF A;  3LWU A;  3FX6 A;  5HOL A;  4R76 A;  3JRU A;  2EK9 A;  2J9A A;  3V38 A;  2FG1 A;  5THW A;  5K8M A;  2PJA A;  3FH4 A;  2BCO A;  1LFW A;  2IJZ A;  3QNV A;  2FAV A;  3PRT A;  3KHX A;  4A38 A;  3L2N A;  4GVW A;  3NH4 A;  1BPN A;  4A94 A;  2BO9 A;  1LAM A;  3KQX A;  3FVL A;  3GUX A;  5D29 A;  4AXV A;  2QVP A;  3SI2 A;  2ACF A;  4NFR A;  4J5R A;  2C6P A;  3SIJ A;  5ELY A;  4IHM A;  4GVV A;  4MXU A;  1KWM A;  3VAR A;  4P4F A;  3EWO A;  4OME A;  4D86 A;  4G1P A;  2ABZ A;  4UIB A;  3V2B A;  3TX8 A;  1SPV A;  4R6T A;  3VH9 A;  5IB9 A;  3EJF A;  3GPG A;  3PB8 X;  4IAV A;  5LYD A;  5F09 A;  1PCA A;  4J5Q A;  4NGT A;  1YD9 A;  1BAV A;  3GLJ A;  2ZEM A;  3JZT A;  2EWB A;  1ZG9 A;  4J5S A;  4UEE A;  2GRE A;  2HB6 A;  2CF4 A;  4DYO A;  4J4Z A;  3GQO A;  3B3V A;  4P4B A;  4ZY2 A;  4YU9 A;  2PVW A;  3KL9 A;  4DJL A;  2Q4Z A;  2CTC A;  3IO1 A;  3PBB A;  3B3T A;  5K8N A;  4KYB A;  4Z65 A;  4EFD A;  1YLO A;  4P10 A;  3KZW A;  3GB0 A;  2JEW A;  3HUV A;  2CTB A;  2XEI A;  4TNU A;  2ZEL A;  3KR4 A;  2ZOG A;  1NSA A;  3WC7 A;  2G9D A;  2V8D A;  4ESS A;  2F8H A;  4MHY A;  4OID A;  2I3C A;  5CB3 A;  3FMC A;  1GYT A;  1CG2 A;  5HXD A;  1TXR A;  4MHN A;  4OP4 A;  4MHZ A;  3I1U A;  5LRJ A;  3SIG A;  3IC1 A;  1HJZ A;  1ARL A;  4P4D A;  4P45 A;  3H8E A;  3KQZ A;  4GM5 A;  2GLJ A;  3T8W A;  3FEE A;  3BXM A;  3H8F A;  1PYT B;  1RTQ A;  3MN8 A;  2ZEP A;  4CPA A;  3EWP A;  2AFX A;  1QMU A;  1TKJ A;  3FEC A;  3PFE A;  1ZR3 A;  4P4I A;  3D67 A;  3D7G A;  4YWY A;  2OR4 A;  2PJ4 A;  2PJ6 A;  1VGY A;  2O4H A;  3EJG A;  2ZEN A;  5DS0 A;  4ETJ A;  3B35 A;  1ZLI A;  1OBR A;  3NH5 A;  1VHE A;  3CT9 A;  4BD9 A;  4OC5 A;  5CB5 A;  3TC8 A;  2FXK A;  3EWR A;  5CBM A;  4PXC A;  3RZA A;  1TF9 A;  1FT7 A;  3PB6 X;  3SI0 A;  3GPQ A;  1XRY A;  1TY8 A;  1LAP A;  4JLL A;  1ZLH A;  3VAT A;  4K0C A;  1Z8L A;  1QQ9 A;  1LOK A;  3SJF A;  3KGQ A;  2PJ2 A;  2AFU A;  5JM6 A;  5LYF A;  3PFO A;  4UF4 A;  3Q6Z A;  2ZEF A;  3IID A;  5JH9 A;  1F2O A;  4NGR A;  3N5F A;  4UEZ A;  8CPA A;  4OC3 A;  2BFR A;  3B2Y A;  4WWV A;  1IY7 A;  3EWQ A;  4ZY1 A;  3BHX A;  3EKE A;  1Z5R A;  3B3S A;  5FSX A;  2HC9 A;  3S9M A;  4DUK A;  2DEA A;  2RB7 A;  2X47 A;  2VRI A;  1Y0Y A;  5HIH A;  2AFO A;  2PJC A;  3IJ3 A;  1IGB A;  5LYI A;  4JYW A;  3D7D A;  4ABK A;  2GLF A;  3GPO A;  3SIH A;  1BPM A;  4MRI A;  4MCS A;  3PB7 X;  4KSI A;  3NA6 A;  1ARM A;  1YW4 A; 
#chains in the Genus database with same CATH topology
 4OKO A;  1XMB A;  2BL1 A;  1XBU A;  1LRZ A;  3NH8 A;  1K4J A;  1AYE A;  3G3S A;  4CGO A;  3H4Q A;  4LQG A;  2P6E A;  5AGE A;  5F49 A;  2I00 A;  3H5Z A;  2DPS A;  1M44 A;  4UFW A;  4FBE A;  2Q44 A;  3G8W A;  4KOX A;  3PB9 X;  4KLW A;  3RO0 A;  2FIW A;  4UCM A;  1YX0 A;  1Y0R A;  3B3W A;  2REF A;  1YRE A;  1TIQ A;  2JZD A;  1CP7 A;  5HVG A;  1CBX A;  2CNT A;  2PJ8 A;  4QUS A;  2BFQ A;  2Q0Y A;  4BIN A;  3WC6 A;  4KOT A;  5JQ4 A;  1IIC A;  4P44 A;  1M4G A;  2GU2 A;  3PP9 A;  3SJX A;  4UML A;  2B5G B;  4B5P A;  1JQG A;  1S7F A;  4LX9 A;  3FBU A;  2BSW A;  3TFY A;  2VZZ A;  4JD6 A;  1S7L A;  1Q7L A;  4RUH A;  1LAN A;  5KTD A;  2Q43 A;  2YNE A;  2QYV A;  4A32 A;  3D4U A;  2AFS A;  2EUI A;  2PC1 A;  1YW6 A;  4ABL A;  3B7I A;  4XPD C;  3FRM A;  4CYN A;  2A4N A;  4M6I A;  3PZJ A;  1Y7R A;  1A2Z A;  4F9V A;  3TTH A;  5AG4 A;  1RO5 A;  2IMO A;  2EBJ A;  1ZG8 A;  1FY7 A;  1GHE A;  4J3G A;  3K9T A;  2ANP A;  5J8C A;  3EXN A;  2PJ5 A;  4P6Y A;  3DNS A;  5LYL A;  1CP6 A;  4RI1 A;  4OC0 A;  2EEE A;  1P0H A;  1BO4 A;  2FL4 A;  4NXY A;  2B5G A;  3WAB A;  3GIU A;  2R7H A;  4PSW A;  1S3Z A;  2AFC A;  4KOV A;  5I0C A;  2ZPA A;  4ZI6 A;  4JXQ A;  2IQ6 A;  4KOU A;  4TU0 A;  3PBE A;  4F9U A;  4CRY B;  2Z11 A;  2PJ9 A;  1Z4R A;  1YSJ A;  3SII A;  1B6B A;  2AFM A;  1TF8 A;  1SQH A;  4MCQ A;  4NGN A;  4F8Z A;  5LRK A;  2QEC A;  1NJR A;  4MFJ A;  4OIW A;  5H84 A;  2GAN A;  3ZJ0 A;  3RAM A;  4X2T A;  1Z4E A;  5J1Q A;  3S6K A;  3T9Y A;  2ARH A;  2PE3 A;  5FSU A;  2PIZ A;  4L8A A;  3CXQ A;  3GKR A;  3HLP A;  3CPX A;  4QC6 A;  2QML A;  1TKH A;  1R3N A;  1HDQ A;  2V8H A;  4P4J A;  3R9E A;  2JZE A;  4AB7 A;  1AMP A;  1DTD A;  4Q7A A;  2PJ1 A;  4ZBG A;  4CYO A;  4O23 A;  3D66 A;  2XD7 A;  4WJB A;  2L8R A;  2PIY A;  2Z3O A;  3WC5 A;  4PXE A;  4KSA A;  3S9L A;  1DE4 C;  4P4E A;  3NE8 A;  4H89 A;  1IOF A;  3CPA A;  2RC4 A;  1TXZ A;  2FVG A;  2Q04 A;  2O53 A;  4OAD A;  4K3N A;  4MHP A;  4PSX A;  2PR1 A;  4C68 A;  4U5Y A;  1LCP A;  4LUA A;  4HPS A;  1CPS A;  1MJ9 A;  2XEG A;  4UBR A;  2WZN A;  3TT2 A;  2HQY A;  1AUG A;  4CGL A;  4MCP A;  4XPD B;  2PDO A;  4MFZ A;  3GQE A;  3N7Z A;  2LGR A;  1HDU A;  5EC4 A;  4NGP A;  2PJ0 A;  1ELL P;  3B3C A;  2ZED A;  3S9N A;  2HUZ A;  4HKF A;  3MRU A;  3V45 A;  2O28 A;  4H2K A;  3EW5 A;  4CAV A;  5FSV A;  3FNC A;  3F5B A;  4X5K A;  2PCU A;  4X8I A;  3R95 A;  1KUY A;  4CAW A;  4NSQ A;  3IEH A;  4R87 A;  1ZG7 A;  3ZZI A;  3KKW A;  5CPA A;  3C26 A;  4ZX8 A;  2ZW5 A;  4NGS A;  3W6X A;  3TCV A;  1WK4 A;  5E3B A;  2P0W A;  2RFH A;  4FD5 A;  4OC1 A;  4PPZ A;  5HVH A;  3D8P A;  5I4M A;  4FWU A;  5IB0 A;  2PRB A;  1R43 A;  1NSL A;  2EO8 A;  3BI1 A;  3T90 A;  4NJR A;  2B4D B;  1CX8 A;  2WYR A;  3D2M A;  2FXF A;  2YGW A;  2YNC C;  4DNC A;  1NE9 A;  5AG6 A;  4B10 A;  2GFQ A;  4KUB A;  4B6Z A;  2VL1 A;  2IL4 A;  1UWY A;  4GUA A;  1QSR A;  3F0A A;  1H8L A;  3K2K A;  3KHZ A;  4Y49 B;  1VHO A;  4BBH A;  1EE3 P;  2ZEE A;  1NMT A;  4TWE A;  3JTK A;  5KTC A;  1XJO A;  3SXN A;  5HMN A;  4OC4 A;  4R57 A;  1XOV A;  7CPA A;  5FSZ A;  2FS5 A;  2X7B A;  2WCT A;  2JDD A;  3DR8 A;  4E0A A;  4H6U A;  4OAE A;  1YR0 A;  1X10 A;  1IID A;  3FB3 A;  4IK2 A;  3SI1 A;  1S7K A;  4A37 A;  4KZT A;  1XF8 A;  2WPW A;  4PXB A;  4Q36 A;  4EVY A;  1BLL E;  2B4D A;  3LOD A;  4EME A;  2BOA A;  1F57 A;  3D7F A;  4F0Y A;  3D68 A;  1TKF A;  2K5T A;  5FSY A;  2NMT A;  2D4O A;  2EK8 A;  3IWE A;  2ZOF A;  2NYQ A;  4M6H A;  2PJ3 A;  4BMH A;  4CGN A;  3DGV A;  2V8V A;  2PVV A;  3TE4 A;  3LMS A;  2XEF A;  4ONW A;  3PEI A;  5JGF A;  2NSM A;  5F46 A;  2V77 A;  2ZW7 A;  3WT4 A;  4CYQ A;  3BJ7 A;  5HVF A;  4AVC A;  2WPX A;  4NF1 A;  4F6A A;  3FYN A;  3IIF A;  4JZ0 A;  3RNZ A;  4ZGY B;  3LAC A;  3V7Z A;  1XFO A;  1S7N A;  1N71 A;  4KOR A;  5AG7 A;  2FE7 A;  2ZW4 A;  3RYO A;  3ISX A;  3KI9 A;  1VHU A;  3VFQ A;  4MFP A;  2JBK A;  2R98 A;  2AFZ A;  5LRG A;  1Q2D A;  4IF5 A;  2ZEO A;  4FD6 A;  4JCA A;  2POK A;  3ETI A;  4K30 A;  4UIA A;  5CMS A;  5E96 A;  3RBU A;  5A27 A;  4MY3 A;  4IQY A;  3FF3 A;  2ZEG A;  4KS9 A;  1ELM P;  1QST A;  2QJ8 A;  3QB8 A;  2C6G A;  3CDX A;  2Z10 A;  2F7V A;  2Y0M A;  4KLV A;  1FNO A;  4GXH A;  4E8O A;  1ZR5 A;  1VHS A;  3NE7 A;  1VIX A;  4HNY B;  4A39 A;  4B14 A;  5IV0 A;  3A9L A;  4C2Z A;  1Y9K A;  4NGM A;  1M4L A;  2Z3K A;  2OOT A;  1CPX A;  3D2P A;  3D7H A;  3SJE A;  3I3G A;  4JWP A;  4NGQ A;  1BOB A;  1XMT A;  2PJB A;  4XNH C;  1Y7E A;  3IWW A;  1I1D A;  2C1C A;  2CXA A;  3TO6 A;  1QSM A;  4FUU A;  4ETK A;  2FIA A;  2PRQ A;  4MCR A;  5IX3 A;  4NCZ A;  2YNC A;  4ZY0 A;  2ZW6 A;  4ONU A;  4FAI A;  3K9U A;  3W91 A;  1U6M A;  4R7M A;  3KR5 A;  1YK3 A;  2DXQ A;  2OH1 A;  3Q71 A;  4ZX9 A;  3NFZ A;  4KOS A;  2B3U A;  5D8N A;  3SHP A;  3TO9 A;  5GCN A;  2F5I A;  4R8F A;  4UFV A;  1YGH A;  3DLJ A;  4MFK A;  3R9G A;  5K8O A;  1IOI A;  6CPA A;  3IFE A;  3P2F A;  4JVV A;  2V8G A;  2ZEH A;  4CAF A;  1HEE A;  1XEB A;  5G21 A;  4KVX A;  1KUV A;  4KUA A;  4UWI A;  4PXD A;  2DX6 A;  2H5M A;  1Z2L A;  4UCP A;  5DUS A;  3KAS A;  4MMO A;  4MFL A;  1F2P A;  1L0C A;  2C6C A;  3FXT A;  4Q38 A;  3TO7 A;  4B11 A;  4ZYQ A;  2REE A;  3FED A;  2PJ7 A;  3VWD A;  4KVO E;  2W2G A;  1I12 A;  1KZF A;  4JGK A;  3PB4 X;  4W9Y A;  4EWT A;  1MJA A;  2JBJ A;  3E0K A;  3BJ8 A;  3BI0 A;  5K8P A;  1KUX A;  3ISZ A;  4PQA A;  5DWM A;  2XEJ A;  4H6Z A;  5FVJ A;  5AIL A;  4R3L A;  4C2X A;  2HV2 A;  2AFW A;  4NJQ A;  2J8N A;  3SJG A;  3IIB A;  3FJU A;  4X3R A;  4OC2 A;  2YND A;  4JXR A;  3H8G A;  1YME A;  2B4B A;  2Q51 A;  3R9F A;  3TOB A;  4UA3 A;  2CIJ A;  3DR6 A;  4UEF A;  3TOA A;  3LWU A;  4XNH B;  4F0X A;  3FX6 A;  5HOL A;  4R76 A;  2Z3P A;  3CXS A;  3JRU A;  4A33 A;  4II9 A;  2EK9 A;  1MJB A;  1MK4 A;  2J9A A;  3V38 A;  5C88 A;  3P2H A;  2FG1 A;  2Q4Y A;  4MHD A;  3SXO A;  1Z8W A;  5THW A;  2KQV A;  2Q4V A;  5K8M A;  2BEI A;  2PJA A;  2GE3 A;  2VBQ A;  4KOY A;  4XPL A;  3W6S A;  3S6G A;  3FH4 A;  2BCO A;  3EO4 A;  2PR8 A;  4MBU A;  1VKC A;  1LFW A;  1JWQ A;  2IJZ A;  2G3T A;  2AJ6 A;  1OZP A;  1CJW A;  2DF5 A;  3QNV A;  2FAV A;  3PRT A;  3KHX A;  2Z3L A;  4A38 A;  4C7H A;  3BLN A;  3L2N A;  4GVW A;  3MGD A;  1QSO A;  3NH4 A;  1BPN A;  4A94 A;  4M3S A;  1UFH A;  5KTA A;  2AE6 A;  5H86 A;  2BO9 A;  4OLL A;  1LAM A;  3KQX A;  5F47 A;  1YVO A;  3FVL A;  4PK2 A;  5HH1 A;  2D4P A;  2PQ8 A;  3GUX A;  5D29 A;  4AXV A;  2QVP A;  3F8K A;  4QVT A;  1Q2C A;  2CY2 A;  2VI7 A;  3GYA A;  2KCW A;  3SI2 A;  1WWZ A;  2ACF A;  4NFR A;  3IU1 A;  4J5R A;  2C6P A;  3SIJ A;  5ELY A;  4IHM A;  4GVV A;  4KSF A;  1KWM A;  2OZG A;  4M85 A;  2Q7S A;  4MXU A;  4QB9 A;  4P4F A;  3VAR A;  3EWO A;  4OME A;  4D86 A;  4G1P A;  2ABZ A;  2Q7B A;  4UIB A;  3V2B A;  3TX8 A;  1SPV A;  3JVN A;  4R6T A;  2B3V A;  2VZY A;  2OZH A;  3IWG A;  3VH9 A;  3WR7 A;  5IB9 A;  2J8R A;  3EJF A;  3GPG A;  4JLY A;  2FT0 A;  3PB8 X;  2Z3N A;  3QAY A;  4XPK A;  5JPH A;  4IAV A;  2B58 A;  5LYD A;  5F09 A;  2GIV A;  1PCA A;  4J5Q A;  4UCN A;  4A95 A;  4FD4 A;  1YD9 A;  4NGT A;  4CGP A;  2VQY A;  4KOW A;  1BAV A;  5DWN A;  3GLJ A;  2ZEM A;  3JZT A;  2EWB A;  1IYK A;  4J5S A;  1ZG9 A;  4UEE A;  2GRE A;  4QBJ A;  1M4D A;  2G3A A;  1CM0 A;  4AG9 A;  2HB6 A;  3R1K A;  2CF4 A;  4DYO A;  4J4Z A;  3GQO A;  3B3V A;  4P4B A;  4ORF A;  4ZY2 A;  4E2A A;  5G20 A;  1XIX A;  4YU9 A;  4U9Y A;  2PVW A;  3KL9 A;  4DJL A;  3D3S A;  2Q4Z A;  3IGR A;  2CTC A;  4CYP A;  2BUE A;  1Z9U A;  3IO1 A;  3PBB A;  3B3T A;  4L89 A;  4R9M A;  3QAH A;  4GS4 A;  4KYB A;  3OWC A;  4CS0 B;  5K8N A;  4Z65 A;  1XE4 A;  4EFD A;  1YLO A;  4P10 A;  3KZW A;  1ON0 A;  3GB0 A;  2JEW A;  2FCK A;  3HUV A;  2CTB A;  2XEI A;  5A28 A;  4TNU A;  3LD2 A;  2ZEL A;  3KR4 A;  2R1I A;  2ZOG A;  5J8F A;  1NSA A;  4M6G A;  2ODF A;  1RXT A;  2Z0Z A;  4JJX A;  3UY5 A;  3WC7 A;  2PSW A;  2G9D A;  2V8D A;  4B5O A;  4ESS A;  4R3K A;  2F8H A;  4MHY A;  4OID A;  2I3C A;  3EY5 A;  4FD7 A;  4YFJ A;  5CB3 A;  3FMC A;  4HNX B;  4MJ8 A;  1GYT A;  1Z8X A;  2EVN A;  1CG2 A;  5F48 A;  2JDC A;  5HXD A;  1Y9W A;  1PU9 A;  4U9Z A;  1TXR A;  3B8G A;  4MHN A;  4OP4 A;  4B12 A;  5EBV A;  4MI4 A;  4MHZ A;  2VEZ A;  3I1U A;  3SIG A;  4RS2 A;  5LRJ A;  3IC1 A;  1HJZ A;  1ARL A;  2OB0 A;  1M4I A;  4P4D A;  4P45 A;  3H8E A;  3KQZ A;  1B87 A;  1YLE A;  3EC4 A;  4GM5 A;  4UFX A;  2GLJ A;  3T8W A;  2C27 A;  2P6F A;  3FEE A;  3BXM A;  4A30 A;  3H8F A;  1PYT B;  1RTQ A;  3PGP A;  3MN8 A;  4Y49 C;  2ZEP A;  4IUS A;  5AG5 A;  4C7I A;  4PV6 A;  4CPA A;  4CGM A;  5CNP A;  4C2Y A;  3EWP A;  2AFX A;  4CAE A;  1QMU A;  1TKJ A;  3FEC A;  3PFE A;  1ZR3 A;  4P4I A;  1Q2Y A;  3D67 A;  3D7G A;  4YWY A;  2CNM A;  3DSB A;  2OR4 A;  2PJ4 A;  2PJ6 A;  1VGY A;  2O4H A;  3VWE A;  3EJG A;  2ZEN A;  2RNK A;  4ETJ A;  3B35 A;  4UWJ A;  5DS0 A;  4CRZ B;  2JEV A;  1ZLI A;  4B13 A;  1OBR A;  5G1Z A;  3NH5 A;  1VHE A;  3CT9 A;  2CNS A;  4HNW B;  2OZU A;  4OC5 A;  1R57 A;  4BD9 A;  5CB5 A;  3TC8 A;  2FXK A;  3EWR A;  5CBM A;  1YQE A;  2VXK A;  4NEX A;  4PXC A;  3EFA A;  3GY9 A;  2P6G A;  3R96 A;  1TF9 A;  4RN7 A;  3RZA A;  1FT7 A;  4A31 A;  2G0B A;  1J4J A;  3S6F A;  1PUA A;  3FIX A;  3PB6 X;  3SI0 A;  3GPQ A;  1XRY A;  1TY8 A;  4AG7 A;  1LAP A;  4JLL A;  1ZO0 A;  1ZLH A;  3VAT A;  4K0C A;  1S60 A;  1QQ9 A;  1Z8L A;  1LOK A;  3SJF A;  3KGQ A;  2R8V A;  1V0C A;  2PJ2 A;  2AFU A;  5JM6 A;  2JZF A;  1M1D A;  1P4N A;  4I49 A;  4A2Z A;  5LYF A;  3PFO A;  4UF4 A;  3Q6Z A;  3V8I A;  2ZEF A;  3IID A;  4KVM E;  1I21 A;  3CZX A;  5EMI A;  5JH9 A;  5C82 A;  1F2O A;  4NGR A;  1QSN A;  3N5F A;  4UEZ A;  8CPA A;  4OC3 A;  2BFR A;  3B2Y A;  3CXP A;  4WWV A;  5ISV A;  1IY7 A;  4LQ6 A;  4YRH A;  5G22 A;  3EWQ A;  4ZY1 A;  3BHX A;  3EKE A;  1YVK A;  3IU2 A;  1Z5R A;  1Z8T A;  1S5K A;  3B3S A;  3I9S A;  5FSX A;  2QIR A;  2HC9 A;  2JLM A;  3S9M A;  4YGO A;  4DUK A;  2DEA A;  2RB7 A;  4MY0 A;  2X47 A;  2VRI A;  1Y0Y A;  5HIH A;  2AFO A;  2PJC A;  2ZXV A;  2WUU A;  3IJ3 A;  1IGB A;  4MFQ A;  5LYI A;  3S6H A;  1IU8 A;  4JYW A;  3DDD A;  3D7D A;  2FSR A;  4AVB A;  4ABK A;  2GLF A;  3JUW A;  3GPO A;  2DPT A;  3SIH A;  1BPM A;  5BWA B;  4MRI A;  4MCS A;  2ATR A;  2WSA A;  3PB7 X;  4AVA A;  2OU2 A;  4PK3 A;  2I79 A;  4KSI A;  2Z3M A;  4CAX A;  1IYL A;  2J8M A;  4B5P B;  3NA6 A;  1ARM A;  1IB1 E;  1X12 A;  1YW4 A; 
#chains in the Genus database with same CATH homology
 4OKO A;  1XMB A;  1XBU A;  3NH8 A;  1AYE A;  4LQG A;  4FBE A;  3PB9 X;  1Y0R A;  3B3W A;  1CP7 A;  5HVG A;  1CBX A;  2PJ8 A;  2BFQ A;  3WC6 A;  4P44 A;  2GU2 A;  3SJX A;  4UML A;  1JQG A;  1Q7L A;  4RUH A;  1LAN A;  2Q43 A;  2QYV A;  3D4U A;  2AFS A;  3B7I A;  1YW6 A;  4ABL A;  4F9V A;  2IMO A;  1ZG8 A;  3K9T A;  2ANP A;  2PJ5 A;  4P6Y A;  5LYL A;  1CP6 A;  4OC0 A;  2EEE A;  3WAB A;  2AFC A;  4ZI6 A;  2IQ6 A;  4TU0 A;  3PBE A;  4F9U A;  2PJ9 A;  1YSJ A;  3SII A;  2AFM A;  1TF8 A;  4MCQ A;  4NGN A;  4F8Z A;  5LRK A;  1NJR A;  4OIW A;  5J1Q A;  3RAM A;  4X2T A;  2PE3 A;  5FSU A;  2PIZ A;  3HLP A;  3CPX A;  1TKH A;  1R3N A;  1HDQ A;  2V8H A;  4P4J A;  1AMP A;  1DTD A;  4Q7A A;  2PJ1 A;  4O23 A;  3D66 A;  2XD7 A;  4WJB A;  2L8R A;  2PIY A;  3WC5 A;  4PXE A;  3S9L A;  1DE4 C;  4P4E A;  3CPA A;  1TXZ A;  2FVG A;  2O53 A;  4K3N A;  4MHP A;  1LCP A;  1CPS A;  2XEG A;  2WZN A;  4MCP A;  3GQE A;  2LGR A;  1HDU A;  4NGP A;  2PJ0 A;  1ELL P;  3B3C A;  2ZED A;  3S9N A;  3MRU A;  3V45 A;  4H2K A;  3EW5 A;  5FSV A;  4X8I A;  2PCU A;  3IEH A;  1ZG7 A;  5CPA A;  4ZX8 A;  4NGS A;  5E3B A;  2RFH A;  4OC1 A;  4PPZ A;  5HVH A;  5I4M A;  4FWU A;  1R43 A;  3BI1 A;  4NJR A;  1CX8 A;  2WYR A;  4B6Z A;  2VL1 A;  1UWY A;  4GUA A;  3K2K A;  3KHZ A;  1H8L A;  1VHO A;  1EE3 P;  2ZEE A;  4TWE A;  1XJO A;  4OC4 A;  7CPA A;  5FSZ A;  4IK2 A;  3SI1 A;  4A37 A;  4PXB A;  1BLL E;  4EME A;  2BOA A;  1F57 A;  3D7F A;  3D68 A;  1TKF A;  5FSY A;  2EK8 A;  2ZOF A;  2NYQ A;  2PJ3 A;  3DGV A;  2V8V A;  2PVV A;  3LMS A;  2XEF A;  4ONW A;  3PEI A;  5JGF A;  2NSM A;  2V77 A;  3WT4 A;  5HVF A;  3IIF A;  4JZ0 A;  3V7Z A;  1XFO A;  3ISX A;  3KI9 A;  1VHU A;  3VFQ A;  2JBK A;  5LRG A;  2AFZ A;  2ZEO A;  4JCA A;  2POK A;  3ETI A;  4UIA A;  3RBU A;  5CMS A;  4IQY A;  3FF3 A;  2ZEG A;  1ELM P;  2QJ8 A;  2C6G A;  3CDX A;  2F7V A;  1FNO A;  1ZR5 A;  1VIX A;  4A39 A;  4NGM A;  1M4L A;  2OOT A;  1CPX A;  3D7H A;  3SJE A;  4NGQ A;  2PJB A;  1Y7E A;  3IWW A;  2C1C A;  4FUU A;  4ETK A;  2PRQ A;  4MCR A;  4ZY0 A;  4FAI A;  4R7M A;  3KR5 A;  3Q71 A;  4ZX9 A;  3NFZ A;  5D8N A;  4R8F A;  3DLJ A;  5K8O A;  6CPA A;  3IFE A;  4JVV A;  2V8G A;  2ZEH A;  1HEE A;  4PXD A;  2DX6 A;  1Z2L A;  5DUS A;  3KAS A;  4MMO A;  1F2P A;  2C6C A;  4ZYQ A;  3FED A;  2PJ7 A;  4JGK A;  3PB4 X;  4W9Y A;  4EWT A;  2JBJ A;  3BI0 A;  5K8P A;  3ISZ A;  4PQA A;  2XEJ A;  5AIL A;  2AFW A;  4NJQ A;  3SJG A;  3IIB A;  3FJU A;  4X3R A;  4OC2 A;  3H8G A;  1YME A;  2Q51 A;  2CIJ A;  4UEF A;  3LWU A;  3FX6 A;  5HOL A;  4R76 A;  3JRU A;  2EK9 A;  2J9A A;  3V38 A;  2FG1 A;  5THW A;  5K8M A;  2PJA A;  3FH4 A;  2BCO A;  1LFW A;  2IJZ A;  3QNV A;  2FAV A;  3PRT A;  3KHX A;  4A38 A;  3L2N A;  4GVW A;  3NH4 A;  1BPN A;  4A94 A;  2BO9 A;  1LAM A;  3KQX A;  3FVL A;  3GUX A;  5D29 A;  4AXV A;  2QVP A;  3SI2 A;  2ACF A;  4NFR A;  4J5R A;  2C6P A;  3SIJ A;  5ELY A;  4IHM A;  4GVV A;  4MXU A;  1KWM A;  3VAR A;  4P4F A;  3EWO A;  4OME A;  4D86 A;  4G1P A;  2ABZ A;  4UIB A;  3V2B A;  3TX8 A;  1SPV A;  4R6T A;  3VH9 A;  5IB9 A;  3EJF A;  3GPG A;  3PB8 X;  4IAV A;  5LYD A;  5F09 A;  1PCA A;  4J5Q A;  4NGT A;  1YD9 A;  1BAV A;  3GLJ A;  2ZEM A;  3JZT A;  2EWB A;  1ZG9 A;  4J5S A;  4UEE A;  2GRE A;  2HB6 A;  2CF4 A;  4DYO A;  4J4Z A;  3GQO A;  3B3V A;  4P4B A;  4ZY2 A;  4YU9 A;  2PVW A;  3KL9 A;  4DJL A;  2Q4Z A;  2CTC A;  3IO1 A;  3PBB A;  3B3T A;  5K8N A;  4KYB A;  4Z65 A;  4EFD A;  1YLO A;  4P10 A;  3KZW A;  3GB0 A;  2JEW A;  3HUV A;  2CTB A;  2XEI A;  4TNU A;  2ZEL A;  3KR4 A;  2ZOG A;  1NSA A;  3WC7 A;  2G9D A;  2V8D A;  4ESS A;  2F8H A;  4MHY A;  4OID A;  2I3C A;  5CB3 A;  3FMC A;  1GYT A;  1CG2 A;  5HXD A;  1TXR A;  4MHN A;  4OP4 A;  4MHZ A;  3I1U A;  5LRJ A;  3SIG A;  3IC1 A;  1HJZ A;  1ARL A;  4P4D A;  4P45 A;  3H8E A;  3KQZ A;  4GM5 A;  2GLJ A;  3T8W A;  3FEE A;  3BXM A;  3H8F A;  1PYT B;  1RTQ A;  3MN8 A;  2ZEP A;  4CPA A;  3EWP A;  2AFX A;  1QMU A;  1TKJ A;  3FEC A;  3PFE A;  1ZR3 A;  4P4I A;  3D67 A;  3D7G A;  4YWY A;  2OR4 A;  2PJ4 A;  2PJ6 A;  1VGY A;  2O4H A;  3EJG A;  2ZEN A;  5DS0 A;  4ETJ A;  3B35 A;  1ZLI A;  1OBR A;  3NH5 A;  1VHE A;  3CT9 A;  4BD9 A;  4OC5 A;  5CB5 A;  3TC8 A;  2FXK A;  3EWR A;  5CBM A;  4PXC A;  3RZA A;  1TF9 A;  1FT7 A;  3PB6 X;  3SI0 A;  3GPQ A;  1XRY A;  1TY8 A;  1LAP A;  4JLL A;  1ZLH A;  3VAT A;  4K0C A;  1Z8L A;  1QQ9 A;  1LOK A;  3SJF A;  3KGQ A;  2PJ2 A;  2AFU A;  5JM6 A;  5LYF A;  3PFO A;  4UF4 A;  3Q6Z A;  2ZEF A;  3IID A;  5JH9 A;  1F2O A;  4NGR A;  3N5F A;  4UEZ A;  8CPA A;  4OC3 A;  2BFR A;  3B2Y A;  4WWV A;  1IY7 A;  3EWQ A;  4ZY1 A;  3BHX A;  3EKE A;  1Z5R A;  3B3S A;  5FSX A;  2HC9 A;  3S9M A;  4DUK A;  2DEA A;  2RB7 A;  2X47 A;  2VRI A;  1Y0Y A;  5HIH A;  2AFO A;  2PJC A;  3IJ3 A;  1IGB A;  5LYI A;  4JYW A;  3D7D A;  4ABK A;  2GLF A;  3GPO A;  3SIH A;  1BPM A;  4MRI A;  4MCS A;  3PB7 X;  4KSI A;  3NA6 A;  1ARM A;  1YW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...