1BPNA

Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
484
structure length
481
Chain Sequence
b'TKGLVLGIYSKEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUCINE AMINOPEPTIDASE
molecule tags Hydrolase(alpha-aminoacylpeptide)
source organism Bos taurus
publication title Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography.
pubmed doi rcsb
total genus 150
structure length 481
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1993-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1bpnA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1bpnA02
4CPAA 4ZX8A 1VHUA 1Y0RA 3Q6ZA 4JLLA 4GUAA 1VIXA 4NGPA 4UF4A 4Z65A 3EW5A 2PJ4A 4MCRA 1CG2A 4MHZA 5HVGA 4X2TA 4DYOA 3TX8A 4F9UA 2RB7A 1ZLHA 5IB9A 4P4JA 2AFWA 5LRJA 4JCAA 4NGTA 1R43A 2IMOA 4J5QA 5K8MA 1AYEA 4F9VA 4NGNA 3PRTA 2PJ2A 3FH4A 2AFSA 4PXCA 1QMUA 4UMLA 1CPSA 1ZG7A 4GVVA 5CBMA 3JRUA 4IK2A 3EJGA 5CMSA 3NH5A 5ELYA 1CP6A 2O53A 1HDQA 2PCUA 4UIAA 5E3BA 5JH9A 2POKA 1IGBA 5I4MA 4J5SA 1EE3P 2FVGA 1ZR3A 2NYQA 4OC5A 4PXDA 3SIHA 5HIHA 3KL9A 4A94A 3JZTA 3GQOA 3PFOA 2AFCA 3N5FA 3FEDA 2BFQA 2CTCA 1VHEA 2QVPA 3IEHA 2GREA 5DUSA 2PJCA 3IO1A 3WC6A 3QNVA 2X47A 1Y7EA 4UIBA 4R7MA 3CT9A 1ELLP 3KZWA 2AFXA 3EKEA 2JEWA 2VRIA 2ZENA 3V38A 5D8NA 2RFHA 1ZR5A 1LANA 2PE3A 4MCQA 4NGRA 3SI1A 1LOKA 4EFDA 2BO9A 3KHXA 2C6GA 3IIDA 2JBKA 4IAVA 2IQ6A 1KWMA 2PJBA 3KI9A 5HXDA 4ZY0A 4ZY1A 3H8EA 2ZEOA 1BPMA 2PVVA 4ABKA 3B2YA 4ZX9A 2V8DA 1Z5RA 1DE4C 3HLPA 3GQEA 2OR4A 4UEEA 3BXMA 4GVWA 2BOAA 3SIJA 2NSMA 5THWA 1F2PA 5HVFA 4MRIA 5K8PA 4P45A 3MRUA 1F2OA 5AILA 1NSAA 3K9TA 3PB7X 2IJZA 3TC8A 3FECA 3PB6X 2J9AA 4K0CA 1HEEA 2XD7A 4NGQA 5K8NA 3FVLA 3HUVA 2F8HA 1LAPA 1FNOA 3WC5A 2PIYA 4WJBA 3IIFA 1ELMP 3B3VA 4JGKA 5HVHA 2PJ8A 4YWYA 3V2BA 3KQZA 3DGVA 5DS0A 4R8FA 2V8VA 4OC2A 3D66A 3CPAA 2ZEPA 2AFZA 2XEJA 2PRQA 2ZOGA 5LRGA 1H8LA 3PEIA 2PJ5A 3GPQA 2DX6A 3B3CA 7CPAA 4OC3A 2DEAA 2G9DA 4MXUA 4BD9A 1GYTA 1RTQA 2O4HA 3VATA 4NJQA 2LGRA 3EWRA 1XFOA 2PJAA 4OKOA 3SI0A 4A38A 1YW6A 1XMBA 5D29A 4MCPA 3D67A 4IHMA 1XBUA 1ZG9A 1R3NA 3K2KA 1Q7LA 3FX6A 4A39A 1VGYA 5JM6A 2AFUA 4KYBA 4ZYQA 3WC7A 3KR4A 2GU2A 5FSXA 1YSJA 3RZAA 1FT7A 3B3SA 3SJFA 3GPOA 2ZELA 1LCPA 2ZEHA 1CBXA 4TU0A 2FG1A 4KSIA 3GPGA 3V7ZA 3PBEA 3B3TA 3MN8A 8CPAA 4R76A 3NH4A 3BI1A 1UWYA 3NFZA 5CB3A 4P6YA 3PBBA 3PB8X 1CX8A 2WZNA 4MHNA 3S9NA 2Q43A 4MMOA 4ZI6A 5K8OA 5FSUA 2ZOFA 2PVWA 4PXBA 4AXVA 4OIDA 5CB5A 1VHOA 1IY7A 2QJ8A 2XEGA 5F09A 3D7DA 3IFEA 4W9YA 1SPVA 1HDUA 4OC0A 2AFOA 5HOLA 3ISXA 1LFWA 2PJ7A 1M4LA 4FWUA 4DUKA 4UEFA 1XRYA 3KASA 2ZEMA 1PCAA 2ZEDA 4ETJA 3PB9X 4PXEA 5FSZA 2JBJA 2EK9A 2EK8A 3S9LA 3SIGA 2PJ6A 1YW4A 3IIBA 3KGQA 5LYIA 3BHXA 4NGSA 4EMEA 2GLFA 4F8ZA 4MCSA 3I1UA 5LYDA 3VFQA 3LWUA 2Q4ZA 4OIWA 3V45A 2Q51A 2GLJA 3B35A 3GB0A 5JGFA 5LYFA 3L2NA 1TKJA 1YD9A 2CF4A 2C1CA 3EWPA 4P44A 4R6TA 4OC1A 3SJGA 3VH9A 4OC4A 2V77A 3NA6A 4D86A 4OMEA 1F57A 3Q71A 1TKHA 4MHPA 1DTDA 3SJXA 5CPAA 3RBUA 1PYTB 1AMPA 1YLOA 2VL1A 1BAVA 4OP4A 5J1QA 4YU9A 4B6ZA 2V8HA 4P4IA 3D4UA 1BLLE 4ESSA 1YMEA 2XEFA 2I3CA 4Q7AA 4P10A 3T8WA 3S9MA 2C6PA 2BCOA 4JVVA 2QYVA 4TWEA 4MHYA 3CPXA 3GUXA 3B7IA 1TY8A 4RUHA 2EEEA 2C6CA 4FUUA 4JZ0A 4NJRA 4X8IA 4G1PA 2OOTA 3NH8A 1Y0YA 4O23A 3RAMA 4ETKA 1ZG8A 3PB4X 5LRKA 4UEZA 1ZLIA 4WWVA 3D68A 1TXRA 3FJUA 3D7GA 3EWQA 3FF3A 4P4DA 2BFRA 3SJEA 5FSVA 6CPAA 2ZEFA 1CPXA 3D7HA 2WYRA 3WT4A 2ZEEA 1HJZA 3GLJA 2L8RA 4JYWA 4NGMA 2ACFA 4ABLA 1XJOA 4ZY2A 4FAIA 1QQ9A 3CDXA 1LAMA 4P4FA 3SI2A 3VARA 3EWOA 4NFRA 3H8GA 2HB6A 2CIJA 4J4ZA 4P4EA 2FXKA 3H8FA 1ARMA 4LQGA 4ONWA 1BPNA 4J5RA 3IWWA 3BI0A 2PJ1A 3IC1A 1OBRA 2XEIA 4PQAA 1TF9A 2HC9A 2EWBA 4H2KA 4FBEA 2ANPA 2ZEGA 4A37A 1JQGA 1ARLA 1Z2LA 4K3NA 4TNUA 4DJLA 3KQXA 2PIZA 3ETIA 3LMSA 5LYLA 3IJ3A 3DLJA 2PJ9A 2FAVA 2V8GA 3D7FA 1CP7A 3FEEA 3KHZA 3KR5A 4PPZA 2F7VA 5FSYA 3WABA 2CTBA 4EWTA 3SIIA 1NJRA 3PFEA 2ABZA 1TF8A 1TKFA 1Z8LA 2PJ3A 3FMCA 3EJFA 2AFMA 4P4BA 4IQYA 4GM5A 4X3RA 2PJ0A 3ISZA 3B3WA 1TXZA
chains in the Genus database with same CATH superfamily
5DWNA 4CPAA 2J8RA 4ZX8A 2FT0A 1VHUA 5AG6A 4B12A 5A28A 1M4IA 5KTAA 1Y0RA 4KUAA 4KZTA 4MJ8A 3Q6ZA 5CNPA 3B3WA 5KTCA 3GYAA 5JPHA 4JLLA 4XNHB 4ONUA 4GUAA 5BWAB 1VIXA 4NGPA 4UF4A 4Z65A 3EW5A 2P6GA 2PJ4A 3GY9A 2EO8A 4MCRA 1CG2A 4MHZA 5HVGA 4X2TA 4QC6A 4DYOA 2K5TA 2YNCA 3TX8A 1XMTA 4F9UA 2RB7A 3A9LA 2KQVA 2OU2A 3RYOA 2Z3PA 1ZLHA 1RXTA 4P4JA 5IB9A 2AFWA 5LRJA 3TFYA 1YGHA 1IB1E 2BEIA 4JCAA 1VHSA 4NGTA 5EMIA 1R43A 2ZPAA 2IMOA 5HH1A 4J5QA 3TCVA 5K8MA 1AYEA 3B8GA 4UCNA 2VBQA 2YGWA 2C27A 4C2XA 4NGNA 1S7NA 3D3SA 4F9VA 1QSOA 3PRTA 1ZO0A 2PJ2A 3FH4A 2AFSA 4PXCA 2VI7A 2FCKA 4A2ZA 4FD4A 1QMUA 4UMLA 1CPSA 1ZG7A 2Q4VA 4GVVA 5CBMA 3JRUA 4K30A 3P2HA 4IK2A 4UCPA 3EJGA 5CMSA 2JZEA 1XF8A 4M6GA 5F09A 3NH5A 5HMNA 1S5KA 5ELYA 1CP6A 2OZHA 2O53A 4F6AA 1HDQA 3TT2A 1CJWA 2PCUA 4UIAA 5E3BA 3FIXA 3FNCA 5JH9A 2POKA 1IGBA 2JZDA 3BLNA 5I4MA 1IYKA 3NE7A 4J5SA 3EC4A 1EE3P 1M4GA 1XE4A 4XPLA 1I12A 2FVGA 3IWGA 1ZR3A 2NYQA 4OC5A 4PXDA 2J8NA 3SIHA 5HIHA 4AVAA 3KL9A 3S6GA 4A94A 4MFZA 1QSRA 3G3SA 4HNYB 2R8VA 2JDDA 3JZTA 2Z11A 4KOTA 3GQOA 3PFOA 2AFCA 1Q2YA 1IOIA 3N5FA 2F5IA 2BFQA 2CTCA 3FEDA 4OAEA 1VHEA 2QVPA 1QSTA 3IEHA 1LRZA 2B3UA 1K4JA 2QECA 2GREA 5DUSA 4B5PA 5FVJA 2Q44A 1Q2DA 2PJCA 3IO1A 3WC6A 1Z8WA 1ON0A 3QNVA 2X47A 1Y7EA 2WSAA 4MFQA 1S7KA 4R7MA 3CT9A 4UIBA 1IU8A 4Q36A 1ELLP 3KZWA 2H5MA 2AFXA 2Q7BA 2Z3MA 3EKEA 2JEWA 2VRIA 1A2ZA 2ZENA 3V38A 5D8NA 2RFHA 3LODA 1ZR5A 1LANA 2PE3A 4MCQA 4NGRA 2D4PA 4CYOA 4UBRA 2WPWA 4UWIA 3SI1A 4C68A 1LOKA 2D4OA 4EFDA 2BO9A 3LACA 5C82A 5GCNA 3KHXA 2C6GA 4ZBGA 3IIDA 4E2AA 3TTHA 1N71A 2JBKA 4IAVA 3W6XA 3QAHA 4CGLA 2PSWA 4KOSA 5G1ZA 5KTDA 4II9A 2IQ6A 1KWMA 4B14A 2OB0A 2P0WA 4DNCA 1YLEA 3RO0A 3ZZIA 1IOFA 2PJBA 3KI9A 3R96A 5HXDA 2CNMA 4ZY0A 1X12A 4ZY1A 2FL4A 4CRYB 3H8EA 2ZEOA 1MJBA 1I1DA 4CAWA 3CZXA 3QB8A 2ZW6A 1BPMA 2PVVA 4ABKA 4Y49B 4H6UA 3B2YA 2GANA 5IV0A 4ZX9A 2V8DA 1Z5RA 4E0AA 5F46A 1DE4C 3HLPA 4PSXA 3GQEA 2OR4A 2EVNA 4LUAA 4UEEA 3BXMA 5F48A 3EO4A 4GVWA 4B13A 2BOAA 3S6KA 3SIJA 2NSMA 5THWA 1F2PA 4B5OA 5HVFA 3WR7A 4BMHA 4MRIA 5K8PA 4CS0B 3VWEA 4KOYA 4P45A 1BO4A 1F2OA 5AILA 1NSAA 3I3GA 1U6MA 2REEA 3K9TA 2IJZA 1L0CA 3PB7X 4UFVA 3ZJ0A 4CYQA 4YFJA 3TC8A 3FECA 3PB6X 2J9AA 1YR0A 4K0CA 2AJ6A 1HEEA 3K9UA 4MFLA 2XD7A 4H89A 4NGQA 3T90A 3S6FA 5K8NA 4GXHA 1MJ9A 2B4BA 2GE3A 3FVLA 3HUVA 2F8HA 4LX9A 1LAPA 1FNOA 2FE7A 5G22A 4A30A 3WC5A 2PIYA 3BJ7A 4WJBA 3IIFA 1IYLA 1ELMP 2JZFA 3B3VA 3TO6A 4JGKA 4AVBA 2P6FA 2OZUA 5HVHA 2PJ8A 2ZXVA 4HKFA 5E96A 4YWYA 4KVME 1X10A 3R9FA 3V2BA 4Q38A 3KQZA 3JVNA 4J3GA 1YVOA 4AG7A 3DGVA 2B58A 5DS0A 4QBJA 4RUHA 4C2YA 4R8FA 2V8VA 1GHEA 2X7BA 1KUXA 1KUVA 4OC2A 3D66A 2B3VA 3CPAA 3FYNA 2ZEPA 2AFZA 2XEJA 3C26A 2PRQA 2ZOGA 4RI1A 5LRGA 2WCTA 1IIDA 3W6SA 1H8LA 4B5PB 1Y7RA 3PEIA 2PJ5A 3IU2A 3PP9A 3GPQA 2Q04A 2VZYA 3D8PA 3DDDA 5EC4A 3DNSA 2DX6A 1VKCA 3B3CA 7CPAA 4GS4A 4OC3A 5C88A 1XIXA 2DEAA 2G9DA 4MXUA 4B10A 1GYTA 2YNDA 1RTQA 1J4JA 2O4HA 3VATA 4NJQA 4BD9A 2LGRA 3EWRA 1XFOA 2PJAA 4KOUA 4M3SA 4HNXB 4OKOA 3SI0A 4NSQA 4A38A 3RNZA 1YW6A 1XMBA 5D29A 4MCPA 2VQYA 3D67A 3IGRA 4IHMA 4QUSA 3PZJA 1XBUA 4MFJA 1ZG9A 4BINA 3FXTA 4L89A 3H5ZA 5ISVA 1Z8TA 1R3NA 3K2KA 3T9YA 1Q7LA 1YQEA 3FX6A 1VGYA 3CXQA 4A39A 5JM6A 5H86A 2AFUA 4E8OA 2CXAA 4KYBA 2PC1A 4ZYQA 2EBJA 2VZZA 4PV6A 3WC7A 1Z4RA 3KR4A 5J8FA 2GU2A 2VEZA 5FSXA 1YSJA 4HPSA 1M4DA 2Q7SA 3RZAA 2R1IA 1FT7A 3LD2A 3B3SA 4A32A 2ARHA 3SJFA 3GPOA 2ZELA 1LCPA 5I0CA 2PR8A 2ZEHA 3F5BA 1CBXA 2WPXA 2GIVA 4TU0A 2FG1A 2FIAA 4KSIA 4MY3A 4PK3A 3GPGA 2PDOA 2BL1A 3V7ZA 3CXPA 5JQ4A 3PBEA 2HV2A 3EFAA 4CGNA 3F0AA 2B5GB 4CYNA 2Z10A 3B3TA 3MN8A 1Z4EA 4R76A 3R1KA 8CPAA 5G21A 3NH4A 3BI1A 2FSRA 4A95A 1UWYA 3NFZA 2ZW4A 5CB3A 4P6YA 4XPKA 1BOBA 1S7LA 2I00A 3PB8X 1CX8A 3PBBA 2WZNA 2QMLA 4AB7A 4F0XA 4MHNA 3S9NA 1MK4A 1Z9UA 2Q43A 3V8IA 3I9SA 1YX0A 4MMOA 3W91A 4ZI6A 4LQ6A 5K8OA 4KOWA 1QSMA 1AUGA 5FSUA 3TE4A 3D2PA 2ZOFA 2PVWA 4PXBA 4AXVA 1S3ZA 2RC4A 3IWEA 4OIDA 5CB5A 1VHOA 2Y0MA 4KVOE 4EVYA 4C7HA 1IY7A 4MBUA 4YRHA 1SQHA 4PK2A 1V0CA 2FS5A 2QJ8A 2XEGA 1YREA 3FBUA 3D7DA 3TOAA 4B11A 2R98A 3IFEA 4KS9A 4W9YA 1SPVA 1HDUA 3R95A 3SXOA 4KORA 4U5YA 4YGOA 1Z8XA 4OC0A 1R57A 2AFOA 5HOLA 3ISXA 4BBHA 1LFWA 2KCWA 1S7FA 2PJ7A 1M4LA 4FWUA 5EBVA 4U9ZA 4A33A 4DUKA 4ZGYB 2RNKA 2G3TA 4MI4A 1XRYA 4R3KA 4UEFA 4JLYA 2G3AA 3KASA 2ZEMA 1PCAA 2VXKA 2ZEDA 2W2GA 4ETJA 3PB9X 5FSZA 4PXEA 4R9MA 2A4NA 2JBJA 1IICA 2REFA 2EK9A 2EK8A 2Z3KA 4CAXA 1Q2CA 3S9LA 3SIGA 2CNSA 1YW4A 2PJ6A 3GIUA 4NF1A 4RN7A 3R9GA 1P0HA 4AG9A 3IIBA 5AG4A 1Y9KA 3KGQA 2R7HA 5LYIA 3N7ZA 3BHXA 2CY2A 4IUSA 4NGSA 5F49A 2ODFA 4EMEA 2GLFA 4JXRA 2OH1A 4F8ZA 4ORFA 4MCSA 3I1UA 5LYDA 3VFQA 3LWUA 2Q4ZA 4OIWA 5F47A 1Y9WA 3V45A 2Q51A 2GLJA 3B35A 3GB0A 4NXYA 3TO9A 3L2NA 5JGFA 5LYFA 4CGOA 1TKJA 2EUIA 5A27A 1YD9A 2CF4A 4RS2A 2C1CA 2FXFA 3EWPA 4P44A 5J8CA 4R6TA 3MGDA 4OC1A 2WUUA 4FD7A 3SJGA 2HQYA 4OC4A 3VH9A 2V77A 3NA6A 4JWPA 2HUZA 4D86A 4KSAA 4OMEA 4JXQA 1F57A 3Q71A 1TKHA 4L8AA 3PGPA 4AVCA 4MHPA 3R9EA 4QB9A 4KOXA 1QSNA 1DTDA 3F8KA 4XPDB 3NE8A 2Q4YA 3MRUA 4HNWB 4KOVA 5IX3A 3GKRA 3SXNA 3TOBA 1B6BA 1YVKA 4R3LA 3SJXA 5CPAA 3RBUA 1PYTB 4FD6A 1AMPA 1YLOA 2VL1A 3BJ8A 4U9YA 1JWQA 1BAVA 4NEXA 4OP4A 5J1QA 4YU9A 4B6ZA 4UFWA 2JLMA 2V8HA 3H4QA 4P4IA 3D4UA 4OADA 1BLLE 4OLLA 4ESSA 1YMEA 2B4DA 2XEFA 2I3CA 4Y49C 2ZW7A 4Q7AA 1PUAA 4P10A 5DWMA 4CAEA 2G0BA 3T8WA 2B4DB 2Q0YA 1OZPA 1KUYA 3S9MA 2C6PA 2BCOA 4JVVA 2Z3NA 2QYVA 4ONWA 2O28A 4TWEA 4X5KA 5G20A 3TO7A 2JDCA 4MHYA 3CPXA 3DR8A 3B7IA 1TY8A 3GUXA 2EEEA 4KSFA 4CGPA 2C6CA 4FUUA 4MHDA 1B87A 4JZ0A 4NJRA 4UWJA 2PRBA 4X8IA 4MFKA 1NMTA 2NMTA 4G1PA 3NH8A 2OOTA 1Y0YA 2I79A 4O23A 4R57A 4CYPA 3RAMA 3DR6A 4ETKA 1PU9A 1ZG8A 1FY7A 3PB4X 5LRKA 4UEZA 2YNEA 4IF5A 1TIQA 4KUBA 1ZLIA 3KKWA 4WWVA 5AG7A 3D68A 4XNHC 1TXRA 4NCZA 3FJUA 3JUWA 3D7GA 3EWQA 4JD6A 3FF3A 4P4DA 4UCMA 3VWDA 2BFRA 3SJEA 5FSVA 6CPAA 2ZEFA 1CPXA 3D7HA 3OWCA 3JTKA 2WYRA 3WT4A 2BUEA 4CGMA 4KLVA 2ZEEA 4PSWA 1HJZA 3GLJA 3SHPA 2PR1A 2L8RA 4JYWA 2ATRA 5IB0A 4NGMA 2DPSA 2ACFA 2PQ8A 4ABLA 3DSBA 4LQGA 5AG5A 1XJOA 4ZY2A 2FIWA 4CAVA 4C7IA 4FAIA 1QQ9A 3CDXA 1LAMA 4P4FA 4UA3A 3SI2A 3VARA 3EWOA 3FB3A 4NFRA 2IL4A 3H8GA 2HB6A 2CIJA 4J4ZA 4P4EA 2FXKA 3FRMA 3H8FA 1ARMA 2CNTA 1RO5A 2JEVA 2ZW5A 1M44A 2Z0ZA 1BPNA 4J5RA 1KZFA 1UFHA 1XEBA 3BI0A 2PJ1A 3IWWA 4M6IA 3IC1A 4M85A 1OBRA 2XEIA 4PQAA 4QVTA 4A31A 1TF9A 3EXNA 2HC9A 2EWBA 2B5GA 2BSWA 4H2KA 4FBEA 1WWZA 2AE6A 3QAYA 2ANPA 2Z3OA 2ZEGA 1I21A 4FD5A 4A37A 1JQGA 3IU1A 1ARLA 4I49A 1Z2LA 1S60A 4K3NA 2DPTA 3EY5A 4TNUA 4DJLA 3KQXA 2OZGA 2PIZA 1M1DA 4XPDC 4KLWA 4JJXA 3ETIA 1XOVA 3LMSA 5LYLA 3IJ3A 4MFPA 3DLJA 2PJ9A 3CXSA 2FAVA 2Z3LA 2V8GA 4H6ZA 3UY5A 3D7FA 3E0KA 1CP7A 3FEEA 3P2FA 3KHZA 3KR5A 4PPZA 1WK4A 2F7VA 4CRZB 3D2MA 5FSYA 3WABA 4M6HA 2CTBA 2J8MA 1NSLA 2P6EA 4CAFA 4C2ZA 1YK3A 2DF5A 2QIRA 4EWTA 3S6HA 3SIIA 1NJRA 3PFEA 4MY0A 2ABZA 1TF8A 2YNCC 4UFXA 4F0YA 1TKFA 2DXQA 1Z8LA 1NE9A 1MJAA 2PJ3A 3FMCA 1CM0A 3EJFA 1P4NA 2AFMA 4P4BA 5H84A 4IQYA 4GM5A 4KVXA 4X3RA 4R87A 2PJ0A 5AGEA 3ISZA 2GFQA 1TXZA 3G8WA
chains in the Genus database with same CATH topology
4CPAA 4ZX8A 1VHUA 1Y0RA 3Q6ZA 4JLLA 4GUAA 1VIXA 4NGPA 4UF4A 4Z65A 3EW5A 2PJ4A 4MCRA 1CG2A 4MHZA 5HVGA 4X2TA 4DYOA 3TX8A 4F9UA 2RB7A 1ZLHA 5IB9A 4P4JA 2AFWA 5LRJA 4JCAA 4NGTA 1R43A 2IMOA 4J5QA 5K8MA 1AYEA 4F9VA 4NGNA 3PRTA 2PJ2A 3FH4A 2AFSA 4PXCA 1QMUA 4UMLA 1CPSA 1ZG7A 4GVVA 5CBMA 3JRUA 4IK2A 3EJGA 5CMSA 3NH5A 5ELYA 1CP6A 2O53A 1HDQA 2PCUA 4UIAA 5E3BA 5JH9A 2POKA 1IGBA 5I4MA 4J5SA 1EE3P 2FVGA 1ZR3A 2NYQA 4OC5A 4PXDA 3SIHA 5HIHA 3KL9A 4A94A 3JZTA 3GQOA 3PFOA 2AFCA 3N5FA 3FEDA 2BFQA 2CTCA 1VHEA 2QVPA 3IEHA 2GREA 5DUSA 2PJCA 3IO1A 3WC6A 3QNVA 2X47A 1Y7EA 4UIBA 4R7MA 3CT9A 1ELLP 3KZWA 2AFXA 3EKEA 2JEWA 2VRIA 2ZENA 3V38A 5D8NA 2RFHA 1ZR5A 1LANA 2PE3A 4MCQA 4NGRA 3SI1A 1LOKA 4EFDA 2BO9A 3KHXA 2C6GA 3IIDA 2JBKA 4IAVA 2IQ6A 1KWMA 2PJBA 3KI9A 5HXDA 4ZY0A 4ZY1A 3H8EA 2ZEOA 1BPMA 2PVVA 4ABKA 3B2YA 4ZX9A 2V8DA 1Z5RA 1DE4C 3HLPA 3GQEA 2OR4A 4UEEA 3BXMA 4GVWA 2BOAA 3SIJA 2NSMA 5THWA 1F2PA 5HVFA 4MRIA 5K8PA 4P45A 3MRUA 1F2OA 5AILA 1NSAA 3K9TA 3PB7X 2IJZA 3TC8A 3FECA 3PB6X 2J9AA 4K0CA 1HEEA 2XD7A 4NGQA 5K8NA 3FVLA 3HUVA 2F8HA 1LAPA 1FNOA 3WC5A 2PIYA 4WJBA 3IIFA 1ELMP 3B3VA 4JGKA 5HVHA 2PJ8A 4YWYA 3V2BA 3KQZA 3DGVA 5DS0A 4R8FA 2V8VA 4OC2A 3D66A 3CPAA 2ZEPA 2AFZA 2XEJA 2PRQA 2ZOGA 5LRGA 1H8LA 3PEIA 2PJ5A 3GPQA 2DX6A 3B3CA 7CPAA 4OC3A 2DEAA 2G9DA 4MXUA 4BD9A 1GYTA 1RTQA 2O4HA 3VATA 4NJQA 2LGRA 3EWRA 1XFOA 2PJAA 4OKOA 3SI0A 4A38A 1YW6A 1XMBA 5D29A 4MCPA 3D67A 4IHMA 1XBUA 1ZG9A 1R3NA 3K2KA 1Q7LA 3FX6A 4A39A 1VGYA 5JM6A 2AFUA 4KYBA 4ZYQA 3WC7A 3KR4A 2GU2A 5FSXA 1YSJA 3RZAA 1FT7A 3B3SA 3SJFA 3GPOA 2ZELA 1LCPA 2ZEHA 1CBXA 4TU0A 2FG1A 4KSIA 3GPGA 3V7ZA 3PBEA 3B3TA 3MN8A 8CPAA 4R76A 3NH4A 3BI1A 1UWYA 3NFZA 5CB3A 4P6YA 3PBBA 3PB8X 1CX8A 2WZNA 4MHNA 3S9NA 2Q43A 4MMOA 4ZI6A 5K8OA 5FSUA 2ZOFA 2PVWA 4PXBA 4AXVA 4OIDA 5CB5A 1VHOA 1IY7A 2QJ8A 2XEGA 5F09A 3D7DA 3IFEA 4W9YA 1SPVA 1HDUA 4OC0A 2AFOA 5HOLA 3ISXA 1LFWA 2PJ7A 1M4LA 4FWUA 4DUKA 4UEFA 1XRYA 3KASA 2ZEMA 1PCAA 2ZEDA 4ETJA 3PB9X 4PXEA 5FSZA 2JBJA 2EK9A 2EK8A 3S9LA 3SIGA 2PJ6A 1YW4A 3IIBA 3KGQA 5LYIA 3BHXA 4NGSA 4EMEA 2GLFA 4F8ZA 4MCSA 3I1UA 5LYDA 3VFQA 3LWUA 2Q4ZA 4OIWA 3V45A 2Q51A 2GLJA 3B35A 3GB0A 5JGFA 5LYFA 3L2NA 1TKJA 1YD9A 2CF4A 2C1CA 3EWPA 4P44A 4R6TA 4OC1A 3SJGA 3VH9A 4OC4A 2V77A 3NA6A 4D86A 4OMEA 1F57A 3Q71A 1TKHA 4MHPA 1DTDA 3SJXA 5CPAA 3RBUA 1PYTB 1AMPA 1YLOA 2VL1A 1BAVA 4OP4A 5J1QA 4YU9A 4B6ZA 2V8HA 4P4IA 3D4UA 1BLLE 4ESSA 1YMEA 2XEFA 2I3CA 4Q7AA 4P10A 3T8WA 3S9MA 2C6PA 2BCOA 4JVVA 2QYVA 4TWEA 4MHYA 3CPXA 3GUXA 3B7IA 1TY8A 4RUHA 2EEEA 2C6CA 4FUUA 4JZ0A 4NJRA 4X8IA 4G1PA 2OOTA 3NH8A 1Y0YA 4O23A 3RAMA 4ETKA 1ZG8A 3PB4X 5LRKA 4UEZA 1ZLIA 4WWVA 3D68A 1TXRA 3FJUA 3D7GA 3EWQA 3FF3A 4P4DA 2BFRA 3SJEA 5FSVA 6CPAA 2ZEFA 1CPXA 3D7HA 2WYRA 3WT4A 2ZEEA 1HJZA 3GLJA 2L8RA 4JYWA 4NGMA 2ACFA 4ABLA 1XJOA 4ZY2A 4FAIA 1QQ9A 3CDXA 1LAMA 4P4FA 3SI2A 3VARA 3EWOA 4NFRA 3H8GA 2HB6A 2CIJA 4J4ZA 4P4EA 2FXKA 3H8FA 1ARMA 4LQGA 4ONWA 1BPNA 4J5RA 3IWWA 3BI0A 2PJ1A 3IC1A 1OBRA 2XEIA 4PQAA 1TF9A 2HC9A 2EWBA 4H2KA 4FBEA 2ANPA 2ZEGA 4A37A 1JQGA 1ARLA 1Z2LA 4K3NA 4TNUA 4DJLA 3KQXA 2PIZA 3ETIA 3LMSA 5LYLA 3IJ3A 3DLJA 2PJ9A 2FAVA 2V8GA 3D7FA 1CP7A 3FEEA 3KHZA 3KR5A 4PPZA 2F7VA 5FSYA 3WABA 2CTBA 4EWTA 3SIIA 1NJRA 3PFEA 2ABZA 1TF8A 1TKFA 1Z8LA 2PJ3A 3FMCA 3EJFA 2AFMA 4P4BA 4IQYA 4GM5A 4X3RA 2PJ0A 3ISZA 3B3WA 1TXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CPA A;  4ZX8 A;  1VHU A;  1Y0R A;  3Q6Z A;  4JLL A;  4GUA A;  1VIX A;  4NGP A;  4UF4 A;  4Z65 A;  3EW5 A;  2PJ4 A;  4MCR A;  1CG2 A;  4MHZ A;  5HVG A;  4X2T A;  4DYO A;  3TX8 A;  4F9U A;  2RB7 A;  1ZLH A;  5IB9 A;  4P4J A;  2AFW A;  5LRJ A;  4JCA A;  4NGT A;  1R43 A;  2IMO A;  4J5Q A;  5K8M A;  1AYE A;  4F9V A;  4NGN A;  3PRT A;  2PJ2 A;  3FH4 A;  2AFS A;  4PXC A;  1QMU A;  4UML A;  1CPS A;  1ZG7 A;  4GVV A;  5CBM A;  3JRU A;  4IK2 A;  3EJG A;  5CMS A;  3NH5 A;  5ELY A;  1CP6 A;  2O53 A;  1HDQ A;  2PCU A;  4UIA A;  5E3B A;  5JH9 A;  2POK A;  1IGB A;  5I4M A;  4J5S A;  1EE3 P;  2FVG A;  1ZR3 A;  2NYQ A;  4OC5 A;  4PXD A;  3SIH A;  5HIH A;  3KL9 A;  4A94 A;  3JZT A;  3GQO A;  3PFO A;  2AFC A;  3N5F A;  3FED A;  2BFQ A;  2CTC A;  1VHE A;  2QVP A;  3IEH A;  2GRE A;  5DUS A;  2PJC A;  3IO1 A;  3WC6 A;  3QNV A;  2X47 A;  1Y7E A;  4UIB A;  4R7M A;  3CT9 A;  1ELL P;  3KZW A;  2AFX A;  3EKE A;  2JEW A;  2VRI A;  2ZEN A;  3V38 A;  5D8N A;  2RFH A;  1ZR5 A;  1LAN A;  2PE3 A;  4MCQ A;  4NGR A;  3SI1 A;  1LOK A;  4EFD A;  2BO9 A;  3KHX A;  2C6G A;  3IID A;  2JBK A;  4IAV A;  2IQ6 A;  1KWM A;  2PJB A;  3KI9 A;  5HXD A;  4ZY0 A;  4ZY1 A;  3H8E A;  2ZEO A;  1BPM A;  2PVV A;  4ABK A;  3B2Y A;  4ZX9 A;  2V8D A;  1Z5R A;  1DE4 C;  3HLP A;  3GQE A;  2OR4 A;  4UEE A;  3BXM A;  4GVW A;  2BOA A;  3SIJ A;  2NSM A;  5THW A;  1F2P A;  5HVF A;  4MRI A;  5K8P A;  4P45 A;  3MRU A;  1F2O A;  5AIL A;  1NSA A;  3K9T A;  3PB7 X;  2IJZ A;  3TC8 A;  3FEC A;  3PB6 X;  2J9A A;  4K0C A;  1HEE A;  2XD7 A;  4NGQ A;  5K8N A;  3FVL A;  3HUV A;  2F8H A;  1LAP A;  1FNO A;  3WC5 A;  2PIY A;  4WJB A;  3IIF A;  1ELM P;  3B3V A;  4JGK A;  5HVH A;  2PJ8 A;  4YWY A;  3V2B A;  3KQZ A;  3DGV A;  5DS0 A;  4R8F A;  2V8V A;  4OC2 A;  3D66 A;  3CPA A;  2ZEP A;  2AFZ A;  2XEJ A;  2PRQ A;  2ZOG A;  5LRG A;  1H8L A;  3PEI A;  2PJ5 A;  3GPQ A;  2DX6 A;  3B3C A;  7CPA A;  4OC3 A;  2DEA A;  2G9D A;  4MXU A;  4BD9 A;  1GYT A;  1RTQ A;  2O4H A;  3VAT A;  4NJQ A;  2LGR A;  3EWR A;  1XFO A;  2PJA A;  4OKO A;  3SI0 A;  4A38 A;  1YW6 A;  1XMB A;  5D29 A;  4MCP A;  3D67 A;  4IHM A;  1XBU A;  1ZG9 A;  1R3N A;  3K2K A;  1Q7L A;  3FX6 A;  4A39 A;  1VGY A;  5JM6 A;  2AFU A;  4KYB A;  4ZYQ A;  3WC7 A;  3KR4 A;  2GU2 A;  5FSX A;  1YSJ A;  3RZA A;  1FT7 A;  3B3S A;  3SJF A;  3GPO A;  2ZEL A;  1LCP A;  2ZEH A;  1CBX A;  4TU0 A;  2FG1 A;  4KSI A;  3GPG A;  3V7Z A;  3PBE A;  3B3T A;  3MN8 A;  8CPA A;  4R76 A;  3NH4 A;  3BI1 A;  1UWY A;  3NFZ A;  5CB3 A;  4P6Y A;  3PBB A;  3PB8 X;  1CX8 A;  2WZN A;  4MHN A;  3S9N A;  2Q43 A;  4MMO A;  4ZI6 A;  5K8O A;  5FSU A;  2ZOF A;  2PVW A;  4PXB A;  4AXV A;  4OID A;  5CB5 A;  1VHO A;  1IY7 A;  2QJ8 A;  2XEG A;  5F09 A;  3D7D A;  3IFE A;  4W9Y A;  1SPV A;  1HDU A;  4OC0 A;  2AFO A;  5HOL A;  3ISX A;  1LFW A;  2PJ7 A;  1M4L A;  4FWU A;  4DUK A;  4UEF A;  1XRY A;  3KAS A;  2ZEM A;  1PCA A;  2ZED A;  4ETJ A;  3PB9 X;  4PXE A;  5FSZ A;  2JBJ A;  2EK9 A;  2EK8 A;  3S9L A;  3SIG A;  2PJ6 A;  1YW4 A;  3IIB A;  3KGQ A;  5LYI A;  3BHX A;  4NGS A;  4EME A;  2GLF A;  4F8Z A;  4MCS A;  3I1U A;  5LYD A;  3VFQ A;  3LWU A;  2Q4Z A;  4OIW A;  3V45 A;  2Q51 A;  2GLJ A;  3B35 A;  3GB0 A;  5JGF A;  5LYF A;  3L2N A;  1TKJ A;  1YD9 A;  2CF4 A;  2C1C A;  3EWP A;  4P44 A;  4R6T A;  4OC1 A;  3SJG A;  3VH9 A;  4OC4 A;  2V77 A;  3NA6 A;  4D86 A;  4OME A;  1F57 A;  3Q71 A;  1TKH A;  4MHP A;  1DTD A;  3SJX A;  5CPA A;  3RBU A;  1PYT B;  1AMP A;  1YLO A;  2VL1 A;  1BAV A;  4OP4 A;  5J1Q A;  4YU9 A;  4B6Z A;  2V8H A;  4P4I A;  3D4U A;  1BLL E;  4ESS A;  1YME A;  2XEF A;  2I3C A;  4Q7A A;  4P10 A;  3T8W A;  3S9M A;  2C6P A;  2BCO A;  4JVV A;  2QYV A;  4TWE A;  4MHY A;  3CPX A;  3GUX A;  3B7I A;  1TY8 A;  4RUH A;  2EEE A;  2C6C A;  4FUU A;  4JZ0 A;  4NJR A;  4X8I A;  4G1P A;  2OOT A;  3NH8 A;  1Y0Y A;  4O23 A;  3RAM A;  4ETK A;  1ZG8 A;  3PB4 X;  5LRK A;  4UEZ A;  1ZLI A;  4WWV A;  3D68 A;  1TXR A;  3FJU A;  3D7G A;  3EWQ A;  3FF3 A;  4P4D A;  2BFR A;  3SJE A;  5FSV A;  6CPA A;  2ZEF A;  1CPX A;  3D7H A;  2WYR A;  3WT4 A;  2ZEE A;  1HJZ A;  3GLJ A;  2L8R A;  4JYW A;  4NGM A;  2ACF A;  4ABL A;  1XJO A;  4ZY2 A;  4FAI A;  1QQ9 A;  3CDX A;  1LAM A;  4P4F A;  3SI2 A;  3VAR A;  3EWO A;  4NFR A;  3H8G A;  2HB6 A;  2CIJ A;  4J4Z A;  4P4E A;  2FXK A;  3H8F A;  1ARM A;  4LQG A;  4ONW A;  1BPN A;  4J5R A;  3IWW A;  3BI0 A;  2PJ1 A;  3IC1 A;  1OBR A;  2XEI A;  4PQA A;  1TF9 A;  2HC9 A;  2EWB A;  4H2K A;  4FBE A;  2ANP A;  2ZEG A;  4A37 A;  1JQG A;  1ARL A;  1Z2L A;  4K3N A;  4TNU A;  4DJL A;  3KQX A;  2PIZ A;  3ETI A;  3LMS A;  5LYL A;  3IJ3 A;  3DLJ A;  2PJ9 A;  2FAV A;  2V8G A;  3D7F A;  1CP7 A;  3FEE A;  3KHZ A;  3KR5 A;  4PPZ A;  2F7V A;  5FSY A;  3WAB A;  2CTB A;  4EWT A;  3SII A;  1NJR A;  3PFE A;  2ABZ A;  1TF8 A;  1TKF A;  1Z8L A;  2PJ3 A;  3FMC A;  3EJF A;  2AFM A;  4P4B A;  4IQY A;  4GM5 A;  4X3R A;  2PJ0 A;  3ISZ A;  3B3W A;  1TXZ A; 
#chains in the Genus database with same CATH topology
 5DWN A;  4CPA A;  2J8R A;  4ZX8 A;  2FT0 A;  1VHU A;  5AG6 A;  4B12 A;  5A28 A;  1M4I A;  5KTA A;  1Y0R A;  4KUA A;  4KZT A;  4MJ8 A;  3Q6Z A;  5CNP A;  3B3W A;  5KTC A;  3GYA A;  5JPH A;  4JLL A;  4XNH B;  4ONU A;  4GUA A;  5BWA B;  1VIX A;  4NGP A;  4UF4 A;  4Z65 A;  3EW5 A;  2P6G A;  2PJ4 A;  3GY9 A;  2EO8 A;  4MCR A;  1CG2 A;  4MHZ A;  5HVG A;  4X2T A;  4QC6 A;  4DYO A;  2K5T A;  2YNC A;  3TX8 A;  1XMT A;  4F9U A;  2RB7 A;  3A9L A;  2KQV A;  2OU2 A;  3RYO A;  2Z3P A;  1ZLH A;  1RXT A;  4P4J A;  5IB9 A;  2AFW A;  5LRJ A;  3TFY A;  1YGH A;  1IB1 E;  2BEI A;  4JCA A;  1VHS A;  4NGT A;  5EMI A;  1R43 A;  2ZPA A;  2IMO A;  5HH1 A;  4J5Q A;  3TCV A;  5K8M A;  1AYE A;  3B8G A;  4UCN A;  2VBQ A;  2YGW A;  2C27 A;  4C2X A;  4NGN A;  1S7N A;  3D3S A;  4F9V A;  1QSO A;  3PRT A;  1ZO0 A;  2PJ2 A;  3FH4 A;  2AFS A;  4PXC A;  2VI7 A;  2FCK A;  4A2Z A;  4FD4 A;  1QMU A;  4UML A;  1CPS A;  1ZG7 A;  2Q4V A;  4GVV A;  5CBM A;  3JRU A;  4K30 A;  3P2H A;  4IK2 A;  4UCP A;  3EJG A;  5CMS A;  2JZE A;  1XF8 A;  4M6G A;  5F09 A;  3NH5 A;  5HMN A;  1S5K A;  5ELY A;  1CP6 A;  2OZH A;  2O53 A;  4F6A A;  1HDQ A;  3TT2 A;  1CJW A;  2PCU A;  4UIA A;  5E3B A;  3FIX A;  3FNC A;  5JH9 A;  2POK A;  1IGB A;  2JZD A;  3BLN A;  5I4M A;  1IYK A;  3NE7 A;  4J5S A;  3EC4 A;  1EE3 P;  1M4G A;  1XE4 A;  4XPL A;  1I12 A;  2FVG A;  3IWG A;  1ZR3 A;  2NYQ A;  4OC5 A;  4PXD A;  2J8N A;  3SIH A;  5HIH A;  4AVA A;  3KL9 A;  3S6G A;  4A94 A;  4MFZ A;  1QSR A;  3G3S A;  4HNY B;  2R8V A;  2JDD A;  3JZT A;  2Z11 A;  4KOT A;  3GQO A;  3PFO A;  2AFC A;  1Q2Y A;  1IOI A;  3N5F A;  2F5I A;  2BFQ A;  2CTC A;  3FED A;  4OAE A;  1VHE A;  2QVP A;  1QST A;  3IEH A;  1LRZ A;  2B3U A;  1K4J A;  2QEC A;  2GRE A;  5DUS A;  4B5P A;  5FVJ A;  2Q44 A;  1Q2D A;  2PJC A;  3IO1 A;  3WC6 A;  1Z8W A;  1ON0 A;  3QNV A;  2X47 A;  1Y7E A;  2WSA A;  4MFQ A;  1S7K A;  4R7M A;  3CT9 A;  4UIB A;  1IU8 A;  4Q36 A;  1ELL P;  3KZW A;  2H5M A;  2AFX A;  2Q7B A;  2Z3M A;  3EKE A;  2JEW A;  2VRI A;  1A2Z A;  2ZEN A;  3V38 A;  5D8N A;  2RFH A;  3LOD A;  1ZR5 A;  1LAN A;  2PE3 A;  4MCQ A;  4NGR A;  2D4P A;  4CYO A;  4UBR A;  2WPW A;  4UWI A;  3SI1 A;  4C68 A;  1LOK A;  2D4O A;  4EFD A;  2BO9 A;  3LAC A;  5C82 A;  5GCN A;  3KHX A;  2C6G A;  4ZBG A;  3IID A;  4E2A A;  3TTH A;  1N71 A;  2JBK A;  4IAV A;  3W6X A;  3QAH A;  4CGL A;  2PSW A;  4KOS A;  5G1Z A;  5KTD A;  4II9 A;  2IQ6 A;  1KWM A;  4B14 A;  2OB0 A;  2P0W A;  4DNC A;  1YLE A;  3RO0 A;  3ZZI A;  1IOF A;  2PJB A;  3KI9 A;  3R96 A;  5HXD A;  2CNM A;  4ZY0 A;  1X12 A;  4ZY1 A;  2FL4 A;  4CRY B;  3H8E A;  2ZEO A;  1MJB A;  1I1D A;  4CAW A;  3CZX A;  3QB8 A;  2ZW6 A;  1BPM A;  2PVV A;  4ABK A;  4Y49 B;  4H6U A;  3B2Y A;  2GAN A;  5IV0 A;  4ZX9 A;  2V8D A;  1Z5R A;  4E0A A;  5F46 A;  1DE4 C;  3HLP A;  4PSX A;  3GQE A;  2OR4 A;  2EVN A;  4LUA A;  4UEE A;  3BXM A;  5F48 A;  3EO4 A;  4GVW A;  4B13 A;  2BOA A;  3S6K A;  3SIJ A;  2NSM A;  5THW A;  1F2P A;  4B5O A;  5HVF A;  3WR7 A;  4BMH A;  4MRI A;  5K8P A;  4CS0 B;  3VWE A;  4KOY A;  4P45 A;  1BO4 A;  1F2O A;  5AIL A;  1NSA A;  3I3G A;  1U6M A;  2REE A;  3K9T A;  2IJZ A;  1L0C A;  3PB7 X;  4UFV A;  3ZJ0 A;  4CYQ A;  4YFJ A;  3TC8 A;  3FEC A;  3PB6 X;  2J9A A;  1YR0 A;  4K0C A;  2AJ6 A;  1HEE A;  3K9U A;  4MFL A;  2XD7 A;  4H89 A;  4NGQ A;  3T90 A;  3S6F A;  5K8N A;  4GXH A;  1MJ9 A;  2B4B A;  2GE3 A;  3FVL A;  3HUV A;  2F8H A;  4LX9 A;  1LAP A;  1FNO A;  2FE7 A;  5G22 A;  4A30 A;  3WC5 A;  2PIY A;  3BJ7 A;  4WJB A;  3IIF A;  1IYL A;  1ELM P;  2JZF A;  3B3V A;  3TO6 A;  4JGK A;  4AVB A;  2P6F A;  2OZU A;  5HVH A;  2PJ8 A;  2ZXV A;  4HKF A;  5E96 A;  4YWY A;  4KVM E;  1X10 A;  3R9F A;  3V2B A;  4Q38 A;  3KQZ A;  3JVN A;  4J3G A;  1YVO A;  4AG7 A;  3DGV A;  2B58 A;  5DS0 A;  4QBJ A;  4RUH A;  4C2Y A;  4R8F A;  2V8V A;  1GHE A;  2X7B A;  1KUX A;  1KUV A;  4OC2 A;  3D66 A;  2B3V A;  3CPA A;  3FYN A;  2ZEP A;  2AFZ A;  2XEJ A;  3C26 A;  2PRQ A;  2ZOG A;  4RI1 A;  5LRG A;  2WCT A;  1IID A;  3W6S A;  1H8L A;  4B5P B;  1Y7R A;  3PEI A;  2PJ5 A;  3IU2 A;  3PP9 A;  3GPQ A;  2Q04 A;  2VZY A;  3D8P A;  3DDD A;  5EC4 A;  3DNS A;  2DX6 A;  1VKC A;  3B3C A;  7CPA A;  4GS4 A;  4OC3 A;  5C88 A;  1XIX A;  2DEA A;  2G9D A;  4MXU A;  4B10 A;  1GYT A;  2YND A;  1RTQ A;  1J4J A;  2O4H A;  3VAT A;  4NJQ A;  4BD9 A;  2LGR A;  3EWR A;  1XFO A;  2PJA A;  4KOU A;  4M3S A;  4HNX B;  4OKO A;  3SI0 A;  4NSQ A;  4A38 A;  3RNZ A;  1YW6 A;  1XMB A;  5D29 A;  4MCP A;  2VQY A;  3D67 A;  3IGR A;  4IHM A;  4QUS A;  3PZJ A;  1XBU A;  4MFJ A;  1ZG9 A;  4BIN A;  3FXT A;  4L89 A;  3H5Z A;  5ISV A;  1Z8T A;  1R3N A;  3K2K A;  3T9Y A;  1Q7L A;  1YQE A;  3FX6 A;  1VGY A;  3CXQ A;  4A39 A;  5JM6 A;  5H86 A;  2AFU A;  4E8O A;  2CXA A;  4KYB A;  2PC1 A;  4ZYQ A;  2EBJ A;  2VZZ A;  4PV6 A;  3WC7 A;  1Z4R A;  3KR4 A;  5J8F A;  2GU2 A;  2VEZ A;  5FSX A;  1YSJ A;  4HPS A;  1M4D A;  2Q7S A;  3RZA A;  2R1I A;  1FT7 A;  3LD2 A;  3B3S A;  4A32 A;  2ARH A;  3SJF A;  3GPO A;  2ZEL A;  1LCP A;  5I0C A;  2PR8 A;  2ZEH A;  3F5B A;  1CBX A;  2WPX A;  2GIV A;  4TU0 A;  2FG1 A;  2FIA A;  4KSI A;  4MY3 A;  4PK3 A;  3GPG A;  2PDO A;  2BL1 A;  3V7Z A;  3CXP A;  5JQ4 A;  3PBE A;  2HV2 A;  3EFA A;  4CGN A;  3F0A A;  2B5G B;  4CYN A;  2Z10 A;  3B3T A;  3MN8 A;  1Z4E A;  4R76 A;  3R1K A;  8CPA A;  5G21 A;  3NH4 A;  3BI1 A;  2FSR A;  4A95 A;  1UWY A;  3NFZ A;  2ZW4 A;  5CB3 A;  4P6Y A;  4XPK A;  1BOB A;  1S7L A;  2I00 A;  3PB8 X;  1CX8 A;  3PBB A;  2WZN A;  2QML A;  4AB7 A;  4F0X A;  4MHN A;  3S9N A;  1MK4 A;  1Z9U A;  2Q43 A;  3V8I A;  3I9S A;  1YX0 A;  4MMO A;  3W91 A;  4ZI6 A;  4LQ6 A;  5K8O A;  4KOW A;  1QSM A;  1AUG A;  5FSU A;  3TE4 A;  3D2P A;  2ZOF A;  2PVW A;  4PXB A;  4AXV A;  1S3Z A;  2RC4 A;  3IWE A;  4OID A;  5CB5 A;  1VHO A;  2Y0M A;  4KVO E;  4EVY A;  4C7H A;  1IY7 A;  4MBU A;  4YRH A;  1SQH A;  4PK2 A;  1V0C A;  2FS5 A;  2QJ8 A;  2XEG A;  1YRE A;  3FBU A;  3D7D A;  3TOA A;  4B11 A;  2R98 A;  3IFE A;  4KS9 A;  4W9Y A;  1SPV A;  1HDU A;  3R95 A;  3SXO A;  4KOR A;  4U5Y A;  4YGO A;  1Z8X A;  4OC0 A;  1R57 A;  2AFO A;  5HOL A;  3ISX A;  4BBH A;  1LFW A;  2KCW A;  1S7F A;  2PJ7 A;  1M4L A;  4FWU A;  5EBV A;  4U9Z A;  4A33 A;  4DUK A;  4ZGY B;  2RNK A;  2G3T A;  4MI4 A;  1XRY A;  4R3K A;  4UEF A;  4JLY A;  2G3A A;  3KAS A;  2ZEM A;  1PCA A;  2VXK A;  2ZED A;  2W2G A;  4ETJ A;  3PB9 X;  5FSZ A;  4PXE A;  4R9M A;  2A4N A;  2JBJ A;  1IIC A;  2REF A;  2EK9 A;  2EK8 A;  2Z3K A;  4CAX A;  1Q2C A;  3S9L A;  3SIG A;  2CNS A;  1YW4 A;  2PJ6 A;  3GIU A;  4NF1 A;  4RN7 A;  3R9G A;  1P0H A;  4AG9 A;  3IIB A;  5AG4 A;  1Y9K A;  3KGQ A;  2R7H A;  5LYI A;  3N7Z A;  3BHX A;  2CY2 A;  4IUS A;  4NGS A;  5F49 A;  2ODF A;  4EME A;  2GLF A;  4JXR A;  2OH1 A;  4F8Z A;  4ORF A;  4MCS A;  3I1U A;  5LYD A;  3VFQ A;  3LWU A;  2Q4Z A;  4OIW A;  5F47 A;  1Y9W A;  3V45 A;  2Q51 A;  2GLJ A;  3B35 A;  3GB0 A;  4NXY A;  3TO9 A;  3L2N A;  5JGF A;  5LYF A;  4CGO A;  1TKJ A;  2EUI A;  5A27 A;  1YD9 A;  2CF4 A;  4RS2 A;  2C1C A;  2FXF A;  3EWP A;  4P44 A;  5J8C A;  4R6T A;  3MGD A;  4OC1 A;  2WUU A;  4FD7 A;  3SJG A;  2HQY A;  4OC4 A;  3VH9 A;  2V77 A;  3NA6 A;  4JWP A;  2HUZ A;  4D86 A;  4KSA A;  4OME A;  4JXQ A;  1F57 A;  3Q71 A;  1TKH A;  4L8A A;  3PGP A;  4AVC A;  4MHP A;  3R9E A;  4QB9 A;  4KOX A;  1QSN A;  1DTD A;  3F8K A;  4XPD B;  3NE8 A;  2Q4Y A;  3MRU A;  4HNW B;  4KOV A;  5IX3 A;  3GKR A;  3SXN A;  3TOB A;  1B6B A;  1YVK A;  4R3L A;  3SJX A;  5CPA A;  3RBU A;  1PYT B;  4FD6 A;  1AMP A;  1YLO A;  2VL1 A;  3BJ8 A;  4U9Y A;  1JWQ A;  1BAV A;  4NEX A;  4OP4 A;  5J1Q A;  4YU9 A;  4B6Z A;  4UFW A;  2JLM A;  2V8H A;  3H4Q A;  4P4I A;  3D4U A;  4OAD A;  1BLL E;  4OLL A;  4ESS A;  1YME A;  2B4D A;  2XEF A;  2I3C A;  4Y49 C;  2ZW7 A;  4Q7A A;  1PUA A;  4P10 A;  5DWM A;  4CAE A;  2G0B A;  3T8W A;  2B4D B;  2Q0Y A;  1OZP A;  1KUY A;  3S9M A;  2C6P A;  2BCO A;  4JVV A;  2Z3N A;  2QYV A;  4ONW A;  2O28 A;  4TWE A;  4X5K A;  5G20 A;  3TO7 A;  2JDC A;  4MHY A;  3CPX A;  3DR8 A;  3B7I A;  1TY8 A;  3GUX A;  2EEE A;  4KSF A;  4CGP A;  2C6C A;  4FUU A;  4MHD A;  1B87 A;  4JZ0 A;  4NJR A;  4UWJ A;  2PRB A;  4X8I A;  4MFK A;  1NMT A;  2NMT A;  4G1P A;  3NH8 A;  2OOT A;  1Y0Y A;  2I79 A;  4O23 A;  4R57 A;  4CYP A;  3RAM A;  3DR6 A;  4ETK A;  1PU9 A;  1ZG8 A;  1FY7 A;  3PB4 X;  5LRK A;  4UEZ A;  2YNE A;  4IF5 A;  1TIQ A;  4KUB A;  1ZLI A;  3KKW A;  4WWV A;  5AG7 A;  3D68 A;  4XNH C;  1TXR A;  4NCZ A;  3FJU A;  3JUW A;  3D7G A;  3EWQ A;  4JD6 A;  3FF3 A;  4P4D A;  4UCM A;  3VWD A;  2BFR A;  3SJE A;  5FSV A;  6CPA A;  2ZEF A;  1CPX A;  3D7H A;  3OWC A;  3JTK A;  2WYR A;  3WT4 A;  2BUE A;  4CGM A;  4KLV A;  2ZEE A;  4PSW A;  1HJZ A;  3GLJ A;  3SHP A;  2PR1 A;  2L8R A;  4JYW A;  2ATR A;  5IB0 A;  4NGM A;  2DPS A;  2ACF A;  2PQ8 A;  4ABL A;  3DSB A;  4LQG A;  5AG5 A;  1XJO A;  4ZY2 A;  2FIW A;  4CAV A;  4C7I A;  4FAI A;  1QQ9 A;  3CDX A;  1LAM A;  4P4F A;  4UA3 A;  3SI2 A;  3VAR A;  3EWO A;  3FB3 A;  4NFR A;  2IL4 A;  3H8G A;  2HB6 A;  2CIJ A;  4J4Z A;  4P4E A;  2FXK A;  3FRM A;  3H8F A;  1ARM A;  2CNT A;  1RO5 A;  2JEV A;  2ZW5 A;  1M44 A;  2Z0Z A;  1BPN A;  4J5R A;  1KZF A;  1UFH A;  1XEB A;  3BI0 A;  2PJ1 A;  3IWW A;  4M6I A;  3IC1 A;  4M85 A;  1OBR A;  2XEI A;  4PQA A;  4QVT A;  4A31 A;  1TF9 A;  3EXN A;  2HC9 A;  2EWB A;  2B5G A;  2BSW A;  4H2K A;  4FBE A;  1WWZ A;  2AE6 A;  3QAY A;  2ANP A;  2Z3O A;  2ZEG A;  1I21 A;  4FD5 A;  4A37 A;  1JQG A;  3IU1 A;  1ARL A;  4I49 A;  1Z2L A;  1S60 A;  4K3N A;  2DPT A;  3EY5 A;  4TNU A;  4DJL A;  3KQX A;  2OZG A;  2PIZ A;  1M1D A;  4XPD C;  4KLW A;  4JJX A;  3ETI A;  1XOV A;  3LMS A;  5LYL A;  3IJ3 A;  4MFP A;  3DLJ A;  2PJ9 A;  3CXS A;  2FAV A;  2Z3L A;  2V8G A;  4H6Z A;  3UY5 A;  3D7F A;  3E0K A;  1CP7 A;  3FEE A;  3P2F A;  3KHZ A;  3KR5 A;  4PPZ A;  1WK4 A;  2F7V A;  4CRZ B;  3D2M A;  5FSY A;  3WAB A;  4M6H A;  2CTB A;  2J8M A;  1NSL A;  2P6E A;  4CAF A;  4C2Z A;  1YK3 A;  2DF5 A;  2QIR A;  4EWT A;  3S6H A;  3SII A;  1NJR A;  3PFE A;  4MY0 A;  2ABZ A;  1TF8 A;  2YNC C;  4UFX A;  4F0Y A;  1TKF A;  2DXQ A;  1Z8L A;  1NE9 A;  1MJA A;  2PJ3 A;  3FMC A;  1CM0 A;  3EJF A;  1P4N A;  2AFM A;  4P4B A;  5H84 A;  4IQY A;  4GM5 A;  4KVX A;  4X3R A;  4R87 A;  2PJ0 A;  5AGE A;  3ISZ A;  2GFQ A;  1TXZ A;  3G8W A; 
#chains in the Genus database with same CATH homology
 4CPA A;  4ZX8 A;  1VHU A;  1Y0R A;  3Q6Z A;  4JLL A;  4GUA A;  1VIX A;  4NGP A;  4UF4 A;  4Z65 A;  3EW5 A;  2PJ4 A;  4MCR A;  1CG2 A;  4MHZ A;  5HVG A;  4X2T A;  4DYO A;  3TX8 A;  4F9U A;  2RB7 A;  1ZLH A;  5IB9 A;  4P4J A;  2AFW A;  5LRJ A;  4JCA A;  4NGT A;  1R43 A;  2IMO A;  4J5Q A;  5K8M A;  1AYE A;  4F9V A;  4NGN A;  3PRT A;  2PJ2 A;  3FH4 A;  2AFS A;  4PXC A;  1QMU A;  4UML A;  1CPS A;  1ZG7 A;  4GVV A;  5CBM A;  3JRU A;  4IK2 A;  3EJG A;  5CMS A;  3NH5 A;  5ELY A;  1CP6 A;  2O53 A;  1HDQ A;  2PCU A;  4UIA A;  5E3B A;  5JH9 A;  2POK A;  1IGB A;  5I4M A;  4J5S A;  1EE3 P;  2FVG A;  1ZR3 A;  2NYQ A;  4OC5 A;  4PXD A;  3SIH A;  5HIH A;  3KL9 A;  4A94 A;  3JZT A;  3GQO A;  3PFO A;  2AFC A;  3N5F A;  3FED A;  2BFQ A;  2CTC A;  1VHE A;  2QVP A;  3IEH A;  2GRE A;  5DUS A;  2PJC A;  3IO1 A;  3WC6 A;  3QNV A;  2X47 A;  1Y7E A;  4UIB A;  4R7M A;  3CT9 A;  1ELL P;  3KZW A;  2AFX A;  3EKE A;  2JEW A;  2VRI A;  2ZEN A;  3V38 A;  5D8N A;  2RFH A;  1ZR5 A;  1LAN A;  2PE3 A;  4MCQ A;  4NGR A;  3SI1 A;  1LOK A;  4EFD A;  2BO9 A;  3KHX A;  2C6G A;  3IID A;  2JBK A;  4IAV A;  2IQ6 A;  1KWM A;  2PJB A;  3KI9 A;  5HXD A;  4ZY0 A;  4ZY1 A;  3H8E A;  2ZEO A;  1BPM A;  2PVV A;  4ABK A;  3B2Y A;  4ZX9 A;  2V8D A;  1Z5R A;  1DE4 C;  3HLP A;  3GQE A;  2OR4 A;  4UEE A;  3BXM A;  4GVW A;  2BOA A;  3SIJ A;  2NSM A;  5THW A;  1F2P A;  5HVF A;  4MRI A;  5K8P A;  4P45 A;  3MRU A;  1F2O A;  5AIL A;  1NSA A;  3K9T A;  3PB7 X;  2IJZ A;  3TC8 A;  3FEC A;  3PB6 X;  2J9A A;  4K0C A;  1HEE A;  2XD7 A;  4NGQ A;  5K8N A;  3FVL A;  3HUV A;  2F8H A;  1LAP A;  1FNO A;  3WC5 A;  2PIY A;  4WJB A;  3IIF A;  1ELM P;  3B3V A;  4JGK A;  5HVH A;  2PJ8 A;  4YWY A;  3V2B A;  3KQZ A;  3DGV A;  5DS0 A;  4R8F A;  2V8V A;  4OC2 A;  3D66 A;  3CPA A;  2ZEP A;  2AFZ A;  2XEJ A;  2PRQ A;  2ZOG A;  5LRG A;  1H8L A;  3PEI A;  2PJ5 A;  3GPQ A;  2DX6 A;  3B3C A;  7CPA A;  4OC3 A;  2DEA A;  2G9D A;  4MXU A;  4BD9 A;  1GYT A;  1RTQ A;  2O4H A;  3VAT A;  4NJQ A;  2LGR A;  3EWR A;  1XFO A;  2PJA A;  4OKO A;  3SI0 A;  4A38 A;  1YW6 A;  1XMB A;  5D29 A;  4MCP A;  3D67 A;  4IHM A;  1XBU A;  1ZG9 A;  1R3N A;  3K2K A;  1Q7L A;  3FX6 A;  4A39 A;  1VGY A;  5JM6 A;  2AFU A;  4KYB A;  4ZYQ A;  3WC7 A;  3KR4 A;  2GU2 A;  5FSX A;  1YSJ A;  3RZA A;  1FT7 A;  3B3S A;  3SJF A;  3GPO A;  2ZEL A;  1LCP A;  2ZEH A;  1CBX A;  4TU0 A;  2FG1 A;  4KSI A;  3GPG A;  3V7Z A;  3PBE A;  3B3T A;  3MN8 A;  8CPA A;  4R76 A;  3NH4 A;  3BI1 A;  1UWY A;  3NFZ A;  5CB3 A;  4P6Y A;  3PBB A;  3PB8 X;  1CX8 A;  2WZN A;  4MHN A;  3S9N A;  2Q43 A;  4MMO A;  4ZI6 A;  5K8O A;  5FSU A;  2ZOF A;  2PVW A;  4PXB A;  4AXV A;  4OID A;  5CB5 A;  1VHO A;  1IY7 A;  2QJ8 A;  2XEG A;  5F09 A;  3D7D A;  3IFE A;  4W9Y A;  1SPV A;  1HDU A;  4OC0 A;  2AFO A;  5HOL A;  3ISX A;  1LFW A;  2PJ7 A;  1M4L A;  4FWU A;  4DUK A;  4UEF A;  1XRY A;  3KAS A;  2ZEM A;  1PCA A;  2ZED A;  4ETJ A;  3PB9 X;  4PXE A;  5FSZ A;  2JBJ A;  2EK9 A;  2EK8 A;  3S9L A;  3SIG A;  2PJ6 A;  1YW4 A;  3IIB A;  3KGQ A;  5LYI A;  3BHX A;  4NGS A;  4EME A;  2GLF A;  4F8Z A;  4MCS A;  3I1U A;  5LYD A;  3VFQ A;  3LWU A;  2Q4Z A;  4OIW A;  3V45 A;  2Q51 A;  2GLJ A;  3B35 A;  3GB0 A;  5JGF A;  5LYF A;  3L2N A;  1TKJ A;  1YD9 A;  2CF4 A;  2C1C A;  3EWP A;  4P44 A;  4R6T A;  4OC1 A;  3SJG A;  3VH9 A;  4OC4 A;  2V77 A;  3NA6 A;  4D86 A;  4OME A;  1F57 A;  3Q71 A;  1TKH A;  4MHP A;  1DTD A;  3SJX A;  5CPA A;  3RBU A;  1PYT B;  1AMP A;  1YLO A;  2VL1 A;  1BAV A;  4OP4 A;  5J1Q A;  4YU9 A;  4B6Z A;  2V8H A;  4P4I A;  3D4U A;  1BLL E;  4ESS A;  1YME A;  2XEF A;  2I3C A;  4Q7A A;  4P10 A;  3T8W A;  3S9M A;  2C6P A;  2BCO A;  4JVV A;  2QYV A;  4TWE A;  4MHY A;  3CPX A;  3GUX A;  3B7I A;  1TY8 A;  4RUH A;  2EEE A;  2C6C A;  4FUU A;  4JZ0 A;  4NJR A;  4X8I A;  4G1P A;  2OOT A;  3NH8 A;  1Y0Y A;  4O23 A;  3RAM A;  4ETK A;  1ZG8 A;  3PB4 X;  5LRK A;  4UEZ A;  1ZLI A;  4WWV A;  3D68 A;  1TXR A;  3FJU A;  3D7G A;  3EWQ A;  3FF3 A;  4P4D A;  2BFR A;  3SJE A;  5FSV A;  6CPA A;  2ZEF A;  1CPX A;  3D7H A;  2WYR A;  3WT4 A;  2ZEE A;  1HJZ A;  3GLJ A;  2L8R A;  4JYW A;  4NGM A;  2ACF A;  4ABL A;  1XJO A;  4ZY2 A;  4FAI A;  1QQ9 A;  3CDX A;  1LAM A;  4P4F A;  3SI2 A;  3VAR A;  3EWO A;  4NFR A;  3H8G A;  2HB6 A;  2CIJ A;  4J4Z A;  4P4E A;  2FXK A;  3H8F A;  1ARM A;  4LQG A;  4ONW A;  1BPN A;  4J5R A;  3IWW A;  3BI0 A;  2PJ1 A;  3IC1 A;  1OBR A;  2XEI A;  4PQA A;  1TF9 A;  2HC9 A;  2EWB A;  4H2K A;  4FBE A;  2ANP A;  2ZEG A;  4A37 A;  1JQG A;  1ARL A;  1Z2L A;  4K3N A;  4TNU A;  4DJL A;  3KQX A;  2PIZ A;  3ETI A;  3LMS A;  5LYL A;  3IJ3 A;  3DLJ A;  2PJ9 A;  2FAV A;  2V8G A;  3D7F A;  1CP7 A;  3FEE A;  3KHZ A;  3KR5 A;  4PPZ A;  2F7V A;  5FSY A;  3WAB A;  2CTB A;  4EWT A;  3SII A;  1NJR A;  3PFE A;  2ABZ A;  1TF8 A;  1TKF A;  1Z8L A;  2PJ3 A;  3FMC A;  3EJF A;  2AFM A;  4P4B A;  4IQY A;  4GM5 A;  4X3R A;  2PJ0 A;  3ISZ A;  3B3W A;  1TXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...