1BPNA

Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
484
structure length
481
Chain Sequence
b'TKGLVLGIYSKEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUCINE AMINOPEPTIDASE
publication title Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(alpha-aminoacylpeptide)
total genus 150
structure length 481
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1993-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1bpnA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1bpnA02
2BFQA 4BD9A 4Q7AA 3EW5A 1Y7EA 2BO9A 3B7IA 1Z8LA 4P4FA 2PRQA 4NGNA 3PB4X 5LYFA 2ZEMA 2ZELA 4GVWA 2POKA 3SJFA 2AFUA 4RUHA 2F8HA 2V8VA 2ZEHA 3SIGA 4JCAA 4EMEA 3PRTA 2X47A 5JGFA 3PBBA 4MHYA 2G9DA 3JZTA 2XEFA 3IFEA 4W9YA 3KQZA 2AFCA 2PJ5A 4IQYA 2AFWA 4P4IA 1CBXA 5AILA 2V8GA 4UIBA 3D68A 5CB5A 3B3SA 4OC0A 2AFZA 4A37A 4R76A 2PJBA 3B35A 3CPAA 4JYWA 3NFZA 1BPMA 2AFXA 1HDUA 2PJ6A 7CPAA 3CPXA 2V77A 4ABKA 2HC9A 5FSVA 4ZY2A 2PJ2A 3FH4A 3SI2A 2PJ0A 2GLJA 5HVFA 4P4DA 3BI0A 4F9UA 4J4ZA 1F57A 2GREA 1BAVA 3NH8A 1RTQA 3IIDA 5I4MA 2PJ3A 5F09A 3PB6X 4B6ZA 3VARA 4G1PA 5D29A 5LRJA 1CPXA 4MHNA 4GUAA 2ZEDA 1M4LA 3D66A 3L2NA 4MHPA 1CX8A 5LRGA 2C6CA 1VGYA 3FECA 3KGQA 4OC1A 3H8EA 3B3WA 5FSZA 4EWTA 1XBUA 1Z5RA 4PXCA 5LYDA 6CPAA 3KI9A 1LANA 4P10A 4Z65A 2ZEEA 5HXDA 1F2PA 3D7FA 2BOAA 4OC4A 4K3NA 1BLLE 1QQ9A 4OMEA 3EKEA 1ELMP 1YD9A 2ANPA 2WYRA 1PYTB 4R8FA 5K8PA 4PXDA 3D7HA 3RAMA 2GU2A 3GQEA 1LFWA 4UEZA 3GLJA 4OC2A 2C6PA 3IJ3A 5HVGA 4JVVA 5HIHA 3B3CA 2IQ6A 4NGQA 3NH4A 2HB6A 5HVHA 4ZY1A 2JEWA 4TNUA 1YMEA 2ACFA 1VHEA 4F9VA 4P4JA 3FEEA 4NGRA 5CMSA 1XMBA 2FVGA 1XFOA 3N5FA 1XRYA 4DJLA 3S9NA 1TY8A 3NH5A 3SJXA 2RB7A 4DUKA 1TKHA 3H8FA 3RBUA 4PXEA 5D8NA 3KL9A 3WC7A 2GLFA 2C1CA 1VHUA 3B3VA 3ISZA 2PVWA 3GPGA 3GQOA 4PXBA 2VL1A 2PE3A 4LQGA 1HDQA 2PJ9A 3WT4A 5JM6A 4TU0A 3LWUA 4FUUA 1TKFA 2V8HA 1TXZA 2PJAA 1Y0YA 4PPZA 3WABA 1YW6A 2PIYA 4PQAA 2L8RA 1R3NA 3NA6A 3EWQA 1H8LA 3I1UA 4P44A 1ZG9A 4JLLA 3VATA 3EWOA 2AFMA 1LAPA 5CB3A 3K9TA 2V8DA 1F2OA 4UIAA 3S9MA 4GM5A 4OIDA 1YSJA 2FAVA 3QNVA 1PCAA 2PIZA 3GPQA 5LYIA 1VHOA 1FNOA 1GYTA 3DGVA 4NGMA 4OC5A 5DS0A 3Q71A 4MCSA 3ETIA 3KQXA 4OC3A 4FAIA 4R6TA 4OIWA 3IO1A 3D4UA 1ZR5A 5CPAA 1AYEA 4ETJA 4YWYA 2IJZA 5JH9A 3VH9A 3V2BA 2AFSA 3KASA 4NFRA 5FSUA 2PJCA 1Q7LA 1R43A 3K2KA 4F8ZA 4NJQA 3SIJA 2OOTA 2WZNA 1CP7A 4IK2A 4P45A 2CTCA 3V38A 4GVVA 2VRIA 3SIHA 2PJ8A 4IAVA 3HLPA 4IHMA 2JBKA 5THWA 4AXVA 1XJOA 4O23A 4FWUA 1DTDA 3PB7X 1LAMA 3KHZA 3FJUA 5K8NA 1TXRA 3PFEA 1LCPA 1SPVA 4D86A 2PJ7A 2CF4A 3DLJA 1ZLHA 4KSIA 2ZENA 4P4BA 3EWPA 4ZI6A 1ZG7A 2PJ1A 4EFDA 5LYLA 3VFQA 1NJRA 2XEIA 3TX8A 2JBJA 4JGKA 2ZOFA 2ABZA 2BFRA 4UEEA 3LMSA 3FVLA 1ELLP 3ISXA 1DE4C 2NYQA 2CTBA 3EJGA 4ABLA 3D7GA 3EJFA 3T8WA 4J5QA 4JZ0A 2PCUA 8CPAA 2XEGA 3BI1A 1IGBA 3V45A 5DUSA 4NJRA 1CPSA 3B2YA 4MCRA 5FSXA 3GUXA 3Q6ZA 1CP6A 4NGTA 3KR4A 3IC1A 1ZR3A 2OR4A 4ZX9A 4J5RA 1Y0RA 3S9LA 2DEAA 1Z2LA 2ZOGA 1TF9A 4NGPA 2O53A 2IMOA 2EK9A 3D67A 5IB9A 1LOKA 2BCOA 5FSYA 3PB9X 2CIJA 3FEDA 4A39A 2Q43A 1KWMA 3IIBA 1TF8A 4H2KA 4NGSA 3TC8A 5E3BA 4A38A 1NSAA 1TKJA 3RZAA 3BHXA 2ZEGA 4P6YA 4UEFA 2PVVA 1QMUA 4X8IA 3GPOA 3SI1A 3IEHA 1YW4A 2ZEOA 3PBEA 4P4EA 5ELYA 1ARLA 4OKOA 2F7VA 1ZG8A 2FG1A 4UF4A 4X3RA 5HOLA 3BXMA 2RFHA 1IY7A 1EE3P 2FXKA 2AFOA 3IWWA 2LGRA 3GB0A 3EWRA 2XEJA 4FBEA 3PEIA 5J1QA 4MMOA 4MRIA 4ONWA 4CPAA 1HJZA 4TWEA 2NSMA 4MCPA 3SIIA 3KZWA 3B3TA 3KHXA 4YU9A 2XD7A 1CG2A 1JQGA 5CBMA 2EEEA 4MXUA 1OBRA 3SI0A 4ZX8A 1YLOA 2EWBA 4WWVA 3CT9A 3PFOA 4ZYQA 3FMCA 1ARMA 2I3CA 1FT7A 4MHZA 3SJEA 3V7ZA 2PJ4A 4ESSA 1AMPA 3IIFA 5LRKA 4A94A 3MRUA 3WC5A 3SJGA 3WC6A 2O4HA 4KYBA 2ZEFA 4ZY0A 1HEEA 1VIXA 4J5SA 2QJ8A 4OP4A 3D7DA 2QVPA 3MN8A 1ZLIA 4R7MA 3JRUA 4K0CA 4DYOA 2J9AA 4UMLA 1BPNA 5K8OA 2QYVA 2C6GA 3PB8X 2Q51A 4X2TA 3FX6A 2Q4ZA 4WJBA 3KR5A 2ZEPA 2EK8A 2DX6A 5K8MA 3H8GA 4MCQA 4ETKA 1UWYA 3CDXA 3FF3A 3HUVA
chains in the Genus database with same CATH superfamily
2BFQA 4BD9A 2EVNA 3EW5A 1Y7EA 2BO9A 2O28A 1Z8LA 3B7IA 3IWEA 4HNWB 4P4FA 5KTDA 2PRQA 1SQHA 4NGNA 3RYOA 3PB4X 5LYFA 2ZEMA 1YVOA 2ZELA 4BMHA 2Z11A 4YFJA 4UCPA 2YNDA 4GVWA 2PR8A 2POKA 3D2PA 3SJFA 2AFUA 4RUHA 2F8HA 2V8VA 1P0HA 2ZEHA 3SIGA 1N71A 4QB9A 4KLVA 5KTCA 1I12A 5H84A 2OZGA 4JCAA 2P6GA 1KZFA 2WUUA 4EMEA 1YLEA 3PRTA 2X47A 4YRHA 4JWPA 2GANA 5JGFA 3PBBA 4MHYA 2G9DA 4IUSA 3JZTA 2XEFA 3IFEA 2BSWA 3KQZA 4HNYB 4W9YA 2AFCA 5G20A 2P6FA 5DWNA 5AG6A 2PJ5A 4IQYA 2CY2A 2AFWA 2FIWA 4P4IA 1CBXA 5AILA 2V8GA 3G8WA 4OAEA 4UIBA 3D68A 5CB5A 2B4BA 3B3SA 4B5PA 4OC0A 4KZTA 4PK3A 2AFZA 1RO5A 4JJXA 1XIXA 4A37A 4R76A 4KOTA 2PJBA 3B35A 1IICA 3CPAA 4JYWA 3NFZA 3PP9A 1BPMA 2AFXA 1HDUA 2PJ6A 7CPAA 3CPXA 2HQYA 1WWZA 2ODFA 1J4JA 1S5KA 2PR1A 2V77A 2Z3KA 1TIQA 4ABKA 2HC9A 5FSVA 4ZY2A 2PJ2A 3TTHA 4C2XA 3FH4A 3SI2A 3SXOA 2PJ0A 2GLJA 5HVFA 3CZXA 3BI0A 4P4DA 4F9UA 4J4ZA 1F57A 2GREA 1BAVA 2ATRA 1RTQA 3NH8A 4UWJA 4A32A 3IIDA 4F0XA 1YVKA 5I4MA 2PJ3A 5F09A 3PB6X 4B6ZA 3VARA 1R57A 5H86A 4G1PA 2B5GA 5D29A 4KSFA 5LRJA 4KVME 4NF1A 1CPXA 4MHNA 4U9ZA 4GUAA 2A4NA 2ZEDA 1M4LA 3D66A 3L2NA 4MHPA 1CX8A 5F48A 5LRGA 2C6CA 1VGYA 2GE3A 3FECA 1QSRA 3KGQA 3H8EA 3B3WA 4KLWA 5FSZA 2ZXVA 4OC1A 3S6HA 3W91A 2VZZA 4EWTA 4CRZB 2Z3PA 1XBUA 4KS9A 1Z5RA 3R9GA 1I21A 2OZUA 4PXCA 3GKRA 4AB7A 4MHDA 4HNXB 4PK2A 4B13A 2D4PA 5LYDA 5G1ZA 6CPAA 4E8OA 3KI9A 2FL4A 1LANA 4CYNA 4P10A 3TO9A 2WSAA 2ZEEA 4Z65A 2JEVA 5HXDA 2EUIA 2AJ6A 3IGRA 1F2PA 4YGOA 3D7FA 5JPHA 2BOAA 4OC4A 2RNKA 1BLLE 4K3NA 1QQ9A 3EKEA 2PRBA 4OMEA 4B10A 1ELMP 1M4IA 1X10A 2CNMA 2IL4A 3EXNA 4LUAA 4EVYA 1YD9A 1Y7RA 2ANPA 2WYRA 4CAXA 1PYTB 2WPXA 3G3SA 4R8FA 2Z3OA 5K8PA 1Z4EA 4PXDA 4BINA 2YNCA 3D7HA 2VI7A 3RAMA 2GU2A 5IV0A 1M44A 3EC4A 3GQEA 1LFWA 1QSTA 4UEZA 3LODA 2D4OA 3GLJA 4OC2A 2C6PA 3NE7A 4KVOE 3IJ3A 5GCNA 5HVGA 4FD5A 4JVVA 4MI4A 5HIHA 3B3CA 3E0KA 2IQ6A 4NGQA 3NH4A 4UCNA 5DWMA 4C2ZA 2HB6A 5HVHA 1M4GA 4ZY1A 4HPSA 4M6IA 2JEWA 3TO6A 2ZW6A 2B4DB 4TNUA 3ZJ0A 2BEIA 4MFZA 1YMEA 2ACFA 1VHEA 4X5KA 3VWDA 4AG7A 4F9VA 4P4JA 4A30A 3FEEA 4NGRA 3BLNA 3R96A 1FY7A 5CMSA 4R87A 1IYKA 1XMBA 1XFOA 2FVGA 3PZJA 1YGHA 2AE6A 3N5FA 1XRYA 2G0BA 4ZBGA 4DJLA 3S9NA 1TY8A 2PC1A 1CM0A 2Q0YA 4UWIA 1Z9UA 3D8PA 3NH5A 3SJXA 1RXTA 2RB7A 4E0AA 2FCKA 4DUKA 2G3TA 1TKHA 3K9UA 4CGOA 3H8FA 3RBUA 1Q2CA 5D8NA 1X12A 4PXEA 4RI1A 2R7HA 3KL9A 3WC7A 3QAHA 2GLFA 2H5MA 2C1CA 4R57A 4M6GA 5A28A 4XPDC 5A27A 3TT2A 5E96A 1S7KA 4Q38A 3QB8A 3N7ZA 1VHUA 4QUSA 1IIDA 3B3VA 3ISZA 4KSAA 1L0CA 2PVWA 2DPSA 3DDDA 3GPGA 1I1DA 3GQOA 2B5GB 2K5TA 3IU1A 3P2FA 3GIUA 4PXBA 2VL1A 2YNCC 1XF8A 2PE3A 4MY0A 4LQGA 1HDQA 1B6BA 2PJ9A 4KUAA 1S7FA 3WT4A 5JM6A 4TU0A 3LWUA 2JLMA 3FYNA 4M3SA 4FUUA 1TKFA 1JWQA 3TO7A 2V8HA 1TXZA 1MJBA 1Y0YA 2PJAA 4CGLA 4PPZA 3WABA 1YW6A 4BBHA 2PIYA 1CJWA 2HV2A 4PQAA 4I49A 2L8RA 1UFHA 1R3NA 3NA6A 3EWQA 5J8FA 2QECA 1Z8TA 4FD7A 1VHSA 4XPDB 1H8LA 3I1UA 4FD4A 2FSRA 2F5IA 4P44A 4Q7AA 1ZG9A 4JLLA 3VATA 3EWOA 2AFMA 4JXRA 2JZFA 1LAPA 5CB3A 2EBJA 3S6FA 3EO4A 4AVAA 4MBUA 3BJ7A 2V8DA 1F2OA 3K9TA 2Q04A 4KOSA 4UIAA 3S9MA 1S60A 4GM5A 4IF5A 2Z3NA 4OIDA 1YSJA 2FAVA 2Q44A 3QNVA 3T9YA 3TOBA 4MFLA 2YGWA 1PCAA 1MJAA 1QSMA 2PIZA 3GPQA 3I9SA 1VHOA 5LYIA 1FNOA 1GYTA 5IB0A 3DGVA 4MFJA 4NGMA 4OC5A 2Q7SA 4XPLA 4FD6A 5DS0A 3Q71A 4MCSA 3ETIA 1LRZA 2X7BA 3KQXA 4A33A 4OC3A 2VZYA 4FAIA 5BWAB 4R6TA 4OIWA 4R3LA 2NMTA 3DR6A 3GY9A 4KOWA 3IO1A 4OADA 3D4UA 4NXYA 1ZR5A 3P2HA 1AYEA 4ETJA 2REFA 2IJZA 3BJ8A 4PV6A 5CPAA 4YWYA 3VH9A 3V2BA 2AFSA 3KASA 4NFRA 2PQ8A 2CNTA 5FSUA 2PJCA 1Q7LA 1R43A 1S7LA 3K2KA 4B14A 2HUZA 4MFPA 4F8ZA 2GFQA 4NJQA 3SIJA 2OOTA 3T90A 1PU9A 2QMLA 4NCZA 2WZNA 5HMNA 1CP7A 4CYOA 3S6GA 3A9LA 4IK2A 4P45A 3W6XA 1Y9KA 2CTCA 2PDOA 3RNZA 1QSNA 4GVVA 3V38A 2FS5A 2VRIA 3SIHA 2FIAA 3FBUA 3V8IA 1IU8A 2B3VA 2PJ8A 4IAVA 3HLPA 3R9FA 4IHMA 4C68A 3C26A 2JBKA 5THWA 4AXVA 4LQ6A 5JQ4A 1XJOA 1OZPA 5J8CA 2C27A 4MJ8A 3WR7A 4O23A 2I00A 1NSLA 4FWUA 1DTDA 3EFAA 3CXQA 3PB7X 1LAMA 2VQYA 3KHZA 3FJUA 5K8NA 5ISVA 2BUEA 4GS4A 3F0AA 1MK4A 2W2GA 1TXRA 1YR0A 2R98A 4AG9A 4AVCA 1XE4A 3PFEA 1LCPA 1SPVA 4D86A 2PJ7A 2CF4A 3SHPA 3IU2A 3DLJA 1ZLHA 4KSIA 2OH1A 2ZENA 4P4BA 3UY5A 3EWPA 2OU2A 4ZI6A 2ARHA 3FNCA 4B5PB 1ZG7A 4CAWA 2PJ1A 3KKWA 4HKFA 3VFQA 4DNCA 4EFDA 5LYLA 4U5YA 4L8AA 1NJRA 2J8NA 1NMTA 4UFWA 2XEIA 3TX8A 2JBJA 4CAEA 4JGKA 2VXKA 2RC4A 4CAVA 4C2YA 4H6UA 2VBQA 2ABZA 2ZOFA 2BFRA 4UEEA 2G3AA 2Z10A 2Z3LA 3F8KA 3LMSA 3FVLA 1ELLP 2FXFA 4KOUA 3LACA 3ISXA 1DE4C 2QIRA 2NYQA 2CTBA 1Y9WA 3EJGA 1XMTA 5C82A 4ABLA 2PSWA 3D7GA 3EJFA 3T8WA 4Y49C 4J5QA 2FT0A 4JZ0A 2PCUA 8CPAA 2XEGA 3BI1A 2Y0MA 1IGBA 4RS2A 1M1DA 4U9YA 3V45A 3R95A 4CGNA 5DUSA 3GYAA 4M85A 4NJRA 3FXTA 1CPSA 4CAFA 3B2YA 4MCRA 5FSXA 4H89A 3GUXA 3Q6ZA 1CP6A 2CXAA 3KR4A 3IC1A 1ZR3A 4NGTA 2OR4A 4ZX9A 2WCTA 4J5RA 1Y0RA 3S9LA 1Z8XA 4CYPA 4II9A 3F5BA 2DEAA 1Z2LA 4XNHC 2ZOGA 1TF9A 1IOIA 4JXQA 4L89A 2O53A 4NGPA 2R8VA 5AG7A 5FVJA 3RO0A 2IMOA 4B12A 4CGPA 5AG4A 3D3SA 4QVTA 2EK9A 4C7HA 3FB3A 3D67A 3R9EA 3VWEA 1KUYA 5IB9A 3JVNA 4F0YA 1LOKA 2B58A 2BCOA 2FE7A 2Q4VA 4UCMA 5FSYA 1Z4RA 3PB9X 1IOFA 4Y49B 2CIJA 4CGMA 3FEDA 2Q7BA 2Q43A 4A39A 1KWMA 3IIBA 1TF8A 4H2KA 4NGSA 4AVBA 3TC8A 5E3BA 4A2ZA 1P4NA 2YNEA 5AG5A 4A38A 3TFYA 1NSAA 2CNSA 1TKJA 5HH1A 1Q2YA 1PUAA 3RZAA 2B4DA 1Z8WA 3BHXA 2ZEGA 4P6YA 4PSXA 4UEFA 3TCVA 4A95A 2PVVA 4A31A 1QMUA 4X8IA 3ZZIA 4OLLA 3GPOA 3SI1A 3IEHA 2VEZA 1K4JA 1YW4A 2ZEOA 3PBEA 4XNHB 2DPTA 3IWGA 3QAYA 4P4EA 5F49A 1ARLA 4OKOA 5ELYA 4CS0B 2F7VA 4E2AA 3TE4A 1ZG8A 4QBJA 2FG1A 4UF4A 3SXNA 4X3RA 5HOLA 1A2ZA 3BXMA 5JH9A 4F6AA 1YREA 2RFHA 2KCWA 1U6MA 1IY7A 1EE3P 2FXKA 1ON0A 1WK4A 3FRMA 4MY3A 4NSQA 4UFXA 5F46A 2AFOA 1V0CA 5IX3A 3W6SA 3IWWA 2LGRA 4MFQA 4M6HA 4KOYA 5CNPA 3GB0A 3EWRA 4K30A 4ZGYB 1S3ZA 2XEJA 3OWCA 3PEIA 4ONUA 4FBEA 3B8GA 5J1QA 4MMOA 4MRIA 1IB1E 4ONWA 4CPAA 1HJZA 2OB0A 4TWEA 2NSMA 4MCPA 2ZW7A 5C88A 3SIIA 1BO4A 3KZWA 5F47A 3B3TA 2ZW4A 4UA3A 3KHXA 2B3UA 3CXSA 4GXHA 4JD6A 2XD7A 4YU9A 1CG2A 1JQGA 5CBMA 4UFVA 2DXQA 2I79A 2EEEA 4H6ZA 1M4DA 1MJ9A 4MXUA 1OBRA 3SI0A 4KOXA 4ZX8A 1YLOA 3EY5A 2EWBA 5G21A 4WWVA 2P6EA 3S6KA 1NE9A 3CT9A 3PFOA 4ZYQA 4KOVA 3FMCA 1ARMA 1IYLA 3H4QA 4MFKA 2I3CA 1KUXA 1YQEA 2GIVA 1VKCA 4LX9A 2JDDA 3DSBA 1KUVA 2R1IA 1FT7A 3DNSA 4MHZA 4ORFA 3SJEA 3V7ZA 4CRYB 2PJ4A 4ESSA 1ZO0A 2OZHA 4J3GA 4B11A 1AMPA 3IIFA 2P0WA 4UBRA 4A94A 5LRKA 3MRUA 3WC5A 4PSWA 3SJGA 3WC6A 4C7IA 3JTKA 1BOBA 2J8MA 2O4HA 4KYBA 1XOVA 2EO8A 4ZY0A 2ZEFA 1HEEA 4NEXA 5EBVA 2ZW5A 3I3GA 1VIXA 4J5SA 2Q4YA 2WPWA 5EMIA 2QJ8A 1GHEA 4QC6A 2J8RA 3JUWA 3D7DA 4OP4A 4CYQA 3NE8A 3MGDA 2QVPA 4XPKA 5I0CA 4R3KA 2DF5A 2Z3MA 3LD2A 2REEA 1YK3A 1QSOA 3TOAA 2BL1A 4KUBA 3MN8A 1ZLIA 4KVXA 3PGPA 4R7MA 4Q36A 2ZPAA 3JRUA 4K0CA 4DYOA 2J9AA 4UMLA 1YX0A 1BPNA 2Z0ZA 5KTAA 3R1KA 5K8OA 2QYVA 2KQVA 1Q2DA 3D2MA 3FIXA 2C6GA 3H5ZA 3PB8X 4RN7A 5G22A 1AUGA 4R9MA 2Q51A 1XEBA 4X2TA 3FX6A 5AGEA 4JLYA 2JZEA 2Q4ZA 4WJBA 3KR5A 2ZEPA 2EK8A 3DR8A 2DX6A 5K8MA 2JDCA 3H8GA 4KORA 3CXPA 4B5OA 1B87A 4MCQA 1S7NA 4ETKA 1UWYA 5EC4A 3CDXA 3FF3A 2JZDA 3HUVA
chains in the Genus database with same CATH topology
2BFQA 4BD9A 4Q7AA 3EW5A 1Y7EA 2BO9A 3B7IA 1Z8LA 4P4FA 2PRQA 4NGNA 3PB4X 5LYFA 2ZEMA 2ZELA 4GVWA 2POKA 3SJFA 2AFUA 4RUHA 2F8HA 2V8VA 2ZEHA 3SIGA 4JCAA 4EMEA 3PRTA 2X47A 5JGFA 3PBBA 4MHYA 2G9DA 3JZTA 2XEFA 3IFEA 4W9YA 3KQZA 2AFCA 2PJ5A 4IQYA 2AFWA 4P4IA 1CBXA 5AILA 2V8GA 4UIBA 3D68A 5CB5A 3B3SA 4OC0A 2AFZA 4A37A 4R76A 2PJBA 3B35A 3CPAA 4JYWA 3NFZA 1BPMA 2AFXA 1HDUA 2PJ6A 7CPAA 3CPXA 2V77A 4ABKA 2HC9A 5FSVA 4ZY2A 2PJ2A 3FH4A 3SI2A 2PJ0A 2GLJA 5HVFA 4P4DA 3BI0A 4F9UA 4J4ZA 1F57A 2GREA 1BAVA 3NH8A 1RTQA 3IIDA 5I4MA 2PJ3A 5F09A 3PB6X 4B6ZA 3VARA 4G1PA 5D29A 5LRJA 1CPXA 4MHNA 4GUAA 2ZEDA 1M4LA 3D66A 3L2NA 4MHPA 1CX8A 5LRGA 2C6CA 1VGYA 3FECA 3KGQA 4OC1A 3H8EA 3B3WA 5FSZA 4EWTA 1XBUA 1Z5RA 4PXCA 5LYDA 6CPAA 3KI9A 1LANA 4P10A 4Z65A 2ZEEA 5HXDA 1F2PA 3D7FA 2BOAA 4OC4A 4K3NA 1BLLE 1QQ9A 4OMEA 3EKEA 1ELMP 1YD9A 2ANPA 2WYRA 1PYTB 4R8FA 5K8PA 4PXDA 3D7HA 3RAMA 2GU2A 3GQEA 1LFWA 4UEZA 3GLJA 4OC2A 2C6PA 3IJ3A 5HVGA 4JVVA 5HIHA 3B3CA 2IQ6A 4NGQA 3NH4A 2HB6A 5HVHA 4ZY1A 2JEWA 4TNUA 1YMEA 2ACFA 1VHEA 4F9VA 4P4JA 3FEEA 4NGRA 5CMSA 1XMBA 2FVGA 1XFOA 3N5FA 1XRYA 4DJLA 3S9NA 1TY8A 3NH5A 3SJXA 2RB7A 4DUKA 1TKHA 3H8FA 3RBUA 4PXEA 5D8NA 3KL9A 3WC7A 2GLFA 2C1CA 1VHUA 3B3VA 3ISZA 2PVWA 3GPGA 3GQOA 4PXBA 2VL1A 2PE3A 4LQGA 1HDQA 2PJ9A 3WT4A 5JM6A 4TU0A 3LWUA 4FUUA 1TKFA 2V8HA 1TXZA 2PJAA 1Y0YA 4PPZA 3WABA 1YW6A 2PIYA 4PQAA 2L8RA 1R3NA 3NA6A 3EWQA 1H8LA 3I1UA 4P44A 1ZG9A 4JLLA 3VATA 3EWOA 2AFMA 1LAPA 5CB3A 3K9TA 2V8DA 1F2OA 4UIAA 3S9MA 4GM5A 4OIDA 1YSJA 2FAVA 3QNVA 1PCAA 2PIZA 3GPQA 5LYIA 1VHOA 1FNOA 1GYTA 3DGVA 4NGMA 4OC5A 5DS0A 3Q71A 4MCSA 3ETIA 3KQXA 4OC3A 4FAIA 4R6TA 4OIWA 3IO1A 3D4UA 1ZR5A 5CPAA 1AYEA 4ETJA 4YWYA 2IJZA 5JH9A 3VH9A 3V2BA 2AFSA 3KASA 4NFRA 5FSUA 2PJCA 1Q7LA 1R43A 3K2KA 4F8ZA 4NJQA 3SIJA 2OOTA 2WZNA 1CP7A 4IK2A 4P45A 2CTCA 3V38A 4GVVA 2VRIA 3SIHA 2PJ8A 4IAVA 3HLPA 4IHMA 2JBKA 5THWA 4AXVA 1XJOA 4O23A 4FWUA 1DTDA 3PB7X 1LAMA 3KHZA 3FJUA 5K8NA 1TXRA 3PFEA 1LCPA 1SPVA 4D86A 2PJ7A 2CF4A 3DLJA 1ZLHA 4KSIA 2ZENA 4P4BA 3EWPA 4ZI6A 1ZG7A 2PJ1A 4EFDA 5LYLA 3VFQA 1NJRA 2XEIA 3TX8A 2JBJA 4JGKA 2ZOFA 2ABZA 2BFRA 4UEEA 3LMSA 3FVLA 1ELLP 3ISXA 1DE4C 2NYQA 2CTBA 3EJGA 4ABLA 3D7GA 3EJFA 3T8WA 4J5QA 4JZ0A 2PCUA 8CPAA 2XEGA 3BI1A 1IGBA 3V45A 5DUSA 4NJRA 1CPSA 3B2YA 4MCRA 5FSXA 3GUXA 3Q6ZA 1CP6A 4NGTA 3KR4A 3IC1A 1ZR3A 2OR4A 4ZX9A 4J5RA 1Y0RA 3S9LA 2DEAA 1Z2LA 2ZOGA 1TF9A 4NGPA 2O53A 2IMOA 2EK9A 3D67A 5IB9A 1LOKA 2BCOA 5FSYA 3PB9X 2CIJA 3FEDA 4A39A 2Q43A 1KWMA 3IIBA 1TF8A 4H2KA 4NGSA 3TC8A 5E3BA 4A38A 1NSAA 1TKJA 3RZAA 3BHXA 2ZEGA 4P6YA 4UEFA 2PVVA 1QMUA 4X8IA 3GPOA 3SI1A 3IEHA 1YW4A 2ZEOA 3PBEA 4P4EA 5ELYA 1ARLA 4OKOA 2F7VA 1ZG8A 2FG1A 4UF4A 4X3RA 5HOLA 3BXMA 2RFHA 1IY7A 1EE3P 2FXKA 2AFOA 3IWWA 2LGRA 3GB0A 3EWRA 2XEJA 4FBEA 3PEIA 5J1QA 4MMOA 4MRIA 4ONWA 4CPAA 1HJZA 4TWEA 2NSMA 4MCPA 3SIIA 3KZWA 3B3TA 3KHXA 4YU9A 2XD7A 1CG2A 1JQGA 5CBMA 2EEEA 4MXUA 1OBRA 3SI0A 4ZX8A 1YLOA 2EWBA 4WWVA 3CT9A 3PFOA 4ZYQA 3FMCA 1ARMA 2I3CA 1FT7A 4MHZA 3SJEA 3V7ZA 2PJ4A 4ESSA 1AMPA 3IIFA 5LRKA 4A94A 3MRUA 3WC5A 3SJGA 3WC6A 2O4HA 4KYBA 2ZEFA 4ZY0A 1HEEA 1VIXA 4J5SA 2QJ8A 4OP4A 3D7DA 2QVPA 3MN8A 1ZLIA 4R7MA 3JRUA 4K0CA 4DYOA 2J9AA 4UMLA 1BPNA 5K8OA 2QYVA 2C6GA 3PB8X 2Q51A 4X2TA 3FX6A 2Q4ZA 4WJBA 3KR5A 2ZEPA 2EK8A 2DX6A 5K8MA 3H8GA 4MCQA 4ETKA 1UWYA 3CDXA 3FF3A 3HUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BFQ A;  4BD9 A;  4Q7A A;  3EW5 A;  1Y7E A;  2BO9 A;  3B7I A;  1Z8L A;  4P4F A;  2PRQ A;  4NGN A;  3PB4 X;  5LYF A;  2ZEM A;  2ZEL A;  4GVW A;  2POK A;  3SJF A;  2AFU A;  4RUH A;  2F8H A;  2V8V A;  2ZEH A;  3SIG A;  4JCA A;  4EME A;  3PRT A;  2X47 A;  5JGF A;  3PBB A;  4MHY A;  2G9D A;  3JZT A;  2XEF A;  3IFE A;  4W9Y A;  3KQZ A;  2AFC A;  2PJ5 A;  4IQY A;  2AFW A;  4P4I A;  1CBX A;  5AIL A;  2V8G A;  4UIB A;  3D68 A;  5CB5 A;  3B3S A;  4OC0 A;  2AFZ A;  4A37 A;  4R76 A;  2PJB A;  3B35 A;  3CPA A;  4JYW A;  3NFZ A;  1BPM A;  2AFX A;  1HDU A;  2PJ6 A;  7CPA A;  3CPX A;  2V77 A;  4ABK A;  2HC9 A;  5FSV A;  4ZY2 A;  2PJ2 A;  3FH4 A;  3SI2 A;  2PJ0 A;  2GLJ A;  5HVF A;  4P4D A;  3BI0 A;  4F9U A;  4J4Z A;  1F57 A;  2GRE A;  1BAV A;  3NH8 A;  1RTQ A;  3IID A;  5I4M A;  2PJ3 A;  5F09 A;  3PB6 X;  4B6Z A;  3VAR A;  4G1P A;  5D29 A;  5LRJ A;  1CPX A;  4MHN A;  4GUA A;  2ZED A;  1M4L A;  3D66 A;  3L2N A;  4MHP A;  1CX8 A;  5LRG A;  2C6C A;  1VGY A;  3FEC A;  3KGQ A;  4OC1 A;  3H8E A;  3B3W A;  5FSZ A;  4EWT A;  1XBU A;  1Z5R A;  4PXC A;  5LYD A;  6CPA A;  3KI9 A;  1LAN A;  4P10 A;  4Z65 A;  2ZEE A;  5HXD A;  1F2P A;  3D7F A;  2BOA A;  4OC4 A;  4K3N A;  1BLL E;  1QQ9 A;  4OME A;  3EKE A;  1ELM P;  1YD9 A;  2ANP A;  2WYR A;  1PYT B;  4R8F A;  5K8P A;  4PXD A;  3D7H A;  3RAM A;  2GU2 A;  3GQE A;  1LFW A;  4UEZ A;  3GLJ A;  4OC2 A;  2C6P A;  3IJ3 A;  5HVG A;  4JVV A;  5HIH A;  3B3C A;  2IQ6 A;  4NGQ A;  3NH4 A;  2HB6 A;  5HVH A;  4ZY1 A;  2JEW A;  4TNU A;  1YME A;  2ACF A;  1VHE A;  4F9V A;  4P4J A;  3FEE A;  4NGR A;  5CMS A;  1XMB A;  2FVG A;  1XFO A;  3N5F A;  1XRY A;  4DJL A;  3S9N A;  1TY8 A;  3NH5 A;  3SJX A;  2RB7 A;  4DUK A;  1TKH A;  3H8F A;  3RBU A;  4PXE A;  5D8N A;  3KL9 A;  3WC7 A;  2GLF A;  2C1C A;  1VHU A;  3B3V A;  3ISZ A;  2PVW A;  3GPG A;  3GQO A;  4PXB A;  2VL1 A;  2PE3 A;  4LQG A;  1HDQ A;  2PJ9 A;  3WT4 A;  5JM6 A;  4TU0 A;  3LWU A;  4FUU A;  1TKF A;  2V8H A;  1TXZ A;  2PJA A;  1Y0Y A;  4PPZ A;  3WAB A;  1YW6 A;  2PIY A;  4PQA A;  2L8R A;  1R3N A;  3NA6 A;  3EWQ A;  1H8L A;  3I1U A;  4P44 A;  1ZG9 A;  4JLL A;  3VAT A;  3EWO A;  2AFM A;  1LAP A;  5CB3 A;  3K9T A;  2V8D A;  1F2O A;  4UIA A;  3S9M A;  4GM5 A;  4OID A;  1YSJ A;  2FAV A;  3QNV A;  1PCA A;  2PIZ A;  3GPQ A;  5LYI A;  1VHO A;  1FNO A;  1GYT A;  3DGV A;  4NGM A;  4OC5 A;  5DS0 A;  3Q71 A;  4MCS A;  3ETI A;  3KQX A;  4OC3 A;  4FAI A;  4R6T A;  4OIW A;  3IO1 A;  3D4U A;  1ZR5 A;  5CPA A;  1AYE A;  4ETJ A;  4YWY A;  2IJZ A;  5JH9 A;  3VH9 A;  3V2B A;  2AFS A;  3KAS A;  4NFR A;  5FSU A;  2PJC A;  1Q7L A;  1R43 A;  3K2K A;  4F8Z A;  4NJQ A;  3SIJ A;  2OOT A;  2WZN A;  1CP7 A;  4IK2 A;  4P45 A;  2CTC A;  3V38 A;  4GVV A;  2VRI A;  3SIH A;  2PJ8 A;  4IAV A;  3HLP A;  4IHM A;  2JBK A;  5THW A;  4AXV A;  1XJO A;  4O23 A;  4FWU A;  1DTD A;  3PB7 X;  1LAM A;  3KHZ A;  3FJU A;  5K8N A;  1TXR A;  3PFE A;  1LCP A;  1SPV A;  4D86 A;  2PJ7 A;  2CF4 A;  3DLJ A;  1ZLH A;  4KSI A;  2ZEN A;  4P4B A;  3EWP A;  4ZI6 A;  1ZG7 A;  2PJ1 A;  4EFD A;  5LYL A;  3VFQ A;  1NJR A;  2XEI A;  3TX8 A;  2JBJ A;  4JGK A;  2ZOF A;  2ABZ A;  2BFR A;  4UEE A;  3LMS A;  3FVL A;  1ELL P;  3ISX A;  1DE4 C;  2NYQ A;  2CTB A;  3EJG A;  4ABL A;  3D7G A;  3EJF A;  3T8W A;  4J5Q A;  4JZ0 A;  2PCU A;  8CPA A;  2XEG A;  3BI1 A;  1IGB A;  3V45 A;  5DUS A;  4NJR A;  1CPS A;  3B2Y A;  4MCR A;  5FSX A;  3GUX A;  3Q6Z A;  1CP6 A;  4NGT A;  3KR4 A;  3IC1 A;  1ZR3 A;  2OR4 A;  4ZX9 A;  4J5R A;  1Y0R A;  3S9L A;  2DEA A;  1Z2L A;  2ZOG A;  1TF9 A;  4NGP A;  2O53 A;  2IMO A;  2EK9 A;  3D67 A;  5IB9 A;  1LOK A;  2BCO A;  5FSY A;  3PB9 X;  2CIJ A;  3FED A;  4A39 A;  2Q43 A;  1KWM A;  3IIB A;  1TF8 A;  4H2K A;  4NGS A;  3TC8 A;  5E3B A;  4A38 A;  1NSA A;  1TKJ A;  3RZA A;  3BHX A;  2ZEG A;  4P6Y A;  4UEF A;  2PVV A;  1QMU A;  4X8I A;  3GPO A;  3SI1 A;  3IEH A;  1YW4 A;  2ZEO A;  3PBE A;  4P4E A;  5ELY A;  1ARL A;  4OKO A;  2F7V A;  1ZG8 A;  2FG1 A;  4UF4 A;  4X3R A;  5HOL A;  3BXM A;  2RFH A;  1IY7 A;  1EE3 P;  2FXK A;  2AFO A;  3IWW A;  2LGR A;  3GB0 A;  3EWR A;  2XEJ A;  4FBE A;  3PEI A;  5J1Q A;  4MMO A;  4MRI A;  4ONW A;  4CPA A;  1HJZ A;  4TWE A;  2NSM A;  4MCP A;  3SII A;  3KZW A;  3B3T A;  3KHX A;  4YU9 A;  2XD7 A;  1CG2 A;  1JQG A;  5CBM A;  2EEE A;  4MXU A;  1OBR A;  3SI0 A;  4ZX8 A;  1YLO A;  2EWB A;  4WWV A;  3CT9 A;  3PFO A;  4ZYQ A;  3FMC A;  1ARM A;  2I3C A;  1FT7 A;  4MHZ A;  3SJE A;  3V7Z A;  2PJ4 A;  4ESS A;  1AMP A;  3IIF A;  5LRK A;  4A94 A;  3MRU A;  3WC5 A;  3SJG A;  3WC6 A;  2O4H A;  4KYB A;  2ZEF A;  4ZY0 A;  1HEE A;  1VIX A;  4J5S A;  2QJ8 A;  4OP4 A;  3D7D A;  2QVP A;  3MN8 A;  1ZLI A;  4R7M A;  3JRU A;  4K0C A;  4DYO A;  2J9A A;  4UML A;  1BPN A;  5K8O A;  2QYV A;  2C6G A;  3PB8 X;  2Q51 A;  4X2T A;  3FX6 A;  2Q4Z A;  4WJB A;  3KR5 A;  2ZEP A;  2EK8 A;  2DX6 A;  5K8M A;  3H8G A;  4MCQ A;  4ETK A;  1UWY A;  3CDX A;  3FF3 A;  3HUV A; 
#chains in the Genus database with same CATH topology
 2BFQ A;  4BD9 A;  2EVN A;  3EW5 A;  1Y7E A;  2BO9 A;  2O28 A;  1Z8L A;  3B7I A;  3IWE A;  4HNW B;  4P4F A;  5KTD A;  2PRQ A;  1SQH A;  4NGN A;  3RYO A;  3PB4 X;  5LYF A;  2ZEM A;  1YVO A;  2ZEL A;  4BMH A;  2Z11 A;  4YFJ A;  4UCP A;  2YND A;  4GVW A;  2PR8 A;  2POK A;  3D2P A;  3SJF A;  2AFU A;  4RUH A;  2F8H A;  2V8V A;  1P0H A;  2ZEH A;  3SIG A;  1N71 A;  4QB9 A;  4KLV A;  5KTC A;  1I12 A;  5H84 A;  2OZG A;  4JCA A;  2P6G A;  1KZF A;  2WUU A;  4EME A;  1YLE A;  3PRT A;  2X47 A;  4YRH A;  4JWP A;  2GAN A;  5JGF A;  3PBB A;  4MHY A;  2G9D A;  4IUS A;  3JZT A;  2XEF A;  3IFE A;  2BSW A;  3KQZ A;  4HNY B;  4W9Y A;  2AFC A;  5G20 A;  2P6F A;  5DWN A;  5AG6 A;  2PJ5 A;  4IQY A;  2CY2 A;  2AFW A;  2FIW A;  4P4I A;  1CBX A;  5AIL A;  2V8G A;  3G8W A;  4OAE A;  4UIB A;  3D68 A;  5CB5 A;  2B4B A;  3B3S A;  4B5P A;  4OC0 A;  4KZT A;  4PK3 A;  2AFZ A;  1RO5 A;  4JJX A;  1XIX A;  4A37 A;  4R76 A;  4KOT A;  2PJB A;  3B35 A;  1IIC A;  3CPA A;  4JYW A;  3NFZ A;  3PP9 A;  1BPM A;  2AFX A;  1HDU A;  2PJ6 A;  7CPA A;  3CPX A;  2HQY A;  1WWZ A;  2ODF A;  1J4J A;  1S5K A;  2PR1 A;  2V77 A;  2Z3K A;  1TIQ A;  4ABK A;  2HC9 A;  5FSV A;  4ZY2 A;  2PJ2 A;  3TTH A;  4C2X A;  3FH4 A;  3SI2 A;  3SXO A;  2PJ0 A;  2GLJ A;  5HVF A;  3CZX A;  3BI0 A;  4P4D A;  4F9U A;  4J4Z A;  1F57 A;  2GRE A;  1BAV A;  2ATR A;  1RTQ A;  3NH8 A;  4UWJ A;  4A32 A;  3IID A;  4F0X A;  1YVK A;  5I4M A;  2PJ3 A;  5F09 A;  3PB6 X;  4B6Z A;  3VAR A;  1R57 A;  5H86 A;  4G1P A;  2B5G A;  5D29 A;  4KSF A;  5LRJ A;  4KVM E;  4NF1 A;  1CPX A;  4MHN A;  4U9Z A;  4GUA A;  2A4N A;  2ZED A;  1M4L A;  3D66 A;  3L2N A;  4MHP A;  1CX8 A;  5F48 A;  5LRG A;  2C6C A;  1VGY A;  2GE3 A;  3FEC A;  1QSR A;  3KGQ A;  3H8E A;  3B3W A;  4KLW A;  5FSZ A;  2ZXV A;  4OC1 A;  3S6H A;  3W91 A;  2VZZ A;  4EWT A;  4CRZ B;  2Z3P A;  1XBU A;  4KS9 A;  1Z5R A;  3R9G A;  1I21 A;  2OZU A;  4PXC A;  3GKR A;  4AB7 A;  4MHD A;  4HNX B;  4PK2 A;  4B13 A;  2D4P A;  5LYD A;  5G1Z A;  6CPA A;  4E8O A;  3KI9 A;  2FL4 A;  1LAN A;  4CYN A;  4P10 A;  3TO9 A;  2WSA A;  2ZEE A;  4Z65 A;  2JEV A;  5HXD A;  2EUI A;  2AJ6 A;  3IGR A;  1F2P A;  4YGO A;  3D7F A;  5JPH A;  2BOA A;  4OC4 A;  2RNK A;  1BLL E;  4K3N A;  1QQ9 A;  3EKE A;  2PRB A;  4OME A;  4B10 A;  1ELM P;  1M4I A;  1X10 A;  2CNM A;  2IL4 A;  3EXN A;  4LUA A;  4EVY A;  1YD9 A;  1Y7R A;  2ANP A;  2WYR A;  4CAX A;  1PYT B;  2WPX A;  3G3S A;  4R8F A;  2Z3O A;  5K8P A;  1Z4E A;  4PXD A;  4BIN A;  2YNC A;  3D7H A;  2VI7 A;  3RAM A;  2GU2 A;  5IV0 A;  1M44 A;  3EC4 A;  3GQE A;  1LFW A;  1QST A;  4UEZ A;  3LOD A;  2D4O A;  3GLJ A;  4OC2 A;  2C6P A;  3NE7 A;  4KVO E;  3IJ3 A;  5GCN A;  5HVG A;  4FD5 A;  4JVV A;  4MI4 A;  5HIH A;  3B3C A;  3E0K A;  2IQ6 A;  4NGQ A;  3NH4 A;  4UCN A;  5DWM A;  4C2Z A;  2HB6 A;  5HVH A;  1M4G A;  4ZY1 A;  4HPS A;  4M6I A;  2JEW A;  3TO6 A;  2ZW6 A;  2B4D B;  4TNU A;  3ZJ0 A;  2BEI A;  4MFZ A;  1YME A;  2ACF A;  1VHE A;  4X5K A;  3VWD A;  4AG7 A;  4F9V A;  4P4J A;  4A30 A;  3FEE A;  4NGR A;  3BLN A;  3R96 A;  1FY7 A;  5CMS A;  4R87 A;  1IYK A;  1XMB A;  1XFO A;  2FVG A;  3PZJ A;  1YGH A;  2AE6 A;  3N5F A;  1XRY A;  2G0B A;  4ZBG A;  4DJL A;  3S9N A;  1TY8 A;  2PC1 A;  1CM0 A;  2Q0Y A;  4UWI A;  1Z9U A;  3D8P A;  3NH5 A;  3SJX A;  1RXT A;  2RB7 A;  4E0A A;  2FCK A;  4DUK A;  2G3T A;  1TKH A;  3K9U A;  4CGO A;  3H8F A;  3RBU A;  1Q2C A;  5D8N A;  1X12 A;  4PXE A;  4RI1 A;  2R7H A;  3KL9 A;  3WC7 A;  3QAH A;  2GLF A;  2H5M A;  2C1C A;  4R57 A;  4M6G A;  5A28 A;  4XPD C;  5A27 A;  3TT2 A;  5E96 A;  1S7K A;  4Q38 A;  3QB8 A;  3N7Z A;  1VHU A;  4QUS A;  1IID A;  3B3V A;  3ISZ A;  4KSA A;  1L0C A;  2PVW A;  2DPS A;  3DDD A;  3GPG A;  1I1D A;  3GQO A;  2B5G B;  2K5T A;  3IU1 A;  3P2F A;  3GIU A;  4PXB A;  2VL1 A;  2YNC C;  1XF8 A;  2PE3 A;  4MY0 A;  4LQG A;  1HDQ A;  1B6B A;  2PJ9 A;  4KUA A;  1S7F A;  3WT4 A;  5JM6 A;  4TU0 A;  3LWU A;  2JLM A;  3FYN A;  4M3S A;  4FUU A;  1TKF A;  1JWQ A;  3TO7 A;  2V8H A;  1TXZ A;  1MJB A;  1Y0Y A;  2PJA A;  4CGL A;  4PPZ A;  3WAB A;  1YW6 A;  4BBH A;  2PIY A;  1CJW A;  2HV2 A;  4PQA A;  4I49 A;  2L8R A;  1UFH A;  1R3N A;  3NA6 A;  3EWQ A;  5J8F A;  2QEC A;  1Z8T A;  4FD7 A;  1VHS A;  4XPD B;  1H8L A;  3I1U A;  4FD4 A;  2FSR A;  2F5I A;  4P44 A;  4Q7A A;  1ZG9 A;  4JLL A;  3VAT A;  3EWO A;  2AFM A;  4JXR A;  2JZF A;  1LAP A;  5CB3 A;  2EBJ A;  3S6F A;  3EO4 A;  4AVA A;  4MBU A;  3BJ7 A;  2V8D A;  1F2O A;  3K9T A;  2Q04 A;  4KOS A;  4UIA A;  3S9M A;  1S60 A;  4GM5 A;  4IF5 A;  2Z3N A;  4OID A;  1YSJ A;  2FAV A;  2Q44 A;  3QNV A;  3T9Y A;  3TOB A;  4MFL A;  2YGW A;  1PCA A;  1MJA A;  1QSM A;  2PIZ A;  3GPQ A;  3I9S A;  1VHO A;  5LYI A;  1FNO A;  1GYT A;  5IB0 A;  3DGV A;  4MFJ A;  4NGM A;  4OC5 A;  2Q7S A;  4XPL A;  4FD6 A;  5DS0 A;  3Q71 A;  4MCS A;  3ETI A;  1LRZ A;  2X7B A;  3KQX A;  4A33 A;  4OC3 A;  2VZY A;  4FAI A;  5BWA B;  4R6T A;  4OIW A;  4R3L A;  2NMT A;  3DR6 A;  3GY9 A;  4KOW A;  3IO1 A;  4OAD A;  3D4U A;  4NXY A;  1ZR5 A;  3P2H A;  1AYE A;  4ETJ A;  2REF A;  2IJZ A;  3BJ8 A;  4PV6 A;  5CPA A;  4YWY A;  3VH9 A;  3V2B A;  2AFS A;  3KAS A;  4NFR A;  2PQ8 A;  2CNT A;  5FSU A;  2PJC A;  1Q7L A;  1R43 A;  1S7L A;  3K2K A;  4B14 A;  2HUZ A;  4MFP A;  4F8Z A;  2GFQ A;  4NJQ A;  3SIJ A;  2OOT A;  3T90 A;  1PU9 A;  2QML A;  4NCZ A;  2WZN A;  5HMN A;  1CP7 A;  4CYO A;  3S6G A;  3A9L A;  4IK2 A;  4P45 A;  3W6X A;  1Y9K A;  2CTC A;  2PDO A;  3RNZ A;  1QSN A;  4GVV A;  3V38 A;  2FS5 A;  2VRI A;  3SIH A;  2FIA A;  3FBU A;  3V8I A;  1IU8 A;  2B3V A;  2PJ8 A;  4IAV A;  3HLP A;  3R9F A;  4IHM A;  4C68 A;  3C26 A;  2JBK A;  5THW A;  4AXV A;  4LQ6 A;  5JQ4 A;  1XJO A;  1OZP A;  5J8C A;  2C27 A;  4MJ8 A;  3WR7 A;  4O23 A;  2I00 A;  1NSL A;  4FWU A;  1DTD A;  3EFA A;  3CXQ A;  3PB7 X;  1LAM A;  2VQY A;  3KHZ A;  3FJU A;  5K8N A;  5ISV A;  2BUE A;  4GS4 A;  3F0A A;  1MK4 A;  2W2G A;  1TXR A;  1YR0 A;  2R98 A;  4AG9 A;  4AVC A;  1XE4 A;  3PFE A;  1LCP A;  1SPV A;  4D86 A;  2PJ7 A;  2CF4 A;  3SHP A;  3IU2 A;  3DLJ A;  1ZLH A;  4KSI A;  2OH1 A;  2ZEN A;  4P4B A;  3UY5 A;  3EWP A;  2OU2 A;  4ZI6 A;  2ARH A;  3FNC A;  4B5P B;  1ZG7 A;  4CAW A;  2PJ1 A;  3KKW A;  4HKF A;  3VFQ A;  4DNC A;  4EFD A;  5LYL A;  4U5Y A;  4L8A A;  1NJR A;  2J8N A;  1NMT A;  4UFW A;  2XEI A;  3TX8 A;  2JBJ A;  4CAE A;  4JGK A;  2VXK A;  2RC4 A;  4CAV A;  4C2Y A;  4H6U A;  2VBQ A;  2ABZ A;  2ZOF A;  2BFR A;  4UEE A;  2G3A A;  2Z10 A;  2Z3L A;  3F8K A;  3LMS A;  3FVL A;  1ELL P;  2FXF A;  4KOU A;  3LAC A;  3ISX A;  1DE4 C;  2QIR A;  2NYQ A;  2CTB A;  1Y9W A;  3EJG A;  1XMT A;  5C82 A;  4ABL A;  2PSW A;  3D7G A;  3EJF A;  3T8W A;  4Y49 C;  4J5Q A;  2FT0 A;  4JZ0 A;  2PCU A;  8CPA A;  2XEG A;  3BI1 A;  2Y0M A;  1IGB A;  4RS2 A;  1M1D A;  4U9Y A;  3V45 A;  3R95 A;  4CGN A;  5DUS A;  3GYA A;  4M85 A;  4NJR A;  3FXT A;  1CPS A;  4CAF A;  3B2Y A;  4MCR A;  5FSX A;  4H89 A;  3GUX A;  3Q6Z A;  1CP6 A;  2CXA A;  3KR4 A;  3IC1 A;  1ZR3 A;  4NGT A;  2OR4 A;  4ZX9 A;  2WCT A;  4J5R A;  1Y0R A;  3S9L A;  1Z8X A;  4CYP A;  4II9 A;  3F5B A;  2DEA A;  1Z2L A;  4XNH C;  2ZOG A;  1TF9 A;  1IOI A;  4JXQ A;  4L89 A;  2O53 A;  4NGP A;  2R8V A;  5AG7 A;  5FVJ A;  3RO0 A;  2IMO A;  4B12 A;  4CGP A;  5AG4 A;  3D3S A;  4QVT A;  2EK9 A;  4C7H A;  3FB3 A;  3D67 A;  3R9E A;  3VWE A;  1KUY A;  5IB9 A;  3JVN A;  4F0Y A;  1LOK A;  2B58 A;  2BCO A;  2FE7 A;  2Q4V A;  4UCM A;  5FSY A;  1Z4R A;  3PB9 X;  1IOF A;  4Y49 B;  2CIJ A;  4CGM A;  3FED A;  2Q7B A;  2Q43 A;  4A39 A;  1KWM A;  3IIB A;  1TF8 A;  4H2K A;  4NGS A;  4AVB A;  3TC8 A;  5E3B A;  4A2Z A;  1P4N A;  2YNE A;  5AG5 A;  4A38 A;  3TFY A;  1NSA A;  2CNS A;  1TKJ A;  5HH1 A;  1Q2Y A;  1PUA A;  3RZA A;  2B4D A;  1Z8W A;  3BHX A;  2ZEG A;  4P6Y A;  4PSX A;  4UEF A;  3TCV A;  4A95 A;  2PVV A;  4A31 A;  1QMU A;  4X8I A;  3ZZI A;  4OLL A;  3GPO A;  3SI1 A;  3IEH A;  2VEZ A;  1K4J A;  1YW4 A;  2ZEO A;  3PBE A;  4XNH B;  2DPT A;  3IWG A;  3QAY A;  4P4E A;  5F49 A;  1ARL A;  4OKO A;  5ELY A;  4CS0 B;  2F7V A;  4E2A A;  3TE4 A;  1ZG8 A;  4QBJ A;  2FG1 A;  4UF4 A;  3SXN A;  4X3R A;  5HOL A;  1A2Z A;  3BXM A;  5JH9 A;  4F6A A;  1YRE A;  2RFH A;  2KCW A;  1U6M A;  1IY7 A;  1EE3 P;  2FXK A;  1ON0 A;  1WK4 A;  3FRM A;  4MY3 A;  4NSQ A;  4UFX A;  5F46 A;  2AFO A;  1V0C A;  5IX3 A;  3W6S A;  3IWW A;  2LGR A;  4MFQ A;  4M6H A;  4KOY A;  5CNP A;  3GB0 A;  3EWR A;  4K30 A;  4ZGY B;  1S3Z A;  2XEJ A;  3OWC A;  3PEI A;  4ONU A;  4FBE A;  3B8G A;  5J1Q A;  4MMO A;  4MRI A;  1IB1 E;  4ONW A;  4CPA A;  1HJZ A;  2OB0 A;  4TWE A;  2NSM A;  4MCP A;  2ZW7 A;  5C88 A;  3SII A;  1BO4 A;  3KZW A;  5F47 A;  3B3T A;  2ZW4 A;  4UA3 A;  3KHX A;  2B3U A;  3CXS A;  4GXH A;  4JD6 A;  2XD7 A;  4YU9 A;  1CG2 A;  1JQG A;  5CBM A;  4UFV A;  2DXQ A;  2I79 A;  2EEE A;  4H6Z A;  1M4D A;  1MJ9 A;  4MXU A;  1OBR A;  3SI0 A;  4KOX A;  4ZX8 A;  1YLO A;  3EY5 A;  2EWB A;  5G21 A;  4WWV A;  2P6E A;  3S6K A;  1NE9 A;  3CT9 A;  3PFO A;  4ZYQ A;  4KOV A;  3FMC A;  1ARM A;  1IYL A;  3H4Q A;  4MFK A;  2I3C A;  1KUX A;  1YQE A;  2GIV A;  1VKC A;  4LX9 A;  2JDD A;  3DSB A;  1KUV A;  2R1I A;  1FT7 A;  3DNS A;  4MHZ A;  4ORF A;  3SJE A;  3V7Z A;  4CRY B;  2PJ4 A;  4ESS A;  1ZO0 A;  2OZH A;  4J3G A;  4B11 A;  1AMP A;  3IIF A;  2P0W A;  4UBR A;  4A94 A;  5LRK A;  3MRU A;  3WC5 A;  4PSW A;  3SJG A;  3WC6 A;  4C7I A;  3JTK A;  1BOB A;  2J8M A;  2O4H A;  4KYB A;  1XOV A;  2EO8 A;  4ZY0 A;  2ZEF A;  1HEE A;  4NEX A;  5EBV A;  2ZW5 A;  3I3G A;  1VIX A;  4J5S A;  2Q4Y A;  2WPW A;  5EMI A;  2QJ8 A;  1GHE A;  4QC6 A;  2J8R A;  3JUW A;  3D7D A;  4OP4 A;  4CYQ A;  3NE8 A;  3MGD A;  2QVP A;  4XPK A;  5I0C A;  4R3K A;  2DF5 A;  2Z3M A;  3LD2 A;  2REE A;  1YK3 A;  1QSO A;  3TOA A;  2BL1 A;  4KUB A;  3MN8 A;  1ZLI A;  4KVX A;  3PGP A;  4R7M A;  4Q36 A;  2ZPA A;  3JRU A;  4K0C A;  4DYO A;  2J9A A;  4UML A;  1YX0 A;  1BPN A;  2Z0Z A;  5KTA A;  3R1K A;  5K8O A;  2QYV A;  2KQV A;  1Q2D A;  3D2M A;  3FIX A;  2C6G A;  3H5Z A;  3PB8 X;  4RN7 A;  5G22 A;  1AUG A;  4R9M A;  2Q51 A;  1XEB A;  4X2T A;  3FX6 A;  5AGE A;  4JLY A;  2JZE A;  2Q4Z A;  4WJB A;  3KR5 A;  2ZEP A;  2EK8 A;  3DR8 A;  2DX6 A;  5K8M A;  2JDC A;  3H8G A;  4KOR A;  3CXP A;  4B5O A;  1B87 A;  4MCQ A;  1S7N A;  4ETK A;  1UWY A;  5EC4 A;  3CDX A;  3FF3 A;  2JZD A;  3HUV A; 
#chains in the Genus database with same CATH homology
 2BFQ A;  4BD9 A;  4Q7A A;  3EW5 A;  1Y7E A;  2BO9 A;  3B7I A;  1Z8L A;  4P4F A;  2PRQ A;  4NGN A;  3PB4 X;  5LYF A;  2ZEM A;  2ZEL A;  4GVW A;  2POK A;  3SJF A;  2AFU A;  4RUH A;  2F8H A;  2V8V A;  2ZEH A;  3SIG A;  4JCA A;  4EME A;  3PRT A;  2X47 A;  5JGF A;  3PBB A;  4MHY A;  2G9D A;  3JZT A;  2XEF A;  3IFE A;  4W9Y A;  3KQZ A;  2AFC A;  2PJ5 A;  4IQY A;  2AFW A;  4P4I A;  1CBX A;  5AIL A;  2V8G A;  4UIB A;  3D68 A;  5CB5 A;  3B3S A;  4OC0 A;  2AFZ A;  4A37 A;  4R76 A;  2PJB A;  3B35 A;  3CPA A;  4JYW A;  3NFZ A;  1BPM A;  2AFX A;  1HDU A;  2PJ6 A;  7CPA A;  3CPX A;  2V77 A;  4ABK A;  2HC9 A;  5FSV A;  4ZY2 A;  2PJ2 A;  3FH4 A;  3SI2 A;  2PJ0 A;  2GLJ A;  5HVF A;  4P4D A;  3BI0 A;  4F9U A;  4J4Z A;  1F57 A;  2GRE A;  1BAV A;  3NH8 A;  1RTQ A;  3IID A;  5I4M A;  2PJ3 A;  5F09 A;  3PB6 X;  4B6Z A;  3VAR A;  4G1P A;  5D29 A;  5LRJ A;  1CPX A;  4MHN A;  4GUA A;  2ZED A;  1M4L A;  3D66 A;  3L2N A;  4MHP A;  1CX8 A;  5LRG A;  2C6C A;  1VGY A;  3FEC A;  3KGQ A;  4OC1 A;  3H8E A;  3B3W A;  5FSZ A;  4EWT A;  1XBU A;  1Z5R A;  4PXC A;  5LYD A;  6CPA A;  3KI9 A;  1LAN A;  4P10 A;  4Z65 A;  2ZEE A;  5HXD A;  1F2P A;  3D7F A;  2BOA A;  4OC4 A;  4K3N A;  1BLL E;  1QQ9 A;  4OME A;  3EKE A;  1ELM P;  1YD9 A;  2ANP A;  2WYR A;  1PYT B;  4R8F A;  5K8P A;  4PXD A;  3D7H A;  3RAM A;  2GU2 A;  3GQE A;  1LFW A;  4UEZ A;  3GLJ A;  4OC2 A;  2C6P A;  3IJ3 A;  5HVG A;  4JVV A;  5HIH A;  3B3C A;  2IQ6 A;  4NGQ A;  3NH4 A;  2HB6 A;  5HVH A;  4ZY1 A;  2JEW A;  4TNU A;  1YME A;  2ACF A;  1VHE A;  4F9V A;  4P4J A;  3FEE A;  4NGR A;  5CMS A;  1XMB A;  2FVG A;  1XFO A;  3N5F A;  1XRY A;  4DJL A;  3S9N A;  1TY8 A;  3NH5 A;  3SJX A;  2RB7 A;  4DUK A;  1TKH A;  3H8F A;  3RBU A;  4PXE A;  5D8N A;  3KL9 A;  3WC7 A;  2GLF A;  2C1C A;  1VHU A;  3B3V A;  3ISZ A;  2PVW A;  3GPG A;  3GQO A;  4PXB A;  2VL1 A;  2PE3 A;  4LQG A;  1HDQ A;  2PJ9 A;  3WT4 A;  5JM6 A;  4TU0 A;  3LWU A;  4FUU A;  1TKF A;  2V8H A;  1TXZ A;  2PJA A;  1Y0Y A;  4PPZ A;  3WAB A;  1YW6 A;  2PIY A;  4PQA A;  2L8R A;  1R3N A;  3NA6 A;  3EWQ A;  1H8L A;  3I1U A;  4P44 A;  1ZG9 A;  4JLL A;  3VAT A;  3EWO A;  2AFM A;  1LAP A;  5CB3 A;  3K9T A;  2V8D A;  1F2O A;  4UIA A;  3S9M A;  4GM5 A;  4OID A;  1YSJ A;  2FAV A;  3QNV A;  1PCA A;  2PIZ A;  3GPQ A;  5LYI A;  1VHO A;  1FNO A;  1GYT A;  3DGV A;  4NGM A;  4OC5 A;  5DS0 A;  3Q71 A;  4MCS A;  3ETI A;  3KQX A;  4OC3 A;  4FAI A;  4R6T A;  4OIW A;  3IO1 A;  3D4U A;  1ZR5 A;  5CPA A;  1AYE A;  4ETJ A;  4YWY A;  2IJZ A;  5JH9 A;  3VH9 A;  3V2B A;  2AFS A;  3KAS A;  4NFR A;  5FSU A;  2PJC A;  1Q7L A;  1R43 A;  3K2K A;  4F8Z A;  4NJQ A;  3SIJ A;  2OOT A;  2WZN A;  1CP7 A;  4IK2 A;  4P45 A;  2CTC A;  3V38 A;  4GVV A;  2VRI A;  3SIH A;  2PJ8 A;  4IAV A;  3HLP A;  4IHM A;  2JBK A;  5THW A;  4AXV A;  1XJO A;  4O23 A;  4FWU A;  1DTD A;  3PB7 X;  1LAM A;  3KHZ A;  3FJU A;  5K8N A;  1TXR A;  3PFE A;  1LCP A;  1SPV A;  4D86 A;  2PJ7 A;  2CF4 A;  3DLJ A;  1ZLH A;  4KSI A;  2ZEN A;  4P4B A;  3EWP A;  4ZI6 A;  1ZG7 A;  2PJ1 A;  4EFD A;  5LYL A;  3VFQ A;  1NJR A;  2XEI A;  3TX8 A;  2JBJ A;  4JGK A;  2ZOF A;  2ABZ A;  2BFR A;  4UEE A;  3LMS A;  3FVL A;  1ELL P;  3ISX A;  1DE4 C;  2NYQ A;  2CTB A;  3EJG A;  4ABL A;  3D7G A;  3EJF A;  3T8W A;  4J5Q A;  4JZ0 A;  2PCU A;  8CPA A;  2XEG A;  3BI1 A;  1IGB A;  3V45 A;  5DUS A;  4NJR A;  1CPS A;  3B2Y A;  4MCR A;  5FSX A;  3GUX A;  3Q6Z A;  1CP6 A;  4NGT A;  3KR4 A;  3IC1 A;  1ZR3 A;  2OR4 A;  4ZX9 A;  4J5R A;  1Y0R A;  3S9L A;  2DEA A;  1Z2L A;  2ZOG A;  1TF9 A;  4NGP A;  2O53 A;  2IMO A;  2EK9 A;  3D67 A;  5IB9 A;  1LOK A;  2BCO A;  5FSY A;  3PB9 X;  2CIJ A;  3FED A;  4A39 A;  2Q43 A;  1KWM A;  3IIB A;  1TF8 A;  4H2K A;  4NGS A;  3TC8 A;  5E3B A;  4A38 A;  1NSA A;  1TKJ A;  3RZA A;  3BHX A;  2ZEG A;  4P6Y A;  4UEF A;  2PVV A;  1QMU A;  4X8I A;  3GPO A;  3SI1 A;  3IEH A;  1YW4 A;  2ZEO A;  3PBE A;  4P4E A;  5ELY A;  1ARL A;  4OKO A;  2F7V A;  1ZG8 A;  2FG1 A;  4UF4 A;  4X3R A;  5HOL A;  3BXM A;  2RFH A;  1IY7 A;  1EE3 P;  2FXK A;  2AFO A;  3IWW A;  2LGR A;  3GB0 A;  3EWR A;  2XEJ A;  4FBE A;  3PEI A;  5J1Q A;  4MMO A;  4MRI A;  4ONW A;  4CPA A;  1HJZ A;  4TWE A;  2NSM A;  4MCP A;  3SII A;  3KZW A;  3B3T A;  3KHX A;  4YU9 A;  2XD7 A;  1CG2 A;  1JQG A;  5CBM A;  2EEE A;  4MXU A;  1OBR A;  3SI0 A;  4ZX8 A;  1YLO A;  2EWB A;  4WWV A;  3CT9 A;  3PFO A;  4ZYQ A;  3FMC A;  1ARM A;  2I3C A;  1FT7 A;  4MHZ A;  3SJE A;  3V7Z A;  2PJ4 A;  4ESS A;  1AMP A;  3IIF A;  5LRK A;  4A94 A;  3MRU A;  3WC5 A;  3SJG A;  3WC6 A;  2O4H A;  4KYB A;  2ZEF A;  4ZY0 A;  1HEE A;  1VIX A;  4J5S A;  2QJ8 A;  4OP4 A;  3D7D A;  2QVP A;  3MN8 A;  1ZLI A;  4R7M A;  3JRU A;  4K0C A;  4DYO A;  2J9A A;  4UML A;  1BPN A;  5K8O A;  2QYV A;  2C6G A;  3PB8 X;  2Q51 A;  4X2T A;  3FX6 A;  2Q4Z A;  4WJB A;  3KR5 A;  2ZEP A;  2EK8 A;  2DX6 A;  5K8M A;  3H8G A;  4MCQ A;  4ETK A;  1UWY A;  3CDX A;  3FF3 A;  3HUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...