1BQ7A

Dsba mutant p151a, role of the cis-proline in the active site of dsba
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
186
structure length
186
Chain Sequence
QYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVAAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (DISULFIDE OXIDOREDUCTASE)
publication title On the role of the cis-proline residue in the active site of DsbA.
pubmed rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 57
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1998-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1bq7A00
2J9HA 5DQYA 4PURA 2CZ3A 1OE7A 5J9BA 3G7YA 3FRCA 4X0XA 1GTIA 4MMMA 2ES7A 1ML6A 3ZREA 2VM1A 1SKRB 4HDEA 3GX0A 1Z6NA 2F51A 3D0ZA 3FYGA 4LMWA 2H01A 4NXIA 2XHFA 3HJPA 1DSBA 4MJAA 3TRPA 1YEXA 3F6FA 1SKSB 1CQGA 1Q98A 2RUFA 3KMOA 3RBTA 1ZYQB 5D73A 4IVFA 1QGVA 3FR6A 1XOBA 1ILOA 4ML1A 3OR5A 4HUAA 3TJBA 4OD7A 4XRAA 4TXVA 2GGTA 3PINA 2C80A 2K18A 3IAM2 1KNGA 4OWYA 4Q5RA 2YNXA 1PRXA 3UOMA 1YDKA 1Q4JA 3W8SA 1M0UA 4WBRD 1JZRA 1ZMAA 2FWGA 1ABAA 2V32A 3BD2A 5ECMB 2DJ3A 2C3NA 1NSWA 4FH8A 2FWHA 4QL7A 2F3MA 1GULA 4KCAA 3KGKA 2O87A 2B1LA 1Z9HA 1QQ2A 3TRQA 5JWRB 3VWWA 1KBNA 2L59A 2VD1A 1A24A 1BYEA 5FWGA 3ZFLA 3GKKA 3M9JA 4I8BA 1YQ1A 2L4QA 2CAQA 4ID0A 2PUKC 1UN2A 3GKMA 3KMNA 2LRNA 2AV4A 2WGRA 1A0RP 1CQHA 3LXZA 5J3RA 1SD9A 1TJDA 4PX1A 4K2DA 3MAKA 1JZWA 3ZITA 4CDOA 2C0GA 1U87A 4GF0A 2IIYA 5DAKA 4LLRA 2FA8A 1DUGA 4Q5NA 3V1WA 2CX3A 1B4QA 3DYRA 1X5EA 5CP1A 2L5OA 2B3SA 1G6YA 3KH9A 2OBIA 3GKXA 4IP1A 3L4NA 4MJBA 2O89A 3UEMA 4IHUA 1O85A 4QQ7A 2EIOA 4KX4A 2H30A 3D4TA 2I9HA 5KN3A 1TXXA 2I81A 4HU9A 4TR0A 3HVVA 1O7UA 2GQLA 2KHPA 5HR2A 3ZVJA 1XFLA 2YN1A 3QAVA 3VLNA 3CXGA 1M99A 1FO5A 3L0HA 4JR4A 2C4JA 2TIRA 1GUMA 3H8QA 4JE1A 3J7Yk 2K6VA 1QK8A 5ECQB 3EVIA 3GRXA 2GZZA 3ZFBA 1YF1A 3O6TA 3RPNA 2VCXA 3ZZXA 2CX4A 2M72A 3NIVA 1QFNA 18GSA 5J4UA 4POMA 2VL9A 2DIYA 4TKYA 1BAYA 1YF0A 4ZL8A 2GQKA 19GSA 3VPTA 1XIYA 1PD21 1PQNA 4JRRA 2JACA 3GKNA 2DJKA 2AAWA 2V41A 3KTBA 3LXTA 2H6ZA 5ID2B 4XS6A 1W89A 1GSQA 1FB0A 4GSSA 3W8JA 4BWQA 2LV3A 3GNJA 1ZCPA 2H73A 4NPBA 2E0QA 2MBSA 2OBKA 2L6CA 5DQSA 4ZL9A 3F4RA 4V1Ap 5IOXA 3UVTA 3CTGA 4KB3A 1NM3A 4RUVA 5A4UA 3Q6OA 5G1KA 5G31A 2H6XA 4EF0A 2EC4A 4J56E 2B1KA 2F8AA 2H1BA 1MTCA 4KNDA 1GNWA 4TR4A 4O92A 4OCFA 4BVXA 1TU8A 3M9KA 3TJFA 1MDJA 2RLIA 4V2MA 3P7XA 4ZB6A 3LYKA 5J41A 1K3YA 2R5GA 3UIWA 5C04A 1X9SB 4FYUA 1F9MA 1G7OA 3M8NA 3QD9A 4LL4B 4Q5FA 3C1SA 4XS4A 3DIEA 3HA9A 1OC8A 3GSSA 2GSSA 3ZIJA 4G19A 1HQOA 2C1YA 3TKQA 5DALB 3U6VA 1ZZYA 3A5WA 5IMVA 3F63A 5F07A 3I6AA 3O76A 4H86A 4O5RA 2B7KA 2FY6A 4J57E 4GQCA 2IMEA 4MABA 1R7HA 3BBYA 4KSOA 3DEXA 1ERTA 2C0EA 3UBKA 3TJKA 2CT6A 1R4WA 1EWXA 1N8JA 1A2LA 2NTOA 1LBKA 3HY2A 2OE3A 3CMIA 2EIRA 3PGTA 3C1RA 3DVXA 2HFDA 3GV1A 4GQFA 1WP0A 3HKRA 2CA8A 1OYJA 1K0CA 4LMVA 2PWJA 3W6GA 4F9ZA 3QMXA 5CAXA 1M2DA 1WE0A 4MCUA 4G9HA 5F06A 2E2MA 3LORA 4ZBAA 3G9BA 4XS1A 3CRTA 4ZBBA 3WGEA 5HR0A 2HI7A 4RI7A 4DSSA 2GSQA 4N11A 3QFAC 2C0DA 3HXSA 2YPMA 4V2LA 2EIQA 3S9FA 5HQPA 5HFIA 2HRNA 2IPAA 5CRHA 1RQMA 1A8LA 2CVBA 2H0HA 4IELA 3I69A 1ZL9A 5DBQA 4CHSA 4XCSA 1EOGA 2LNTA 1NW2A 4FIWA 4MJEA 4BWSA 1BX9A 2LQOA 4NMUA 2GT6A 1XZOA 3I43A 3FK8A 1GRXA 4AJ6A 4G2EA 3EU4A 2YJHA 2HT9A 2VCVA 1USBA 5G1LA 4YAVA 5G2ZA 3LWAA 4K0NA 1XWCA 1SJZA 2ZUPA 2IMFA 1TW9A 1F2EA 3WT1A 1O73A 2JZRA 1TP9A 2WRTA 3FEUA 3UJ1A 1K3OA 2X99A 3A2VA 4MZWA 5HFKA 3WD6A 4JEDA 4ILFA 2DJ1A 1EEJA 1U3AA 1EGRA 1YZXA 4ZB8A 5AN1A 1PMTA 2JL4A 4V2NA 2WZ9A 3BOAA 3R2QA 2BJXA 2O7KA 5KN2A 1EV4A 4TR3A 1KEBA 3E3EA 2QSIA 1Z7PA 3VWUA 1T1VA 2D2ZA 2LEGA 4YAPA 5GSSA 1V9WA 5JCUA 3EMPA 5F0GA 3LQ7A 5D9WA 1AAZA 2YP6A 1FG4A 4KW6A 2R2JA 3ISOA 3FW2A 3M0FA 1T8EB 4I5QA 3GURA 6GSYA 4BVYA 1KTEA 3FKFA 1PL1A 4V1Ag 2YWMA 4IGJA 1WPIA 3D21A 5LD0A 2LRCA 4L5OA 2HSHA 2LQQA 3E9JB 1K0DA 3TKPA 1XW9A 4PQ1A 1RW1A 4TR1A 3QAWA 2H75A 3RHBA 1Z3EA 3TKSE 2VCZA 4ZXGA 1J08A 3F6DA 1AXDA 1XVWA 2A2SA 2KP1A 1EEMA 2DSAA 4KUNA 4X1UA 3F3RA 1M2AA 3QPMA 2WJUA 5L71A 3CRUA 5AIVA 3Q18A 3F3QA 1ZGNA 4WBJA 5IPGA 4HOJA 4WEYA 4EE0A 2OACA 3SWLA 2AB6A 2CZ2A 2MZCA 3BCIA 4KCEA 1MD3A 2H74A 1GWCA 3F4SA 2O8VB 3FR3A 2GTUA 4POLA 1SJIA 3QFBC 2FHEA 2RUEA 2J23A 1R5AA 2VO4A 1ERUA 4FYBA 3CSHA 3KZQA 1VF1A 4POKA 4HI7A 2HSYA 2HZEA 5G5FA 2C8UA 2H0GA 2JU5A 4EKZA 1K0AA 2DBCA 3FZ9A 4BA7A 5ECIB 2LKUA 2WULA 2IMDA 2H1GA 3DVWA 2L4CA 3M1GA 2K8SA 5DAKB 1SKWB 4XRDA 4NHWA 3H93A 2WB9A 1XWKA 1S3CA 2QKEA 4JU5A 3GFKA 4PGTA 1Z6MA 5HFGA 3HCZA 1TK8B 1I9DA 1TI1A 2ALBA 2IFQB 1J0FA 1G0TA 2M46A 1XPVA 1SENA 2XBQA 4K1FA 5AIXA 1ZYEA 1BG5A 2MYGA 5ENUA 2H71A 3EINA 3VWVA 2H6YA 5ECPB 3C73A 4K8MA 5H5QA 5ABRA 4POBA 5B8BA 4EL1A 1O8WA 2CVDA 3DWVA 4O7HA 6GSXA 5JWOB 1VF3A 3GYKA 2IFQA 4IP6A 4IQAA 3F8UA 1M9BA 2CAIA 1O6JA 2YZHA 1SL1B 2CV4A 3KXOA 4KGIA 4OFTA 3UAPA 3KD0A 7GSSA 4TXOA 1TKDB 3TOTA 1S3DA 5ECRB 6GSTA 1T7PB 2JZTA 3US3A 1K3LA 4HU7A 5D9VA 3C71A 4WETA 2LS5A 2VAFA 3M3MA 3TJGA 3VI7A 4YH2A 3CYNA 2IMKA 3FR9A 3ERWA 2X8GA 2AJQB 3ME8A 3TUEA 3J7Yb 3KP8A 1SL2B 1GNEA 3IBHA 3IHQA 4F2IA 1XW6A 2AHEA 3HZ4A 2XBIA 5D9XA 2L57A 3L9VA 4L0WA 3VFIA 4I97A 1SU9A 1SYXA 3C8EA 2FCHA 4E8EA 4ML6A 4TN8A 2VL2C 4PUAA 4L8EA 3U5RE 1IYIA 3ZMLA 1PL2A 3ZRDA 1HNBA 5IMAA 2PPTA 4ZILA 1B48A 1MDKA 2VM2A 4OFNA 3ZL5A 4MDCA 5F05A 1H4OA 5IMZA 4HZ2A 5JWQB 4HZ4A 4K6XA 2KUCA 1ACVA 2X8HA 2OA7A 3IDVA 5CNWA 1QUWA 1WRYA 5B7CA 4LL1B 3EE2A 4TOPA 1B8XA 2VCTA 4ECBA 4RQRA 3D22A 4JBBA 4KSMA 5IIZA 4IJ3A 2AUVA 4AJ7A 4KAEA 3EURA 1AC1A 2PMTA 1QMVA 2F8FA 1G7EA 4HS1A 4XS4B 4QL9A 1WOUA 3TGZA 5LCZA 2FGXA 1UC7A 3RDWA 4LA1A 3IK9A 1T4ZA 5IQYA 3IR4A 2M80A 3IPZA 2A2RA 1GSEA 1JZOA 5ECLB 5EPFA 1V2AA 1ZOFA 1F3BA 2L5LA 4YQMA 1Y25A 2V2GA 4DEJA 1DE1A 1EGOA 3GHAA 5GZZB 3LEFA 2FD3A 2KOKA 3I9V2 3RPPA 1A0FA 5ECOB 3DMLA 4RQXA 3P8WA 5CREA 4AF2A 2NVLA 2VL3A 4KDYA 1J9BA 3HYPA 1PX7A 5KEJA 2LTKA 1SJ6A 2R4VA 1GLPA 4GSNA 3AY8A 2HRFA 1DBYA 4WR5A 4WF4A 1XOAA 4HQSA 1XXUA 1BEDA 1YJ6A 3LSZA 4NAXA 3TOUA 1GH2A 3EYTA 1Y6EA 4HQZA 3Q74A 5H5RA 1HNAA 2RM5A 3GL3A 2N5BA 8GSSA 4DSSB 1FW1A 4X43A 3CSJA 2C0FA 3RHCA 5A4WA 3D6IA 4XHMA 4D73A 2R3XA 2ZNMA 11GSA 4PQIA 1OC9A 1T4YA 1FB6A 5C00A 3VI5A 2P5RA 4IW9A 2OE1A 5IOWA 2QGVA 1ERVA 2X8CA 1OE8A 1V57A 2VL2A 1B9YC 3QCPA 4AJ8A 1GUKA 5G30A 4MF6A 2HE3A 2REMA 3TB2A 3KTLA 1NHOA 4MZBA 1K0OA 1WMJA 3F9UA 1WJKA 3TJJA 1EP7A 3LYPA 1TRSA 1FVJA 3HVSA 4MPGA 1TI3A 2PERA 3KP9A 5IPHA 2V6OA 3IXRA 5J9CA 1SL0B 4MK3A 2E7PA 3CSIA 4YQUA 1HD2A 2KLXA 4HJMA 1SD8A 3E0UA 4N10A 4XTSA 3IA1A 1T3BA 1HYUA 1VRSD 9GSSA 3ME7A 1OKTA 2WCIA 3UVHA 4HJ2A 2I4AA 2VCWA 1VGLA 4OFMA 1JHBA 3NZNA 2ON5A 5GSTA 3EMXA 2OJLA 1JLWA 2H0IA 1U6TA 2P31A 3PH9A 3LG6A 1BJXA 1S3AA 2NPBA 2B5XA 3GTUA 3N9JA 3ZVJD 1XWAA 2K8VA 2H1AA 4MLYA 4EDZA 1OAZA 2HYXA 2ON7A 3KEBA 3ZTLA 2AYTA 1X9MB 2FWFA 2YWIA 3LJRA 4DSRA 5DJLA 1V40A 5ECKB 5A4VA 1AW9A 2JZSA 4ISDA 1LU4A 5B6MA 2HZFA 4K9ZA 5A5KA 4MZCA 4WF5A 4NHZA 5J5NA 1H75A 3IC4A 2YJ7A 4TR1B 2B7JA 2G0FA 3NOFA 5D96A 5CRGA 2MMZA 4BPYA 2JSYA 4GRFA 1T00A 3ZYWA 1A8YA 5KN1A 16GSA 3L9SA 2DIZA 5B6NA 2H66A 1TRWA 4Z7XA 1V98A 2LJRA 4IN0A 1THOA 4JZQA 4KDXA 1AQWA 1PN9A 4EVMA 1C72A 1AQVA 3TKSC 1G6WA 2WDUA 3LFLA 2GSTA 1UA5A 1YKCA 2MBTA 4N0ZA 1B9XC 1XVQA 5DJMA 2FUG2 1M7TA 4OCEA 2FA4A 5F8BA 2HZEB 1XCCA 4K7OA 3EU3A 5JCGA 1TK0B 1SYRA 1GTAA 5HR1A 2NBSA 3QAGA 2X64A 2JSZA 1AQXA 1U88A 2FLSA 5ECNB 1GTUA 5D93A 1AUCA 3CBUA 5DVBA 4F03A 1K0BA 4ECIA 3BCKA 4TRXA 2H72A 3H1NA 3KH7A 3GH9A 3K8NA 4MPFA 10GSA 4TW5A 2QC7A 5CO3A 5DDLA 4MF5A 3GIXA 3HD5A 2V6KA 3IOSA 3GMFA 3LGCA 5E59A 1F6MC 5CRWA 1XBSA 2A4VA 2I3YA 3P2AA 3F4TA 5D9TA 1Z7RA 2C3QA 2N5FA 5FHIA 2TRXA 4GTUA 1U3IA 3RAZA 4GXZA 1SK1A 2YV9A 2DJ0A 4PUFC 1GSSA 1M9AA 2PBJA 2H1DA 1UVZA 2IL3A 5CYYA 2VLTA 3ZMKA 2LSTA 4E8HA 4RI6A 3TKRA 1O81A 4GWRA 2B6MA 12GSA 1ERWA 5IM9A 4MH3A 4ZL7A 4NWYA 1TU7A 4TXOB 2P5QA 2GDRA 1FHEA 4F82A 2FNOA 3QR6A 3VURA 4PXOA 4KH7A 2H19A 4XIHA 5ECSA 1VF4A 4YQVA 1PKWA 3L78A 4HEA2 2G2QA 4Q5QA 4ULXA 2XPDA 5INYA 2LJAA 4TVEA 1SK2A 3VK9A 4K7IA 4GCIA 5ECHB 1A2JA 3HVXA 1GSDA 1EP8A 4ZBDA 3KIJA 1M2BA 5AISA 2VLUA 4OO5A 5EL8A 3ED3A 3GUSA 4NV5A 4L0UA 2HXKA 2XPEA 5GAND 1HNCA 1THXA 2DMMA 3SBCA 3TKSA 4ECCA 3DXBA 1V58A 3HJOA 3ZIVA 4OMVA 1DE2A 4MF7A 2IN3A 3APQA 5ELGA 3N5OA 5ELAA 2IMIA 2IWTA 4IKHA 3HDCA 1WIKA 3KJYA 2YV7A 1JLVA 2O85A 3MSZA 4EO3A 4F0BA 4EUYA 2H8LA 2RIIA 5CRDA 2V1MA 1A2MA 1E2YA 1PX6A 1YEPA 2OKAA 5B8AA 3JCML 1K0NA 5H5SA 4P3YB 3GN3A 6GSSA 1OC3A 2VOCA 2R37A 1XWGA 2E2GA 1IYHA 4GLTA 2LNSA 2FWEA 1PKZA 2LJKA 2GZYA 3F0IA 1B4PA 4J2FA 3IV4A 2LRTA 1EZKA 1I5GA 1BQ7A 5EVOA 5FT3A 3TRXA 1RK4A 3A3TA 1PGTA 1YKAA 4G10A 3GSTA 2JADA 3UMAA 2WS2A 2GVPA 1MDIA 1X5CA 5HR3A 4WR4A 3ZLPA 22GSA 3IRAA 2PGTA 2B5EA 2P0GA 6GSWA 2PN8A 1TK5B 3CTFA 2KP2A 4N0VA 4EC0A 2I1UA 3H79A 5ID2A 5EY6A 5COHA 4KA0A 3WT2A 4ZIJA 2VUPA 1FVKA 3ERFA 1LJRA 1FAAA 4ECJA 3IAS2 3MWHA 20GSA 4DVCA 3MNGA 1E6BA 4KDUA 2BMXA 4MJCA 3FZ5A 3H4KA 1F37A 1AIUA 3WGXA 1ST9A 1X0RA 3HHVA 1OVNA 5D8IA 3DGQA 3UL3A 4EXJA 1XWBA 1GUHA 1PSQA 4CW9A 17GSA 3QOUA 3IE3A 3UARA 4D73B 3APSA 3C7MA 4IQ1A 2YZUA 1GTBA 4MA9A 1OC9B 4EDYA 4FO5A 3GX8A 3PR8A 3QDNA 6GSUA 3KCMA 2GLRA 1GL8A 1GSFA 2DLXA 4IS0A 3IK7A 4MH2A 4DSQA 3WYWA 3FHKA 6GSVA 2DMLA 1JZDA 3EWLA 5JCWA 3A2XA 3D5JA 3FY7A 3KM6A 2LUSA 1OKDA 1GSUA 2GS3A 4I2TA 4I6XA 1TRUA 3A2WA 3O3TA 4ZB9A 5DALA 5DCGA 5IMCA 3Q19A 2MMOA 1YY7A 1VF2A 5KN0A 1Z5YE 2XC2A 3DD3A 1MEKA 2R6KA 5E4WA 1R5PA 2VLVA 3UBLA 2IJYA 1EV9A 1JFUA 1SK0A 4PNFA 5AGYA 1N2AA 4I2UA 1A23A 3BJ5A 4PQHA 2CVKA 1PA3A 1XW5A 3DKSA 2C3TA 3APOA 4PNGA 3G7IA 4OO4A 1X5DA 2PU9C 1W4VA 14GSA 2H70A 1GSYA 2YWNA 4ACSA 4MP4A 1WWJA 1TRVA 2PVOC 2GZPA 3GTUB 4NV2A 1R26A 1K0MA 1TTZA 5DCHA 5G5EA 2DC5A 4BL7A 1TOFA 13GSA 5IMDA 2MMAA 1F3AA 2N5AA 2MMNA 1GP1A 2H76A 3GL5A 3HZ8A 1MD4A 4AGSA 1ON4A 2VIMA 2DJJA 4F0CA 4JR6A 3D4MA 5IO0A 2VCQA 3TCOA 3GA4A 3WGDA 2ZCTA 4O32A 5LNKe 2BTOT 1O8XA 2WFCA 2CQ9A 4KE3A 5IO2A 4K7NA 2HLSA 2YWOA 2GT5A 2YANA 1QXHA 5GAPD 3TDGA 3VPQA 3L9UA 4WXTA 3GH6A 2YOIA 2HNLA 5IMFA 3FZAA 3MDKA 2PVQA 1EOHA 3FZ4A 2TRCP 4FYCA 2B5YA 2F9SA 2Z9SA 3ERGA 3VWXA 2RM6A 4K0GA 4GSTA 4IJIA 3HJMA 4L5LA 1GLQA 2L6DA 1FOVA 4WKWA 2DJ2A 2OADA 3DRNA 3G7JA 3EC3A 3P90A 2OE0A 4N30A 2VD0A 2GSRA 1NHYA 2YCDA 2NDOA 1URMA 2K9FA 4IBPA 1X9WB 2GQMA 1TDIA
chains in the Genus database with same CATH superfamily
2J9HA 5DQYA 4PURA 2CZ3A 1OE7A 5J9BA 3G7YA 3FRCA 4X0XA 1GTIA 4MMMA 2X4AA 2ES7A 1ML6A 3ZREA 2VM1A 1SKRB 4HDEA 3GX0A 1Z6NA 2F51A 3D0ZA 3FYGA 4LMWA 2H01A 4NXIA 2XHFA 3HJPA 1DSBA 4MJAA 2QA1A 3TRPA 1YEXA 3F6FA 1SKSB 1CQGA 1Q98A 2RUFA 3KMOA 3RBTA 1ZYQB 5D73A 4IVFA 1QGVA 3FR6A 1XOBA 1ILOA 4ML1A 3OR5A 4HUAA 4MNNA 3TJBA 4OD7A 4XRAA 4TXVA 2GGTA 3PINA 2C80A 1ZYPA 2K18A 3IAM2 1KNGA 4OWYA 4Q5RA 2YNXA 1PRXA 3UOMA 1YDKA 1Q4JA 3W8SA 1M0UA 4WBRD 1JZRA 1ZMAA 2FWGA 1ABAA 2V32A 3BD2A 5ECMB 2DJ3A 2C3NA 1NSWA 4FH8A 2FWHA 4QL7A 2F3MA 1GULA 4KCAA 3KGKA 2O87A 2B1LA 1Z9HA 1QQ2A 3TRQA 5JWRB 3VWWA 1KBNA 2L59A 2VD1A 1A24A 1BYEA 5FWGA 3ZFLA 3GKKA 3M9JA 4I8BA 1YQ1A 2L4QA 2CAQA 4ID0A 2PUKC 1UN2A 3GKMA 3KMNA 2R0GA 2LRNA 2AV4A 2WGRA 1A0RP 1CQHA 3LXZA 5J3RA 4A5PA 1SD9A 1TJDA 4PX1A 4K2DA 3MAKA 1JZWA 3ZITA 4CDOA 2C0GA 1U87A 4GF0A 2IIYA 5DAKA 4LLRA 2FA8A 1DUGA 4Q5NA 3V1WA 2CX3A 1B4QA 3DYRA 1X5EA 5CP1A 2L5OA 2B3SA 1G6YA 3KH9A 2OBIA 3GKXA 4IP1A 3L4NA 4MJBA 2O89A 3UEMA 4IHUA 1O85A 4QQ7A 2EIOA 4PTSA 4KX4A 2H30A 3D4TA 2I9HA 5KN3A 1TXXA 2I81A 4HU9A 4TR0A 3HVVA 1O7UA 2GQLA 2KHPA 5HR2A 3ZVJA 1XFLA 2YN1A 3QAVA 3VLNA 3CXGA 1M99A 1FO5A 3L0HA 4JR4A 2C4JA 2TIRA 1GUMA 3H8QA 4JE1A 3J7Yk 3LW9A 2K6VA 1QK8A 5ECQB 3EVIA 3GRXA 2GZZA 3ZFBA 5KOXA 1YF1A 3O6TA 3RPNA 2VCXA 3ZZXA 2CX4A 2M72A 3NIVA 1QFNA 18GSA 5J4UA 4POMA 2VL9A 2DIYA 4TKYA 1BAYA 1YF0A 4ZL8A 2GQKA 19GSA 3VPTA 1XIYA 1PD21 1PQNA 4JRRA 2JACA 3GKNA 2DJKA 2AAWA 2V41A 3KTBA 3LXTA 2H6ZA 5ID2B 4XS6A 1W89A 1GSQA 1FB0A 4GSSA 3W8JA 4BWQA 2LV3A 3GNJA 1ZCPA 2H73A 4NPBA 4BVXB 2E0QA 2MBSA 2OBKA 2L6CA 5DQSA 4ZL9A 3F4RA 4V1Ap 5IOXA 3UVTA 3CTGA 4KB3A 1NM3A 4RUVA 5A4UA 3Q6OA 5G1KA 5G31A 2H6XA 4EF0A 2EC4A 4J56E 2B1KA 2F8AA 2H1BA 1MTCA 4KNDA 1GNWA 4TR4A 4O92A 4OCFA 4BVXA 4K2XA 1TU8A 3M9KA 3TJFA 1MDJA 2RLIA 4V2MA 3P7XA 4ZB6A 3LYKA 5J41A 1K3YA 2R5GA 3UIWA 5C04A 1X9SB 4FYUA 1F9MA 1G7OA 3M8NA 3QD9A 4LL4B 4Q5FA 3C1SA 4XS4A 3DIEA 3HA9A 1OC8A 3GSSA 2GSSA 3ZIJA 4G19A 1HQOA 2C1YA 3TKQA 5DALB 3U6VA 1ZZYA 3A5WA 5IMVA 3F63A 5F07A 3I6AA 3O76A 4H86A 4O5RA 2B7KA 2FY6A 4J57E 4GQCA 2IMEA 3R3EA 4MABA 1R7HA 3BBYA 4KSOA 3DEXA 1ERTA 4CY6A 2C0EA 3UBKA 3TJKA 2CT6A 1R4WA 1EWXA 1N8JA 1A2LA 2NTOA 1LBKA 3HY2A 2OE3A 3CMIA 2EIRA 3PGTA 3C1RA 3DVXA 2HFDA 3GV1A 4GQFA 1WP0A 3HKRA 2CA8A 1OYJA 1K0CA 4LMVA 2PWJA 3W6GA 4F9ZA 3QMXA 5CAXA 1M2DA 1WE0A 4MCUA 4G9HA 5F06A 2E2MA 3LORA 4ZBAA 3G9BA 4XS1A 3CRTA 4ZBBA 3WGEA 5HR0A 2HI7A 4BL7B 4RI7A 4DSSA 2GSQA 4N11A 3QFAC 2C0DA 3HXSA 2YPMA 4V2LA 2EIQA 3S9FA 5HQPA 5HFIA 2HRNA 2IPAA 5CRHA 1RQMA 1A8LA 2CVBA 2H0HA 4IELA 3I69A 4Z2UA 1ZL9A 5DBQA 4CHSA 4XCSA 1EOGA 2LNTA 1NW2A 4FIWA 4MJEA 4BWSA 1BX9A 2LQOA 4NMUA 2GT6A 1XZOA 3I43A 3FK8A 1GRXA 4AJ6A 4G2EA 3EU4A 2YJHA 2HT9A 2VCVA 1USBA 5G1LA 4YAVA 5G2ZA 3MIXA 3LWAA 4K0NA 1XWCA 1SJZA 2ZUPA 2IMFA 1TW9A 1F2EA 3WT1A 1O73A 2JZRA 1TP9A 2WRTA 3FEUA 3UJ1A 1K3OA 2X99A 3A2VA 4MZWA 5HFKA 3WD6A 4JEDA 4ILFA 2DJ1A 1EEJA 1U3AA 1EGRA 1YZXA 4ZB8A 5AN1A 1PMTA 2JL4A 4V2NA 2WZ9A 3BOAA 3R2QA 2BJXA 2O7KA 5KN2A 1EV4A 4TR3A 1KEBA 3E3EA 2QSIA 1Z7PA 3VWUA 4BVYB 1T1VA 2D2ZA 2LEGA 4YAPA 5GSSA 1V9WA 4G0LA 4ICYA 5JCUA 3EMPA 5F0GA 3LQ7A 5D9WA 1AAZA 2YP6A 1FG4A 4KW6A 2R2JA 3ISOA 3FW2A 3M0FA 1T8EB 4I5QA 3GURA 4FQUA 6GSYA 4BVYA 1KTEA 3FKFA 1PL1A 4V1Ag 2YWMA 4IGJA 1WPIA 3D21A 5LD0A 2LRCA 4L5OA 2HSHA 2LQQA 3E9JB 1K0DA 3TKPA 1XW9A 3PPUA 4PQ1A 1RW1A 4TR1A 3QAWA 4O5UA 2H75A 3RHBA 1Z3EA 3TKSE 2VCZA 4ZXGA 1J08A 3F6DA 1AXDA 1XVWA 2A2SA 2KP1A 1EEMA 2DSAA 4KUNA 4X1UA 3F3RA 1M2AA 3QPMA 2WJUA 5L71A 3CRUA 5AIVA 3Q18A 3F3QA 1ZGNA 4WBJA 5IPGA 4HOJA 4WEYA 4EE0A 2OACA 3SWLA 2AB6A 2CZ2A 2MZCA 3BCIA 4KCEA 1MD3A 2H74A 1GWCA 3EPTA 3F4SA 2O8VB 3FR3A 2GTUA 4POLA 1SJIA 3QFBC 2FHEA 2RUEA 3IC8A 2J23A 1R5AA 2R0PA 2VO4A 1ERUA 4FYBA 3CSHA 3A5IA 3KZQA 1VF1A 4POKA 4HI7A 2HSYA 2HZEA 5G5FA 2C8UA 2H0GA 2JU5A 4EKZA 1K0AA 2DBCA 3FZ9A 4BA7A 5ECIB 2LKUA 2WULA 2IMDA 2H1GA 3DVWA 2L4CA 3M1GA 4X4JA 2K8SA 5DAKB 1SKWB 4XRDA 4NHWA 3H93A 2WB9A 1XWKA 1S3CA 2QKEA 4JU5A 3GFKA 4PGTA 1Z6MA 5HFGA 3HCZA 1TK8B 1I9DA 1TI1A 2ALBA 2IFQB 1J0FA 1G0TA 2M46A 1XPVA 1SENA 2XBQA 4K1FA 5AIXA 1ZYEA 1BG5A 2MYGA 5ENUA 2H71A 3EINA 3VWVA 2H6YA 5ECPB 3C73A 4K8MA 5H5QA 5ABRA 4POBA 5B8BA 4EL1A 1O8WA 2CVDA 3DWVA 2DKHA 4O7HA 6GSXA 5JWOB 1VF3A 3GYKA 2IFQA 4IP6A 4IQAA 3F8UA 1M9BA 2CAIA 1O6JA 2YZHA 1SL1B 2CV4A 3KXOA 4KGIA 4OFTA 3UAPA 3KD0A 7GSSA 4TXOA 1TKDB 4KF9A 3TOTA 1S3DA 5ECRB 6GSTA 1T7PB 2JZTA 3US3A 1K3LA 4HU7A 5D9VA 3C71A 4WETA 2LS5A 2VAFA 3M3MA 3TJGA 2QA2A 3VI7A 4YH2A 3CYNA 2IMKA 3FR9A 3ERWA 2X8GA 2AJQB 3ME8A 3TUEA 3J7Yb 3KP8A 1SL2B 1GNEA 3IBHA 3IHQA 4F2IA 1XW6A 2AHEA 3HZ4A 2XBIA 5D9XA 2L57A 3L9VA 4L0WA 3VFIA 4I97A 1SU9A 1SYXA 3C8EA 2FCHA 4E8EA 4ML6A 4TN8A 2VL2C 4PUAA 4L8EA 3U5RE 1IYIA 3ZMLA 1PL2A 3ZRDA 1HNBA 5IMAA 2PPTA 4ZILA 1B48A 1MDKA 2VM2A 3FMWA 4OFNA 3ZL5A 4MDCA 5F05A 1H4OA 5IMZA 4HZ2A 5JWQB 4HZ4A 4K6XA 2KUCA 1ACVA 2X8HA 2OA7A 3IDVA 5CNWA 1QUWA 5KOWA 1WRYA 5B7CA 4LL1B 3EE2A 4TOPA 1B8XA 2VCTA 4ECBA 4RQRA 3D22A 4JBBA 4KSMA 5IIZA 4IJ3A 2AUVA 4G0IA 4KAEA 4AJ7A 3EURA 1AC1A 2PMTA 1QMVA 2F8FA 1G7EA 4HS1A 4XS4B 4QL9A 4YKFA 1WOUA 3TGZA 3IHGA 5LCZA 2FGXA 1UC7A 3RDWA 4LA1A 3IK9A 1T4ZA 5IQYA 3IR4A 2M80A 3IPZA 3MYDA 2A2RA 1GSEA 1JZOA 5ECLB 5EPFA 1V2AA 1ZOFA 1F3BA 2L5LA 4YQMA 1Y25A 2V2GA 4DEJA 1DE1A 1EGOA 3GHAA 5GZZB 3LEFA 2FD3A 2KOKA 3I9V2 3RPPA 1A0FA 5ECOB 3DMLA 4RQXA 3P8WA 5CREA 4AF2A 2NVLA 2VL3A 4KDYA 1J9BA 3HYPA 1PX7A 5KEJA 2LTKA 1SJ6A 2R4VA 1GLPA 4GSNA 3AY8A 2HRFA 1DBYA 4WR5A 4WF4A 1XOAA 4HQSA 1XXUA 1BEDA 1YJ6A 3LSZA 4NAXA 3TOUA 1GH2A 3EYTA 1Y6EA 4HQZA 3Q74A 5H5RA 1HNAA 2RM5A 3GL3A 2N5BA 8GSSA 4DSSB 1FW1A 4X43A 3CSJA 2C0FA 3RHCA 5A4WA 3D6IA 4XHMA 4D73A 2R3XA 2ZNMA 11GSA 4PQIA 1OC9A 1T4YA 1FB6A 5C00A 3VI5A 2P5RA 4IW9A 2OE1A 5IOWA 2QGVA 1ERVA 4EIQA 2X8CA 1OE8A 1V57A 2VL2A 1B9YC 3QCPA 4AJ8A 1GUKA 5G30A 4MF6A 2HE3A 2REMA 3TB2A 1FOHA 3KTLA 1NHOA 4MZBA 1K0OA 1WMJA 3F9UA 1WJKA 2HSMA 3TJJA 1EP7A 3LYPA 1TRSA 1FVJA 3HVSA 4MPGA 1TI3A 1PFOA 2PERA 3KP9A 5IPHA 2V6OA 3IXRA 5J9CA 1SL0B 4MK3A 2E7PA 3CSIA 4YQUA 1HD2A 2KLXA 4HJMA 1SD8A 3E0UA 4N10A 4XTSA 3IA1A 1T3BA 1HYUA 1VRSD 9GSSA 3ME7A 1OKTA 2WCIA 3UVHA 4HJ2A 2I4AA 2VCWA 1VGLA 4OFMA 1JHBA 3NZNA 2ON5A 5GSTA 3EMXA 2OJLA 1JLWA 2H0IA 1U6TA 2P31A 3PH9A 3LG6A 1BJXA 1S3AA 2NPBA 2B5XA 3GTUA 3N9JA 3ZVJD 1XWAA 2K8VA 2H1AA 4MLYA 4EDZA 1OAZA 2HYXA 2ON7A 3KEBA 3ZTLA 2AYTA 1X9MB 2FWFA 2YWIA 3LJRA 4DSRA 5DJLA 1V40A 4EIPA 5ECKB 5A4VA 1AW9A 2JZSA 4ISDA 1LU4A 5B6MA 2HZFA 4K9ZA 4K5SA 5A5KA 4MZCA 4WF5A 4NHZA 2R0CA 5J5NA 1H75A 3IC4A 4HSCX 2YJ7A 4TR1B 2B7JA 2G0FA 3NOFA 5D96A 5CRGA 2MMZA 4BPYA 2JSYA 4GRFA 1T00A 3ZYWA 1A8YA 5KN1A 16GSA 3L9SA 2DIZA 5B6NA 2H66A 1TRWA 4Z7XA 1V98A 2LJRA 4IN0A 1THOA 4JZQA 4KDXA 1AQWA 1PN9A 4EVMA 1C72A 1AQVA 4Z2RA 3TKSC 4YKGA 1G6WA 2WDUA 3LFLA 2GSTA 1UA5A 1YKCA 2MBTA 4N0ZA 1B9XC 1XVQA 5DJMA 2FUG2 4BIKA 1M7TA 4OCEA 2FA4A 5F8BA 2HZEB 1XCCA 1ZYNA 4K7OA 3EU3A 5JCGA 1TK0B 1SYRA 1GTAA 5HR1A 2NBSA 3QAGA 2X64A 2JSZA 2HRKA 1AQXA 1U88A 2FLSA 5ECNB 1GTUA 5D93A 1AUCA 3CBUA 5DVBA 4F03A 3CQFA 1K0BA 4ECIA 3BCKA 4TRXA 2H72A 3H1NA 3KH7A 3GH9A 3K8NA 4MPFA 10GSA 4TW5A 2QC7A 5CO3A 5DDLA 4MF5A 3GIXA 3HD5A 2V6KA 3IOSA 3GMFA 3LGCA 5E59A 1F6MC 5CRWA 1XBSA 2A4VA 2I3YA 3P2AA 3F4TA 5D9TA 1Z7RA 2C3QA 2N5FA 5FHIA 2TRXA 4GTUA 1U3IA 3RAZA 4GXZA 1SK1A 2YV9A 2DJ0A 4PUFC 1GSSA 1M9AA 2PBJA 2H1DA 1UVZA 2IL3A 5CYYA 2VLTA 3ZMKA 2LSTA 4E8HA 4RI6A 3TKRA 1O81A 4GWRA 2B6MA 12GSA 1ERWA 5IM9A 4MH3A 4ZL7A 4NWYA 1TU7A 4TXOB 2P5QA 2GDRA 1FHEA 4F82A 2FNOA 3HVNA 3QR6A 3VURA 4PXOA 4KH7A 2H19A 4XIHA 5ECSA 1VF4A 4YQVA 1PKWA 3L78A 4HEA2 2G2QA 4Q5QA 4ULXA 2XPDA 5INYA 2LJAA 4TVEA 1SK2A 3VK9A 4K7IA 4GCIA 5ECHB 1A2JA 3HVXA 1GSDA 1EP8A 4ZBDA 3KIJA 1M2BA 5AISA 2VLUA 4OO5A 5EL8A 3ED3A 3GUSA 4NV5A 4L0UA 2HXKA 2XPEA 5GAND 2X49A 1HNCA 1THXA 2DMMA 3SBCA 3TKSA 4ECCA 3DXBA 1V58A 3HJOA 3ZIVA 4G0KA 4OMVA 2DKIA 1DE2A 4MF7A 2IN3A 3APQA 5ELGA 3N5OA 5ELAA 2IMIA 2IWTA 4IKHA 3HDCA 1WIKA 3KJYA 2UZ8A 2YV7A 1JLVA 2O85A 3MSZA 4EO3A 4F0BA 4EUYA 2H8LA 2RIIA 5CRDA 2V1MA 1A2MA 1E2YA 1PX6A 1YEPA 2OKAA 5B8AA 3JCML 1K0NA 5H5SA 4P3YB 3GN3A 6GSSA 1OC3A 2VOCA 2R37A 1XWGA 2E2GA 1IYHA 4GLTA 2LNSA 2FWEA 1PKZA 2LJKA 2GZYA 3F0IA 4K5RA 1B4PA 4J2FA 3IV4A 2LRTA 1EZKA 1I5GA 1BQ7A 5EVOA 5FT3A 3TRXA 1RK4A 3A3TA 1PGTA 1YKAA 4G10A 3GSTA 2JADA 3UMAA 2WS2A 2GVPA 1MDIA 1X5CA 5HR3A 4WR4A 3ZLPA 22GSA 3IRAA 2PGTA 2B5EA 2A4HA 2P0GA 6GSWA 2PN8A 1TK5B 3CTFA 2KP2A 4USSA 4N0VA 4EC0A 2I1UA 3H79A 5ID2A 5EY6A 5COHA 4KA0A 3WT2A 4ZIJA 1M3JA 2VUPA 1FVKA 3ERFA 1LJRA 1FAAA 4ECJA 3IAS2 3MWHA 20GSA 4DVCA 3MNGA 1E6BA 4KDUA 2BMXA 4MJCA 3FZ5A 3H4KA 1F37A 1AIUA 3WGXA 1ST9A 1X0RA 4CY8A 3HHVA 1OVNA 5D8IA 3DGQA 3UL3A 4EXJA 1XWBA 1GUHA 1PSQA 4CW9A 17GSA 3QOUA 3IE3A 3UARA 4D73B 3APSA 3C7MA 4IQ1A 1M3IA 2YZUA 1GTBA 4MA9A 1OC9B 4EDYA 4FO5A 3GX8A 3PR8A 5BMUA 3QDNA 6GSUA 3KCMA 2GLRA 1GL8A 1GSFA 2DLXA 4IS0A 3IK7A 4MH2A 4Z2TA 4DSQA 3WYWA 3FHKA 6GSVA 2DMLA 1JZDA 3EWLA 5JCWA 3A2XA 3D5JA 3FY7A 3KM6A 2LUSA 1OKDA 1GSUA 2GS3A 4I2TA 4I6XA 1TRUA 3A2WA 3O3TA 4ZB9A 5DALA 5DCGA 5IMCA 3Q19A 2MMOA 1YY7A 1VF2A 5KN0A 1Z5YE 2XC2A 3DD3A 1MEKA 2R6KA 5E4WA 1R5PA 2VLVA 3UBLA 2IJYA 1EV9A 1JFUA 1SK0A 4PNFA 5AGYA 1N2AA 4I2UA 1A23A 3BJ5A 4PQHA 2CVKA 1PA3A 1XW5A 3DKSA 2C3TA 3APOA 4PNGA 3G7IA 4OO4A 1X5DA 2PU9C 1W4VA 14GSA 1PN0A 2H70A 1GSYA 2YWNA 4ACSA 4MP4A 1WWJA 1TRVA 2PVOC 2GZPA 3GTUB 4NV2A 1R26A 1K0MA 1TTZA 5DCHA 5G5EA 2DC5A 4BL7A 2A2PA 1TOFA 13GSA 1XG8A 5IMDA 2MMAA 1F3AA 2N5AA 2MMNA 1GP1A 2H76A 3GL5A 3HZ8A 1MD4A 4AGSA 1ON4A 2VIMA 2DJJA 4F0CA 4JR6A 3D4MA 5IO0A 4O5QA 2VCQA 3TCOA 3GA4A 3WGDA 2ZCTA 2HRAA 4O32A 5LNKe 5BRTA 2BTOT 1O8XA 2WFCA 2CQ9A 4KE3A 5IO2A 4K7NA 2HLSA 2YWOA 2GT5A 2YANA 1QXHA 5GAPD 3TDGA 3VPQA 3L9UA 4WXTA 3GH6A 2YOIA 2HNLA 5IMFA 3FZAA 3MDKA 2PVQA 1S3RA 1EOHA 3FZ4A 2TRCP 4FYCA 2B5YA 2F9SA 2Z9SA 3ERGA 3VWXA 2RM6A 4K0GA 4GSTA 4IJIA 3HJMA 4L5LA 1GLQA 2L6DA 1FOVA 4WKWA 2DJ2A 2OADA 3DRNA 3G7JA 3EC3A 3P90A 2OE0A 4N30A 2VD0A 2GSRA 1NHYA 2YCDA 2NDOA 1URMA 2K9FA 4IBPA 1X9WB 2GQMA 1TDIA
chains in the Genus database with same CATH topology
2J9HA 5DQYA 4PURA 2CZ3A 1OE7A 5J9BA 3G7YA 3FRCA 4X0XA 1GTIA 4MMMA 2X4AA 2ES7A 1ML6A 3ZREA 2VM1A 1SKRB 4HDEA 3GX0A 1Z6NA 2F51A 3D0ZA 3FYGA 4LMWA 2H01A 4NXIA 2XHFA 3HJPA 1DSBA 4MJAA 2QA1A 3TRPA 1YEXA 3F6FA 1SKSB 1CQGA 1Q98A 2RUFA 3KMOA 3RBTA 1ZYQB 5D73A 4IVFA 1QGVA 3FR6A 1XOBA 1ILOA 4ML1A 3OR5A 4HUAA 4MNNA 3TJBA 4OD7A 4XRAA 4TXVA 2GGTA 3PINA 2C80A 1ZYPA 2K18A 3IAM2 1KNGA 4OWYA 4Q5RA 2YNXA 1PRXA 3UOMA 1YDKA 1Q4JA 3W8SA 1M0UA 4WBRD 1JZRA 1ZMAA 2FWGA 1ABAA 2V32A 3BD2A 5ECMB 2DJ3A 2C3NA 1NSWA 4FH8A 2FWHA 4QL7A 2F3MA 1GULA 4KCAA 3KGKA 2O87A 2B1LA 1Z9HA 1QQ2A 3TRQA 5JWRB 3VWWA 1KBNA 2L59A 2VD1A 1A24A 1BYEA 5FWGA 3ZFLA 3GKKA 3M9JA 4I8BA 1YQ1A 2L4QA 2CAQA 4ID0A 2PUKC 1UN2A 3GKMA 3KMNA 2R0GA 2LRNA 2AV4A 2WGRA 1A0RP 1CQHA 3LXZA 5J3RA 4A5PA 1SD9A 1TJDA 4PX1A 4K2DA 3MAKA 1JZWA 3ZITA 4CDOA 2C0GA 1U87A 4GF0A 2IIYA 5DAKA 4LLRA 2FA8A 1DUGA 4Q5NA 3V1WA 2CX3A 1B4QA 3DYRA 1X5EA 5CP1A 2L5OA 2B3SA 1G6YA 3KH9A 2OBIA 3GKXA 4IP1A 3L4NA 4MJBA 2O89A 3UEMA 4IHUA 1O85A 4QQ7A 2EIOA 4PTSA 4KX4A 2H30A 3D4TA 2I9HA 5KN3A 1TXXA 2I81A 4HU9A 4TR0A 3HVVA 1O7UA 2GQLA 2KHPA 5HR2A 3ZVJA 1XFLA 2YN1A 3QAVA 3VLNA 3CXGA 1M99A 1FO5A 3L0HA 4JR4A 2C4JA 2TIRA 1GUMA 3H8QA 4JE1A 3J7Yk 3LW9A 2K6VA 1QK8A 5ECQB 3EVIA 3GRXA 2GZZA 3ZFBA 5KOXA 1YF1A 3O6TA 3RPNA 2VCXA 3ZZXA 2CX4A 2M72A 3NIVA 1QFNA 18GSA 5J4UA 4POMA 2VL9A 2DIYA 4TKYA 1BAYA 1YF0A 4ZL8A 2GQKA 19GSA 3VPTA 1XIYA 1PD21 1PQNA 4JRRA 2JACA 3GKNA 2DJKA 2AAWA 2V41A 3KTBA 3LXTA 2H6ZA 5ID2B 4XS6A 1W89A 1GSQA 1FB0A 4GSSA 3W8JA 4BWQA 2LV3A 3GNJA 1ZCPA 2H73A 4NPBA 4BVXB 2E0QA 2MBSA 2OBKA 2L6CA 5DQSA 4ZL9A 3F4RA 4V1Ap 5IOXA 3UVTA 3CTGA 4KB3A 1NM3A 4RUVA 5A4UA 3Q6OA 5G1KA 5G31A 2H6XA 4EF0A 2EC4A 4J56E 2B1KA 2F8AA 2H1BA 1MTCA 4KNDA 1GNWA 4TR4A 4O92A 4OCFA 4BVXA 4K2XA 1TU8A 3M9KA 3TJFA 1MDJA 2RLIA 4V2MA 3P7XA 4ZB6A 3LYKA 5J41A 1K3YA 2R5GA 3UIWA 5C04A 1X9SB 4FYUA 1F9MA 1G7OA 3M8NA 3QD9A 4LL4B 4Q5FA 3C1SA 4XS4A 3DIEA 3HA9A 1OC8A 3GSSA 2GSSA 3ZIJA 4G19A 1HQOA 2C1YA 3TKQA 5DALB 3U6VA 1ZZYA 3A5WA 5IMVA 3F63A 5F07A 3I6AA 3O76A 4H86A 4O5RA 2B7KA 2FY6A 4J57E 4GQCA 2IMEA 3R3EA 4MABA 1R7HA 3BBYA 4KSOA 3DEXA 1ERTA 4CY6A 2C0EA 3UBKA 3TJKA 2CT6A 1R4WA 1EWXA 1N8JA 1A2LA 2NTOA 1LBKA 3HY2A 2OE3A 3CMIA 2EIRA 3PGTA 3C1RA 3DVXA 2HFDA 3GV1A 4GQFA 1WP0A 3HKRA 2CA8A 1OYJA 1K0CA 4LMVA 2PWJA 3W6GA 4F9ZA 3QMXA 5CAXA 1M2DA 1WE0A 4MCUA 4G9HA 5F06A 2E2MA 3LORA 4ZBAA 3G9BA 4XS1A 3CRTA 4ZBBA 3WGEA 5HR0A 2HI7A 4BL7B 4RI7A 4DSSA 2GSQA 4N11A 3QFAC 2C0DA 3HXSA 2YPMA 4V2LA 2EIQA 3S9FA 5HQPA 5HFIA 2HRNA 2IPAA 5CRHA 1RQMA 1A8LA 2CVBA 2H0HA 4IELA 3I69A 4Z2UA 1ZL9A 5DBQA 4CHSA 4XCSA 1EOGA 2LNTA 1NW2A 4FIWA 4MJEA 4BWSA 1BX9A 2LQOA 4NMUA 2GT6A 1XZOA 3I43A 3FK8A 1GRXA 4AJ6A 4G2EA 3EU4A 2YJHA 2HT9A 2VCVA 1USBA 5G1LA 4YAVA 5G2ZA 3MIXA 3LWAA 4K0NA 1XWCA 1SJZA 2ZUPA 2IMFA 1TW9A 1F2EA 3WT1A 1O73A 2JZRA 1TP9A 2WRTA 3FEUA 3UJ1A 1K3OA 2X99A 3A2VA 4MZWA 5HFKA 3WD6A 4JEDA 4ILFA 2DJ1A 1EEJA 1U3AA 1EGRA 1YZXA 4ZB8A 5AN1A 1PMTA 2JL4A 4V2NA 2WZ9A 3BOAA 3R2QA 2BJXA 2O7KA 5KN2A 1EV4A 4TR3A 1KEBA 3E3EA 2QSIA 1Z7PA 3VWUA 4BVYB 1T1VA 2D2ZA 2LEGA 4YAPA 5GSSA 1V9WA 4G0LA 4ICYA 5JCUA 3EMPA 5F0GA 3LQ7A 5D9WA 1AAZA 2YP6A 1FG4A 4KW6A 2R2JA 3ISOA 3FW2A 3M0FA 1T8EB 4I5QA 3GURA 4FQUA 6GSYA 4BVYA 1KTEA 3FKFA 1PL1A 4V1Ag 2YWMA 4IGJA 1WPIA 3D21A 5LD0A 2LRCA 4L5OA 2HSHA 2LQQA 3E9JB 1K0DA 3TKPA 1XW9A 3PPUA 4PQ1A 1RW1A 4TR1A 3QAWA 4O5UA 2H75A 3RHBA 1Z3EA 3TKSE 2VCZA 4ZXGA 1J08A 3F6DA 1AXDA 1XVWA 2A2SA 2KP1A 1EEMA 2DSAA 4KUNA 4X1UA 3F3RA 1M2AA 3QPMA 2WJUA 5L71A 3CRUA 5AIVA 3Q18A 3F3QA 1ZGNA 4WBJA 5IPGA 4HOJA 4WEYA 4EE0A 2OACA 3SWLA 2AB6A 2CZ2A 2MZCA 3BCIA 4KCEA 1MD3A 2H74A 1GWCA 3EPTA 3F4SA 2O8VB 3FR3A 2GTUA 4POLA 1SJIA 3QFBC 2FHEA 2RUEA 3IC8A 2J23A 1R5AA 2R0PA 2VO4A 1ERUA 4FYBA 3CSHA 3A5IA 3KZQA 1VF1A 4POKA 4HI7A 2HSYA 2HZEA 5G5FA 2C8UA 2H0GA 2JU5A 4EKZA 1K0AA 2DBCA 3FZ9A 4BA7A 5ECIB 2LKUA 2WULA 2IMDA 2H1GA 3DVWA 2L4CA 3M1GA 4X4JA 2K8SA 5DAKB 1SKWB 4XRDA 4NHWA 3H93A 2WB9A 1XWKA 1S3CA 2QKEA 4JU5A 3GFKA 4PGTA 1Z6MA 5HFGA 3HCZA 1TK8B 1I9DA 1TI1A 2ALBA 2IFQB 1J0FA 1G0TA 2M46A 1XPVA 1SENA 2XBQA 4K1FA 5AIXA 1ZYEA 1BG5A 2MYGA 5ENUA 2H71A 3EINA 3VWVA 2H6YA 5ECPB 3C73A 4K8MA 5H5QA 5ABRA 4POBA 5B8BA 4EL1A 1O8WA 2CVDA 3DWVA 2DKHA 4O7HA 6GSXA 5JWOB 1VF3A 3GYKA 2IFQA 4IP6A 4IQAA 3F8UA 1M9BA 2CAIA 1O6JA 2YZHA 1SL1B 2CV4A 3KXOA 4KGIA 4OFTA 3UAPA 3KD0A 7GSSA 4TXOA 1TKDB 4KF9A 3TOTA 1S3DA 5ECRB 6GSTA 1T7PB 2JZTA 3US3A 1K3LA 4HU7A 5D9VA 3C71A 4WETA 2LS5A 2VAFA 3M3MA 3TJGA 2QA2A 3VI7A 4YH2A 3CYNA 2IMKA 3FR9A 3ERWA 2X8GA 2AJQB 3ME8A 3TUEA 3J7Yb 3KP8A 1SL2B 1GNEA 3IBHA 3IHQA 4F2IA 1XW6A 2AHEA 3HZ4A 2XBIA 5D9XA 2L57A 3L9VA 4L0WA 3VFIA 4I97A 1SU9A 1SYXA 3C8EA 2FCHA 4E8EA 4ML6A 4TN8A 2VL2C 4PUAA 4L8EA 3U5RE 1IYIA 3ZMLA 1PL2A 3ZRDA 1HNBA 5IMAA 2PPTA 4ZILA 1B48A 1MDKA 2VM2A 3FMWA 4OFNA 3ZL5A 4MDCA 5F05A 1H4OA 5IMZA 4HZ2A 5JWQB 4HZ4A 4K6XA 2KUCA 1ACVA 2X8HA 2OA7A 3IDVA 5CNWA 1QUWA 5KOWA 1WRYA 5B7CA 4LL1B 3EE2A 4TOPA 1B8XA 2VCTA 4ECBA 4RQRA 3D22A 4JBBA 4KSMA 5IIZA 4IJ3A 2AUVA 4G0IA 4KAEA 4AJ7A 3EURA 1AC1A 2PMTA 1QMVA 2F8FA 1G7EA 4HS1A 4XS4B 4QL9A 4YKFA 1WOUA 3TGZA 3IHGA 5LCZA 2FGXA 1UC7A 3RDWA 4LA1A 3IK9A 1T4ZA 5IQYA 3IR4A 2M80A 3IPZA 3MYDA 2A2RA 1GSEA 1JZOA 5ECLB 5EPFA 1V2AA 1ZOFA 1F3BA 2L5LA 4YQMA 1Y25A 2V2GA 4DEJA 1DE1A 1EGOA 3GHAA 5GZZB 3LEFA 2FD3A 2KOKA 3I9V2 3RPPA 1A0FA 5ECOB 3DMLA 4RQXA 3P8WA 5CREA 4AF2A 2NVLA 2VL3A 4KDYA 1J9BA 3HYPA 1PX7A 5KEJA 2LTKA 1SJ6A 2R4VA 1GLPA 4GSNA 3AY8A 2HRFA 1DBYA 4WR5A 4WF4A 1XOAA 4HQSA 1XXUA 1BEDA 1YJ6A 3LSZA 4NAXA 3TOUA 1GH2A 3EYTA 1Y6EA 4HQZA 3Q74A 5H5RA 1HNAA 2RM5A 3GL3A 2N5BA 8GSSA 4DSSB 1FW1A 4X43A 3CSJA 2C0FA 3RHCA 5A4WA 3D6IA 4XHMA 4D73A 2R3XA 2ZNMA 11GSA 4PQIA 1OC9A 1T4YA 1FB6A 5C00A 3VI5A 2P5RA 4IW9A 2OE1A 5IOWA 2QGVA 1ERVA 4EIQA 2X8CA 1OE8A 1V57A 2VL2A 1B9YC 3QCPA 4AJ8A 1GUKA 5G30A 4MF6A 2HE3A 2REMA 3TB2A 1FOHA 3KTLA 1NHOA 4MZBA 1K0OA 1WMJA 3F9UA 1WJKA 2HSMA 3TJJA 1EP7A 3LYPA 1TRSA 1FVJA 3HVSA 4MPGA 1TI3A 2PERA 3KP9A 5IPHA 2V6OA 3IXRA 5J9CA 1SL0B 4MK3A 2E7PA 3CSIA 4YQUA 1HD2A 2KLXA 4HJMA 1SD8A 3E0UA 4N10A 4XTSA 3IA1A 1T3BA 1HYUA 1VRSD 9GSSA 3ME7A 1OKTA 2WCIA 3UVHA 4HJ2A 2I4AA 2VCWA 1VGLA 4OFMA 1JHBA 3NZNA 2ON5A 5GSTA 3EMXA 2OJLA 1JLWA 2H0IA 1U6TA 2P31A 3PH9A 3LG6A 1BJXA 1S3AA 2NPBA 2B5XA 3GTUA 3N9JA 3ZVJD 1XWAA 2K8VA 2H1AA 4MLYA 4EDZA 1OAZA 2HYXA 2ON7A 3KEBA 3ZTLA 2AYTA 1X9MB 2FWFA 2YWIA 3LJRA 4DSRA 5DJLA 1V40A 4EIPA 5ECKB 5A4VA 1AW9A 2JZSA 4ISDA 1LU4A 5B6MA 2HZFA 4K9ZA 4K5SA 5A5KA 4MZCA 4WF5A 4NHZA 2R0CA 5J5NA 1H75A 3IC4A 2YJ7A 4TR1B 2B7JA 2G0FA 3NOFA 5D96A 5CRGA 2MMZA 4BPYA 2JSYA 4GRFA 1T00A 3ZYWA 1A8YA 5KN1A 16GSA 3L9SA 2DIZA 5B6NA 2H66A 1TRWA 4Z7XA 1V98A 2LJRA 4IN0A 1THOA 4JZQA 4KDXA 1AQWA 1PN9A 4EVMA 1C72A 1AQVA 4Z2RA 3TKSC 4YKGA 1G6WA 2WDUA 3LFLA 2GSTA 1UA5A 1YKCA 2MBTA 4N0ZA 1B9XC 1XVQA 5DJMA 2FUG2 1M7TA 4OCEA 2FA4A 5F8BA 2HZEB 1XCCA 1ZYNA 4K7OA 3EU3A 5JCGA 1TK0B 1SYRA 1GTAA 5HR1A 2NBSA 3QAGA 2X64A 2JSZA 2HRKA 1AQXA 1U88A 2FLSA 5ECNB 1GTUA 5D93A 1AUCA 3CBUA 5DVBA 4F03A 1K0BA 4ECIA 3BCKA 4TRXA 2H72A 3H1NA 3KH7A 3GH9A 3K8NA 4MPFA 10GSA 4TW5A 2QC7A 5CO3A 5DDLA 4MF5A 3GIXA 3HD5A 2V6KA 3IOSA 3GMFA 3LGCA 5E59A 1F6MC 5CRWA 1XBSA 2A4VA 2I3YA 3P2AA 3F4TA 5D9TA 1Z7RA 2C3QA 2N5FA 5FHIA 2TRXA 4GTUA 1U3IA 3RAZA 4GXZA 1SK1A 2YV9A 2DJ0A 4PUFC 1GSSA 1M9AA 2PBJA 2H1DA 1UVZA 2IL3A 5CYYA 2VLTA 3ZMKA 2LSTA 4E8HA 4RI6A 3TKRA 1O81A 4GWRA 2B6MA 12GSA 1ERWA 5IM9A 4MH3A 4ZL7A 4NWYA 1TU7A 4TXOB 2P5QA 2GDRA 1FHEA 4F82A 2FNOA 3QR6A 3VURA 4PXOA 4KH7A 2H19A 4XIHA 5ECSA 1VF4A 4YQVA 1PKWA 3L78A 4HEA2 2G2QA 4Q5QA 4ULXA 2XPDA 5INYA 2LJAA 4TVEA 1SK2A 3VK9A 4K7IA 4GCIA 5ECHB 1A2JA 3HVXA 1GSDA 1EP8A 4ZBDA 3KIJA 1M2BA 5AISA 2VLUA 4OO5A 5EL8A 3ED3A 3GUSA 4NV5A 4L0UA 2HXKA 2XPEA 5GAND 2X49A 1HNCA 1THXA 2DMMA 3SBCA 3TKSA 4ECCA 3DXBA 1V58A 3HJOA 3ZIVA 4G0KA 4OMVA 2DKIA 1DE2A 4MF7A 2IN3A 3APQA 5ELGA 3N5OA 5ELAA 2IMIA 2IWTA 4IKHA 3HDCA 1WIKA 3KJYA 2UZ8A 2YV7A 1JLVA 2O85A 3MSZA 4EO3A 4F0BA 4EUYA 2H8LA 2RIIA 5CRDA 2V1MA 1A2MA 1E2YA 1PX6A 1YEPA 2OKAA 5B8AA 3JCML 1K0NA 5H5SA 4P3YB 3GN3A 6GSSA 1OC3A 2VOCA 2R37A 1XWGA 2E2GA 1IYHA 4GLTA 2LNSA 2FWEA 1PKZA 2LJKA 2GZYA 3F0IA 4K5RA 1B4PA 4J2FA 3IV4A 2LRTA 1EZKA 1I5GA 1BQ7A 5EVOA 5FT3A 3TRXA 1RK4A 3A3TA 1PGTA 1YKAA 4G10A 3GSTA 2JADA 3UMAA 2WS2A 2GVPA 1MDIA 1X5CA 5HR3A 4WR4A 3ZLPA 22GSA 3IRAA 2PGTA 2B5EA 2A4HA 2P0GA 6GSWA 2PN8A 1TK5B 3CTFA 2KP2A 4USSA 4N0VA 4EC0A 2I1UA 3H79A 5ID2A 5EY6A 5COHA 4KA0A 3WT2A 4ZIJA 2VUPA 1FVKA 3ERFA 1LJRA 1FAAA 4ECJA 3IAS2 3MWHA 20GSA 4DVCA 3MNGA 1E6BA 4KDUA 2BMXA 4MJCA 3FZ5A 3H4KA 1F37A 1AIUA 3WGXA 1ST9A 1X0RA 4CY8A 3HHVA 1OVNA 5D8IA 3DGQA 3UL3A 4EXJA 1XWBA 1GUHA 1PSQA 4CW9A 17GSA 3QOUA 3IE3A 3UARA 4D73B 3APSA 3C7MA 4IQ1A 2YZUA 1GTBA 4MA9A 1OC9B 4EDYA 4FO5A 3GX8A 3PR8A 5BMUA 3QDNA 6GSUA 3KCMA 2GLRA 1GL8A 1GSFA 2DLXA 4IS0A 3IK7A 4MH2A 4Z2TA 4DSQA 3WYWA 3FHKA 6GSVA 2DMLA 1JZDA 3EWLA 5JCWA 3A2XA 3D5JA 3FY7A 3KM6A 2LUSA 1OKDA 1GSUA 2GS3A 4I2TA 4I6XA 1TRUA 3A2WA 3O3TA 4ZB9A 5DALA 5DCGA 5IMCA 3Q19A 2MMOA 1YY7A 1VF2A 5KN0A 1Z5YE 2XC2A 3DD3A 1MEKA 2R6KA 5E4WA 1R5PA 2VLVA 3UBLA 2IJYA 1EV9A 1JFUA 1SK0A 4PNFA 5AGYA 1N2AA 4I2UA 1A23A 3BJ5A 4PQHA 2CVKA 1PA3A 1XW5A 3DKSA 2C3TA 3APOA 4PNGA 3G7IA 4OO4A 1X5DA 2PU9C 1W4VA 14GSA 1PN0A 2H70A 1GSYA 2YWNA 4ACSA 4MP4A 1WWJA 1TRVA 2PVOC 2GZPA 3GTUB 4NV2A 1R26A 1K0MA 1TTZA 5DCHA 5G5EA 2DC5A 4BL7A 2A2PA 1TOFA 13GSA 5IMDA 2MMAA 1F3AA 2N5AA 2MMNA 1GP1A 2H76A 3GL5A 3HZ8A 1MD4A 4AGSA 1ON4A 2VIMA 2DJJA 4F0CA 4JR6A 3D4MA 5IO0A 4O5QA 2VCQA 3TCOA 3GA4A 3WGDA 2ZCTA 2HRAA 4O32A 5LNKe 5BRTA 2BTOT 1O8XA 2WFCA 2CQ9A 4KE3A 5IO2A 4K7NA 2HLSA 2YWOA 2GT5A 2YANA 1QXHA 5GAPD 3TDGA 3VPQA 3L9UA 4WXTA 3GH6A 2YOIA 2HNLA 5IMFA 3FZAA 3MDKA 2PVQA 1EOHA 3FZ4A 2TRCP 4FYCA 2B5YA 2F9SA 2Z9SA 3ERGA 3VWXA 2RM6A 4K0GA 4GSTA 4IJIA 3HJMA 4L5LA 1GLQA 2L6DA 1FOVA 4WKWA 2DJ2A 2OADA 3DRNA 3G7JA 3EC3A 3P90A 2OE0A 4N30A 2VD0A 2GSRA 1NHYA 2YCDA 2NDOA 1URMA 2K9FA 4IBPA 1X9WB 2GQMA 1TDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9H A;  5DQY A;  4PUR A;  2CZ3 A;  1OE7 A;  5J9B A;  3G7Y A;  3FRC A;  4X0X A;  1GTI A;  4MMM A;  2ES7 A;  1ML6 A;  3ZRE A;  2VM1 A;  1SKR B;  4HDE A;  3GX0 A;  1Z6N A;  2F51 A;  3D0Z A;  3FYG A;  4LMW A;  2H01 A;  4NXI A;  2XHF A;  3HJP A;  1DSB A;  4MJA A;  3TRP A;  1YEX A;  3F6F A;  1SKS B;  1CQG A;  1Q98 A;  2RUF A;  3KMO A;  3RBT A;  1ZYQ B;  5D73 A;  4IVF A;  1QGV A;  3FR6 A;  1XOB A;  1ILO A;  4ML1 A;  3OR5 A;  4HUA A;  3TJB A;  4OD7 A;  4XRA A;  4TXV A;  2GGT A;  3PIN A;  2C80 A;  2K18 A;  3IAM 2;  1KNG A;  4OWY A;  4Q5R A;  2YNX A;  1PRX A;  3UOM A;  1YDK A;  1Q4J A;  3W8S A;  1M0U A;  4WBR D;  1JZR A;  1ZMA A;  2FWG A;  1ABA A;  2V32 A;  3BD2 A;  5ECM B;  2DJ3 A;  2C3N A;  1NSW A;  4FH8 A;  2FWH A;  4QL7 A;  2F3M A;  1GUL A;  4KCA A;  3KGK A;  2O87 A;  2B1L A;  1Z9H A;  1QQ2 A;  3TRQ A;  5JWR B;  3VWW A;  1KBN A;  2L59 A;  2VD1 A;  1A24 A;  1BYE A;  5FWG A;  3ZFL A;  3GKK A;  3M9J A;  4I8B A;  1YQ1 A;  2L4Q A;  2CAQ A;  4ID0 A;  2PUK C;  1UN2 A;  3GKM A;  3KMN A;  2LRN A;  2AV4 A;  2WGR A;  1A0R P;  1CQH A;  3LXZ A;  5J3R A;  1SD9 A;  1TJD A;  4PX1 A;  4K2D A;  3MAK A;  1JZW A;  3ZIT A;  4CDO A;  2C0G A;  1U87 A;  4GF0 A;  2IIY A;  5DAK A;  4LLR A;  2FA8 A;  1DUG A;  4Q5N A;  3V1W A;  2CX3 A;  1B4Q A;  3DYR A;  1X5E A;  5CP1 A;  2L5O A;  2B3S A;  1G6Y A;  3KH9 A;  2OBI A;  3GKX A;  4IP1 A;  3L4N A;  4MJB A;  2O89 A;  3UEM A;  4IHU A;  1O85 A;  4QQ7 A;  2EIO A;  4KX4 A;  2H30 A;  3D4T A;  2I9H A;  5KN3 A;  1TXX A;  2I81 A;  4HU9 A;  4TR0 A;  3HVV A;  1O7U A;  2GQL A;  2KHP A;  5HR2 A;  3ZVJ A;  1XFL A;  2YN1 A;  3QAV A;  3VLN A;  3CXG A;  1M99 A;  1FO5 A;  3L0H A;  4JR4 A;  2C4J A;  2TIR A;  1GUM A;  3H8Q A;  4JE1 A;  3J7Y k;  2K6V A;  1QK8 A;  5ECQ B;  3EVI A;  3GRX A;  2GZZ A;  3ZFB A;  1YF1 A;  3O6T A;  3RPN A;  2VCX A;  3ZZX A;  2CX4 A;  2M72 A;  3NIV A;  1QFN A;  18GS A;  5J4U A;  4POM A;  2VL9 A;  2DIY A;  4TKY A;  1BAY A;  1YF0 A;  4ZL8 A;  2GQK A;  19GS A;  3VPT A;  1XIY A;  1PD2 1;  1PQN A;  4JRR A;  2JAC A;  3GKN A;  2DJK A;  2AAW A;  2V41 A;  3KTB A;  3LXT A;  2H6Z A;  5ID2 B;  4XS6 A;  1W89 A;  1GSQ A;  1FB0 A;  4GSS A;  3W8J A;  4BWQ A;  2LV3 A;  3GNJ A;  1ZCP A;  2H73 A;  4NPB A;  2E0Q A;  2MBS A;  2OBK A;  2L6C A;  5DQS A;  4ZL9 A;  3F4R A;  4V1A p;  5IOX A;  3UVT A;  3CTG A;  4KB3 A;  1NM3 A;  4RUV A;  5A4U A;  3Q6O A;  5G1K A;  5G31 A;  2H6X A;  4EF0 A;  2EC4 A;  4J56 E;  2B1K A;  2F8A A;  2H1B A;  1MTC A;  4KND A;  1GNW A;  4TR4 A;  4O92 A;  4OCF A;  4BVX A;  1TU8 A;  3M9K A;  3TJF A;  1MDJ A;  2RLI A;  4V2M A;  3P7X A;  4ZB6 A;  3LYK A;  5J41 A;  1K3Y A;  2R5G A;  3UIW A;  5C04 A;  1X9S B;  4FYU A;  1F9M A;  1G7O A;  3M8N A;  3QD9 A;  4LL4 B;  4Q5F A;  3C1S A;  4XS4 A;  3DIE A;  3HA9 A;  1OC8 A;  3GSS A;  2GSS A;  3ZIJ A;  4G19 A;  1HQO A;  2C1Y A;  3TKQ A;  5DAL B;  3U6V A;  1ZZY A;  3A5W A;  5IMV A;  3F63 A;  5F07 A;  3I6A A;  3O76 A;  4H86 A;  4O5R A;  2B7K A;  2FY6 A;  4J57 E;  4GQC A;  2IME A;  4MAB A;  1R7H A;  3BBY A;  4KSO A;  3DEX A;  1ERT A;  2C0E A;  3UBK A;  3TJK A;  2CT6 A;  1R4W A;  1EWX A;  1N8J A;  1A2L A;  2NTO A;  1LBK A;  3HY2 A;  2OE3 A;  3CMI A;  2EIR A;  3PGT A;  3C1R A;  3DVX A;  2HFD A;  3GV1 A;  4GQF A;  1WP0 A;  3HKR A;  2CA8 A;  1OYJ A;  1K0C A;  4LMV A;  2PWJ A;  3W6G A;  4F9Z A;  3QMX A;  5CAX A;  1M2D A;  1WE0 A;  4MCU A;  4G9H A;  5F06 A;  2E2M A;  3LOR A;  4ZBA A;  3G9B A;  4XS1 A;  3CRT A;  4ZBB A;  3WGE A;  5HR0 A;  2HI7 A;  4RI7 A;  4DSS A;  2GSQ A;  4N11 A;  3QFA C;  2C0D A;  3HXS A;  2YPM A;  4V2L A;  2EIQ A;  3S9F A;  5HQP A;  5HFI A;  2HRN A;  2IPA A;  5CRH A;  1RQM A;  1A8L A;  2CVB A;  2H0H A;  4IEL A;  3I69 A;  1ZL9 A;  5DBQ A;  4CHS A;  4XCS A;  1EOG A;  2LNT A;  1NW2 A;  4FIW A;  4MJE A;  4BWS A;  1BX9 A;  2LQO A;  4NMU A;  2GT6 A;  1XZO A;  3I43 A;  3FK8 A;  1GRX A;  4AJ6 A;  4G2E A;  3EU4 A;  2YJH A;  2HT9 A;  2VCV A;  1USB A;  5G1L A;  4YAV A;  5G2Z A;  3LWA A;  4K0N A;  1XWC A;  1SJZ A;  2ZUP A;  2IMF A;  1TW9 A;  1F2E A;  3WT1 A;  1O73 A;  2JZR A;  1TP9 A;  2WRT A;  3FEU A;  3UJ1 A;  1K3O A;  2X99 A;  3A2V A;  4MZW A;  5HFK A;  3WD6 A;  4JED A;  4ILF A;  2DJ1 A;  1EEJ A;  1U3A A;  1EGR A;  1YZX A;  4ZB8 A;  5AN1 A;  1PMT A;  2JL4 A;  4V2N A;  2WZ9 A;  3BOA A;  3R2Q A;  2BJX A;  2O7K A;  5KN2 A;  1EV4 A;  4TR3 A;  1KEB A;  3E3E A;  2QSI A;  1Z7P A;  3VWU A;  1T1V A;  2D2Z A;  2LEG A;  4YAP A;  5GSS A;  1V9W A;  5JCU A;  3EMP A;  5F0G A;  3LQ7 A;  5D9W A;  1AAZ A;  2YP6 A;  1FG4 A;  4KW6 A;  2R2J A;  3ISO A;  3FW2 A;  3M0F A;  1T8E B;  4I5Q A;  3GUR A;  6GSY A;  4BVY A;  1KTE A;  3FKF A;  1PL1 A;  4V1A g;  2YWM A;  4IGJ A;  1WPI A;  3D21 A;  5LD0 A;  2LRC A;  4L5O A;  2HSH A;  2LQQ A;  3E9J B;  1K0D A;  3TKP A;  1XW9 A;  4PQ1 A;  1RW1 A;  4TR1 A;  3QAW A;  2H75 A;  3RHB A;  1Z3E A;  3TKS E;  2VCZ A;  4ZXG A;  1J08 A;  3F6D A;  1AXD A;  1XVW A;  2A2S A;  2KP1 A;  1EEM A;  2DSA A;  4KUN A;  4X1U A;  3F3R A;  1M2A A;  3QPM A;  2WJU A;  5L71 A;  3CRU A;  5AIV A;  3Q18 A;  3F3Q A;  1ZGN A;  4WBJ A;  5IPG A;  4HOJ A;  4WEY A;  4EE0 A;  2OAC A;  3SWL A;  2AB6 A;  2CZ2 A;  2MZC A;  3BCI A;  4KCE A;  1MD3 A;  2H74 A;  1GWC A;  3F4S A;  2O8V B;  3FR3 A;  2GTU A;  4POL A;  1SJI A;  3QFB C;  2FHE A;  2RUE A;  2J23 A;  1R5A A;  2VO4 A;  1ERU A;  4FYB A;  3CSH A;  3KZQ A;  1VF1 A;  4POK A;  4HI7 A;  2HSY A;  2HZE A;  5G5F A;  2C8U A;  2H0G A;  2JU5 A;  4EKZ A;  1K0A A;  2DBC A;  3FZ9 A;  4BA7 A;  5ECI B;  2LKU A;  2WUL A;  2IMD A;  2H1G A;  3DVW A;  2L4C A;  3M1G A;  2K8S A;  5DAK B;  1SKW B;  4XRD A;  4NHW A;  3H93 A;  2WB9 A;  1XWK A;  1S3C A;  2QKE A;  4JU5 A;  3GFK A;  4PGT A;  1Z6M A;  5HFG A;  3HCZ A;  1TK8 B;  1I9D A;  1TI1 A;  2ALB A;  2IFQ B;  1J0F A;  1G0T A;  2M46 A;  1XPV A;  1SEN A;  2XBQ A;  4K1F A;  5AIX A;  1ZYE A;  1BG5 A;  2MYG A;  5ENU A;  2H71 A;  3EIN A;  3VWV A;  2H6Y A;  5ECP B;  3C73 A;  4K8M A;  5H5Q A;  5ABR A;  4POB A;  5B8B A;  4EL1 A;  1O8W A;  2CVD A;  3DWV A;  4O7H A;  6GSX A;  5JWO B;  1VF3 A;  3GYK A;  2IFQ A;  4IP6 A;  4IQA A;  3F8U A;  1M9B A;  2CAI A;  1O6J A;  2YZH A;  1SL1 B;  2CV4 A;  3KXO A;  4KGI A;  4OFT A;  3UAP A;  3KD0 A;  7GSS A;  4TXO A;  1TKD B;  3TOT A;  1S3D A;  5ECR B;  6GST A;  1T7P B;  2JZT A;  3US3 A;  1K3L A;  4HU7 A;  5D9V A;  3C71 A;  4WET A;  2LS5 A;  2VAF A;  3M3M A;  3TJG A;  3VI7 A;  4YH2 A;  3CYN A;  2IMK A;  3FR9 A;  3ERW A;  2X8G A;  2AJQ B;  3ME8 A;  3TUE A;  3J7Y b;  3KP8 A;  1SL2 B;  1GNE A;  3IBH A;  3IHQ A;  4F2I A;  1XW6 A;  2AHE A;  3HZ4 A;  2XBI A;  5D9X A;  2L57 A;  3L9V A;  4L0W A;  3VFI A;  4I97 A;  1SU9 A;  1SYX A;  3C8E A;  2FCH A;  4E8E A;  4ML6 A;  4TN8 A;  2VL2 C;  4PUA A;  4L8E A;  3U5R E;  1IYI A;  3ZML A;  1PL2 A;  3ZRD A;  1HNB A;  5IMA A;  2PPT A;  4ZIL A;  1B48 A;  1MDK A;  2VM2 A;  4OFN A;  3ZL5 A;  4MDC A;  5F05 A;  1H4O A;  5IMZ A;  4HZ2 A;  5JWQ B;  4HZ4 A;  4K6X A;  2KUC A;  1ACV A;  2X8H A;  2OA7 A;  3IDV A;  5CNW A;  1QUW A;  1WRY A;  5B7C A;  4LL1 B;  3EE2 A;  4TOP A;  1B8X A;  2VCT A;  4ECB A;  4RQR A;  3D22 A;  4JBB A;  4KSM A;  5IIZ A;  4IJ3 A;  2AUV A;  4AJ7 A;  4KAE A;  3EUR A;  1AC1 A;  2PMT A;  1QMV A;  2F8F A;  1G7E A;  4HS1 A;  4XS4 B;  4QL9 A;  1WOU A;  3TGZ A;  5LCZ A;  2FGX A;  1UC7 A;  3RDW A;  4LA1 A;  3IK9 A;  1T4Z A;  5IQY A;  3IR4 A;  2M80 A;  3IPZ A;  2A2R A;  1GSE A;  1JZO A;  5ECL B;  5EPF A;  1V2A A;  1ZOF A;  1F3B A;  2L5L A;  4YQM A;  1Y25 A;  2V2G A;  4DEJ A;  1DE1 A;  1EGO A;  3GHA A;  5GZZ B;  3LEF A;  2FD3 A;  2KOK A;  3I9V 2;  3RPP A;  1A0F A;  5ECO B;  3DML A;  4RQX A;  3P8W A;  5CRE A;  4AF2 A;  2NVL A;  2VL3 A;  4KDY A;  1J9B A;  3HYP A;  1PX7 A;  5KEJ A;  2LTK A;  1SJ6 A;  2R4V A;  1GLP A;  4GSN A;  3AY8 A;  2HRF A;  1DBY A;  4WR5 A;  4WF4 A;  1XOA A;  4HQS A;  1XXU A;  1BED A;  1YJ6 A;  3LSZ A;  4NAX A;  3TOU A;  1GH2 A;  3EYT A;  1Y6E A;  4HQZ A;  3Q74 A;  5H5R A;  1HNA A;  2RM5 A;  3GL3 A;  2N5B A;  8GSS A;  4DSS B;  1FW1 A;  4X43 A;  3CSJ A;  2C0F A;  3RHC A;  5A4W A;  3D6I A;  4XHM A;  4D73 A;  2R3X A;  2ZNM A;  11GS A;  4PQI A;  1OC9 A;  1T4Y A;  1FB6 A;  5C00 A;  3VI5 A;  2P5R A;  4IW9 A;  2OE1 A;  5IOW A;  2QGV A;  1ERV A;  2X8C A;  1OE8 A;  1V57 A;  2VL2 A;  1B9Y C;  3QCP A;  4AJ8 A;  1GUK A;  5G30 A;  4MF6 A;  2HE3 A;  2REM A;  3TB2 A;  3KTL A;  1NHO A;  4MZB A;  1K0O A;  1WMJ A;  3F9U A;  1WJK A;  3TJJ A;  1EP7 A;  3LYP A;  1TRS A;  1FVJ A;  3HVS A;  4MPG A;  1TI3 A;  2PER A;  3KP9 A;  5IPH A;  2V6O A;  3IXR A;  5J9C A;  1SL0 B;  4MK3 A;  2E7P A;  3CSI A;  4YQU A;  1HD2 A;  2KLX A;  4HJM A;  1SD8 A;  3E0U A;  4N10 A;  4XTS A;  3IA1 A;  1T3B A;  1HYU A;  1VRS D;  9GSS A;  3ME7 A;  1OKT A;  2WCI A;  3UVH A;  4HJ2 A;  2I4A A;  2VCW A;  1VGL A;  4OFM A;  1JHB A;  3NZN A;  2ON5 A;  5GST A;  3EMX A;  2OJL A;  1JLW A;  2H0I A;  1U6T A;  2P31 A;  3PH9 A;  3LG6 A;  1BJX A;  1S3A A;  2NPB A;  2B5X A;  3GTU A;  3N9J A;  3ZVJ D;  1XWA A;  2K8V A;  2H1A A;  4MLY A;  4EDZ A;  1OAZ A;  2HYX A;  2ON7 A;  3KEB A;  3ZTL A;  2AYT A;  1X9M B;  2FWF A;  2YWI A;  3LJR A;  4DSR A;  5DJL A;  1V40 A;  5ECK B;  5A4V A;  1AW9 A;  2JZS A;  4ISD A;  1LU4 A;  5B6M A;  2HZF A;  4K9Z A;  5A5K A;  4MZC A;  4WF5 A;  4NHZ A;  5J5N A;  1H75 A;  3IC4 A;  2YJ7 A;  4TR1 B;  2B7J A;  2G0F A;  3NOF A;  5D96 A;  5CRG A;  2MMZ A;  4BPY A;  2JSY A;  4GRF A;  1T00 A;  3ZYW A;  1A8Y A;  5KN1 A;  16GS A;  3L9S A;  2DIZ A;  5B6N A;  2H66 A;  1TRW A;  4Z7X A;  1V98 A;  2LJR A;  4IN0 A;  1THO A;  4JZQ A;  4KDX A;  1AQW A;  1PN9 A;  4EVM A;  1C72 A;  1AQV A;  3TKS C;  1G6W A;  2WDU A;  3LFL A;  2GST A;  1UA5 A;  1YKC A;  2MBT A;  4N0Z A;  1B9X C;  1XVQ A;  5DJM A;  2FUG 2;  1M7T A;  4OCE A;  2FA4 A;  5F8B A;  2HZE B;  1XCC A;  4K7O A;  3EU3 A;  5JCG A;  1TK0 B;  1SYR A;  1GTA A;  5HR1 A;  2NBS A;  3QAG A;  2X64 A;  2JSZ A;  1AQX A;  1U88 A;  2FLS A;  5ECN B;  1GTU A;  5D93 A;  1AUC A;  3CBU A;  5DVB A;  4F03 A;  1K0B A;  4ECI A;  3BCK A;  4TRX A;  2H72 A;  3H1N A;  3KH7 A;  3GH9 A;  3K8N A;  4MPF A;  10GS A;  4TW5 A;  2QC7 A;  5CO3 A;  5DDL A;  4MF5 A;  3GIX A;  3HD5 A;  2V6K A;  3IOS A;  3GMF A;  3LGC A;  5E59 A;  1F6M C;  5CRW A;  1XBS A;  2A4V A;  2I3Y A;  3P2A A;  3F4T A;  5D9T A;  1Z7R A;  2C3Q A;  2N5F A;  5FHI A;  2TRX A;  4GTU A;  1U3I A;  3RAZ A;  4GXZ A;  1SK1 A;  2YV9 A;  2DJ0 A;  4PUF C;  1GSS A;  1M9A A;  2PBJ A;  2H1D A;  1UVZ A;  2IL3 A;  5CYY A;  2VLT A;  3ZMK A;  2LST A;  4E8H A;  4RI6 A;  3TKR A;  1O81 A;  4GWR A;  2B6M A;  12GS A;  1ERW A;  5IM9 A;  4MH3 A;  4ZL7 A;  4NWY A;  1TU7 A;  4TXO B;  2P5Q A;  2GDR A;  1FHE A;  4F82 A;  2FNO A;  3QR6 A;  3VUR A;  4PXO A;  4KH7 A;  2H19 A;  4XIH A;  5ECS A;  1VF4 A;  4YQV A;  1PKW A;  3L78 A;  4HEA 2;  2G2Q A;  4Q5Q A;  4ULX A;  2XPD A;  5INY A;  2LJA A;  4TVE A;  1SK2 A;  3VK9 A;  4K7I A;  4GCI A;  5ECH B;  1A2J A;  3HVX A;  1GSD A;  1EP8 A;  4ZBD A;  3KIJ A;  1M2B A;  5AIS A;  2VLU A;  4OO5 A;  5EL8 A;  3ED3 A;  3GUS A;  4NV5 A;  4L0U A;  2HXK A;  2XPE A;  5GAN D;  1HNC A;  1THX A;  2DMM A;  3SBC A;  3TKS A;  4ECC A;  3DXB A;  1V58 A;  3HJO A;  3ZIV A;  4OMV A;  1DE2 A;  4MF7 A;  2IN3 A;  3APQ A;  5ELG A;  3N5O A;  5ELA A;  2IMI A;  2IWT A;  4IKH A;  3HDC A;  1WIK A;  3KJY A;  2YV7 A;  1JLV A;  2O85 A;  3MSZ A;  4EO3 A;  4F0B A;  4EUY A;  2H8L A;  2RII A;  5CRD A;  2V1M A;  1A2M A;  1E2Y A;  1PX6 A;  1YEP A;  2OKA A;  5B8A A;  3JCM L;  1K0N A;  5H5S A;  4P3Y B;  3GN3 A;  6GSS A;  1OC3 A;  2VOC A;  2R37 A;  1XWG A;  2E2G A;  1IYH A;  4GLT A;  2LNS A;  2FWE A;  1PKZ A;  2LJK A;  2GZY A;  3F0I A;  1B4P A;  4J2F A;  3IV4 A;  2LRT A;  1EZK A;  1I5G A;  1BQ7 A;  5EVO A;  5FT3 A;  3TRX A;  1RK4 A;  3A3T A;  1PGT A;  1YKA A;  4G10 A;  3GST A;  2JAD A;  3UMA A;  2WS2 A;  2GVP A;  1MDI A;  1X5C A;  5HR3 A;  4WR4 A;  3ZLP A;  22GS A;  3IRA A;  2PGT A;  2B5E A;  2P0G A;  6GSW A;  2PN8 A;  1TK5 B;  3CTF A;  2KP2 A;  4N0V A;  4EC0 A;  2I1U A;  3H79 A;  5ID2 A;  5EY6 A;  5COH A;  4KA0 A;  3WT2 A;  4ZIJ A;  2VUP A;  1FVK A;  3ERF A;  1LJR A;  1FAA A;  4ECJ A;  3IAS 2;  3MWH A;  20GS A;  4DVC A;  3MNG A;  1E6B A;  4KDU A;  2BMX A;  4MJC A;  3FZ5 A;  3H4K A;  1F37 A;  1AIU A;  3WGX A;  1ST9 A;  1X0R A;  3HHV A;  1OVN A;  5D8I A;  3DGQ A;  3UL3 A;  4EXJ A;  1XWB A;  1GUH A;  1PSQ A;  4CW9 A;  17GS A;  3QOU A;  3IE3 A;  3UAR A;  4D73 B;  3APS A;  3C7M A;  4IQ1 A;  2YZU A;  1GTB A;  4MA9 A;  1OC9 B;  4EDY A;  4FO5 A;  3GX8 A;  3PR8 A;  3QDN A;  6GSU A;  3KCM A;  2GLR A;  1GL8 A;  1GSF A;  2DLX A;  4IS0 A;  3IK7 A;  4MH2 A;  4DSQ A;  3WYW A;  3FHK A;  6GSV A;  2DML A;  1JZD A;  3EWL A;  5JCW A;  3A2X A;  3D5J A;  3FY7 A;  3KM6 A;  2LUS A;  1OKD A;  1GSU A;  2GS3 A;  4I2T A;  4I6X A;  1TRU A;  3A2W A;  3O3T A;  4ZB9 A;  5DAL A;  5DCG A;  5IMC A;  3Q19 A;  2MMO A;  1YY7 A;  1VF2 A;  5KN0 A;  1Z5Y E;  2XC2 A;  3DD3 A;  1MEK A;  2R6K A;  5E4W A;  1R5P A;  2VLV A;  3UBL A;  2IJY A;  1EV9 A;  1JFU A;  1SK0 A;  4PNF A;  5AGY A;  1N2A A;  4I2U A;  1A23 A;  3BJ5 A;  4PQH A;  2CVK A;  1PA3 A;  1XW5 A;  3DKS A;  2C3T A;  3APO A;  4PNG A;  3G7I A;  4OO4 A;  1X5D A;  2PU9 C;  1W4V A;  14GS A;  2H70 A;  1GSY A;  2YWN A;  4ACS A;  4MP4 A;  1WWJ A;  1TRV A;  2PVO C;  2GZP A;  3GTU B;  4NV2 A;  1R26 A;  1K0M A;  1TTZ A;  5DCH A;  5G5E A;  2DC5 A;  4BL7 A;  1TOF A;  13GS A;  5IMD A;  2MMA A;  1F3A A;  2N5A A;  2MMN A;  1GP1 A;  2H76 A;  3GL5 A;  3HZ8 A;  1MD4 A;  4AGS A;  1ON4 A;  2VIM A;  2DJJ A;  4F0C A;  4JR6 A;  3D4M A;  5IO0 A;  2VCQ A;  3TCO A;  3GA4 A;  3WGD A;  2ZCT A;  4O32 A;  5LNK e;  2BTO T;  1O8X A;  2WFC A;  2CQ9 A;  4KE3 A;  5IO2 A;  4K7N A;  2HLS A;  2YWO A;  2GT5 A;  2YAN A;  1QXH A;  5GAP D;  3TDG A;  3VPQ A;  3L9U A;  4WXT A;  3GH6 A;  2YOI A;  2HNL A;  5IMF A;  3FZA A;  3MDK A;  2PVQ A;  1EOH A;  3FZ4 A;  2TRC P;  4FYC A;  2B5Y A;  2F9S A;  2Z9S A;  3ERG A;  3VWX A;  2RM6 A;  4K0G A;  4GST A;  4IJI A;  3HJM A;  4L5L A;  1GLQ A;  2L6D A;  1FOV A;  4WKW A;  2DJ2 A;  2OAD A;  3DRN A;  3G7J A;  3EC3 A;  3P90 A;  2OE0 A;  4N30 A;  2VD0 A;  2GSR A;  1NHY A;  2YCD A;  2NDO A;  1URM A;  2K9F A;  4IBP A;  1X9W B;  2GQM A;  1TDI A; 
#chains in the Genus database with same CATH topology
 2J9H A;  5DQY A;  4PUR A;  2CZ3 A;  1OE7 A;  5J9B A;  3G7Y A;  3FRC A;  4X0X A;  1GTI A;  4MMM A;  2X4A A;  2ES7 A;  1ML6 A;  3ZRE A;  2VM1 A;  1SKR B;  4HDE A;  3GX0 A;  1Z6N A;  2F51 A;  3D0Z A;  3FYG A;  4LMW A;  2H01 A;  4NXI A;  2XHF A;  3HJP A;  1DSB A;  4MJA A;  2QA1 A;  3TRP A;  1YEX A;  3F6F A;  1SKS B;  1CQG A;  1Q98 A;  2RUF A;  3KMO A;  3RBT A;  1ZYQ B;  5D73 A;  4IVF A;  1QGV A;  3FR6 A;  1XOB A;  1ILO A;  4ML1 A;  3OR5 A;  4HUA A;  4MNN A;  3TJB A;  4OD7 A;  4XRA A;  4TXV A;  2GGT A;  3PIN A;  2C80 A;  1ZYP A;  2K18 A;  3IAM 2;  1KNG A;  4OWY A;  4Q5R A;  2YNX A;  1PRX A;  3UOM A;  1YDK A;  1Q4J A;  3W8S A;  1M0U A;  4WBR D;  1JZR A;  1ZMA A;  2FWG A;  1ABA A;  2V32 A;  3BD2 A;  5ECM B;  2DJ3 A;  2C3N A;  1NSW A;  4FH8 A;  2FWH A;  4QL7 A;  2F3M A;  1GUL A;  4KCA A;  3KGK A;  2O87 A;  2B1L A;  1Z9H A;  1QQ2 A;  3TRQ A;  5JWR B;  3VWW A;  1KBN A;  2L59 A;  2VD1 A;  1A24 A;  1BYE A;  5FWG A;  3ZFL A;  3GKK A;  3M9J A;  4I8B A;  1YQ1 A;  2L4Q A;  2CAQ A;  4ID0 A;  2PUK C;  1UN2 A;  3GKM A;  3KMN A;  2R0G A;  2LRN A;  2AV4 A;  2WGR A;  1A0R P;  1CQH A;  3LXZ A;  5J3R A;  4A5P A;  1SD9 A;  1TJD A;  4PX1 A;  4K2D A;  3MAK A;  1JZW A;  3ZIT A;  4CDO A;  2C0G A;  1U87 A;  4GF0 A;  2IIY A;  5DAK A;  4LLR A;  2FA8 A;  1DUG A;  4Q5N A;  3V1W A;  2CX3 A;  1B4Q A;  3DYR A;  1X5E A;  5CP1 A;  2L5O A;  2B3S A;  1G6Y A;  3KH9 A;  2OBI A;  3GKX A;  4IP1 A;  3L4N A;  4MJB A;  2O89 A;  3UEM A;  4IHU A;  1O85 A;  4QQ7 A;  2EIO A;  4PTS A;  4KX4 A;  2H30 A;  3D4T A;  2I9H A;  5KN3 A;  1TXX A;  2I81 A;  4HU9 A;  4TR0 A;  3HVV A;  1O7U A;  2GQL A;  2KHP A;  5HR2 A;  3ZVJ A;  1XFL A;  2YN1 A;  3QAV A;  3VLN A;  3CXG A;  1M99 A;  1FO5 A;  3L0H A;  4JR4 A;  2C4J A;  2TIR A;  1GUM A;  3H8Q A;  4JE1 A;  3J7Y k;  3LW9 A;  2K6V A;  1QK8 A;  5ECQ B;  3EVI A;  3GRX A;  2GZZ A;  3ZFB A;  5KOX A;  1YF1 A;  3O6T A;  3RPN A;  2VCX A;  3ZZX A;  2CX4 A;  2M72 A;  3NIV A;  1QFN A;  18GS A;  5J4U A;  4POM A;  2VL9 A;  2DIY A;  4TKY A;  1BAY A;  1YF0 A;  4ZL8 A;  2GQK A;  19GS A;  3VPT A;  1XIY A;  1PD2 1;  1PQN A;  4JRR A;  2JAC A;  3GKN A;  2DJK A;  2AAW A;  2V41 A;  3KTB A;  3LXT A;  2H6Z A;  5ID2 B;  4XS6 A;  1W89 A;  1GSQ A;  1FB0 A;  4GSS A;  3W8J A;  4BWQ A;  2LV3 A;  3GNJ A;  1ZCP A;  2H73 A;  4NPB A;  4BVX B;  2E0Q A;  2MBS A;  2OBK A;  2L6C A;  5DQS A;  4ZL9 A;  3F4R A;  4V1A p;  5IOX A;  3UVT A;  3CTG A;  4KB3 A;  1NM3 A;  4RUV A;  5A4U A;  3Q6O A;  5G1K A;  5G31 A;  2H6X A;  4EF0 A;  2EC4 A;  4J56 E;  2B1K A;  2F8A A;  2H1B A;  1MTC A;  4KND A;  1GNW A;  4TR4 A;  4O92 A;  4OCF A;  4BVX A;  4K2X A;  1TU8 A;  3M9K A;  3TJF A;  1MDJ A;  2RLI A;  4V2M A;  3P7X A;  4ZB6 A;  3LYK A;  5J41 A;  1K3Y A;  2R5G A;  3UIW A;  5C04 A;  1X9S B;  4FYU A;  1F9M A;  1G7O A;  3M8N A;  3QD9 A;  4LL4 B;  4Q5F A;  3C1S A;  4XS4 A;  3DIE A;  3HA9 A;  1OC8 A;  3GSS A;  2GSS A;  3ZIJ A;  4G19 A;  1HQO A;  2C1Y A;  3TKQ A;  5DAL B;  3U6V A;  1ZZY A;  3A5W A;  5IMV A;  3F63 A;  5F07 A;  3I6A A;  3O76 A;  4H86 A;  4O5R A;  2B7K A;  2FY6 A;  4J57 E;  4GQC A;  2IME A;  3R3E A;  4MAB A;  1R7H A;  3BBY A;  4KSO A;  3DEX A;  1ERT A;  4CY6 A;  2C0E A;  3UBK A;  3TJK A;  2CT6 A;  1R4W A;  1EWX A;  1N8J A;  1A2L A;  2NTO A;  1LBK A;  3HY2 A;  2OE3 A;  3CMI A;  2EIR A;  3PGT A;  3C1R A;  3DVX A;  2HFD A;  3GV1 A;  4GQF A;  1WP0 A;  3HKR A;  2CA8 A;  1OYJ A;  1K0C A;  4LMV A;  2PWJ A;  3W6G A;  4F9Z A;  3QMX A;  5CAX A;  1M2D A;  1WE0 A;  4MCU A;  4G9H A;  5F06 A;  2E2M A;  3LOR A;  4ZBA A;  3G9B A;  4XS1 A;  3CRT A;  4ZBB A;  3WGE A;  5HR0 A;  2HI7 A;  4BL7 B;  4RI7 A;  4DSS A;  2GSQ A;  4N11 A;  3QFA C;  2C0D A;  3HXS A;  2YPM A;  4V2L A;  2EIQ A;  3S9F A;  5HQP A;  5HFI A;  2HRN A;  2IPA A;  5CRH A;  1RQM A;  1A8L A;  2CVB A;  2H0H A;  4IEL A;  3I69 A;  4Z2U A;  1ZL9 A;  5DBQ A;  4CHS A;  4XCS A;  1EOG A;  2LNT A;  1NW2 A;  4FIW A;  4MJE A;  4BWS A;  1BX9 A;  2LQO A;  4NMU A;  2GT6 A;  1XZO A;  3I43 A;  3FK8 A;  1GRX A;  4AJ6 A;  4G2E A;  3EU4 A;  2YJH A;  2HT9 A;  2VCV A;  1USB A;  5G1L A;  4YAV A;  5G2Z A;  3MIX A;  3LWA A;  4K0N A;  1XWC A;  1SJZ A;  2ZUP A;  2IMF A;  1TW9 A;  1F2E A;  3WT1 A;  1O73 A;  2JZR A;  1TP9 A;  2WRT A;  3FEU A;  3UJ1 A;  1K3O A;  2X99 A;  3A2V A;  4MZW A;  5HFK A;  3WD6 A;  4JED A;  4ILF A;  2DJ1 A;  1EEJ A;  1U3A A;  1EGR A;  1YZX A;  4ZB8 A;  5AN1 A;  1PMT A;  2JL4 A;  4V2N A;  2WZ9 A;  3BOA A;  3R2Q A;  2BJX A;  2O7K A;  5KN2 A;  1EV4 A;  4TR3 A;  1KEB A;  3E3E A;  2QSI A;  1Z7P A;  3VWU A;  4BVY B;  1T1V A;  2D2Z A;  2LEG A;  4YAP A;  5GSS A;  1V9W A;  4G0L A;  4ICY A;  5JCU A;  3EMP A;  5F0G A;  3LQ7 A;  5D9W A;  1AAZ A;  2YP6 A;  1FG4 A;  4KW6 A;  2R2J A;  3ISO A;  3FW2 A;  3M0F A;  1T8E B;  4I5Q A;  3GUR A;  4FQU A;  6GSY A;  4BVY A;  1KTE A;  3FKF A;  1PL1 A;  4V1A g;  2YWM A;  4IGJ A;  1WPI A;  3D21 A;  5LD0 A;  2LRC A;  4L5O A;  2HSH A;  2LQQ A;  3E9J B;  1K0D A;  3TKP A;  1XW9 A;  3PPU A;  4PQ1 A;  1RW1 A;  4TR1 A;  3QAW A;  4O5U A;  2H75 A;  3RHB A;  1Z3E A;  3TKS E;  2VCZ A;  4ZXG A;  1J08 A;  3F6D A;  1AXD A;  1XVW A;  2A2S A;  2KP1 A;  1EEM A;  2DSA A;  4KUN A;  4X1U A;  3F3R A;  1M2A A;  3QPM A;  2WJU A;  5L71 A;  3CRU A;  5AIV A;  3Q18 A;  3F3Q A;  1ZGN A;  4WBJ A;  5IPG A;  4HOJ A;  4WEY A;  4EE0 A;  2OAC A;  3SWL A;  2AB6 A;  2CZ2 A;  2MZC A;  3BCI A;  4KCE A;  1MD3 A;  2H74 A;  1GWC A;  3EPT A;  3F4S A;  2O8V B;  3FR3 A;  2GTU A;  4POL A;  1SJI A;  3QFB C;  2FHE A;  2RUE A;  3IC8 A;  2J23 A;  1R5A A;  2R0P A;  2VO4 A;  1ERU A;  4FYB A;  3CSH A;  3A5I A;  3KZQ A;  1VF1 A;  4POK A;  4HI7 A;  2HSY A;  2HZE A;  5G5F A;  2C8U A;  2H0G A;  2JU5 A;  4EKZ A;  1K0A A;  2DBC A;  3FZ9 A;  4BA7 A;  5ECI B;  2LKU A;  2WUL A;  2IMD A;  2H1G A;  3DVW A;  2L4C A;  3M1G A;  4X4J A;  2K8S A;  5DAK B;  1SKW B;  4XRD A;  4NHW A;  3H93 A;  2WB9 A;  1XWK A;  1S3C A;  2QKE A;  4JU5 A;  3GFK A;  4PGT A;  1Z6M A;  5HFG A;  3HCZ A;  1TK8 B;  1I9D A;  1TI1 A;  2ALB A;  2IFQ B;  1J0F A;  1G0T A;  2M46 A;  1XPV A;  1SEN A;  2XBQ A;  4K1F A;  5AIX A;  1ZYE A;  1BG5 A;  2MYG A;  5ENU A;  2H71 A;  3EIN A;  3VWV A;  2H6Y A;  5ECP B;  3C73 A;  4K8M A;  5H5Q A;  5ABR A;  4POB A;  5B8B A;  4EL1 A;  1O8W A;  2CVD A;  3DWV A;  2DKH A;  4O7H A;  6GSX A;  5JWO B;  1VF3 A;  3GYK A;  2IFQ A;  4IP6 A;  4IQA A;  3F8U A;  1M9B A;  2CAI A;  1O6J A;  2YZH A;  1SL1 B;  2CV4 A;  3KXO A;  4KGI A;  4OFT A;  3UAP A;  3KD0 A;  7GSS A;  4TXO A;  1TKD B;  4KF9 A;  3TOT A;  1S3D A;  5ECR B;  6GST A;  1T7P B;  2JZT A;  3US3 A;  1K3L A;  4HU7 A;  5D9V A;  3C71 A;  4WET A;  2LS5 A;  2VAF A;  3M3M A;  3TJG A;  2QA2 A;  3VI7 A;  4YH2 A;  3CYN A;  2IMK A;  3FR9 A;  3ERW A;  2X8G A;  2AJQ B;  3ME8 A;  3TUE A;  3J7Y b;  3KP8 A;  1SL2 B;  1GNE A;  3IBH A;  3IHQ A;  4F2I A;  1XW6 A;  2AHE A;  3HZ4 A;  2XBI A;  5D9X A;  2L57 A;  3L9V A;  4L0W A;  3VFI A;  4I97 A;  1SU9 A;  1SYX A;  3C8E A;  2FCH A;  4E8E A;  4ML6 A;  4TN8 A;  2VL2 C;  4PUA A;  4L8E A;  3U5R E;  1IYI A;  3ZML A;  1PL2 A;  3ZRD A;  1HNB A;  5IMA A;  2PPT A;  4ZIL A;  1B48 A;  1MDK A;  2VM2 A;  3FMW A;  4OFN A;  3ZL5 A;  4MDC A;  5F05 A;  1H4O A;  5IMZ A;  4HZ2 A;  5JWQ B;  4HZ4 A;  4K6X A;  2KUC A;  1ACV A;  2X8H A;  2OA7 A;  3IDV A;  5CNW A;  1QUW A;  5KOW A;  1WRY A;  5B7C A;  4LL1 B;  3EE2 A;  4TOP A;  1B8X A;  2VCT A;  4ECB A;  4RQR A;  3D22 A;  4JBB A;  4KSM A;  5IIZ A;  4IJ3 A;  2AUV A;  4G0I A;  4KAE A;  4AJ7 A;  3EUR A;  1AC1 A;  2PMT A;  1QMV A;  2F8F A;  1G7E A;  4HS1 A;  4XS4 B;  4QL9 A;  4YKF A;  1WOU A;  3TGZ A;  3IHG A;  5LCZ A;  2FGX A;  1UC7 A;  3RDW A;  4LA1 A;  3IK9 A;  1T4Z A;  5IQY A;  3IR4 A;  2M80 A;  3IPZ A;  3MYD A;  2A2R A;  1GSE A;  1JZO A;  5ECL B;  5EPF A;  1V2A A;  1ZOF A;  1F3B A;  2L5L A;  4YQM A;  1Y25 A;  2V2G A;  4DEJ A;  1DE1 A;  1EGO A;  3GHA A;  5GZZ B;  3LEF A;  2FD3 A;  2KOK A;  3I9V 2;  3RPP A;  1A0F A;  5ECO B;  3DML A;  4RQX A;  3P8W A;  5CRE A;  4AF2 A;  2NVL A;  2VL3 A;  4KDY A;  1J9B A;  3HYP A;  1PX7 A;  5KEJ A;  2LTK A;  1SJ6 A;  2R4V A;  1GLP A;  4GSN A;  3AY8 A;  2HRF A;  1DBY A;  4WR5 A;  4WF4 A;  1XOA A;  4HQS A;  1XXU A;  1BED A;  1YJ6 A;  3LSZ A;  4NAX A;  3TOU A;  1GH2 A;  3EYT A;  1Y6E A;  4HQZ A;  3Q74 A;  5H5R A;  1HNA A;  2RM5 A;  3GL3 A;  2N5B A;  8GSS A;  4DSS B;  1FW1 A;  4X43 A;  3CSJ A;  2C0F A;  3RHC A;  5A4W A;  3D6I A;  4XHM A;  4D73 A;  2R3X A;  2ZNM A;  11GS A;  4PQI A;  1OC9 A;  1T4Y A;  1FB6 A;  5C00 A;  3VI5 A;  2P5R A;  4IW9 A;  2OE1 A;  5IOW A;  2QGV A;  1ERV A;  4EIQ A;  2X8C A;  1OE8 A;  1V57 A;  2VL2 A;  1B9Y C;  3QCP A;  4AJ8 A;  1GUK A;  5G30 A;  4MF6 A;  2HE3 A;  2REM A;  3TB2 A;  1FOH A;  3KTL A;  1NHO A;  4MZB A;  1K0O A;  1WMJ A;  3F9U A;  1WJK A;  2HSM A;  3TJJ A;  1EP7 A;  3LYP A;  1TRS A;  1FVJ A;  3HVS A;  4MPG A;  1TI3 A;  1PFO A;  2PER A;  3KP9 A;  5IPH A;  2V6O A;  3IXR A;  5J9C A;  1SL0 B;  4MK3 A;  2E7P A;  3CSI A;  4YQU A;  1HD2 A;  2KLX A;  4HJM A;  1SD8 A;  3E0U A;  4N10 A;  4XTS A;  3IA1 A;  1T3B A;  1HYU A;  1VRS D;  9GSS A;  3ME7 A;  1OKT A;  2WCI A;  3UVH A;  4HJ2 A;  2I4A A;  2VCW A;  1VGL A;  4OFM A;  1JHB A;  3NZN A;  2ON5 A;  5GST A;  3EMX A;  2OJL A;  1JLW A;  2H0I A;  1U6T A;  2P31 A;  3PH9 A;  3LG6 A;  1BJX A;  1S3A A;  2NPB A;  2B5X A;  3GTU A;  3N9J A;  3ZVJ D;  1XWA A;  2K8V A;  2H1A A;  4MLY A;  4EDZ A;  1OAZ A;  2HYX A;  2ON7 A;  3KEB A;  3ZTL A;  2AYT A;  1X9M B;  2FWF A;  2YWI A;  3LJR A;  4DSR A;  5DJL A;  1V40 A;  4EIP A;  5ECK B;  5A4V A;  1AW9 A;  2JZS A;  4ISD A;  1LU4 A;  5B6M A;  2HZF A;  4K9Z A;  4K5S A;  5A5K A;  4MZC A;  4WF5 A;  4NHZ A;  2R0C A;  5J5N A;  1H75 A;  3IC4 A;  4HSC X;  2YJ7 A;  4TR1 B;  2B7J A;  2G0F A;  3NOF A;  5D96 A;  5CRG A;  2MMZ A;  4BPY A;  2JSY A;  4GRF A;  1T00 A;  3ZYW A;  1A8Y A;  5KN1 A;  16GS A;  3L9S A;  2DIZ A;  5B6N A;  2H66 A;  1TRW A;  4Z7X A;  1V98 A;  2LJR A;  4IN0 A;  1THO A;  4JZQ A;  4KDX A;  1AQW A;  1PN9 A;  4EVM A;  1C72 A;  1AQV A;  4Z2R A;  3TKS C;  4YKG A;  1G6W A;  2WDU A;  3LFL A;  2GST A;  1UA5 A;  1YKC A;  2MBT A;  4N0Z A;  1B9X C;  1XVQ A;  5DJM A;  2FUG 2;  4BIK A;  1M7T A;  4OCE A;  2FA4 A;  5F8B A;  2HZE B;  1XCC A;  1ZYN A;  4K7O A;  3EU3 A;  5JCG A;  1TK0 B;  1SYR A;  1GTA A;  5HR1 A;  2NBS A;  3QAG A;  2X64 A;  2JSZ A;  2HRK A;  1AQX A;  1U88 A;  2FLS A;  5ECN B;  1GTU A;  5D93 A;  1AUC A;  3CBU A;  5DVB A;  4F03 A;  3CQF A;  1K0B A;  4ECI A;  3BCK A;  4TRX A;  2H72 A;  3H1N A;  3KH7 A;  3GH9 A;  3K8N A;  4MPF A;  10GS A;  4TW5 A;  2QC7 A;  5CO3 A;  5DDL A;  4MF5 A;  3GIX A;  3HD5 A;  2V6K A;  3IOS A;  3GMF A;  3LGC A;  5E59 A;  1F6M C;  5CRW A;  1XBS A;  2A4V A;  2I3Y A;  3P2A A;  3F4T A;  5D9T A;  1Z7R A;  2C3Q A;  2N5F A;  5FHI A;  2TRX A;  4GTU A;  1U3I A;  3RAZ A;  4GXZ A;  1SK1 A;  2YV9 A;  2DJ0 A;  4PUF C;  1GSS A;  1M9A A;  2PBJ A;  2H1D A;  1UVZ A;  2IL3 A;  5CYY A;  2VLT A;  3ZMK A;  2LST A;  4E8H A;  4RI6 A;  3TKR A;  1O81 A;  4GWR A;  2B6M A;  12GS A;  1ERW A;  5IM9 A;  4MH3 A;  4ZL7 A;  4NWY A;  1TU7 A;  4TXO B;  2P5Q A;  2GDR A;  1FHE A;  4F82 A;  2FNO A;  3HVN A;  3QR6 A;  3VUR A;  4PXO A;  4KH7 A;  2H19 A;  4XIH A;  5ECS A;  1VF4 A;  4YQV A;  1PKW A;  3L78 A;  4HEA 2;  2G2Q A;  4Q5Q A;  4ULX A;  2XPD A;  5INY A;  2LJA A;  4TVE A;  1SK2 A;  3VK9 A;  4K7I A;  4GCI A;  5ECH B;  1A2J A;  3HVX A;  1GSD A;  1EP8 A;  4ZBD A;  3KIJ A;  1M2B A;  5AIS A;  2VLU A;  4OO5 A;  5EL8 A;  3ED3 A;  3GUS A;  4NV5 A;  4L0U A;  2HXK A;  2XPE A;  5GAN D;  2X49 A;  1HNC A;  1THX A;  2DMM A;  3SBC A;  3TKS A;  4ECC A;  3DXB A;  1V58 A;  3HJO A;  3ZIV A;  4G0K A;  4OMV A;  2DKI A;  1DE2 A;  4MF7 A;  2IN3 A;  3APQ A;  5ELG A;  3N5O A;  5ELA A;  2IMI A;  2IWT A;  4IKH A;  3HDC A;  1WIK A;  3KJY A;  2UZ8 A;  2YV7 A;  1JLV A;  2O85 A;  3MSZ A;  4EO3 A;  4F0B A;  4EUY A;  2H8L A;  2RII A;  5CRD A;  2V1M A;  1A2M A;  1E2Y A;  1PX6 A;  1YEP A;  2OKA A;  5B8A A;  3JCM L;  1K0N A;  5H5S A;  4P3Y B;  3GN3 A;  6GSS A;  1OC3 A;  2VOC A;  2R37 A;  1XWG A;  2E2G A;  1IYH A;  4GLT A;  2LNS A;  2FWE A;  1PKZ A;  2LJK A;  2GZY A;  3F0I A;  4K5R A;  1B4P A;  4J2F A;  3IV4 A;  2LRT A;  1EZK A;  1I5G A;  1BQ7 A;  5EVO A;  5FT3 A;  3TRX A;  1RK4 A;  3A3T A;  1PGT A;  1YKA A;  4G10 A;  3GST A;  2JAD A;  3UMA A;  2WS2 A;  2GVP A;  1MDI A;  1X5C A;  5HR3 A;  4WR4 A;  3ZLP A;  22GS A;  3IRA A;  2PGT A;  2B5E A;  2A4H A;  2P0G A;  6GSW A;  2PN8 A;  1TK5 B;  3CTF A;  2KP2 A;  4USS A;  4N0V A;  4EC0 A;  2I1U A;  3H79 A;  5ID2 A;  5EY6 A;  5COH A;  4KA0 A;  3WT2 A;  4ZIJ A;  1M3J A;  2VUP A;  1FVK A;  3ERF A;  1LJR A;  1FAA A;  4ECJ A;  3IAS 2;  3MWH A;  20GS A;  4DVC A;  3MNG A;  1E6B A;  4KDU A;  2BMX A;  4MJC A;  3FZ5 A;  3H4K A;  1F37 A;  1AIU A;  3WGX A;  1ST9 A;  1X0R A;  4CY8 A;  3HHV A;  1OVN A;  5D8I A;  3DGQ A;  3UL3 A;  4EXJ A;  1XWB A;  1GUH A;  1PSQ A;  4CW9 A;  17GS A;  3QOU A;  3IE3 A;  3UAR A;  4D73 B;  3APS A;  3C7M A;  4IQ1 A;  1M3I A;  2YZU A;  1GTB A;  4MA9 A;  1OC9 B;  4EDY A;  4FO5 A;  3GX8 A;  3PR8 A;  5BMU A;  3QDN A;  6GSU A;  3KCM A;  2GLR A;  1GL8 A;  1GSF A;  2DLX A;  4IS0 A;  3IK7 A;  4MH2 A;  4Z2T A;  4DSQ A;  3WYW A;  3FHK A;  6GSV A;  2DML A;  1JZD A;  3EWL A;  5JCW A;  3A2X A;  3D5J A;  3FY7 A;  3KM6 A;  2LUS A;  1OKD A;  1GSU A;  2GS3 A;  4I2T A;  4I6X A;  1TRU A;  3A2W A;  3O3T A;  4ZB9 A;  5DAL A;  5DCG A;  5IMC A;  3Q19 A;  2MMO A;  1YY7 A;  1VF2 A;  5KN0 A;  1Z5Y E;  2XC2 A;  3DD3 A;  1MEK A;  2R6K A;  5E4W A;  1R5P A;  2VLV A;  3UBL A;  2IJY A;  1EV9 A;  1JFU A;  1SK0 A;  4PNF A;  5AGY A;  1N2A A;  4I2U A;  1A23 A;  3BJ5 A;  4PQH A;  2CVK A;  1PA3 A;  1XW5 A;  3DKS A;  2C3T A;  3APO A;  4PNG A;  3G7I A;  4OO4 A;  1X5D A;  2PU9 C;  1W4V A;  14GS A;  1PN0 A;  2H70 A;  1GSY A;  2YWN A;  4ACS A;  4MP4 A;  1WWJ A;  1TRV A;  2PVO C;  2GZP A;  3GTU B;  4NV2 A;  1R26 A;  1K0M A;  1TTZ A;  5DCH A;  5G5E A;  2DC5 A;  4BL7 A;  2A2P A;  1TOF A;  13GS A;  1XG8 A;  5IMD A;  2MMA A;  1F3A A;  2N5A A;  2MMN A;  1GP1 A;  2H76 A;  3GL5 A;  3HZ8 A;  1MD4 A;  4AGS A;  1ON4 A;  2VIM A;  2DJJ A;  4F0C A;  4JR6 A;  3D4M A;  5IO0 A;  4O5Q A;  2VCQ A;  3TCO A;  3GA4 A;  3WGD A;  2ZCT A;  2HRA A;  4O32 A;  5LNK e;  5BRT A;  2BTO T;  1O8X A;  2WFC A;  2CQ9 A;  4KE3 A;  5IO2 A;  4K7N A;  2HLS A;  2YWO A;  2GT5 A;  2YAN A;  1QXH A;  5GAP D;  3TDG A;  3VPQ A;  3L9U A;  4WXT A;  3GH6 A;  2YOI A;  2HNL A;  5IMF A;  3FZA A;  3MDK A;  2PVQ A;  1S3R A;  1EOH A;  3FZ4 A;  2TRC P;  4FYC A;  2B5Y A;  2F9S A;  2Z9S A;  3ERG A;  3VWX A;  2RM6 A;  4K0G A;  4GST A;  4IJI A;  3HJM A;  4L5L A;  1GLQ A;  2L6D A;  1FOV A;  4WKW A;  2DJ2 A;  2OAD A;  3DRN A;  3G7J A;  3EC3 A;  3P90 A;  2OE0 A;  4N30 A;  2VD0 A;  2GSR A;  1NHY A;  2YCD A;  2NDO A;  1URM A;  2K9F A;  4IBP A;  1X9W B;  2GQM A;  1TDI A; 
#chains in the Genus database with same CATH homology
 2J9H A;  5DQY A;  4PUR A;  2CZ3 A;  1OE7 A;  5J9B A;  3G7Y A;  3FRC A;  4X0X A;  1GTI A;  4MMM A;  2X4A A;  2ES7 A;  1ML6 A;  3ZRE A;  2VM1 A;  1SKR B;  4HDE A;  3GX0 A;  1Z6N A;  2F51 A;  3D0Z A;  3FYG A;  4LMW A;  2H01 A;  4NXI A;  2XHF A;  3HJP A;  1DSB A;  4MJA A;  2QA1 A;  3TRP A;  1YEX A;  3F6F A;  1SKS B;  1CQG A;  1Q98 A;  2RUF A;  3KMO A;  3RBT A;  1ZYQ B;  5D73 A;  4IVF A;  1QGV A;  3FR6 A;  1XOB A;  1ILO A;  4ML1 A;  3OR5 A;  4HUA A;  4MNN A;  3TJB A;  4OD7 A;  4XRA A;  4TXV A;  2GGT A;  3PIN A;  2C80 A;  1ZYP A;  2K18 A;  3IAM 2;  1KNG A;  4OWY A;  4Q5R A;  2YNX A;  1PRX A;  3UOM A;  1YDK A;  1Q4J A;  3W8S A;  1M0U A;  4WBR D;  1JZR A;  1ZMA A;  2FWG A;  1ABA A;  2V32 A;  3BD2 A;  5ECM B;  2DJ3 A;  2C3N A;  1NSW A;  4FH8 A;  2FWH A;  4QL7 A;  2F3M A;  1GUL A;  4KCA A;  3KGK A;  2O87 A;  2B1L A;  1Z9H A;  1QQ2 A;  3TRQ A;  5JWR B;  3VWW A;  1KBN A;  2L59 A;  2VD1 A;  1A24 A;  1BYE A;  5FWG A;  3ZFL A;  3GKK A;  3M9J A;  4I8B A;  1YQ1 A;  2L4Q A;  2CAQ A;  4ID0 A;  2PUK C;  1UN2 A;  3GKM A;  3KMN A;  2R0G A;  2LRN A;  2AV4 A;  2WGR A;  1A0R P;  1CQH A;  3LXZ A;  5J3R A;  4A5P A;  1SD9 A;  1TJD A;  4PX1 A;  4K2D A;  3MAK A;  1JZW A;  3ZIT A;  4CDO A;  2C0G A;  1U87 A;  4GF0 A;  2IIY A;  5DAK A;  4LLR A;  2FA8 A;  1DUG A;  4Q5N A;  3V1W A;  2CX3 A;  1B4Q A;  3DYR A;  1X5E A;  5CP1 A;  2L5O A;  2B3S A;  1G6Y A;  3KH9 A;  2OBI A;  3GKX A;  4IP1 A;  3L4N A;  4MJB A;  2O89 A;  3UEM A;  4IHU A;  1O85 A;  4QQ7 A;  2EIO A;  4PTS A;  4KX4 A;  2H30 A;  3D4T A;  2I9H A;  5KN3 A;  1TXX A;  2I81 A;  4HU9 A;  4TR0 A;  3HVV A;  1O7U A;  2GQL A;  2KHP A;  5HR2 A;  3ZVJ A;  1XFL A;  2YN1 A;  3QAV A;  3VLN A;  3CXG A;  1M99 A;  1FO5 A;  3L0H A;  4JR4 A;  2C4J A;  2TIR A;  1GUM A;  3H8Q A;  4JE1 A;  3J7Y k;  3LW9 A;  2K6V A;  1QK8 A;  5ECQ B;  3EVI A;  3GRX A;  2GZZ A;  3ZFB A;  5KOX A;  1YF1 A;  3O6T A;  3RPN A;  2VCX A;  3ZZX A;  2CX4 A;  2M72 A;  3NIV A;  1QFN A;  18GS A;  5J4U A;  4POM A;  2VL9 A;  2DIY A;  4TKY A;  1BAY A;  1YF0 A;  4ZL8 A;  2GQK A;  19GS A;  3VPT A;  1XIY A;  1PD2 1;  1PQN A;  4JRR A;  2JAC A;  3GKN A;  2DJK A;  2AAW A;  2V41 A;  3KTB A;  3LXT A;  2H6Z A;  5ID2 B;  4XS6 A;  1W89 A;  1GSQ A;  1FB0 A;  4GSS A;  3W8J A;  4BWQ A;  2LV3 A;  3GNJ A;  1ZCP A;  2H73 A;  4NPB A;  4BVX B;  2E0Q A;  2MBS A;  2OBK A;  2L6C A;  5DQS A;  4ZL9 A;  3F4R A;  4V1A p;  5IOX A;  3UVT A;  3CTG A;  4KB3 A;  1NM3 A;  4RUV A;  5A4U A;  3Q6O A;  5G1K A;  5G31 A;  2H6X A;  4EF0 A;  2EC4 A;  4J56 E;  2B1K A;  2F8A A;  2H1B A;  1MTC A;  4KND A;  1GNW A;  4TR4 A;  4O92 A;  4OCF A;  4BVX A;  4K2X A;  1TU8 A;  3M9K A;  3TJF A;  1MDJ A;  2RLI A;  4V2M A;  3P7X A;  4ZB6 A;  3LYK A;  5J41 A;  1K3Y A;  2R5G A;  3UIW A;  5C04 A;  1X9S B;  4FYU A;  1F9M A;  1G7O A;  3M8N A;  3QD9 A;  4LL4 B;  4Q5F A;  3C1S A;  4XS4 A;  3DIE A;  3HA9 A;  1OC8 A;  3GSS A;  2GSS A;  3ZIJ A;  4G19 A;  1HQO A;  2C1Y A;  3TKQ A;  5DAL B;  3U6V A;  1ZZY A;  3A5W A;  5IMV A;  3F63 A;  5F07 A;  3I6A A;  3O76 A;  4H86 A;  4O5R A;  2B7K A;  2FY6 A;  4J57 E;  4GQC A;  2IME A;  3R3E A;  4MAB A;  1R7H A;  3BBY A;  4KSO A;  3DEX A;  1ERT A;  4CY6 A;  2C0E A;  3UBK A;  3TJK A;  2CT6 A;  1R4W A;  1EWX A;  1N8J A;  1A2L A;  2NTO A;  1LBK A;  3HY2 A;  2OE3 A;  3CMI A;  2EIR A;  3PGT A;  3C1R A;  3DVX A;  2HFD A;  3GV1 A;  4GQF A;  1WP0 A;  3HKR A;  2CA8 A;  1OYJ A;  1K0C A;  4LMV A;  2PWJ A;  3W6G A;  4F9Z A;  3QMX A;  5CAX A;  1M2D A;  1WE0 A;  4MCU A;  4G9H A;  5F06 A;  2E2M A;  3LOR A;  4ZBA A;  3G9B A;  4XS1 A;  3CRT A;  4ZBB A;  3WGE A;  5HR0 A;  2HI7 A;  4BL7 B;  4RI7 A;  4DSS A;  2GSQ A;  4N11 A;  3QFA C;  2C0D A;  3HXS A;  2YPM A;  4V2L A;  2EIQ A;  3S9F A;  5HQP A;  5HFI A;  2HRN A;  2IPA A;  5CRH A;  1RQM A;  1A8L A;  2CVB A;  2H0H A;  4IEL A;  3I69 A;  4Z2U A;  1ZL9 A;  5DBQ A;  4CHS A;  4XCS A;  1EOG A;  2LNT A;  1NW2 A;  4FIW A;  4MJE A;  4BWS A;  1BX9 A;  2LQO A;  4NMU A;  2GT6 A;  1XZO A;  3I43 A;  3FK8 A;  1GRX A;  4AJ6 A;  4G2E A;  3EU4 A;  2YJH A;  2HT9 A;  2VCV A;  1USB A;  5G1L A;  4YAV A;  5G2Z A;  3MIX A;  3LWA A;  4K0N A;  1XWC A;  1SJZ A;  2ZUP A;  2IMF A;  1TW9 A;  1F2E A;  3WT1 A;  1O73 A;  2JZR A;  1TP9 A;  2WRT A;  3FEU A;  3UJ1 A;  1K3O A;  2X99 A;  3A2V A;  4MZW A;  5HFK A;  3WD6 A;  4JED A;  4ILF A;  2DJ1 A;  1EEJ A;  1U3A A;  1EGR A;  1YZX A;  4ZB8 A;  5AN1 A;  1PMT A;  2JL4 A;  4V2N A;  2WZ9 A;  3BOA A;  3R2Q A;  2BJX A;  2O7K A;  5KN2 A;  1EV4 A;  4TR3 A;  1KEB A;  3E3E A;  2QSI A;  1Z7P A;  3VWU A;  4BVY B;  1T1V A;  2D2Z A;  2LEG A;  4YAP A;  5GSS A;  1V9W A;  4G0L A;  4ICY A;  5JCU A;  3EMP A;  5F0G A;  3LQ7 A;  5D9W A;  1AAZ A;  2YP6 A;  1FG4 A;  4KW6 A;  2R2J A;  3ISO A;  3FW2 A;  3M0F A;  1T8E B;  4I5Q A;  3GUR A;  4FQU A;  6GSY A;  4BVY A;  1KTE A;  3FKF A;  1PL1 A;  4V1A g;  2YWM A;  4IGJ A;  1WPI A;  3D21 A;  5LD0 A;  2LRC A;  4L5O A;  2HSH A;  2LQQ A;  3E9J B;  1K0D A;  3TKP A;  1XW9 A;  3PPU A;  4PQ1 A;  1RW1 A;  4TR1 A;  3QAW A;  4O5U A;  2H75 A;  3RHB A;  1Z3E A;  3TKS E;  2VCZ A;  4ZXG A;  1J08 A;  3F6D A;  1AXD A;  1XVW A;  2A2S A;  2KP1 A;  1EEM A;  2DSA A;  4KUN A;  4X1U A;  3F3R A;  1M2A A;  3QPM A;  2WJU A;  5L71 A;  3CRU A;  5AIV A;  3Q18 A;  3F3Q A;  1ZGN A;  4WBJ A;  5IPG A;  4HOJ A;  4WEY A;  4EE0 A;  2OAC A;  3SWL A;  2AB6 A;  2CZ2 A;  2MZC A;  3BCI A;  4KCE A;  1MD3 A;  2H74 A;  1GWC A;  3EPT A;  3F4S A;  2O8V B;  3FR3 A;  2GTU A;  4POL A;  1SJI A;  3QFB C;  2FHE A;  2RUE A;  3IC8 A;  2J23 A;  1R5A A;  2R0P A;  2VO4 A;  1ERU A;  4FYB A;  3CSH A;  3A5I A;  3KZQ A;  1VF1 A;  4POK A;  4HI7 A;  2HSY A;  2HZE A;  5G5F A;  2C8U A;  2H0G A;  2JU5 A;  4EKZ A;  1K0A A;  2DBC A;  3FZ9 A;  4BA7 A;  5ECI B;  2LKU A;  2WUL A;  2IMD A;  2H1G A;  3DVW A;  2L4C A;  3M1G A;  4X4J A;  2K8S A;  5DAK B;  1SKW B;  4XRD A;  4NHW A;  3H93 A;  2WB9 A;  1XWK A;  1S3C A;  2QKE A;  4JU5 A;  3GFK A;  4PGT A;  1Z6M A;  5HFG A;  3HCZ A;  1TK8 B;  1I9D A;  1TI1 A;  2ALB A;  2IFQ B;  1J0F A;  1G0T A;  2M46 A;  1XPV A;  1SEN A;  2XBQ A;  4K1F A;  5AIX A;  1ZYE A;  1BG5 A;  2MYG A;  5ENU A;  2H71 A;  3EIN A;  3VWV A;  2H6Y A;  5ECP B;  3C73 A;  4K8M A;  5H5Q A;  5ABR A;  4POB A;  5B8B A;  4EL1 A;  1O8W A;  2CVD A;  3DWV A;  2DKH A;  4O7H A;  6GSX A;  5JWO B;  1VF3 A;  3GYK A;  2IFQ A;  4IP6 A;  4IQA A;  3F8U A;  1M9B A;  2CAI A;  1O6J A;  2YZH A;  1SL1 B;  2CV4 A;  3KXO A;  4KGI A;  4OFT A;  3UAP A;  3KD0 A;  7GSS A;  4TXO A;  1TKD B;  4KF9 A;  3TOT A;  1S3D A;  5ECR B;  6GST A;  1T7P B;  2JZT A;  3US3 A;  1K3L A;  4HU7 A;  5D9V A;  3C71 A;  4WET A;  2LS5 A;  2VAF A;  3M3M A;  3TJG A;  2QA2 A;  3VI7 A;  4YH2 A;  3CYN A;  2IMK A;  3FR9 A;  3ERW A;  2X8G A;  2AJQ B;  3ME8 A;  3TUE A;  3J7Y b;  3KP8 A;  1SL2 B;  1GNE A;  3IBH A;  3IHQ A;  4F2I A;  1XW6 A;  2AHE A;  3HZ4 A;  2XBI A;  5D9X A;  2L57 A;  3L9V A;  4L0W A;  3VFI A;  4I97 A;  1SU9 A;  1SYX A;  3C8E A;  2FCH A;  4E8E A;  4ML6 A;  4TN8 A;  2VL2 C;  4PUA A;  4L8E A;  3U5R E;  1IYI A;  3ZML A;  1PL2 A;  3ZRD A;  1HNB A;  5IMA A;  2PPT A;  4ZIL A;  1B48 A;  1MDK A;  2VM2 A;  3FMW A;  4OFN A;  3ZL5 A;  4MDC A;  5F05 A;  1H4O A;  5IMZ A;  4HZ2 A;  5JWQ B;  4HZ4 A;  4K6X A;  2KUC A;  1ACV A;  2X8H A;  2OA7 A;  3IDV A;  5CNW A;  1QUW A;  5KOW A;  1WRY A;  5B7C A;  4LL1 B;  3EE2 A;  4TOP A;  1B8X A;  2VCT A;  4ECB A;  4RQR A;  3D22 A;  4JBB A;  4KSM A;  5IIZ A;  4IJ3 A;  2AUV A;  4G0I A;  4KAE A;  4AJ7 A;  3EUR A;  1AC1 A;  2PMT A;  1QMV A;  2F8F A;  1G7E A;  4HS1 A;  4XS4 B;  4QL9 A;  4YKF A;  1WOU A;  3TGZ A;  3IHG A;  5LCZ A;  2FGX A;  1UC7 A;  3RDW A;  4LA1 A;  3IK9 A;  1T4Z A;  5IQY A;  3IR4 A;  2M80 A;  3IPZ A;  3MYD A;  2A2R A;  1GSE A;  1JZO A;  5ECL B;  5EPF A;  1V2A A;  1ZOF A;  1F3B A;  2L5L A;  4YQM A;  1Y25 A;  2V2G A;  4DEJ A;  1DE1 A;  1EGO A;  3GHA A;  5GZZ B;  3LEF A;  2FD3 A;  2KOK A;  3I9V 2;  3RPP A;  1A0F A;  5ECO B;  3DML A;  4RQX A;  3P8W A;  5CRE A;  4AF2 A;  2NVL A;  2VL3 A;  4KDY A;  1J9B A;  3HYP A;  1PX7 A;  5KEJ A;  2LTK A;  1SJ6 A;  2R4V A;  1GLP A;  4GSN A;  3AY8 A;  2HRF A;  1DBY A;  4WR5 A;  4WF4 A;  1XOA A;  4HQS A;  1XXU A;  1BED A;  1YJ6 A;  3LSZ A;  4NAX A;  3TOU A;  1GH2 A;  3EYT A;  1Y6E A;  4HQZ A;  3Q74 A;  5H5R A;  1HNA A;  2RM5 A;  3GL3 A;  2N5B A;  8GSS A;  4DSS B;  1FW1 A;  4X43 A;  3CSJ A;  2C0F A;  3RHC A;  5A4W A;  3D6I A;  4XHM A;  4D73 A;  2R3X A;  2ZNM A;  11GS A;  4PQI A;  1OC9 A;  1T4Y A;  1FB6 A;  5C00 A;  3VI5 A;  2P5R A;  4IW9 A;  2OE1 A;  5IOW A;  2QGV A;  1ERV A;  4EIQ A;  2X8C A;  1OE8 A;  1V57 A;  2VL2 A;  1B9Y C;  3QCP A;  4AJ8 A;  1GUK A;  5G30 A;  4MF6 A;  2HE3 A;  2REM A;  3TB2 A;  1FOH A;  3KTL A;  1NHO A;  4MZB A;  1K0O A;  1WMJ A;  3F9U A;  1WJK A;  2HSM A;  3TJJ A;  1EP7 A;  3LYP A;  1TRS A;  1FVJ A;  3HVS A;  4MPG A;  1TI3 A;  2PER A;  3KP9 A;  5IPH A;  2V6O A;  3IXR A;  5J9C A;  1SL0 B;  4MK3 A;  2E7P A;  3CSI A;  4YQU A;  1HD2 A;  2KLX A;  4HJM A;  1SD8 A;  3E0U A;  4N10 A;  4XTS A;  3IA1 A;  1T3B A;  1HYU A;  1VRS D;  9GSS A;  3ME7 A;  1OKT A;  2WCI A;  3UVH A;  4HJ2 A;  2I4A A;  2VCW A;  1VGL A;  4OFM A;  1JHB A;  3NZN A;  2ON5 A;  5GST A;  3EMX A;  2OJL A;  1JLW A;  2H0I A;  1U6T A;  2P31 A;  3PH9 A;  3LG6 A;  1BJX A;  1S3A A;  2NPB A;  2B5X A;  3GTU A;  3N9J A;  3ZVJ D;  1XWA A;  2K8V A;  2H1A A;  4MLY A;  4EDZ A;  1OAZ A;  2HYX A;  2ON7 A;  3KEB A;  3ZTL A;  2AYT A;  1X9M B;  2FWF A;  2YWI A;  3LJR A;  4DSR A;  5DJL A;  1V40 A;  4EIP A;  5ECK B;  5A4V A;  1AW9 A;  2JZS A;  4ISD A;  1LU4 A;  5B6M A;  2HZF A;  4K9Z A;  4K5S A;  5A5K A;  4MZC A;  4WF5 A;  4NHZ A;  2R0C A;  5J5N A;  1H75 A;  3IC4 A;  2YJ7 A;  4TR1 B;  2B7J A;  2G0F A;  3NOF A;  5D96 A;  5CRG A;  2MMZ A;  4BPY A;  2JSY A;  4GRF A;  1T00 A;  3ZYW A;  1A8Y A;  5KN1 A;  16GS A;  3L9S A;  2DIZ A;  5B6N A;  2H66 A;  1TRW A;  4Z7X A;  1V98 A;  2LJR A;  4IN0 A;  1THO A;  4JZQ A;  4KDX A;  1AQW A;  1PN9 A;  4EVM A;  1C72 A;  1AQV A;  4Z2R A;  3TKS C;  4YKG A;  1G6W A;  2WDU A;  3LFL A;  2GST A;  1UA5 A;  1YKC A;  2MBT A;  4N0Z A;  1B9X C;  1XVQ A;  5DJM A;  2FUG 2;  1M7T A;  4OCE A;  2FA4 A;  5F8B A;  2HZE B;  1XCC A;  1ZYN A;  4K7O A;  3EU3 A;  5JCG A;  1TK0 B;  1SYR A;  1GTA A;  5HR1 A;  2NBS A;  3QAG A;  2X64 A;  2JSZ A;  2HRK A;  1AQX A;  1U88 A;  2FLS A;  5ECN B;  1GTU A;  5D93 A;  1AUC A;  3CBU A;  5DVB A;  4F03 A;  1K0B A;  4ECI A;  3BCK A;  4TRX A;  2H72 A;  3H1N A;  3KH7 A;  3GH9 A;  3K8N A;  4MPF A;  10GS A;  4TW5 A;  2QC7 A;  5CO3 A;  5DDL A;  4MF5 A;  3GIX A;  3HD5 A;  2V6K A;  3IOS A;  3GMF A;  3LGC A;  5E59 A;  1F6M C;  5CRW A;  1XBS A;  2A4V A;  2I3Y A;  3P2A A;  3F4T A;  5D9T A;  1Z7R A;  2C3Q A;  2N5F A;  5FHI A;  2TRX A;  4GTU A;  1U3I A;  3RAZ A;  4GXZ A;  1SK1 A;  2YV9 A;  2DJ0 A;  4PUF C;  1GSS A;  1M9A A;  2PBJ A;  2H1D A;  1UVZ A;  2IL3 A;  5CYY A;  2VLT A;  3ZMK A;  2LST A;  4E8H A;  4RI6 A;  3TKR A;  1O81 A;  4GWR A;  2B6M A;  12GS A;  1ERW A;  5IM9 A;  4MH3 A;  4ZL7 A;  4NWY A;  1TU7 A;  4TXO B;  2P5Q A;  2GDR A;  1FHE A;  4F82 A;  2FNO A;  3QR6 A;  3VUR A;  4PXO A;  4KH7 A;  2H19 A;  4XIH A;  5ECS A;  1VF4 A;  4YQV A;  1PKW A;  3L78 A;  4HEA 2;  2G2Q A;  4Q5Q A;  4ULX A;  2XPD A;  5INY A;  2LJA A;  4TVE A;  1SK2 A;  3VK9 A;  4K7I A;  4GCI A;  5ECH B;  1A2J A;  3HVX A;  1GSD A;  1EP8 A;  4ZBD A;  3KIJ A;  1M2B A;  5AIS A;  2VLU A;  4OO5 A;  5EL8 A;  3ED3 A;  3GUS A;  4NV5 A;  4L0U A;  2HXK A;  2XPE A;  5GAN D;  2X49 A;  1HNC A;  1THX A;  2DMM A;  3SBC A;  3TKS A;  4ECC A;  3DXB A;  1V58 A;  3HJO A;  3ZIV A;  4G0K A;  4OMV A;  2DKI A;  1DE2 A;  4MF7 A;  2IN3 A;  3APQ A;  5ELG A;  3N5O A;  5ELA A;  2IMI A;  2IWT A;  4IKH A;  3HDC A;  1WIK A;  3KJY A;  2UZ8 A;  2YV7 A;  1JLV A;  2O85 A;  3MSZ A;  4EO3 A;  4F0B A;  4EUY A;  2H8L A;  2RII A;  5CRD A;  2V1M A;  1A2M A;  1E2Y A;  1PX6 A;  1YEP A;  2OKA A;  5B8A A;  3JCM L;  1K0N A;  5H5S A;  4P3Y B;  3GN3 A;  6GSS A;  1OC3 A;  2VOC A;  2R37 A;  1XWG A;  2E2G A;  1IYH A;  4GLT A;  2LNS A;  2FWE A;  1PKZ A;  2LJK A;  2GZY A;  3F0I A;  4K5R A;  1B4P A;  4J2F A;  3IV4 A;  2LRT A;  1EZK A;  1I5G A;  1BQ7 A;  5EVO A;  5FT3 A;  3TRX A;  1RK4 A;  3A3T A;  1PGT A;  1YKA A;  4G10 A;  3GST A;  2JAD A;  3UMA A;  2WS2 A;  2GVP A;  1MDI A;  1X5C A;  5HR3 A;  4WR4 A;  3ZLP A;  22GS A;  3IRA A;  2PGT A;  2B5E A;  2A4H A;  2P0G A;  6GSW A;  2PN8 A;  1TK5 B;  3CTF A;  2KP2 A;  4USS A;  4N0V A;  4EC0 A;  2I1U A;  3H79 A;  5ID2 A;  5EY6 A;  5COH A;  4KA0 A;  3WT2 A;  4ZIJ A;  2VUP A;  1FVK A;  3ERF A;  1LJR A;  1FAA A;  4ECJ A;  3IAS 2;  3MWH A;  20GS A;  4DVC A;  3MNG A;  1E6B A;  4KDU A;  2BMX A;  4MJC A;  3FZ5 A;  3H4K A;  1F37 A;  1AIU A;  3WGX A;  1ST9 A;  1X0R A;  4CY8 A;  3HHV A;  1OVN A;  5D8I A;  3DGQ A;  3UL3 A;  4EXJ A;  1XWB A;  1GUH A;  1PSQ A;  4CW9 A;  17GS A;  3QOU A;  3IE3 A;  3UAR A;  4D73 B;  3APS A;  3C7M A;  4IQ1 A;  2YZU A;  1GTB A;  4MA9 A;  1OC9 B;  4EDY A;  4FO5 A;  3GX8 A;  3PR8 A;  5BMU A;  3QDN A;  6GSU A;  3KCM A;  2GLR A;  1GL8 A;  1GSF A;  2DLX A;  4IS0 A;  3IK7 A;  4MH2 A;  4Z2T A;  4DSQ A;  3WYW A;  3FHK A;  6GSV A;  2DML A;  1JZD A;  3EWL A;  5JCW A;  3A2X A;  3D5J A;  3FY7 A;  3KM6 A;  2LUS A;  1OKD A;  1GSU A;  2GS3 A;  4I2T A;  4I6X A;  1TRU A;  3A2W A;  3O3T A;  4ZB9 A;  5DAL A;  5DCG A;  5IMC A;  3Q19 A;  2MMO A;  1YY7 A;  1VF2 A;  5KN0 A;  1Z5Y E;  2XC2 A;  3DD3 A;  1MEK A;  2R6K A;  5E4W A;  1R5P A;  2VLV A;  3UBL A;  2IJY A;  1EV9 A;  1JFU A;  1SK0 A;  4PNF A;  5AGY A;  1N2A A;  4I2U A;  1A23 A;  3BJ5 A;  4PQH A;  2CVK A;  1PA3 A;  1XW5 A;  3DKS A;  2C3T A;  3APO A;  4PNG A;  3G7I A;  4OO4 A;  1X5D A;  2PU9 C;  1W4V A;  14GS A;  1PN0 A;  2H70 A;  1GSY A;  2YWN A;  4ACS A;  4MP4 A;  1WWJ A;  1TRV A;  2PVO C;  2GZP A;  3GTU B;  4NV2 A;  1R26 A;  1K0M A;  1TTZ A;  5DCH A;  5G5E A;  2DC5 A;  4BL7 A;  2A2P A;  1TOF A;  13GS A;  5IMD A;  2MMA A;  1F3A A;  2N5A A;  2MMN A;  1GP1 A;  2H76 A;  3GL5 A;  3HZ8 A;  1MD4 A;  4AGS A;  1ON4 A;  2VIM A;  2DJJ A;  4F0C A;  4JR6 A;  3D4M A;  5IO0 A;  4O5Q A;  2VCQ A;  3TCO A;  3GA4 A;  3WGD A;  2ZCT A;  2HRA A;  4O32 A;  5LNK e;  5BRT A;  2BTO T;  1O8X A;  2WFC A;  2CQ9 A;  4KE3 A;  5IO2 A;  4K7N A;  2HLS A;  2YWO A;  2GT5 A;  2YAN A;  1QXH A;  5GAP D;  3TDG A;  3VPQ A;  3L9U A;  4WXT A;  3GH6 A;  2YOI A;  2HNL A;  5IMF A;  3FZA A;  3MDK A;  2PVQ A;  1EOH A;  3FZ4 A;  2TRC P;  4FYC A;  2B5Y A;  2F9S A;  2Z9S A;  3ERG A;  3VWX A;  2RM6 A;  4K0G A;  4GST A;  4IJI A;  3HJM A;  4L5L A;  1GLQ A;  2L6D A;  1FOV A;  4WKW A;  2DJ2 A;  2OAD A;  3DRN A;  3G7J A;  3EC3 A;  3P90 A;  2OE0 A;  4N30 A;  2VD0 A;  2GSR A;  1NHY A;  2YCD A;  2NDO A;  1URM A;  2K9F A;  4IBP A;  1X9W B;  2GQM A;  1TDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...