1BQEA

Ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly (t155g)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE
publication title Probing the determinants of coenzyme specificity in ferredoxin-NADP+ reductase by site-directed mutagenesis.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 87
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1bqeA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1bqeA02
5HXBA 1E62A 2BGIA 3MCAA 4K1XA 1W2BB 4TMVA 1Q81D 4RD3A 4ZGQB 1R5OA 3LVBA 2VNIA 1S72B 2QDXA 3P26A 4ZCIA 4TMTA 4N3NA 2YWEA 4RD0A 1JA1A 5GV8A 2QEXB 3OZVA 3W2HA 3AVXA 1IJFA 2BSAA 3V76A 5H59A 3CCEB 4RD1A 4B48A 3WY9A 1EXMA 1KK1A 4M4SA 3QFSA 4ZCMA 4FN5A 2PMDA 1G7TA 4C43A 1EP1B 1OB5A 3CCMB 3E1YE 1GAQA 1FNCA 1DG1G 1AMOA 1JNYA 1ZM4A 4ZGNB 1YHQB 1KQSB 4G1VA 1HA3A 2CRVA 3G71B 2D74A 3ZZTA 5DSZA 4TMXA 3VNUA 3CW2A 3CRZA 4EH1A 3I55B 5THXA 3FPKA 3PENA 4RCYA 1NDHA 2DCUA 1KK0A 1GO2A 2VNJA 5TV2A 3CCJB 3LYUA 4RD4A 2BN4A 4U9UA 4UAJA 3CCQB 1TUIA 1B23P 3VO2A 5AN9A 3I1FA 2BM0A 1K73D 1GR1A 2B7CA 2XNJA 4DQLA 3B78A 1OGIA 1FRQA 3W2EA 3VNVA 4H9GA 4G1BA 1ELOA 4AF6A 1EP2B 3ZC3A 1KD1D 4IW3B 1DDGA 4AF7A 3CCLB 2DETA 4TMWA 1VQ5B 3CC2B 3AVTA 4M2LA 3SJZA 1QGZA 3G6EB 1D8TA 1SKQA 2GQFA 4FWTA 2YWFA 1D1NA 2HCJB 4YALA 4YAWA 1JB9A 2HDNB 1KTVA 2QN6A 4PC7A 3ES9A 1GJRA 1FNDA 3CC7B 3CCVB 2C77A 1B2RA 3JQQA 2VYQA 3AGPA 1BJKA 4LBZA 3QSYA 1G7RA 3CCRB 1Q86D 1VQOB 3ZZUA 1YJ9B 3OZUA 3U6KA 3WNDA 2B7BA 3OJWA 1H42A 1F60A 3CMAB 3B82A 1FNBA 3J81k 2E1RA 4PC2A 1ZM2A 1QG0A 1TTTA 1KK2A 1BX0A 5TY0A 1BX1A 1KRHA 3CPWB 1QVGB 1Q82D 1DDIA 4YAUA 2BV3A 3ZBUA 2ZITA 1J9ZA 4TMZA 2OK7A 3ZZ0A 2VNKA 3W5VA 1M90D 1QVFB 1VQ6B 1A8PA 1K9MD 4LBYA 2XNCA 4C0SA 1SM4A 4LBVA 1G7SA 2OK8A 3OZWA 1N0UA 3AGQA 5EMNA 5TR9A 3LRXA 2PIAA 4ZV4A 4R71A 2VZLA 1WDTA 1EP3B 4Y7CA 1TLLA 2DEUA 3U6BA 1W87A 3AVVA 1CNFA 1VQ9B 1W35A 4PC6A 4LC0A 4RD2A 2YWHA 3OW2B 5JBQA 1QFZA 3CC4B 1U2RA 3U2QA 1VQNB 4Y9UA 4FK8A 3G4SB 2BF4A 2HMAA 1EFCA 1FDRA 1N8RD 3FJOA 3QFCA 4BPRA 3CB4A 1F20A 1FRNA 3A1FA 4QFMA 1YJNB 1YJWB 4P6VF 1VQ4B 3WBKA 4Y9RA 1VQPB 4Q7JB 4M1KA 1IJEA 3E20A 1AIPA 4QHYA 1EFUA 1D2EA 1VQ8B 1N0VC 1VQMB 1QGAA 1EWYA 1QH0A 2BM1A 4B47A 2CNDA 4J0QA 4PC1A 4M53A 4MYTA 4WQMA 1R5BA 1NJID 2RC5A 1E64A 2GPJA 1VQLB 3QE2A 3I56B 1GAWA 5GV7A 2RC6A 3OJXA 2QA4B 4B44A 1UMKA 2NPFA 3CCUB 3B8HA 1CQXA 2QTZA 4PC3A 1DARA 1XB2A 3WYAA 1EFTA 2FX3A 2J7KA 3MMPA 1Q7YD 1KJZA 2AHOA 5H5JA 2BGJA 4YAOA 4NBSA 3W2GA 4B4DA 3ZBTA 4B43A 3CD6B 1W34A 1KC8D 3AVWA 3MHPA 1YIJB 1QGYA 1QX4A 2R6HA 2QMUA 1G7CA 1IB0A 3QFRA 3W5HA 3AVUA 2OTJB 4ACBA 4HE6A 1QFYA 1CNEA 1E63A 2QTLA 3LO8A 4PGOA 4B3XA 1YI2B 4ACAA 1QUFA 1ZM9A 4ZCLA 4LBWA 4P3YA 5FA6A 4RCZA 3VMFA 3WNBA 2EIXA 1FNMA 3W2IA 3JQPA 1M1KD 1XE1A 4AC9A 1OGJA 1QFJA 1S0UA 3W5UA 2BMWA 5KSWB 3P27A 2EFGA 4YHBA 4TN1A 1QUEA 1YITB 1VQ7B 4N3GA 2B5OA 2BVNA 2DY1A 4M0LA 4NCNA 1K8AD 3WBJA 4F7DA 1OB2A 3CXCB 2OTLB 3AVYA 3QFTA 1BQEA 2X3UA 1ZM3A 4MYUA 3CMEB 1H85A 2VNHA 2DERA 2PLFA 1KK3A 4RJLA 1ZUNB 3W2FA 3CCSB 2YWGA 1VQKB 1TVCA 2BPOA 1JA0A 2C78A 3WNCA 1GVHA 1R5NA 3JQRA 4YAFA 4HE5A 3VO1A 1I7PA 2XEXA 1JJ2B 4G5GA 4RD6A 4DQKA 3WXMA
chains in the Genus database with same CATH superfamily
2H1WA 1MUUA 3TI9A 5KKCA 3FGPA 4HDNA 1GQ2A 3N0XA 4K1XA 5CCBA 1U9ZA 2QYHA 2RBGA 1KR5A 4TMVA 1YB6A 2FUNB 3NBAA 2DT8A 2H2WA 2OZVA 1LK7A 3Q72A 4NPAA 4RQTA 2BEVA 4BRWA 3N2LA 5EOVA 3QQ5A 4KKTA 2JGLA 4HAXA 4LCJA 3EG9B 4Z8YA 4G0WA 2P3QA 3NIFB 3LVBA 2PKWA 2UVDA 3T95A 1VDZA 1J23A 1E9CA 4M49A 2OUIA 3H2JA 4TMTA 3TQRA 1Q0UA 2ZWPA 2YWEA 1VPVA 2AOWA 2BHRA 4RHEA 4UM5A 1NRKA 5GV8A 3K5WA 1XRNA 3A28A 3PEWA 4QASA 2I6QA 2GASA 3N0WA 1TRHA 4NV0A 1W36D 4B3TB 1IJFA 1NAHA 2ACKA 4B3HA 3FMIA 3LY9A 1YR6A 4EKGA 3WYCA 3K2IA 2MT9A 1KEWA 3DEIA 3GAAA 8ADHA 3GNTA 3FI0A 1CUSA 1YMUA 3UM9A 4FN5A 4NAHA 3VPSA 1BKSB 1X77A 1QYDA 3VR5A 1P1CA 3D6TB 3D7RA 2O2CA 3NP7A 4W5JA 3DCNA 1WZEA 2JZOA 4OU5A 2ZPTX 4V0RA 5KQLA 4KGDA 4BO8A 1BIFA 4JUAA 2XYRA 2YV4A 5B58C 1WB9A 3BDIA 4RZ2A 3A1PA 1U7ZA 2DIEA 2JI8A 5MF6A 3RTGA 1TCCA 1UK7A 3EF0A 3SPXA 5CTAA 2E4XA 2PEZA 4OGFA 2J0EA 4O3MA 4NIMA 5DI9A 1U3WA 1X7YB 2QX7A 3AOGA 3SC2B 3L7IA 1DXHA 1RAHA 1Y3DE 4MUAA 5CX4A 2B30A 3TS1A 1DELA 4GPTA 4M36A 4TV8A 2CT8A 1ZXXA 2X14A 4Q3CA 1JMYA 2I3ZA 1DT3A 4HLCA 4G1VA 1PX0A 2BL4A 2PIDA 2V7XA 5FPSA 2NV0A 2P67A 2WIJA 2F64A 1NXQA 1ODLA 2BKLA 5K3SA 1DAMA 2B1JA 1PJ3A 3JWHA 5K3BA 1DCMA 3W4IA 5A5GA 1KRXA 4BLOA 1A2BA 4CFZA 4PX9A 3AYZB 2Y4NA 2BC9A 3N8DA 4XCXA 5JZBA 1QVZA 1R9JA 3H05A 4DRXA 4IKEA 1FTGA 5HIJA 1U7XA 2MSNA 4RDIA 2XX3A 4QUDA 3SQXA 3LLCA 5JI2E 2I2WA 1WEHA 4N5DA 2WYWA 3AUTA 4KPUA 5B55A 3C8MA 2DU8A 2WKRA 4UQOA 2LP4Y 4M0CA 2NU7B 4FD2A 1TFUA 5DN9A 2EDAA 3COZA 2I6GA 3STHA 3OZ7A 4YXWA 2X2EA 4ZVQA 4XQEA 2ZXUA 3EWIA 3KUKA 5L6LB 1SXJC 2ISSD 2D00A 2R6DA 3IPLA 1ZK0A 5ITWA 1GLNA 1MAUA 2RGEA 3G7UA 1E2LA 4W8OA 4XD7A 5LB4A 1GGNA 2D1YA 3G88A 1I5RA 2K6GA 3GJSA 2X76A 3LVFO 4JJ4A 4LTMA 1XLVA 3NHSA 1WSAA 4O4HB 2IEDA 4D98A 3TKAA 5T57A 1NBIA 1RJEA 2IEIA 4D4MA 5TGDA 3ZDYB 2CE7A 3BF8A 1R0ZA 3E7FA 2CLFB 4MTCA 3H86A 1UZLA 1ZU4A 2OZLA 2NZVG 3I1IA 2BDEA 3QUCA 4JQSA 221PA 4KXQA 5KPJA 1L8OA 1N6NA 4F56A 2R4TA 1XNRB 3BKXA 2ET6A 3OY2A 4L9WA 2F1HA 3MOGA 3FUXA 1E20A 4J0HA 3H99A 4R2HA 3ZXUB 2DETA 1X1RA 3IP8A 2ECFA 3AVTA 1VRVA 2QOEA 3MCVA 1LS1A 5H82A 1DTSA 4ARAA 4BP8A 5K0ZA 2XCQA 3I12A 4P2BA 1KJNA 3KQNA 4ILKA 4IXMA 4RDLA 2B37A 1MOQA 4OSEA 3SDSA 1XNGA 2M98A 5ALEA 3SIRA 4AJIA 4PCLA 4BVEA 2BP7B 2JH9A 2O1WA 2NM0A 3CIFA 2DFVA 3D59A 3HG7A 2HQ1A 1CY7A 3M1LA 3D3QA 4GM0A 3GJ5A 4HH3C 4TSRA 4TVOA 5AVJA 1XD9A 2ZZGA 2PJRA 3ICOA 3NAQA 4OHUA 3LPCA 1Z39A 1XRQA 3EDQA 2HDNB 3ASTA 1FB5A 1OA0A 1MMFB 3NBMA 4JDUA 3WVNA 2RI6A 4CKXA 2FVYA 5B36A 3ZWDA 3CTAA 2NNWB 3DP9A 4YRBA 2HC9A 3MQ2A 2ALJA 4PPGA 3E15A 3Q3GE 4IR7A 3AJ8A 4LW8A 3BTVA 2K7ZA 1LGYA 1JHPA 4JVMA 3L0PA 3AF1A 3L4JA 2WT4A 2UYQA 4E32A 1K86A 1H3FA 1ZMBA 1E9BA 2PUVA 4W5TA 4DR3B 5JROA 2AG1A 3Q2KA 4MB0A 1PZNA 1WCIB 1YGYA 1YI1A 1S4QA 1VGRA 3RUHA 2FMHA 2FN9A 4A8HA 1XZIA 2G9UA 3U7EB 3EQ6A 3FVVA 3W6NA 1T1SA 4HNTA 4E51A 1Q6ZA 4RKYA 4DWJA 4LHXA 4BJ5A 5BURA 1EFVB 3M4XA 1GGEA 3OP4A 4QDTA 4LYJA 4UVDA 5A0FA 4YV0A 1TE2A 2GN1A 3MEQA 4FSHA 1QRSA 3I4FA 2A0UA 4IILA 1BEUB 2NQTA 4O0MA 3ZIDA 5F1YA 5HA5A 3H75A 3NTLA 5ECWA 1GCGA 1BWSA 2HT1A 3FSGA 3ULKA 3SQWA 1MH1A 1I9CA 4CLRB 3UGTA 4OHVA 1G5QA 5DTJA 3T3OA 2QL6A 2EERA 1E79D 2FE4A 4F4JA 4PLYA 2WTXA 4CM4B 1F2VA 2H29A 3LHDA 4K6HA 4OY3A 3VJLA 4DCTA 5CITA 5HM6A 2C8VA 2VVTA 3MPUA 3P0IA 3QEKA 4XB1A 4WKOA 4JASB 4PYRA 3UT5B 4M6WB 1OFIA 3QELA 1LC0A 1SU8A 3BQMB 5FF9A 3ZBQA 1XZMA 2EXXA 3A2LA 1H6CA 2CCGA 1VPTA 1Q16A 3IMKA 1YRYE 5E6SA 5EZ5A 1NPDA 4DR6B 1GP2A 1QIIA 2I4RA 1EUZA 5ALOA 2JLRA 2RARA 2VBVA 4EVQA 1DS6A 3O0TA 1G38A 4KXYA 1Z2CA 1RWNA 3AHHA 2RHTA 3EWAA 1H8HD 2GZDA 1P2UA 1XNJA 4OUDB 4QVKA 2OBSA 2CFCA 4N76A 3S6JA 5KWIA 2XD4A 1FMLA 2ZCVA 1SZJG 3S7TA 1V0JA 4MSUA 3V32A 2BV3A 4C5BA 5AVWA 2I9KA 1SMKA 1Z6GA 3QX7A 1PR6A 3PNMA 3KQVA 5HZHA 4XYBA 5D5PA 4WWHA 4CZ2A 3HHPA 5JNRA 3PUMA 3HKDB 2V7WA 3RARA 4PPFA 5JE8A 3SHOA 1ZIXA 2XQJA 3TR6A 3IUJA 1QP0A 2FSFA 5K8CA 3VHRA 1JG7A 4FE3A 1GXSA 3PV0A 1XE3A 2ZTLA 4FGSA 3C6ZA 5EVJA 4B33A 1MRZA 3B6MA 3N1UA 1NUSA 3NTVA 3WIBA 4CKCA 4TS9A 4F0JA 1BVHA 4IVNA 4RABA 1JEJA 3E05A 1L1EA 3E9EA 2HBRA 4E5PA 2J31A 3SF8B 4LZZA 3ZQ6A 2ZJFA 3WKEA 1BVRA 1J1IA 2G4CA 3Q7RA 1KJJA 4FQ5A 5CB4B 4XSVA 1F12A 4HEJA 3QF4A 4X41A 4GXTA 1N5IA 1YFKA 5U4QA 4BP1A 3WGVA 1HQYE 5LZ5A 3THWA 1TLLA 2KPOA 3AW8A 3VXKA 2HSWA 3PYMA 4CE6A 1Z2NX 1FYFA 4DIDA 5KHLB 1GKLA 4JJAA 3FPAA 2PV7A 3B38A 4AECA 1WHSB 4UNNA 5FKJA 2CNKA 3AVPA 3V1UA 3VC7A 4A03A 2IBSA 2YWRA 5CVDA 1NMXA 2WHRA 1W35A 4B2IA 3OBBA 4D9KA 2GCIA 4E4YA 1WVIA 2FFBA 2QROA 3A58B 4X44A 2B69A 1SC4A 2YWJA 1U2RA 1OZFA 3GEEA 3HRKA 4AJPA 3MWGA 4NEHB 5DM1A 2R751 4XFJA 1DQRA 1A4RA 5BSMA 3GUVA 4GNKA 4JBYA 1ZUHA 5AXDA 3CRVA 5T67A 2HQRA 2GN4A 1ZD3A 2X4LA 3EDCA 4RJTA 1R5JA 3FSJX 2ZB8A 4BNDB 1DBSA 2RHWA 3PNLA 2ZYAA 3WMWA 3RS2A 3VDNB 1G16A 2IUSA 2QS9A 5CW2A 2IUEA 1F20A 1UDRA 3SD7A 4DPKA 2QL5A 2ZI6A 4MARA 1UWVA 2X77A 4KGVA 2OLEA 2Q8NA 4QFMA 5BVHB 3P9XA 1JECA 4D79A 4P25A 4HH4A 5IKXA 2JGIA 1H9AA 1IY8A 2P77A 2NZ2A 3P52A 1C4XA 3I9FA 4L0QA 3DW1X 1V1MA 5FPTA 2EFJA 2QPTA 3N8NA 3U40A 1TKBA 1ZI8A 3WRXC 4ARBA 4IP0A 5FIUA 1F8UA 1ZISA 4GXNA 1PG5A 4QPDA 4TRMA 1RIFA 4GLOA 5LWHA 1HURA 5KNCD 1JDUA 1P45A 1GSHA 2W43A 2WD7A 4G85A 4QRDA 2IC5A 1FTQA 2J5KA 4YRPA 1XUOA 3CLKA 2ZSUA 3H18A 1TTQB 1UOQA 3LBFA 4YCJA 4A0SA 4Z5XA 3BMQB 4OIMA 2ZWIA 3A4TA 1J4AA 1BEZA 1LPMA 1HFWA 2BFMA 4LI3X 5I7OA 2P3LA 4LK3A 3VISA 2ARKA 3AHDA 5BT8A 2XODA 2Z56A 4TLEA 3NHFA 3ADBA 3T0IA 1CUGA 4XUCA 4W9RA 3WLEA 4B2LA 2C7PA 2MSCB 5KNLA 2WTMA 4UNIA 5BMVA 2PQMA 2ZRHA 4L50A 5FH9A 3WBBA 4C4AA 2RGUA 2DF8A 3LGSA 4BCDA 4DABA 3N5KA 3TIFA 1NJ6A 2I3BA 3V2UA 3GW8A 4PHGA 4K03A 3GL9A 5JPIA 3ZWPA 3CCUB 4IDQA 1H05A 2HDHA 1PGOA 3R40A 4ILEA 1IBRA 4WNAA 4IOLA 4F84A 4Q7EA 1JPUA 3RFVA 4RGBA 1UFVA 1UEIA 2KLHA 3L8YA 4NESA 2FUCA 1QYIA 3HKBA 2DLNA 3A7EA 1L7PA 2ZYIA 5U9CA 2O2GA 4RVCA 2PA3A 1Z6TA 3QEMB 2GD6A 5J35A 1NZJA 5HJ7A 3OZXA 4KXVA 2AHOA 2FF5A 4NRDA 2GHIA 2I22A 4F46A 5K4HA 3LQ4A 3TEFA 1Y82A 4NBKA 2IU0A 2F1JA 3MBOA 1RJDA 4QO8A 2EKLA 4AKHA 3FY4A 4YCBA 4E46A 1QX4A 4QHTA 4RVDA 4F04A 2C0PA 3UY4A 4WTOA 3A9UA 4BWYA 5EPEA 1HMPA 1XGKA 2XXBA 1D2CA 1WOYA 1A98A 1G3IA 2CHVA 2DFLA 2VWGA 1RTKA 3EXIA 1TI7A 2C4UA 1W8IA 1XA4A 3T5GA 4AWAA 2V74B 1E6KA 3KHKA 1IEXA 4M9QA 4ZVSA 4TKLA 1XEXA 1MXFA 3CZPA 5E2BA 4B0OA 4YFVA 2CL6X 1T9DA 1UP4A 1RCUA 3IESA 4I66A 5GGXA 3RC1A 4DYHA 5HHTA 1UMDB 3PFIA 3RK1A 3IRVA 4BFSA 1WW8A 3SX0A 5JCXA 1OOEA 5K3FB 1GFIA 2EJWA 4LYAA 4IIBA 5FAXA 2JF0A 3ZJVA 1ZM9A 1WZ2A 1YFJA 1OYOA 4MJ3A 2L42A 1GTRA 1VIAA 1HY3A 4JKYA 5HG0A 1XD8A 3K1ZA 3O74A 2EIXA 2PL9A 2Z5FA 4HWSA 3B60A 3SC2A 5GIPE 1EIZA 2GH1A 2IHBA 3RRZA 2HZ7A 4IQ0A 4FEGA 1XE1A 3LC1O 3F46A 5DXFA 2NVUA 1PR5A 3F6BX 4YMWA 4DXHA 1J90A 4QDKA 2A5DA 2ZJ4A 3EFHA 3W5UA 4IJMA 3I23A 1RWXA 3U3OA 5JJCA 1XVAA 4C0QC 1N6IA 1R64A 3OW7A 2ZBGA 1ZYUA 2XQFA 2XF8A 3P27A 2YUTA 3RSFA 3NONA 4W63A 3TLBA 1V95A 4TN1A 1WBBA 1LW6E 1RBMA 1BDIA 3A05A 3IKLA 5CYOA 4ZRDA 3T5BA 3PXEA 1D6JA 1W4AA 3SY8A 5D7BA 1HDCA 1HM5A 1ZMTA 2OVFA 4LE0A 4RKFA 3EDOA 1H8ED 3DV0B 4HT3B 4YT4A 1Z08A 3S29A 4DA8A 4RH0A 1T0PA 2FR0A 2GB4A 4JEMA 2E0IA 1RRCA 1C1YA 3RANA 3G8AA 3BM5A 4J3JA 2XDQB 3BOSA 1A8SA 1JQDA 1RNLA 3Q6QA 1DHTA 1VIVA 2DY1A 2CNOA 1YS9A 2ZTNA 4FZ3A 1FIUA 1MA0A 3HCBA 2DTDA 2BMDA 1YVDA 5C5EA 4F7WA 4GXQA 4W1PA 1XLWA 5LIRA 3Q3VA 2G7ZA 3CXCB 1IZ7A 1F2DA 3AUXA 2IE8A 2UYYA 4PQYA 2J0UA 2Y1WA 3PE3A 2VXYA 4JJKA 4N8SA 2WWWA 1SPXA 2EU8A 4QPCA 3WWEA 1U4OA 1UKEA 2VZ0A 5E3IA 2I80A 4Z7OB 2ZBDA 4M3NA 5K8LA 1Z29A 4J7XA 4B73A 2C94A 2O3JA 4OAOA 1OI2A 1C8LA 2DUWA 3EVCA 4Q7MB 4QECA 4BFUA 1UXHA 3LOPA 5L7WA 1GL6A 4QTYA 1BDHA 3VDRA 5E6RB 5JCOA 2FSHA 4ABTA 1TO2E 3U7RA 4AY3A 4G4GA 2QM7A 1LWOA 3WGYA 3EC2A 4QOJA 3W2FA 1QIDA 1VQKB 2ZBRA 3DE5X 3N28A 3RAFC 1ZNYA 3T7EA 3BFVA 1GPMA 1PR9A 4W1SA 4F93B 3PNVA 2FPPB 2WYHA 3OF5A 3I2KA 2GAAA 4KFUA 2YXLA 5KSOA 4AS1A 3TW8B 1YZTA 1GLVA 4L2IA 1SEPA 4PANA 5BVGB 3VO1A 3F5QA 2VUUA 3NAZA 1X80B 5JMTA 5BSEA 4V39A 5IJ9B 4L3OA 4EEZA 1L8LA 3GMDA 4EGAA 3MJHA 4UMVA 2FVXA 2R8BA 2R4QA 5DOZA 3KT3A 2I6XA 3M4NA 3DBIA 3MXOA 1T5BA 1Q77A 2DOKA 2GCOB 3BTOA 4WADA 5TJ9A 1OC4A 2X7XA 3NXKA 2Z1DA 4MUJA 1JSCA 4YBRA 4YGYA 1UQRA 5FUWA 4ZXPA 3SK0A 4A0HA 5TQ0B 4F8YA 1G20A 4DBVO 3NWOA 3DZCA 4QM7A 4PZ0A 4PX2A 5CRIA 1E1LA 3NS7A 3G79A 4WX2B 4ZGQB 2NO4A 4ARIA 4F3KA 5MN6A 4GOKA 4KRXA 5EJ7A 4QZVA 4GLBA 3P26A 1QDUA 1KOJA 2AKAB 1IG0A 4GICA 3QNMA 1I14A 2QBYB 4OGLA 2ZKIA 2BTQB 4YV1A 1JA1A 2VH1A 2RGAA 4GBJA 1ZJJA 1GRRA 2VEDA 3U80A 3UXHA 5CB8A 2L19A 3G85A 4JJZA 3LPAA 3MFQA 3C1OA 4MWDA 2NXJA 1SCAA 4QC2A 4XFDA 1B6TA 3NCHA 1YOBA 4ZAVA 1IN6A 5BWBA 3SYNA 2WKQA 4YP9A 3W0LB 3L8ZA 5KC9A 3V76A 1UWCA 1ZMOA 2WAYA 4G0YA 3UJPA 3WGHA 1D0IA 3PHHA 5AICA 1YX2A 3QZUA 3J80A 4MWOA 5CAEA 5FDFA 5DK4A 3PUXA 1EVZA 1KK1A 4HDQB 4IXWA 3MWYW 3O9MA 2JA2A 3T7CA 3ZPXA 2O3RA 3VR4H 3L3BA 4IYJA 4LY0A 3DEAA 3WIOA 2G88A 4DF3A 3FHOA 1IZ0A 2B34A 3G1TA 2RGYA 5TB5A 3OKFA 2WFZA 3PL5A 5EUMA 2FSVA 3CX3A 2EX1A 2PDAA 3E1YE 4FLMA 3KZXA 3FFAA 4PCVA 1HYBA 3VSAA 1SK8A 4JJ7A 4N0DA 3L43A 2RH5A 1ULUA 2AF3C 2PD3A 2R5NA 2BE7A 1N7IA 1NBEA 4I4LA 2VJJA 2IHYA 4JUIA 2RGWA 4RVHA 2VDMB 3MJTA 3QBJA 4YK7A 3RJ9A 4JLPA 4QUEA 3VR3A 5KHOC 1T15A 1JAXA 1NB0A 4DQVA 4HAOA 1WXDA 4FW9A 1PJ6A 1LTHR 1DBPA 3L0DA 3QYFA 4HBZA 4QOSA 1F2UA 4Z4ZA 2V5VA 3CS3A 4MVJE 3PR2B 5CIQA 1L6IA 1LLQA 2B8TA 2QA5A 1TZMA 3DVAA 1U3TA 2VQFB 3B1WA 4Q3BA 5TQJA 3MWFA 2A33A 4DRZA 2WIFA 4JN6B 4U02A 1G5TA 1Y1LA 4AY2A 1BJRE 1L4MA 1N2HA 3KUDA 3G9XA 1MU0A 3QX8A 1YWGO 4BFTA 4F12A 1VPWA 1DC7A 2O2DA 4NCBA 3NTXA 3ABQB 3L93A 3PICA 2F1IA 5COAA 2VWPA 2H1CA 5EE5B 4E5NA 2PUAA 4LX0A 4RVNA 1JHQA 3JS5A 1RC8A 2HMTA 3L02A 4RKRA 1YB5A 1C29B 4AKTA 4TMYA 4CNQA 1LH0A 2VWHA 1YBAA 2P9CA 4CKBA 3TQSA 1QSGA 3PNSA 2W70A 2XNJA 1R6BX 1N25A 4JVLA 2DGDA 3USCS 5KB3A 1X74A 1RWMA 5A5VA 3ZCPA 2YIDA 4IJWA 4LDZA 4DCGA 4KFRA 1RJ9B 1ZESA 2O2ZA 3ZIAD 1POXA 2E55A 2YZMA 4JIMA 4UUPA 5HIMA 4BVKA 1DE0A 4PX5A 1YJ5A 1CYEA 4ZQHA 1QIEA 3V9AA 2A86A 2F3TA 2P9EA 3W3ZB 4D8TA 3S68A 8GPBA 4WBNB 6NULA 1EE2A 2A30A 4XN3A 4QVIA 4K46A 1ZOOA 2ZLBA 2A2ZA 5FNVB 3TIGA 3PC3A 5HKKD 4J76A 1CJKC 2C2WA 1IN7A 4PN3A 1RWKA 2XIJA 3X2FA 4DJFC 4CRWB 5EJ5A 3ASQA 2P0YA 2IU4A 3ZGOA 4DW8A 5HKAA 3ETCA 3R0QA 1UD3A 2QAGA 4RIIA 2XDYA 2YHBA 2QRUA 1QVVA 1M76A 3RK0A 4OHFA 1N2XA 4EKEA 1A3CA 1DX6A 3L1HA 1YB2A 1P1IA 1QGZA 4OOVA 3PWTA 4X92A 4KACA 1YHZA 2P7HA 3CNQS 1PCXA 4RACA 1SKQA 4B6RA 4ASUA 2PQ0A 3DQPA 4Z9FA 5HRAA 3HDGA 5LIPA 2QSYA 1OXXK 2P2LA 4H31A 2NYUA 3O1LA 2A9JA 2D0OB 3L07A 5HTOA 2FP3A 2X13A 1R16A 2DC1A 1V9SA 1OFHA 4BLRA 3UJ6A 1VJCA 1G5HA 3OX2A 1QHFA 5LR6A 1NULA 3BBLA 4NMMA 3NIGB 2R0QC 2I54A 1KS2A 4D9GA 3DE0X 4BV9A 3SXPA 1G6OA 2EFCB 4YMUA 4HF7A 4XPZA 2PBLA 1NONA 3MOSA 1OMOA 1A5SB 1Z07A 4GPBA 4YRCA 1WSRA 1X7ZA 2RGDA 4OO3A 2CNNA 3RT7A 1YUBA 3CCVB 2WILA 2HMUA 3E1SA 2ZQZA 3UNXA 3DKKA 13PKA 4V0OA 4UUOA 3AGPA 5EIHA 1DAOA 4LBZA 1KSHA 4XQFA 3H1EA 1UKBA 4MK4A 3R7BA 1WMAA 1YDFA 4GBED 3HJCA 5C1BA 1JSRA 2J59A 3CW9A 5TMDA 4MW1A 2Q21A 2JJ2D 1PQPA 2WEKA 3EDYA 1CJCA 2HFJA 1T4MA 1XVTA 5AIAA 3E2IA 5E6UA 1AO3A 4ANFA 1FSPA 1YRBA 4BZXA 1SKUA 4FBGA 3V6LA 2GRAA 1AQYA 5FT9A 1MT3A 1ZIOA 1LBQA 3USES 3AU9A 3NQ41 3EDMA 4RTPA 5IK2A 4B3FX 3DUFB 1W30A 4OV6B 3CLRC 4FYVA 1VFNA 3NHLA 2YW2A 4DLPA 4JIGA 4JJIA 2NSDA 5JCOC 1F60A 1V7CA 1WKVA 4P7BA 1BGWA 4MDYA 3VOSA 1GWNA 2IS4A 1G3RA 4EPRA 1Z5WA 2WTAA 4PNPA 1P0FA 3VNSA 1TAQA 4BMDA 3WJ1A 1ZM2A 5TMEA 4UW9A 2HLPA 1H6BA 1HXHA 2CKDA 2EZTA 2J45A 1J0AA 3PTZA 3Q3CA 4W5WA 3TKYA 2PZJA 2PS1A 3HZOA 4B32A 4D3SA 4TV8F 2JGDB 3FJ1A 5E0KB 1P2DA 4EZBA 1O3YA 1DOZA 4MULA 1D8AA 3VKUA 5B12A 2FOLA 4QPNA 2GF2A 1XDSA 3CLUC 1RFLA 3IP1A 3R0ZA 4N5MA 4WCVA 2DFDA 5HF8A 3VDXA 4GP9A 1UPBA 5IBQA 4Q4AA 3SLKA 4ENPA 1GAXA 4ZDWA 4PZUA 4KQ2A 3ZBUA 5EZYF 1OX4A 4S2EA 3PLNA 2Q2QA 3PHBE 4WI1A 5CH5A 5GVRA 4TVSA 3CR3C 1DWPA 3Q3JB 1XTUA 1ZD8A 2IYYA 2I2BA 3IXQA 4Y2VA 3PA6A 3LC7O 1BDJA 1QHXA 1QVFB 1R50A 3DWEX 3NRJA 2WC1A 4P84A 2B6NA 1E4EA 1PJSA 2EBHX 3PXCX 4JI8B 3S2UA 2COEA 1G8HA 1GVNB 4EFMA 1MZPA 3HM9A 1HL7A 4HDKB 3VSBA 3A9SA 3R5SA 5H8WA 3O3MB 5F51A 2NU8A 5I7SA 2BKVA 1E8DA 2VCHA 2W00A 1XDWA 3LHKA 4LV6A 1T3TA 4YRSA 5I4CA 4TWAA 3P2IA 4QLOA 4HVLA 2YY6A 4FZ5A 3PA1A 5HP4A 3KELA 1QHSA 1Y80A 3DF9A 4JZKA 2ID4A 3CPXA 2G80A 3ZHZA 3PA8A 1TQHA 2WYOA 2ZRBA 3BIXA 4FVTA 4GVXA 1W48A 1OX6A 3QUSA 5MFZA 5ICCA 2RHDA 4JY7A 4MAFA 4ZAYA 5FWYB 1CDOA 1VSBA 4LC0A 1WRBA 3WLPA 4CV0A 4K5QA 5DRTA 4DCMA 5K8TA 1Y7PA 4ALNA 4EB6A 2DB3A 1PYGA 3G1WA 3AW9A 4M55A 4MPPA 1CDEA 1ICIA 1U81A 1YOVA 1ISSA 1Y7HA 2OEPA 3G02A 4HZGA 4JEHA 1SRRA 2FSVC 3QVMA 4CMCA 4EK9A 1USGA 4KB5A 3RRFA 4MUEA 16PKA 1Y7LA 4ENUA 1K7CA 1TAUA 4ERXA 1J0DA 5DWVA 5AVRA 1FMCA 4AK9A 5KYNA 1T5LA 2HK9A 3ILHA 3DR5A 3K2EA 4B7AA 1EINA 3E9QA 4PLTA 2A0XA 1YA6A 3IAM1 4RXMA 3DB1A 5BR4A 3NC4A 2AEEA 3TTWA 3W2TA 4ZOBA 5IBCA 2IYTA 3NANA 2ZUCA 4FFLA 1KZHA 3VC2A 1DEAA 3IUSA 4NE9A 3P1JA 2X4DA 5MGBA 5KAMA 3EXFA 4UM9B 1XQ6A 3HK2A 1MRNA 2FEOA 1EDZA 3LP6A 1OBCA 2IIBA 3ONWA 4FEYA 4L28A 1CE8B 4CIWA 3H9EO 3PXUA 4TLCA 5C8VA 4J7UA 1U6IA 1N3BA 1X92A 2BGRA 2EBUA 1ADFA 3UT6A 4DTIA 1KIAA 3O4GA 2HQBA 4FFBA 1CZLA 2JB9A 5CHYA 3SIWA 4X8LA 2GHTA 2DFPA 3KCQA 2AYXA 2I8LA 3WGNA 5D3MA 1UUFA 4C7BA 2ZRJA 2ST1A 4YQZA 5FV4A 1GGJA 3QBTA 4XDZA 1P7PA 2OPBA 5G4KB 4II7A 2FVGA 5DN6D 4LJ6A 4WY8A 2OB1A 4QV2A 1JUDA 1OBHA 1R2QA 4YRAA 5CFRA 2XTNA 3C87A 3M5CA 1P81A 4EHLA 1ORWA 3I56B 3KQQA 1DLJA 2GNPA 2ADFA 3GG9A 5GV7A 2EFHB 4HK4A 4MVJI 5AQEA 3ZKWA 1HYQA 1VBKA 3ETLA 4GU5A 1TA0A 3UW3A 1J5EB 2HNAA 2O2SA 3HYCA 3QG1A 2RBKA 4FNGA 4BEBA 2WTBA 2WE7A 4LTDA 1W7AA 4XPIB 1W2GA 4HTFB 2OD7A 2QAGC 3Q40A 2CFOA 5DGTA 3OLXA 2WMYA 4A0RA 4DK0A 1I33A 4RESA 3N2KA 2YCBA 4RDXA 3RHZA 1WOSA 1F14A 2HJ9A 1SPBS 3EOAI 4KK4A 3OEHA 3Q6MA 5H5JA 1NJFA 1FBNA 4N82A 4E5UA 2IVFA 2BGJA 1KFEB 2HXSA 4KMOA 4NEGA 3T94A 9GPBA 5KQSA 4TYNA 2G8LA 1WSVA 2A0WA 3BMCA 4OJKA 1ABBA 1K28D 4MWCA 1H2BA 3BCSA 3FMGA 4M0MA 2POQX 1DX4A 4PYKA 4U7HA 5BPFA 3TUZC 4ED9A 4NFSA 3RIXA 3KETA 1Z2OX 2B0CA 3F5SA 4ENWA 1WF6A 1BA2A 2OSBA 3GIWA 1QWOA 2N46A 1F4LA 4I4TB 1MN6A 3V46A 5DW3A 3T3DA 3WYFA 3T0FA 3IP9A 4TZ6A 1CNEA 2ORWA 4IHKA 2EZ4A 2PBFA 3L0OA 4FUQA 1YI2B 2XQKA 4RJ2A 3BWEA 1EBUA 1ECJA 1Q57A 2WLTA 3PC2A 2ODBA 4IZOA 1K5GA 3GFGA 3KFLA 5PGMA 2K2QB 5JECA 5IM4A 5ELXA 5HF6A 2AQKA 4MJ7A 2QD1A 1TX4B 3K1AA 4LBWA 3K1TA 10MHA 4XJTA 2G67A 5AK3A 2OT3B 4ZOEA 4AU1A 2JFUA 2Q5EA 4ITUA 4EFNA 5BNIA 1EXVA 2HRQA 4KX5A 4DADA 1X7XA 2EWMA 3H1AA 4JSYA 4K0KB 4QBFA 4DDKA 4ZKDA 3ZUGA 1QHNA 4ZGWA 5K0EA 3T99A 4MV0A 2BM9A 3H8SA 5JS6A 2OB2A 1QO7A 4WZ6A 2KHZA 2E2WA 3A4NA 1K06A 5EXPA 4O08A 3C3BA 4BNHA 5JARA 5ED0A 2H0RA 4YCDA 5CXXA 2NPIA 3THXA 5CDTA 3CZ5A 1SCKA 4IICA 5ANRB 1FLNA 1JRLA 4KOAA 3U9LA 4DCUA 2EP5A 3EG9A 3H11B 4Y0VA 4U7PB 4ZAXA 4TYWA 4GS5A 4AZ0B 1WCWA 2NZWA 1MOPA 1U8EA 3NHZA 4CL3A 4KREA 3JPWA 4CHTA 2FDCA 1ZQ9A 1J21A 3CY6A 3GD7A 3HJUA 1PJ5A 3KV3O 4NZNA 4PONA 4BMOB 4D02A 2Y05A 1RYYA 4ZDJA 3UJCA 1KMCA 2CMHA 4I5GA 2WJVA 3WBJA 1S9DA 2B6HA 4KE8A 4BMVA 1N78A 3S81A 1XIVA 1KY5A 4OK5A 3OQNA 4KQCA 4UQPA 1JQLB 3IH5A 3ND8A 1MC4A 3HDVA 3PDJA 1M2GA 4I1OA 1CKEA 3V4OA 3AVYA 1CR0A 1SOWA 1WZUA 1MQ8B 3K09A 3I61A 1XV5A 2ZS7A 3N2IA 1E9RA 1DFIA 1GPJA 2QLBA 1Q1GA 4UPDA 5EIWA 1AXGA 3I45A 1XJ0A 1NBOA 2G08A 4K6FA 4MZDA 1PFUA 1D1QA 1HUQA 1PD1A 1ZH2A 2YN4A 3OKPA 1VHTA 3I72A 3GFTA 3ORQA 4PLGA 4U9IS 3CPEA 3ANTA 3PU6A 3DPIA 4Q9IA 1QPBA 5JZOA 4LQDA 3N2YA 4F21A 3IVRA 2BSXA 3MIZA 3L5KA 2VJAA 1JU9A 2PZEA 4E5DA 3A6DA 2I4IA 4G4JA 4OOEA 1ZUNB 1X7YA 3K2QA 5NLLA 2CLHB 1CJSA 1VSVA 2QMYA 5IYZF 3O21A 4CUKA 1EFKA 4L75A 2XA1A 5TXGA 3NKFA 1V8FA 2RGXA 3P0FA 4IIHA 3QFHA 2VPYA 2Q49A 4P4LA 1E4YA 3SVZA 5BV0A 3IUPA 4DS3A 4XYGA 4G5HA 2PR2A 3F97A 5JSQA 5BMVF 4EG3A 4EB3A 3FJYA 4Y3UA 1PQWA 4ARSA 3PDHA 1Z7GA 3O4VA 5AUPB 5F9HA 1AKTA 3A6FA 2B82A 4BS9A 2VUTA 5D3KA 1KYWA 5LDDC 2RB4A 1NMZA 1S2MA 5GONB 1E1DA 4YNBA 3NI2A 1TD9A 3C39A 5CJPA 3GFQA 1QVWA 2DPLA 1KYIA 1SVIA 4FCVA 3V2HA 2E85A 2CC2A 2GVNA 2NU7A 1KFJB 2Q2WA 1SVLA 3NOOA 2R1ZA 4IIJB 3NVDA 1C0EA 4ZYVA 3VTAA 3HB1A 2VTKA 3Q3HA 1RAAA 4HMPA 4A8TA 4HFRA 1Y37A 1FDVA 1WD5A 2GJPA 4WEQA 2L2QA 1NKVA 2AT1A 3GC6A 1SUIA 4Q9JA 3RUPA 3Q6RA 4A5OA 4EYOA 2KMLA 5A03A 4I1VA 5HCNA 5CXUA 1KJQA 2R1TB 4TL6A 2IDZA 3LQYA 3TFWA 3UWOA 5DLYA 1WA5A 5F78A 2GBIA 1PGJA 4O4HA 4A3SA 3KSZO 5CDHA 4MPJA 2CHQA 2O8CB 2ID7A 1DO0A 1GPH1 4J1QA 3AQ4A 2R8XA 5B1SA 4BRZA 4C78A 4EX6A 3BWYA 5BN1A 2WJPA 1WUTA 1ZBDA 2H2FA 5KVSA 4MI6A 3TJMA 4OBEA 3WK5A 2IUTA 4XCQA 3OECA 5EIBD 2HD4A 2YY7A 3KYBA 2QY6A 3DOFA 1G18A 2ECQA 3DMGA 4FN4A 4M8KA 1G2QA 4C0HA 4E2XA 2DBQA 2DAPA 3G5AA 3RSLA 5EHZA 2ZI4A 1JAHA 2AEFA 4NZZA 1AZWA 5KTRA 4B5KA 3DLCA 1NF3A 5EAIA 4MWTA 5KNDH 2RE8A 3ZDDA 3NB0A 4GL2A 4EFDA 2V5AA 4S24A 1JHDA 1ZM4A 2Z8XA 3GEBA 2PKQO 1QHEA 1YR1A 2BP7A 2PKXA 4JGGA 4LX8A 5J2UB 4OHBA 3K9FC 4ZI7A 3GLVA 4EP1A 1VG9B 4AG5A 4O33A 3A70A 2YJ5A 3ABIA 3BERA 3T1QA 3PFCA 4U7JA 1RJFA 4BGVA 2F6RA 4U2FA 3Q11A 5ITVA 1NNEA 3LNCA 5A89A 3M33A 4M1TA 1BO6A 5AHWA 4AN0A 2WU3A 3TUIC 3GOHA 5A9SB 1KVSA 5FD8A 4XVCA 2HRZA 2FPUA 4B71A 4D8UA 2ISQA 2F8TA 1WDWB 3JAWB 4DQUA 3AFNA 2F3RA 3PENA 1LJLA 3DL0A 3IKMB 3NUQA 1ZJYA 4NU8X 2AC4A 3IOMA 1UANA 3PR3A 4PO3X 2H1RA 5BW6B 5ARBA 3OTOB 2AMJA 2X9LA 5P8WA 1XZNA 1JHXA 1WCIA 2CLOB 2Q9BA 1HLDA 2R4UA 4RLFA 3RASA 5AVUA 3ASRA 5JXHA 1L4KA 2VK1A 4CIXA 3OKAA 2QTCA 2BN4A 3LYHA 4B7UA 2WUWE 4DV7B 3Q4GA 4GZ5A 1TA9A 1ZH4A 3ZWBA 3K73O 3TVYA 5EMJA 3I1FA 1K73D 1EFVA 3HYRA 4ESHA 3OICA 3C3KA 1T4GA 4EYGA 1TW2A 3HLYA 4F9GA 4NXMB 3X1YA 3G2LA 4ME6A 3BFJA 2YH2A 3K0KA 4RBNA 3OCWA 3P5BA 4ZOAA 4ZVNA 2M6SA 4PM4A 3WB9A 1OH7A 3E3OA 3H84A 5EP1A 2LDXA 3BWCA 1J8YF 4NOLA 1O4WA 3FWKA 3GCDA 4UATA 3ZQUA 1Y8ZA 2FGKA 1ELOA 4L8FA 2PMEA 2VNSA 1GAEO 1ULBA 2NVWA 3AV3A 4CLRA 1AXEA 1X7GA 1FXWF 3HCFA 2CV1A 1SCUB 4CM4A 2GGSA 3JTMA 1EI9A 4FNAA 3TLCA 3UT5A 4UVIA 3ONNA 4WESB 4M6WA 4RK0A 1B8NA 1Y6FA 1F2TB 4GOLD 1A7JA 5DDIP 3QX3A 2FQQA 3CCLB 3C3YA 3KR1A 4QQ8A 5JMPA 3QV2A 2EAUA 521PA 4QQRA 3GEHA 4REMA 5JSFA 2IWRA 1LI7A 4GGMX 4TTVA 4YMGA 2GQFA 1L2TA 1SXIA 1D1NA 4OUDA 4Y2HA 2VHCA 5LZ8A 1U1CA 5DNEA 2C5BA 1SHZA 3D02A 3SZLA 2HCJB 4BFZA 2FR8A 2C4KA 4YAEA 4CLOB 1VKNA 1KE2A 1JI0A 5K3EA 2WSIA 1VPEA 2JIOA 4F5EA 4HUTA 3FSEA 3PXBA 1OSNA 2OTCA 4NV1A 5CNMA 3UG7A 2VAVA 3TPCA 4NDNE 3CT6A 1N8NA 3HKDA 3HJBA 3DJFA 3Q2OA 3QPVA 1JP7A 3EXHB 3GRUA 3IMCA 4RV5A 4ZANA 1C14A 3KXLA 2P62A 3PKIA 4AXBA 3N0VA 3H83A 2VXCA 1GADO 3KR9A 4PZ9A 1YD7A 2WG2A 4QYTA 4TRJA 4RANA 2XDAA 5EWLB 3SFZA 3WAGA 2HRBA 1GJRA 2H48A 2NADA 3EULA 3L8FA 3N8HA 2EQAA 4F96A 5L46A 3GDOA 3SF8A 5LNK1 3CP8A 2C9MA 3K0AA 3HHEA 1TLTA 4I55B 5JJBA 5CB4A 3PNPA 4E30A 3JQGB 1VJTA 5ALRA 2I76A 3OIDA 5EINA 4W5HA 3VZPA 2W8BB 1SUWA 3EQ2A 3I6BA 4TPKA 3N86A 4ZVKA 1WNTA 4JT8A 1UBRS 4RVUA 3GT7A 3LNNA 2YJZA 3PQ4A 2QT0A 2SHKA 1MC8A 2X7HA 4LSZA 5BUQA 1Q50A 1WHSA 4R0MA 4Z7NB 4DFDA 3OIYA 5EKXA 4YMSA 1ADBA 4LDPA 1KAMA 2I1WA 3K09C 3OTWA 1JWLA 1SAYA 2QYSA 3F0TA 4CMIB 1GZDA 2W37A 3WJ7A 5EEGA 3BC1A 2FPRA 3B6IA 3UYLA 4DJJA 1GG5A 2QZ4A 3RFFA 1H4TA 2O07A 4WK2B 2ZSAA 3ZQ4A 2HI0A 5I48A 2VLBA 3QOYA 4B80A 2ZSJA 4MPDA 3GGJA 3PD7A 1YJXA 4LPKA 3LUHA 2VK2A 3ACCA 1MGPA 1SIWA 3AU8A 4E3ZA 4P81A 2CY0A 4E4RA 2BTEA 1AQ6A 1VZ2A 1DINA 2HJVA 2QLNA 3ETGA 3TQTA 3WYBA 1QPZA 3QVXA 2OO3A 4BNDA 3RU9A 2OBMA 3CNOA 3ZJYA 5KYVA 1CF4A 3OFNA 3UK2A 2OYSA 4Q9AA 4EYQA 3VPGA 1FJXA 3U26A 3UC9A 3ITDA 2MYNA 3O03A 4R9NA 3FLMA 4OU4A 5AKXA 5GP1A 2R25B 3RUAA 4EHIA 5C1IA 1GQRA 4K6CA 4Y2XA 5FWXA 1Y63A 3IP6A 4RJIA 3LZCA 1KAOA 4D7AA 1RZUA 4HQLA 1ESEA 2ZT6A 4EMSA 4RK7A 4U00A 2ZITA 4HAVA 3OU6A 1JHZA 2OK7A 4NZYA 1E1QD 2REBA 4Z4YA 2C20A 4WWVA 5K8UA 1VXOA 5BWMA 3DMPA 3RVSA 3BULA 4D8YA 1N57A 1XHLA 4TL9A 2ZQYA 3WL8A 1NW5A 3QTBA 1KI2A 1AK1A 1L4HA 2XBUA 1P7CA 3BF7A 2FZGA 3LCCA 2WU4A 1NBHA 5IAEA 5J23A 3HO1A 3ELUA 4EJFA 4ALIA 3T06B 1UPAA 3EVAA 5J5CA 3BMQA 3P9YA 3HWX1 3OZWA 1F48A 1KOGA 5AFSA 1MP0A 3LWNA 3QKWA 2IZZA 5CX1B 5HCIA 4C2AA 3U44B 2JIZA 1JL3A 2H5JA 1I51A 3PSAA 4Q3LA 1IUKA 2WE8A 3ASYA 3DFZA 1TM4E 2HREA 3DD1A 4DLUA 5I5GA 3F5FA 1M54A 3HXKA 3CLSC 4MWGA 5KX5B 2AEMA 1KBZA 1JH9A 1U0EA 5JNTA 2Z98A 3B8EA 2MR5A 3CLHA 4ENTA 5TGZA 1WORA 1PFQA 3MJDA 4QREA 2IXEA 2BM8A 4U6NA 4Q39A 1A9YA 4TSFA 1AM4D 2I6TA 2WRZA 1CEQA 2Z0MA 1AF7A 1M5UA 2FWPA 1VLLA 2RJOA 2O20A 4MV5A 4B3RB 3ROQA 3NW9A 5DT2A 2HXYA 2YHIB 1XXHA 1DKPA 1QZXA 2JI6A 4PGHA 3CC4B 4DNTB 4NCAA 1EGVB 1ZC4A 4G9EA 2VT6A 2AK2A 5DBOA 3PT5A 1DL5A 1OXSC 2YXDA 3C6XA 1INLA 2FSIA 3D9QX 1FDRA 4G0QA 4L5AA 5F2OA 3T9FA 2JVIA 3EZXA 3QFCA 2BISA 4H4DA 1CUFA 3EGDB 5LQDA 2JHFA 1SUDA 3K5IA 3X1KA 1SZPA 1O08A 3KPJA 4HC4A 2HU8A 4WW0A 1R8JA 1W93A 1EQAA 4P58A 2D1QA 3D8UA 3CUUA 3EEBA 4LZLA 3NHWA 4U0KA 3KYCB 3TCXB 1OTHA 4H4EA 4TM8A 3P9PA 4O1IA 1XN1A 4L02A 4DM3A 2WFAA 2VPPA 2H1LA 1ZLYA 3CG0A 4KH0A 4MLPA 3FB1A 4KIJA 1FTNA 3EW9A 1TYBE 3NGLA 5EJ2A 2FWNA 1GL7A 3E0QA 3E9ZA 3I05A 4H3VA 1E66A 1R0KA 1N2SA 2DYKA 2W2QA 1LNSA 2VHWA 4IINA 1V0EA 3ZVMA 4OLAA 4XN0A 3DFKA 1DRKA 1THMA 1QRTA 1UMDA 3ASPA 4DZTA 1QP7A 2X8AA 1Y7IA 1KMMA 4OXNA 2C4VA 2V6BA 3E7PA 3C16C 3GYBA 3PB3A 4ID3A 1P4JA 5F5LA 5K3FA 2LV8A 5CGQB 3ZH9B 3ZZ1A 1EWYA 4OP7A 2OP1A 3AHGA 5C8XA 2XKBA 4ZREA 2QZSA 2UDPA 1I2BA 1VBFA 1XJCA 3QI7A 3Q1KA 4LY6A 5F7JA 4EARA 6AT1A 1GT6A 1W0JD 3PZBA 4WQMA 4Q3OA 2SKEA 1R5BA 2W4MA 1GHTA 1WSDA 1Z8DA 4G8CA 1SGWA 3BG5A 4UM8B 4A26A 4JBNA 2ZIZA 5I9MA 4KPEC 3M4YA 1Z4IA 3R5TA 3DWGA 4LJSA 3PRHA 3DTNA 3MW8A 2Z3WA 3K16A 4BP3A 2C7VA 4D0LB 1KNQA 1Z4QA 4TTJA 3TOCA 4EPTA 4HVCA 5AD1A 3ECCA 5ESDA 5IH7A 3FSRA 1J1UA 3AESB 2XKAA 1NKSA 3HP4A 1SOUA 1R18A 1ID8A 5BXQC 4I08A 1WXEA 4JWTA 1ZOSA 3WR5A 5K0CA 5DP2A 4WLNA 4WXYB 1RZRD 3HUEA 1G59A 9ABPA 3R6TA 1Q22A 2Y93A 5G41A 2P9TA 2WD8A 3DV0A 1EFTA 4OOFA 5DGCA 4D46A 1MA3A 1WXGA 2N47A 3PDUA 4JELA 5DX1A 3O47A 3STWA 2HADA 4PZZA 2IXFA 2XDQA 1QX3A 1JBEA 2QRKA 2JGNA 4QE3A 1JJFA 2A6PA 3ITEA 4O0LA 2UAGA 2O8FB 1P0MA 4OMCA 3L1VA 2J67A 1QS0B 1GY8A 3D7MA 2O2XA 3HLTA 3AVWA 4FTWA 4XRRA 1LDGA 4P92A 1U8XX 3WTBA 2FR8C 2J41A 1UXIA 4EB0A 2QM0A 2RJNA 3ESXA 5LMUB 3NO4A 2NMVA 2SNIE 2E5WA 5EG5A 1JEAA 5ALJA 4FNOA 3OQBA 3ZCRA 4NBRA 2QYOA 5KDDA 5LQKA 1XNQB 3V34A 5LDGA 4JNKA 3PXXA 2AMFA 3MD0A 4ZVOA 5CFOA 4IDOA 1CUDA 3KWMA 4XR9A 2LIVA 1NJ1A 3J81A 5HJEA 3UENA 5E6RA 4NNPA 2CVFA 1Q0QA 5IKPA 3U5TA 3SS8A 4EJ0A 2BZSA 5KYYB 2R47A 1S8AA 3PJEA 3R8CA 1GPUA 5F73A 3U3KA 2VJOA 4CG2A 5LM3A 4MGIR 4G2TA 2J09A 1HX7A 3C5HA 1H5UA 4KPFC 2G36A 1J97A 4Q7QA 3GAMA 1Z4JA 3TW8A 1Z33A 3A1WA 3OWHA 1T3HA 4LYGA 2NTYC 3ROFA 5BVGA 5ALFA 3WX0A 1X80A 2QN3A 1NVFA 2D5IA 2HUPA 3DWFA 5IJ9A 5JPCA 3WDMA 5AP9A 2KQUA 4MMZB 3VH2A 1J25A 1SUPA 2IUUA 4JODA 2CF4A 1G5IA 2C1EA 2GCOA 1WOMA 4O2BA 3S0JA 1ZNQO 4BGEA 1LVHA 1TZJA 1GU0A 3FKQA 3AF2A 2LR0A 1NTRA 1XMQB 4BLUA 1AN9A 5TQ0A 5B30A 2O3SA 2H63A 3CSSA 4AJLA 4OIFA 3SQOA 1OV6A 4EA8A 4LF4B 3UCEA 2PXHA 4DLZA 3F7NA 3KOOA 1TYDE 4ZQCB 5HIAA 4R9VA 3AUUA 1PBNA 1NVBA 1DC8A 3AKDA 2VPZA 3DVQX 2QBYA 5IUKC 2IX9A 3QKRB 4TTSA 2BTQA 1RMTA 3RM3A 1L3BA 1TOAA 1IVNA 5E2IA 1K8AD 4LE2A 4PXAA 2DXIA 4QELA 1USIA 1PK9A 5AW3A 2GK3A 3G0DA 2FRDA 5CFLA 1EWVA 4OTZA 2R60A 3TFOA 2OTLB 4CLXA 4M1EA 4KK3A 5L7TA 4WXEA 1UC9A 1KJWA 2DFNA 1JQ5A 3LQKA 3A6JA 2BGMA 3IAFA 2HR1A 2JASA 1J6UA 1XOIA 3ILYA 2D1RA 1DEHA 4WN9B 3PRYA 1H85A 5GWXA 3ONVA 2QT9A 4GX0A 4UZEA 1UMBB 1WX1A 3B36A 1N9ZA 1ZMRA 3N6XA 2D5BA 4GI3A 1VYTA 4F4DA 3UCXA 5EXXA 1DWUA 3DGEC 2VFAA 1JAIA 4YLGA 2HA6A 4YP7A 5TX7A 2W4QA 4MYCA 3STYA 5J4LA 4C0KA 1YCGA 2IP4A 2Q5JA 1U7HA 5KYWA 4PBTA 2OFPA 4B6SA 4EG4A 1UCFA 3LLVA 4NK5A 5SYAA 4BDTA 2LWIA 2XNDD 2ZXFA 3OCZA 3UOGA 4F97A 1O94D 1TUEA 3IEVA 2HIHA 4DB4A 5IF9A 3ADPA 1NXSA 4F1WA 3SHWA 3VI3B 2QZZA 4P36A 5F7OA 1M1XB 3NWEA 4ARCA 1T36A 4HE5A 4YS6A 1L7AA 3BTSA 3TTVA 3B1XA 3DAFA 3D43A 1IXRC 2WF7A 4YAKA 3GELA 1GTSA 4G5GA 1OB0A 1RCFA 3COPA 3SJBA 1OWLA 2A9PA 1KH2A 3GH3A 4IDBA 1AS2A 3LCMA 4BNNA 3IAS1 1VQ1A 3VO9A 2OYNA 2YQ4A 3BJEA 4YP6A 1Y6ZA 2N75A 4Q6BA 2PGDA 1RRFA 3TX2A 1LF5A 3VDQA 3C7KA 4COOA 5HBRA 9LDTA 1RP1A 3EPKA 1BCSB 1VF7A 5HS6A 1UADA 3EXG1 3D0QA 3EB9A 4Z2YA 2LE0A 3GP3A 3RY8A 3OQMA 2OHJA 2LBPA 2ZBUA 4H16A 3IHKA 2QRJA 3C5EA 3QWBA 1SH7A 1K4KA 2O2HA 4LNUB 3E5NA 3D4NA 1E2UA 4N65A 4BWGA 1UFRA 2ZGVA 4O1HA 3OTHA 1NP6A 2CYBA 5SZHB 4ATNA 4DT1B 1RJ9A 1FRZA 2I87A 4ZOLB 5ADWA 2QV7A 4JXJA 5BQ3A 5F4OA 5E9WA 2IEYA 2CLSA 2R6GA 2R6FA 2WWYA 1A9QA 5EI5A 4ZHSA 4KV7A 4IDFA 3ZCXA 4WBNA 2IXDA 3Q15C 4DG5A 4S35A 5D87A 3DDUA 4WT7A 4X1OA 4C5CA 1NMEA 2C0CA 3AY7A 2A58A 2JRCA 1NVGA 5FNVA 4B6JA 3IAXA 4ALJA 2I2XB 2O2EA 4BEVA 3AZQA 4O2RA 3L7OA 3LD9A 3QLUA 4MR9B 5CYFA 3DE3X 2BZGA 4PYNA 3HE3A 1KU6A 5I47A 4GLFA 5DXJA 4ZZ1A 1VBNA 4N0PA 4Q66C 4I8XA 2X42A 4EUHA 3AERB 3KOMA 4DAOA 2V7PA 3OQPA 2FMIA 4QTTB 4RMNA 1I18A 4GSYA 4WVLA 5CVTA 2PL5A 1E1YA 2B83A 3HBJA 3IP5A 1BMFA 1BKYA 2IHUA 3OZFA 1AK9A 3W3AA 4ZCPA 3IMEA 4YRZA 1LSOA 4FFDA 4GBGA 5K4AA 1TKAA 4NMLA 2H1IA 2WT8A 4ZRNA 3ZW8A 2PKEA 2VWQA 1WQ1R 4MYSA 5AO9A 4MHOA 4ITRC 1V25A 3GRKA 3V1LA 3PGA1 1UD5A 4LOKA 5ENVA 1OIWA 4PZCA 1JYFA 1X1SA 3ZZTA 2C57A 4P4SB 2QVXX 3ENVA 1VLJA 4HVTA 4MCIA 2ZBPA 1OUMA 2EG9A 1LBIA 3VNUA 4EH1A 3DV2A 4A82A 1Q0SA 1UDCA 4UVHA 1PP4A 5DHTA 3E0XA 2IW1A 4MRVA 2VYND 4KP7A 1NJSA 3LAWA 1GQSA 1QVAA 3GA5A 5JZ9A 4ZCTA 4BKQA 1CEYA 1GYPA 1PR0A 3O7MA 5EPOA 3REQB 5JFGA 1Z75A 1N2ZA 3KWLA 3TZBA 1XL0A 2AD5A 4EF6A 1NUPA 1PT5A 1QGED 2ZATA 2VYVA 3DF7A 4I6JA 5AI6A 3D1VA 4ZWNA 3ZBPA 4C7XA 2AMLA 1S4MA 2C29D 1VJRA 3QE0A 1ZJ4A 1XKLA 2ISCA 3BRWD 4CKWB 3GLQA 5EHQA 2DUNA 1UFOA 1M83A 1DWQA 1QOQB 4RXUA 2NZXA 4XMYA 3LQ1A 3ZZNA 1FA9A 2R96A 4XLAA 1PIWA 1KQOA 1P1HA 2ZVJA 3URMA 1AZTA 4UPEA 5KOYA 5ALLA 2C9CA 5LNK6 2RHBA 3Q7EA 2Y92A 3ELBA 4HAIA 3RHSA 2WF8A 4I46A 2EWVA 3TOSA 5DIZA 5KQPA 1I5OA 2XMRA 2V7EA 3S44A 3P2OA 4IIXA 4IHJB 1JS1X 5FB3A 4AX8A 1LFAA 1UWKA 3WLMA 3DUFA 3QRWA 2PS3A 5AW7A 2C9BA 1L8XA 2IKSA 4E5MA 4MRPA 2V31A 4AF7A 4OFXA 1T5SA 1R37A 1NFRA 4HRAA 4XORA 2RMKA 3OWOA 4HDMB 3KXPA 3UFBA 2G0TA 3EUWA 4A2CA 1WTHD 4JUBA 1Z26A 2OGTA 1ZKMA 3ZH2A 5KJCA 2DPMA 2QAIA 2GXSA 1E2DA 4UDOA 5TF0A 1OJ7A 3BRQA 2UYHA 2BT4A 2JGDA 3NWPA 4XVHA 3R3HA 4IMRA 1QKJA 3FBWA 2B92A 4JMPA 5I9IA 3VPXA 3ANXA 3MWJA 4RVSA 1CLEA 3QLTA 4OQMA 2GNAA 2ONYA 3E3MA 5EHIA 1LI4A 2JI4A 3GRCA 3ZHOA 1VTKA 3ITNA 1Y1PA 2WPDD 3EIWA 3VMMA 1VKRA 1RLUA 3E22B 2QN6A 3WV5A 2X5JO 1QBGA 1T8TA 1BYIA 2FJ0A 3ZI4A 3LO5A 3U39A 4URUR 1P39A 1CY6A 4BE9A 4UEQA 4M60A 4CPDA 1NW8A 3QXCA 2J5QA 4HDKA 1E61A 3FW1A 2BHNA 1JE0A 1BS2A 3EZ2A 3PLRA 4P22A 3D54D 1NV9A 3VFDA 3AIIA 1EFRA 3CG4A 2RAPA 1M6VB 1T1EA 1HETA 1SK9A 1WUJS 1ZCFA 3MCUA 1PRYA 4GOXA 5EJ4A 2J33A 1NVMB 5DEIA 4E15A 4ECEA 2ZRCA 3VPDA 5B3KA 2P4HX 1DOHA 4Q12A 2VJDA 5EL0A 4MQLA 3ROMA 3T7IA 1M8PA 2O8VA 2YVQA 2XOKD 4QXPA 2FRDC 2DQSA 2ORED 3TTYA 4CM9A 3U4HA 4O4HF 1ZEJA 4F1KA 4MKGA 2V4MA 1U2QA 2CXPA 2XT0A 3VR1A 4ER7A 2NXNA 5HK9A 1YJ9B 1P4SA 3SC3A 1HSOA 3GDGA 3OJEA 1AD2A 1IK4A 3MLAA 5FWYA 4CIYA 3WKCA 1EUDB 2JRLA 5C2JB 3WGUA 4MV4A 4R54A 4TYQA 5IW8A 2F8LA 4I1IA 3UJ9A 4CN9A 4OKIA 3PITA 3EOZA 4YONB 3UN1A 1Y0YA 4PAAA 4RQAA 1JKXA 4PR0A 1VCOA 3Q39A 1JA9A 2PU5A 4CIDA 2Z2YA 4CL2A 1NYLA 2XOXA 4ZYUA 5C5IA 4JB8A 2MINB 4N0QA 2IPXA 5JG7A 3U7IA 4XOPA 1HO3A 3DBRB 3KB1A 3CMAB 3JATB 3B82A 1DUIA 1NZFA 1G8YA 1NQUA 3H0CA 5AKKA 3RS8A 4YCMA 4CMEA 5JNLA 5EY5B 4PCUA 1RVV1 1QG0A 3A6HA 5DSXA 5C46F 3VR6A 4WGGA 4OF4A 1PVVA 2QP3A 1MC5A 4H35A 1A95A 4K9PA 4EG0A 4F3CA 4ZI7F 5EQTA 3K4PA 4BE4A 1LLCA 4D96A 4NBUA 4TXMA 5HTKA 1X8JA 1II0A 2O4CA 9ATCA 4KJXA 2X0FA 3GVLA 4E14A 4AICA 4KXWA 4CR8A 2WUDA 4URWR 4JHLA 2V7QA 2FI1A 4DDUA 4I7EA 1CE8A 1K2WA 3N74A 3MAGA 4R98A 2WF9A 1QLHA 4NBWA 3EZGA 4HPJB 3UK0A 2B36A 3UMFA 4DZZA 4XLLA 2ZSFA 2CJXA 5F1KA 5IVPA 2PHZA 3NEYA 4PEVA 4TL7A 4LN1A 3H5TA 1M0TA 4NX2A 2RH9B 5JCPA 3G9ZA 2Q3BA 3KR2A 5BV8A 4D3ZA 1YZQA 3DMYA 3OSUA 4BUZA 1Y1TA 1JEOA 2PM8A 3QW4B 4JC5A 4FFNA 1EP3B 1P8AA 4XIIA 3T1HB 1AX9A 2MYUA 4OXQA 5DASA 5G4KA 3GJRA 3TLAA 2ZJ5A 4B3CA 4OHCA 4DM4A 2OM2A 1VPLA 3LY5A 1PJ2A 5ILQA 4MCHA 3N7UA 1MNAA 2PT5A 2PX2A 3LZ6A 4IGFA 4URFA 2XMPA 5GM1A 1V39A 3T5DA 3W78A 2UYGA 4UHJA 5KNBA 2NP6A 4QICA 1V6AA 1LK0A 4CCWA 4EENA 1UQTA 4RD2A 2O7SA 5JS2A 3WJAA 4HYTA 3OW2B 1PJCA 3KM0A 3QLUC 5GM2A 3B3GA 4EYSA 4XPIA 2R6JA 4HTFA 3THYA 2O9JA 3L1KA 4QULA 5TT1A 3W5CA 4OJYA 2JCGA 4MHSA 2AKEA 3N8KA 5LA6B 1ZFNA 2QX8A 4GKKB 4AWXA 3G0OA 5AH0A 2POCA 1G4HA 3FUUA 1LEHA 4N12A 1UDXA 4MVXA 3LUBA 1NT4A 4IAOA 4O8ZA 4WKGA 3S5UA 1CWUA 2Y0DA 3GFOA 3L82B 5B7PA 3L92A 1A5BB 5CFMA 3QK7A 2PRZA 3CB4A 1SG6A 3BDVA 4G5YA 1MCZA 5FO0A 4CF7A 2XZPA 3KSDO 4BLQA 2ZUEA 4V0QA 1FRNA 2WJYA 4MLZA 4YAIA 1K8QA 2YJGA 2FZCA 2ICAA 2IXBA 3ZW9A 2JN9A 3WBKA 4KLAA 2CVPA 5DEOA 2JJYA 2P0EA 3T8YA 3TR5A 1XRSB 1PL7A 5A4DA 1OR8A 4I4TA 4L0CA 4N54A 2AFRA 1F8FA 2DBRA 1BMDA 4Q00A 4UNSA 2FX2A 1GUBA 1XXLA 2GYVA 2QORA 2WB4A 2YRXA 4TXHA 3REGA 1H0HA 4XTCS 4AS3A 4DLRA 3LTEA 2D5LA 1O0BA 2JCYA 2YIJA 4YASA 1XRRA 4C3OB 4L72A 1M6WA 4NMHA 5A6VA 4NU0A 3JQAD 1D2EA 4Y6GB 4NJMB 2C2XA 4IZHA 4MEBA 1ONNA 3EEFA 2W2MA 3KQLA 4ZEWA 2HV8A 1R9GA 2JDID 2O14A 1OTYA 5CB4F 2PD6A 5A8AA 2RI1A 4GD3Q 1L5KA 1BWQA 4MYTA 3PQ7A 5FOTA 1PT8A 1JTEA 2I6SA 5KTPA 1NW7A 3GZ4A 1R3DA 2J7PD 1JDTA 1JEEA 1ZLXA 5JS8A 2P2GA 1TZBA 3DT8A 4JFRA 3LIIA 4OM7A 2BR4A 4ZO4A 3SYLA 4AJ4A 4B2YA 4OI4A 4E12A 1SEVA 1VQLB 4OHZA 3QE2A 2HFKA 1YR8A 4C6TB 4MVJG 2BHSA 4INOA 4V0KA 3M6IA 4LXYA 2VHEA 3HFGA 2GESA 2N1MA 3J7TA 1WULS 1Z5PA 4FZVA 4RORA 3X1MA 2VZEA 2XADA 3RLFA 4JP2A 4C7OB 4OYYA 3WL3A 5SZJA 4ZQGA 2WJJA 2VRNA 5LD2B 1WEKA 4GI1A 3H11A 3WIUA 2VT3A 3GMTA 3VHLB 4AZ0A 4ROXA 5IBRA 1U4NA 3RUFA 2YZ2A 3QYAA 2PO5A 2IEAA 2QG4A 4LK2A 3A2KA 4CTOA 1BKDR 2BGGA 4QUGA 1V5VA 1EE9A 1UK6A 4YACA 4AP9A 2NZUG 2BBSA 4KHZA 4AJJA 2Q1TA 5AVSA 2PSEA 3B7WA 1D6MA 3GCGA 4JITA 2WJHA 1IBSA 2PJUA 3HFJA 1KE1A 4CMBA 4EJSB 1G42A 3JWJA 4BDSA 4CIAA 2IWHA 1HE3A 2ERCA 3WGOA 4PBRA 3ZBTA 1JI3A 5C81A 5JC8A 1JQEA 3H0EA 4O6VA 1M6YA 4I14A 4KI7A 1E3QA 2R6HA 1OKKA 1WXWA 2OBNA 4FI3F 3HN6A 4HEHA 2F9MA 3K0FB 3VC3A 1EK1A 4XFKA 2VBTA 2P3SA 3E48A 5KDOA 4GG1A 2H8KA 1GNLA 1GUYA 1WUKS 2GLXA 3JWPA 2H51A 1E8MA 2I9PA 1NLUA 4QT0A 1T35A 1WXXA 1CZHA 1GKIA 4R0VA 5INTA 3LO8A 3JU3A 1RI1A 1ZUNA 5AESA 3MUEA 5DWDA 4M9CA 1IMJA 1BS1A 4UDNA 2FWBA 1XVUA 1AZLA 3W5AA 4ACAA 4N48A 3ISJA 4DYDA 7MDHA 3KKQA 1WQ3A 5F5XA 1AQNA 2WSSD 5FA6A 2JD0A 4WAUA 2WY2D 3ZN2A 1YLOA 1NUAA 4YRFA 2EP7A 3KL9A 5IS2A 5FULA 3C45A 2PQ2A 3BRCA 3OJFA 4FPXA 3T3GA 2OBFA 4HMQA 1N3IA 4X94A 1MNQA 1M1KD 3SIPA 5EQDA 3BKWA 1DBWA 5IN5A 5KOIA 3U4MA 2DT5A 1HE5A 4YR9A 1MAAA 1V48A 1XTTA 3GLTA 1ZICA 3FOWA 4D2IA 2A14A 2B25A 4BC0A 3DLHA 3ZTYA 2ROQA 1I8DA 4X6UA 3QEOA 5GONA 4RSGA 3OLYA 3ICEA 4JJFA 1UT5A 2LUOA 2WZDA 1H9CA 2FJPA 3ELWA 4HG2A 3PQ5A 4IIJA 1X13A 2DSNA 1VLMA 1TM2A 1Z2AA 5FFFA 2PXAA 3IJEB 4F9EA 1F5SA 2QIOA 4ETMA 1X6VA 1QC5B 1ST2A 3B12A 3W6OA 3WO1A 5CFNA 3WKAA 1EQUA 2OYCA 4ENQA 4CMEC 3PL1A 3QWHA 1OFVA 4ND5A 3ZY5A 5FBVB 5KOJB 1GN9A 2R1TA 3L8MA 3IAS6 1SXJD 1W94A 1IQUA 1JZQA 4WFKA 1C7QA 2YZ7A 4EF5A 5KC8A 1SUCA 1JIKA 1U1GA 1AQUA 4Q4CA 2YS6A 4YUYA 4F45A 1E9VA 1N2IA 4EYEA 2O8CA 4V3BA 3SNKA 1R6TA 3BORA 3K92A 3E5HA 2EZ9A 4FFWA 4CF5A 3P9ZA 1BH2A 4PYIA 3HY6A 1P9NA 5KQMA 3QFTA 4KODA 3UJ7A 1JSXA 1MTZA 3M9WA 3AUAA 1QJCA 2AN5A 4RMIA 2C5HA 1DAPA 3CNEA 3F71A 3I6QA 1UMCB 3OQ1A 4F4UA 5HZMA 4MYUA 1IOWA 1X38A 4F4CA 4KSBA 1RC0A 3SZUA 3LBIA 4S0XA 5AI4A 1N3YA 3UJ8A 5KU1A 8MHTA 1TEHA 2Y8EA 1PV2A 1GRQA 2JGKA 2IKQA 4LDQA 3F8SA 4C03A 2HK6A 5AVTA 3DEYX 4ZAZA 3AKYA 5AK0A 2Y1LA 3H2ZA 4U9HS 3LG2A 2VF5X 3RU7A 3CZ9A 1QF6A 4JU9A 2BHLA 1PJQA 4PFKA 5L51A 2CVQA 5J2UA 5EIXA 3CR8A 5ICFA 2Q5FA 3CFYA 3EYWA 2QX9A 5L45A 1CZNA 2M32A 2AX3A 2BPOA 4GPEA 4QXMA 4V2UA 1Z7YA 2C78A 2JKVA 3IIIA 4LJLA 2WWVD 2NSYA 1AA9A 1TJ4A 3DNFA 3GJ4A 2G9RA 5SV2A 1T5OA 1XJWA 1ZC3A 4HWTA 3Q3IA 3M6WA 4EA7A 2J0SA 2XQIA 1P5HA 3MTEA 4RD6A 1B26A 4Y18A 3TAHA 4JGIA 3JAWA 1O95A 2ERXA 3NM6B 4JBWA 2GI4A 1WMSA 4QRIA 3S1SA 2CMKA 5AW0A 3NHUA 3NT2A 4Q1FA 3HFRA 2AXNA 3ONDA 3B1KA 4L73A 3GUUA 4P32A 1KJ9A 3KKMA 2XI4A 4UMDA 4D3XA 2XMZA 2PK3A 1G5FA 4NSNA 2X3YA 4RD3A 1C7ZA 1YH3A 3N75A 4R68A 3VHQA 3QVVA 4Z4GA 4G0OA 3KDAA 1WO8A 2XA2A 4G0NA 5A9TA 2CJWB 3A10A 3WSVA 2A78A 3L6OO 1JR3D 4AFNA 1ORTA 1P7YA 1UBLS 3CPHA 2NV6A 3RREA 3L40A 1MD9A 1WS6A 3QMVA 1CR1A 4EHFA 4YIHA 1QIJA 1FYXA 2VHXA 4TZKA 5L3ZA 5AI5A 1FP4B 4ZTZB 1MABB 1GPYA 2WYVA 4ND1A 2VP3A 4RHCA 2IOHA 5AJYA 5EWJB 4OA5A 3CVUA 4GT1A 3DFFA 3RGWS 1NVKA 3G6KA 1H5NA 4QJ3A 1CHDA 2ASEA 1Z47A 4NG4A 2H1SA 2JLWA 3NTUA 3W9SA 5JBNA 4KRGA 1SCUA 3LLMA 4ERNA 4ZKEA 4PSDA 2SKCA 5HMMA 2IYXA 2GAIA 3C70A 3RAGA 2YYZA 1OILA 2DBVO 2B21A 2B4RO 3O7WA 5SICE 3IDZA 4EKIA 4WESA 3A04A 3UATA 3FMFA 1F2TA 4WASA 5I9SA 5EYPB 1ZNWA 5BOSB 2AC2A 3LVQE 4ZQIA 4ZO7A 4L0DA 2GF9A 2JFQA 3MYYA 2X4GA 4UTRA 5I45A 3ELYA 2WFLB 5CA0B 1L4UA 3BWDD 1ZVJA 4KBFA 2OFWA 4ZQFA 2XYPA 5CT8A 1I3KA 3H2SA 2O5RA 2P35A 4QJ4A 4QJ5A 1Z0FA 1H3EA 4TQAA 3SX2A 4HFJA 4CLOA 2DUMA 2VL7A 4UREA 2GLUA 1HA3A 2IT1A 5G1OA 3VZCA 1O0CA 1TM7E 5KWEA 5BSYA 3C4JA 1AXRA 4RIFA 3C2QA 4U8HA 4BAUA 3HEBA 1ZVQA 2BEJA 3EXHA 3HJHA 4KWEA 3CP2A 4WE3A 4F5YA 1FRVA 1JXOA 3G68A 3QHQA 5JLAA 3ST7A 5HVNA 4KUHA 3L06A 4O2BF 3DZFA 4MS4B 5K3AA 1NN5A 1AY0A 2PJZA 1PGPA 3HDHA 5EWLA 3V3TA 1XDGA 5B4VA 3VKGA 3DLIA 2R7LA 3BRSA 3CCJB 1WP4A 3ZCTA 5KKNB 3FNGA 2HF9A 1JLSA 3GR6A 1DJQA 4I55A 4OP3A 5B1HA 3VJMA 5GADl 3T15A 4IGIA 1H2HA 4XGNA 3JQGA 3AF0A 2Z1MA 4EUKA 5HQJA 3DAOA 1PR2A 2DJIA 2W8BA 2X1VA 4TM7A 4KXLA 3N8GA 3IYLW 2FW6A 5EESA 3OE7A 1IVYA 4DQLA 3G5LA 2OR3A 5FO1A 3RNOA 5I5EA 5BV1A 4XVQA 4MLCA 1C2TA 4HH1A 1HE1C 3SG0A 1P0PA 3OOSA 4R2LA 3ZU3A 4D4GA 4DWVA 2ZUFA 3U4QB 4X7DA 1M2NA 5IRCD 1QQTA 4UU8A 1RI3A 4ON9A 3RIMA 2ZE6A 1J00A 4KLZA 2OP0A 4BNYA 4CMIA 3NBZC 4BJ3A 4UQLA 1XP8A 4H9GA 2OD9A 3BCRA 2WTUA 3LWZA 5JRDS 2TECE 1JHUA 1Z5UA 2D7CA 2C5EA 1QFXA 2OOKA 4A1FA 4Z9XA 3VR5D 1TKCA 5CT9A 3Q9UA 4UHKA 2ZKLA 2JAOA 1SXQA 4ZOQI 2RK3A 3FVQA 1DDGA 1N1DA 4TVBA 4HWOA 3SMVA 1R4NB 4BLVA 1S89A 1D2HA 2G5GX 3LLSA 3LBNA 4YP0A 4LHWA 3CC2B 3H3XA 2QWXA 4G8DA 1GFSA 4H3SA 3U9TA 3ZY2A 1YRLA 1IM5A 4CU2A 1KZ1A 5GJBA 3O90A 2OCXA 4ID9A 4YC7A 2N9UA 1WE2A 2VQ6A 2YZKA 3BREA 3ZGNA 6PFKA 2HSGA 2FPMA 2I8AA 4WK6A 3ZI0A 3LQRA 1ONBA 5F9FA 1TL7C 4TTIA 3ANYB 1BXGB 5AI0A 3NDIA 3RV3A 1F6WA 5TIIA 1I3NA 1MGOA 4P2NA 2I55A 1H0RA 4CU5A 4FIDA 3PT9A 1K7XB 1SD2A 5AM1A 5H83A 5F2NA 2TMGA 4LA4A 3HXQA 4PLWA 5COQA 3U3DA 4KO4S 3HCDA 4Y2UA 2QTFA 4GHWA 1O9GA 3ZU5A 3VJKA 1N75A 1W85B 1O5OA 4GZMA 3HY3A 2ZTHA 1PBTA 3ZHCA 2WJ4A 2IIVA 4IV0A 1DGQA 1HYEA 2IZ5A 4QU0A 1WPXA 4QJIA 4X65B 5CX1A 1UDBA 1SUEA 2BZ1A 4KE9A 1ZR4A 2ZAMA 2IP2A 3BSFA 4BGIA 1LJUA 1AQLA 2XV1A 3Q10A 4HADA 5KX5A 5JZSA 3C7TA 4YXWD 2O0MA 3FDZB 3QPDA 4QUJA 3RTEA 4J4TA 4KN6A 4G0PA 4P35A 4XD7D 3SOZA 1M8GA 2KSQA 3QFFA 4FOOA 1OHHA 4TYMA 3TG8A 3ZW7A 1RD4A 5EGNA 3TLZA 4OPOA 4WBNF 2OCDA 2F9LA 3FKSA 2CWDA 1R88A 2O2IA 2YHIA 3BE4A 3Q0IA 2F9FA 3QENA 3VVBA 2F3SA 3K7EA 4G0MA 4GNRA 2FQ1A 1C4KA 1I0ZA 1PN3A 1JEDA 3F3YA 4PFJA 3HRIA 4JC0A 5F3WB 2YV1A 121PA 2AKYA 4IDHA 4L5CA 3FPPA 1KFBB 4JEIA 4W7HA 3ROXA 3VH3A 4WNYA 4LNAA 3EGDA 1PJ7A 1FNBA 3UHFA 1JFVA 2Z9CA 1SU7A 5EMHA 2C0QA 2DLCX 3EZ9A 3KYCA 3MGAA 4Y6LA 5KSPA 1CFJA 2AHRA 2G70A 4WSOA 4AO8A 2X6YA 1L7NA 4I9FA 5JXGA 1UJ5A 4D0RA 5DI3B 2FF7A 2WWIA 3KKEA 1RBZA 4IEEA 5J4YA 3IXLA 4B1FA 3KU1A 5EKDA 1YR7A 4I2VA 3SSOA 4A2PA 3D4PA 4AMYA 4BTVA 2HSDA 1ZW6A 3ER9A 4AYWA 1O95C 3ZZ0A 4M46A 2YWCA 2CCKA 1B8UA 2FEXA 5L6MB 1Y9DA 2W2PA 2XGGA 1N32B 3V55A 3QPUA 3KZMA 5THKA 1NN3A 3DXFA 2WKPA 4CXMA 1J2EA 3QKTA 4F6CA 2XUQA 4L85A 2I4OA 1RWWA 5DLDA 5EQJB 3FTFA 2CLMB 1KVRA 3I09A 2F2TA 2MSWA 4MGYR 2ZJOA 4C6RA 3KPUA 1W4LA 3LRXA 1C0LA 2OGSA 1XQVA 2AZTA 2PLNA 3R9IA 4AKIA 5JAQA 1IRIA 2DBYA 2XJ9A 3QWAA 1EVIA 5CNJA 1E77A 4GYWA 4YBZA 2JFHA 3KKZA 5KU7A 2ZRAA 3H2IA 3C8UA 4KNWA 1LNZA 1YK0A 4X60A 4LVOA 2YR0A 4CV2A 5HYVA 3AVVA 1A5AB 1EQ2A 1QZ3A 2UUOA 3OHPA 4OSPA 4B4UA 1MJGA 2IYAA 4B35A 3AESA 4EATA 2QG9A 5L7YA 2D8AA 1DXYA 3FSGD 4PC6A 4TWIA 3V7YA 3X43A 4BVFA 2QUZA 4MS3B 2OHXA 1MO4A 3I2JA 1SO8A 5EWMB 1OIVA 3OZEA 3QKUA 1GNQA 1A1SA 3FOEC 2WM9B 2BF4A 1ADCA 4RPJA 2OFOA 2HMAA 1N6PA 3OU2A 2GCGA 3LSTA 2YJTD 3EVNA 2FA9A 4R2XA 4LXQA 1JDJA 4R16A 1W1WA 4UE2A 5EZSA 4ZALA 3UUGA 4AYXA 1M3SA 1Q95A 3CUSA 1V8BA 3QUQA 2O8FA 1QS0A 4TMKA 4HR7A 4IOMA 4KVFA 3QEJA 1NVTA 1VLVA 2PZBA 4F11A 4WNIA 1GD1O 1MG0A 1CY1A 1JJVA 2TRSB 2WHPB 3PGMA 1Y5NA 1HH4A 1TJ5A 1YJWB 3KYDB 1AVTA 3P19A 2OZPA 4FMDB 1O6CA 2ODWA 2EC5A 4QSMA 3VU8A 2PANA 3EXHC 3BAZA 5HZGA 4HX9A 3T35A 1JIIA 4JKOA 1EIWA 3LT0A 5IZ4A 3DHWC 4EQ6B 4KBGA 3UWPA 2G0AA 4EECA 4KMRA 4CI0B 2IHTA 4TXNA 1FPQA 3AJDA 2H2DA 3PPVA 5JY1A 1IHMA 5KYYA 1H65A 3HN2A 3OIWA 3HGQA 1XZJA 2BCJQ 1TT5B 1CB7A 3CO5A 4K7JA 3EAQA 3RVPA 1YNOA 1VIDA 3P9NA 4PC1A 4RLSA 5BWLA 2OD2A 3DLBA 1J07A 4JSRA 2V8BA 3E5MA 1JT2A 4G2NA 4IDEA 1Z3CA 2ZUTA 1J0BA 4LQCA 1CX9B 1H1LA 4QU9A 5FX2A 4PNZA 3RF7A 3RTAA 3GNQA 4ZVUA 4OATA 2QD5A 4MGEA 1GAWA 1BE0A 2A1UB 2IHJA 2Z6BD 1T5TA 2YDXA 1GEEA 5J43A 2C84A 3GH1A 3SJCA 4CMJA 4F6RB 5CYGA 1RM0A 4R3NA 1ULHA 4AY5A 3CVOA 2HX1A 2OMEA 4GXRA 3FTNA 1YHYA 3W7VA 3JQ8B 1RI5A 4YGXB 5MN5A 3K6RA 2VCEA 1FVFA 3AHIA 2ZIGA 3ZY3A 1ZONA 2FKAA 2P41A 4RY9A 2UYCA 3GOQA 5ULLA 1YIOA 3QKRA 3SI7A 1BD3A 2ZTMA 2Z8YA 3AEQB 4LJAA 2DE0X 1K6EA 3MMPA 3X2SA 1DEXA 4JROA 1X3LA 1EVJA 1YZHA 4XR4A 3GJ6A 1DRWA 4HWKA 1A2OA 5DSTA 3U3RA 3H9JA 4BV8A 4TKVB 3N6RA 4FDAA 1QU2A 1EK2A 3DE2X 4M7RA 1NJGA 3I52A 2XB8A 4E0BA 2FDXA 5DZSA 3RWMB 4CMKA 4JENA 2D2IA 1LDYA 2ZRFA 3OF2A 2GTHA 2AOXA 4WN9A 1V35A 4FJ0A 5DE3A 1X7HA 2X41A 3A2NA 4AW9A 5K0TA 1YTLA 1UMBA 3LKBA 2EIHA 4GL4A 1SC1A 3R09A 2PUCA 1MX1A 3EG5A 4KO2S 3DMNA 4C4OA 5LFAA 2Q6KA 2QR2A 1OD6A 4IH9A 2OQ2A 2GVZC 5A5DA 1Y33E 1CULC 2HMVA 3GHHA 4NMXB 2CYCA 3OEEA 1E63A 1QAQA 2H1FA 1LF0A 1JDVA 1L3IA 3S3TA 3VA7A 3P71T 1GCAA 4BX3A 5KBYA 4RMJA 3NBYC 1UBUS 3Q5DA 3EJ6A 3WGGA 1A27A 4UEOA 3JZDA 4KWIA 5UKDA</