1BQLL

Structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPAIMSASPGEKVTMTCSASSSVNYMYWYQQKSGTSPKRWIYDTSKLASGVPVRFSGSGSGTSYSLTISSMETEDAATYYCQQWGRNPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYHEL-5 FAB (LIGHT CHAIN)
publication title Refined structures of bobwhite quail lysozyme uncomplexed and complexed with the HyHEL-5 Fab fragment.
pubmed doi rcsb
source organism Mus musculus
molecule tags Antibody/antigen
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1995-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bqlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bqlL01
3HC0B 3NCCB 5I2IA 3UJTH 3WE6B 3C60D 5JUEH 3GBNH 4FMKA 1G7HA 5DRWA 3UTZB 1PKOA 3QIWA 5E1HB 3OKMA 3LQMA 4HWNA 3NIDF 1GJIA 3GGWA 3NACH 1EEUA 2F5BL 1A7OL 5FO8B 3IFLL 4I0PA 1QBAA 4Z5RA 3S37X 5IKCB 4M6NH 3O2DL 4DK3A 2HJLA 4I18B 2VDLL 5DF0A 4NQEE 1KPRB 1Z3GH 1KB9K 3DETC 4ZODA 1A6WL 1AQKL 3GRWH 3TBYB 3OKKB 1I8IB 3GSWA 3SE9L 4QRQB 2A83B 3UYRL 2GY7B 5HVGB 3WUWG 4MX7A 3O3BA 3AXLA 5CSZA 5DD6B 4G8FB 5JA9A 2VSCA 3WN5B 3TCLB 1TETH 3BN3B 4LVNB 4U6TA 3HR6A 4L3EA 2PXYD 3WNKA 4TULH 4X6CA 4XVTL 3G6JB 3CDGA 4PLJD 4WFHE 3TO4A 4AZ8A 4GBXC 1FG2A 5IW1A 5CGMA 4O2EB 4UBDD 3KPLA 5C1MB 4PRHB 5FGCE 1EBPA 3QDHA 3T3PE 1FC2D 3LS4L 4F80A 3I02B 2WBJB 5T3XL 1MFCH 4OZIF 3T0WA 1M4KA 4H5SB 2VERN 1W0WA 4NQSB 5DGQA 1DQQA 1FRGH 4LSVL 2RAMA 1E28A 3UTTE 1HCFX 2YPLA 4OF5A 4PJ9C 5I6XC 4OZ4B 1J8HD 4H0GA 5FV1L 4KK9C 3IAPA 2R2EA 3BP4A 3U36A 4JFDE 4PP1D 2YOCA 1IGIH 1OTTC 5C0EB 4IM8A 1V7ML 3BO8A 1A2YA 2JJSA 2OL3B 3MRHB 3LZFH 1KCRL 1RZ8A 4MA8L 5GISL 3MRMA 4QRPB 2J4WH 1HOCA 2WAHA 4PV8B 1GAFL 4YWGL 1XH3A 3WFDH 4AT6A 1RIHL 5IQ9B 1KJVA 2JKXA 2NY2D 3RTQB 3FT2A 5K33A 1PVHA 3ET9F 1PG7H 3P4OB 5D9SA 1MRCH 5J06A 1FZMB 4ODVH 5ESAB 5F8RC 2BSRB 2CLZB 4M5ZH 1JJUA 2WUCH 4PB9H 4NQVB 4QHUA 4WI2A 2ESVB 5CZXD 4ZUWB 3BH8B 4QOKD 3EYQD 3RHWF 4DJMA 2NNAB 4J3UA 1H3WM 4ZUSB 1OY3B 5TE4L 4RMUA 1I85A 3KYAA 4GAYB 1TQBC 5D1XD 3TIEA 1VFAA 3CH1A 2AK1L 4PD4J 3JV4B 2J12B 3WXVL 1ZSDA 5L2KA 4WV1B 1CFSB 1PZ5B 3MV9E 4XZUA 5DDHA 5AZ2L 1BM3L 4R97C 5MEQB 3ZDZF 1IEAA 1CQYA 4MQXD 5I74C 1SBBA 5F88A 4DGYH 5DGRA 3S9DB 2OYPA 4R4BB 1FIGH 1OT1A 5FDWB 3HMXA 4ODWA 3ETBF 3S98A 2XNAB 4PJIB 4YGVB 3VXMD 4KXZI 3N9GH 4KKNA 3VFWA 5B3JF 5H8DA 1Q9WA 4Z7UF 4ODTL 4XCNB 5HHNB 5K9QI 1WIPA 1F3JB 2NY4C 4XC3H 1RU9H 3TNNA 2IQ9H 1SQ2N 3PWPB 4GW1B 1IL1B 5CMAA 2NR6D 1RQ5A 4Q6IB 4X5WB 2Q86A 3VXSB 4AMKH 1RUQL 4FQ1H 4YK4C 2GAZB 3AY4A 2X2YA 1GL4B 5M95B 1I8MB 1CLZH 1NC2B 1HXMB 4JFZH 5EC2B 4LLYB 3GNML 1NCDH 5DJ2A 3D3VE 3QT2A 1JGEA 3GRWA 1MI5D 4N90E 1ZGLP 3VH8A 5CP7A 4AEEA 2HMID 3QDME 2VL5B 3MV8A 3SY0A 4JVPA 1T3FB 4HKZB 3MRNA 4A6YH 1LEKB 4OFIA 2GCYB 4PG9A 4C83A 4U2ZA 3CLEL 4WJ5A 5I1JL 2HFGL 2A38A 4X80H 3NIGE 2NLJA 1P4IH 5LBSH 4HKBB 5C0GB 4OZFB 1MF2H 2OR8A 1C5CH 1JF6A 2XN9A 4R3SA 4OZGE 5EZOL 2Q3ZA 1YNKH 1G7PB 5F7NC 5A2FA 3AU1B 3BQUA 4JFEE 5ELIA 3NH7H 4NC1C 3QHZL 3WN5C 1NAKH 4LVNC 2X7LB 1C16A 3CCHB 2OXGA 5GGQL 3QHTC 1BWMA 1TJGH 3VXPB 1U3HD 2V2TA 2DM3A 1SY6L 3TT1L 1U91A 1BIIB 1LO2H 3I50L 4XRCA 4XTRC 3U0WH 1DLHB 5FM4A 1C5DA 3QCUH 1OTUD 2WBJC 2NTFA 1X6LA 5HHXH 3LEYH 3ULUH 3KPRB 3VCLA 1A7NL 5LCVH 2CK0H 4JRXE 2DQIL 3NABL 4LLWA 2L4OA 4TRPL 5FO9B 5KJRH 5F97E 3E3QC 2QSCL 5IBTL 3ARDD 5E8OB 2YEZA 1NJ9B 3B9EA 2AJYL 3CZFA 1IM9B 2VL4A 3QPXH 3ZTJH 5CAYB 4V1DB 4HV8A 1JGUL 1EMTH 5GJSL 5TF1H 4HUWB 4WWID 1VFUA 3ZHLA 3G04A 3W9EB 4WIQA 5HHMB 4FZ8H 4XP9L 5DJ6B 2B0SL 1SJEB 5KSAB 5KVGH 1SEBB 2G75A 3PV6B 3MRJB 4OZIA 4WI9A 1F58L 1GC1H 2W0FB 4I5BB 1IKNA 5D7KD 3HC3H 4S1SH 2D31B 2NY6B 2FIRT 4G9FD 5AWNH 5FYJE 3QAZB 5F1OB 2KH2B 4HS3B 2NXZD 3KHOA 4AIXA 4RMQA 4WEBL 5E6ID 3MBEB 2UVEA 3I85A 2W9EL 5D7LE 4BZ1H 2DQGH 3L3JA 1B6UA 4X5LA 3IJYA 4HJGB 1M7DA 3GEWB 4GQ9H 4YDVA 4AIZA 1NFKA 4R7DA 2AJ3A 4E5XA 4OLXL 3QISA 2HFTA 4RZCB 1RJCA 3UEZA 4J1UA 1VKXB 1RHFA 4YE4L 2R2BB 4JR9L 4HIJB 4PJCF 4WV1C 1S7WB 4MNQD 4OLVH 1HKFA 3VD3A 2ZCLL 2C7UA 4D0DA 2MHAB 3EYOA 3MBXL 4YXKH 1MVUA 1AP2A 2AEPH 2BNUB 3PXHA 4Z7VB 4BKLA 2E3VA 4JO2L 5HYFA 4XCEA 2JLLA 3RWEA 2BFVH 3FL7A 5D7IE 1N5AA 2NY0B 2NW3B 4ZFGH 1KXQE 3ME0A 1WF5A 3TC9A 5HI3D 3TPUA 2BJML 3VFMA 4A6YA 4Q6IC 3N06B 2CJUL 2EEBA 3IXAA 2AQ1A 3ZE0F 5JIIA 3CIQA 2DMCA 4HUUA 3UMTA 2ZG1A 4YR6B 3WFBL 5T3ZE 3DV6A 3UYOD 2UY7A 2DQFB 5LQBL 4Q58C 5ALCL 4JRYA 2VQ1A 2LAAA 2BCKA 3AM8A 4M43L 1R0AL 1GGBH 1TDQA 4D9QD 1GSMA 4RMTA 3ROOB 3HE6B 2R0LH 4JFOA 5MEND 3MUHL 3TO2A 4YFEA 5JDJA 4ONFL 1CE1L 3PJSB 3VMPA 4LAJH 2AABL 4G8EA 4GW4A 3G9AB 1S5IL 4JY6B 3MOAL 4JKLA 1UYWH 2DF3A 5IR1B 4DGIH 1F4XH 1LO3L 3S96B 1U58A 1A1NB 2XACC 5DYOB 5IFJA 4U1LB 4MA7H 1EXUB 3QWOB 3I6KB 3PGCB 4GRWE 4WUKH 4ZUTA 1UFUA 1FL5A 4TNVF 1R3LB 4M1DH 2EIEA 4N1EA 5KSUB 3H7BB 2IANE 5EOTA 5LXGH 3QNXA 1E6OL 3FN9A 3BKML 3BP6B 4KQ3L 1OD7A 1B90A 5ICZA 3MRRB 4XMPH 4AEFA 5BOPA 5GRWA 3RRQA 5JA8B 3B2UC 5JHDD 2W9LA 4OT1L 1LD9B 3D18A 2EKJA 3HC4L 2YKLH 2XQYK 1WBXA 3X3FH 3U82B 5GS2H 1BD2A 1MCRA 2Z8SA 4JJHA 3VXRE 2CDGB 5H37G 2VXVH 3EZJB 5J57B 4G8IB 3DVGA 1IFHL 4LFHG 4FABL 4FQJH 3DXAB 3KLDA 2E6JA 3QFDA 5IBUB 1N7ML 5F3HA 4ZDHA 5I8EA 1JK8B 1D3CA 3OV6A 4YQXL 1MUJA 3ZYOA 4ZG1A 3QI9B 5D8JH 5HHPA 5EBLA 2I24N 2K7PA 4ZSOB 3NCJH 4N0FA 3LKRB 3BKCH 4WEUD 1JFQL 1TZGL 3EFDL 1MFAL 4NRYA 2FLRT 3R8BB 1XGYH 5F1KC 2QADD 5IFAH 1F6AB 5KSAC 1EEYA 3RX8A 5CD5D 4F58H 2Z35B 4NKQB 1WBYA 1NCCL 4LIQL 2ED8A 5E5MB 5JNYB 5DQ9B 3QIBD 1JPST 1OP5H 2EDYA 3QAZC 3MRBB 5ILTH 1OW0C 3CPLA 3BH9B 4NHCH 3GK8L 4OGXH 4CMHC 5KVEH 3MBEC 4M8QB 1QKZL 4XHQA 2WWMC 3PQYB 4U6HA 4EN3B 4GRMA 4UU9A 5DRZB 5DJXA 4ETQA 1QBLH 4UV4H 1Q0YL 3MNZA 1S9XB 2VLRE 3O4OB 3U0TB 1BZ9B 1U8NA 2EXWC 1CR9L 5C07E 3RZWA 3KHQA 2R0ZL 2P24A 4RNRA 3AGVA 1EHXA 3FZUD 3GDBA 3SKJH 3KPQA 2ZSVB 4GG6E 5FECA 5C0AB 5ICXB 3L5HA 2DQEL 3GMRA 4NNYA 4OM1L 3DIFA 4HXBL 1RIUH 3O4LE 2CRIA 3MO1A 3SDDB 4GBXA 3QDGE 2WV3A 4JO3H 1AI1L 1F90L 5D5MF 4TOYL 1NFDE 3D39D 1OSPL 1X5KA 3MLVH 2FH6A 1ZT7A 3JTSB 3VJ6A 4JZNB 1L7TH 4MDJB 1IT9L 3TNMB 1J05B 5L88H 1PYWA 2WSKA 1WWCA 3MRKA 3QB7C 2NY0C 4F37F 3U4EB 5CJQL 1L7IL 1IKFH 3R4DA 1P1ZB 5TGBB 4PJ9A 3I3BA 5K93A 3DX6A 3MREB 3CSPA 2HWZH 1T1ZB 3W11C 3V5DB 3C60B 5IBUG 2YA2A 4KKCD 3VW3L 1MY7A 3BGMA 2A9MH 4HWEL 3WIFA 5J6GA 4I13B 3MLWL 3ZL4L 1QVOB 3IFPB 4PJBF 4PJGB 3OKLA 5B38G 1IGYA 4K23L 25C8H 2QQKH 4NNXB 1MPAH 1S8DB 4GAGL 3HE6C 1UZ6E 2C1OA 4U1GB 3SJVE 1IC5L 2ATKB 5M94B 4GAJH 3GMMB 1N2RB 1AGEA 1N64L 4IOSD 3ISWA 5DWUH 4BH7A 2H9GB 3RWIA 1A6UH 3FOMB 2BDNH 4F7CA 3HG1D 1CGTA 4ZXBD 4PJIF 3HPLA 3OKEB 2OL3H 5DMGC 3TBVB 4WI8A 5INDA 3WUWA 2PXYB 5C92A 2OLDA 5IB5A 5DHYB 3IB4A 1QRNE 5FOJA 1S7SA 3HFML 2LVCA 3D6GA 3LN4A 1GZPA 4U1JB 1E6JH 3BT2H 2EH8L 4P5KB 5F7FA 4HUXA 2FHBA 1NPUA 1OM3H 5IMLA 4OCRH 2R0KL 2AI0H 4V2CB 4P5MB 4JPWH 3RHWK 4X6EB 2VLJD 3Q6GH 2XI9A 3MRPB 4L5FH 3QEUB 1FLRH 2EO9A 3LS5L 4OFYA 1I1FA 2DYPA 1EEQA 4UQ2B 3QUKB 4XMLL 2JJTC 1EHLL 3OAUH 1J8HB 4U1HA 5F7LB 5H35A 2BNQA 2YD5A 4GKOA 4UIMB 2EEAA 2FBJL 2Y06L 4F8TA 3O3UN 1RVFL 3IDUA 3EGSB 1AJ7H 4X6FA 4UT9L 3FFCE 3BZFA 3S37H 4BSJA 4K2UL 5DSCB 2F53D 5I17B 3EDEA 3OAZH 3VXUE 1ROWA 2BHYA 2EIDA 4X9GA 3QI9C 4Q9RH 3BKJH 4NZTL 1EAPB 1A4JA 4U6YB 1IGFL 3CJJA 3OBAA 1BVZA 3DMMD 3VGAC 1QBML 3HC0A 3HNTH 4U05A 3H8NA 2AQ3A 3OF6D 1JBJA 3BAEH 3PWUB 3TA3D 1QA9B 2A0LC 3QUYD 3MX0A 3AS0A 4G6JL 4X7CC 3WIHH 3UTZA 1Q72L 4QOKB 4JB9L 5F71A 5IEHA 1BPVA 5HDQL 4ZNEE 5FO8A 1A3RL 5IKCA 1VSCA 5D1XB 4OV5B 1OAYL 4EN3C 4LVHC 1DBAH 2VUOA 4KHXL 4KK8D 3V0VB 1C8PA 3TBYA 4OKVA 3OKKA 1I8IA 3O4OC 4Z7NE 4HZAA 4QRQA 3RKPA 2H2SD 2A83A 3CSYA 5IMKB 1TVBB 2XICA 2CD0A 3BN9C 1ZT4B 5H2BB 2DOCA 5DD0L 4G8FA 3Q5TA 3QNYB 3WN5A 3TCLA 3MXVH 4OM0L 3TYGL 1PEWA 4PS4L 2ED9A 3MROA 5SWZD 3G6JA 5E2WH 5D4QA 4P2OD 3VXMB 3SDDC 3T0AA 5GGRY 4O2EA 2HLFD 1ETZA 2MJWA 1FE8H 4RBPK 1KEML 5E5RB 1CT8B 4Y19D 3I02A 3I3EA 2WBJA 4HKXA 4QRRB 1NGWA 5TE7L 2DQUL 4H5SA 4NQSA 4P57B 2VLKB 5IOPA 1J0KA 4NKIH 1OGTB 4HK0B 1UXSB 3LN5B 4QXWA 4UB0H 3E8UH 4OZ4A 4J3WA 3DURB 1MI5B 2FD6L 1GPOL 2V2XB 3Q0HA 4NGHL 3DX7B 2J88L 3B43A 5C6TL 3ZDYF 5C0EA 5IQ7H 4OF0A 3TIDB 4JPVH 2OL3A 3G6AB 3MRHA 1D5IH 3GI9H 1JI2A 1FZJA 4KPHL 1T80A 4C57C 4QTIL 4PV8A 5CUSH 2YMXL 5DMKB 5IQ9A 1BQLH 3M17B 1DJSA 3ARBC 4XP4L 2ADFH 1NQBA 3P4OA 3Q2CA 1FZMA 2K7QA 5ESAA 2NPLX 2PYEE 3QBTB 5IUSA 2CLZA 1WK0A 4NQVA 4KTEL 2ESVA 1A7BA 1G9EA 1TPXB 3BH8A 2NNAA 1P6AB 2PXYC 3GM8A 1HSAB 3KYKH 3QWRD 4PJ5B 5M7QA 2Q6WB 1U3HB 4GAYA 3HI1A 4Q0XH 4KUZH 4FXKA 2KKQA 5GS0D 3EJYC 4NPYB 4Y7MA 3S6CA 4YHKH 2YSSA 4WV1A 3IKCB 1PZ5A 2LU7A 2ZCKL 5MEQA 1UM5H 1YNLL 3NA4A 2EH7L 3TBWB 3IXTB 4HC1L 2DIJA 2P48B 3EW3B 5FAAA 2AEQL 1RFDL 1W72B 1LK3L 5MP6L 4HULB 1DN0A 3LD8B 4LEXL 2XZQH 4R4BA 3ARDB 1N3NB 5EIQA 2PN5A 4WU5B 5FDWA 1NGQH 1A21A 2XNAA 4PJIA 3LRHA 4YGVA 1BVKB 3FO9B 4LCUA 4LARL 1QSEE 5HHNA 3L1OL 1EO8L 4TVPD 4CU7A 1F3JA 5F9AC 4LCYB 3WIHA 3MOBL 1ORSB 3PWPA 1IL1A 3HMWL 4GW1A 4NSKA 3CVHH 1XF4B 5GXBB 3MRGB 4Q6IA 2XFXB 4X5WA 1T2JA 3VXSA 2I25N 3KYOB 1OARL 4KJYA 2GAZA 1WAAF 2WP3O 4LPTA 3HCVB 4P9HL 4M5YH 3S34L 2YWZA 1JZ3A 4FFYH 1I8MA 4X8XA 1NC2A 5H37H 4PJFB 5GS0L 2GHWB 4D94A 4G9FB 4Y1AE 3B9DA 1D7FA 2JK5B 2HT2C 2NXZB 3KXFD 4QF1A 4QXGH 2QHLA 3MMEA 2CRMA 3STLB 1Z9SA 3S36X 2J3SA 2XOTA 4K3EH 2VL5A 5I9QB 1MOEA 1L9MA 5CZXC 3V7MA 1T3FA 3BUYB 2OXHA 1WZMA 3C2AH 5E5UB 5GIRB 1G1CA 1UJ3C 1AY1H 2GCYA 4W81A 3R06B 3FN3A 2J2ZA 5AZEL 3L7FA 3MLRL 3G6DL 4YDJB 4YHLL 5KTEL 1K2DA 1ULVA 4TVPL 4P3CL 4J3VA 5KS9E 3HHRB 1KCVL 3F12B 2I60H 5C0GA 5BMFL 3MJ9H 5J8OA 2G60H 4MVBC 3QPQD 4MNQB 3IU4H 43C9B 4PGBA 3EDJA 4MQXC 4M62H 4ELKA 1NMAL 1G7PA 1FFQA 3AU1A 1RMFH 2Q3AA 1UACH 2VR9A 2X7LA 3RPIB 4JFFE 3CCHA 1K3IA 1J0HA 3UTQB 4XC1H 4NFBA 1A14H 3VXPA 3KPTA 4HXAH 2OTWB 2DQTH 1BIIA 5T1KB 4OTXH 3MNVB 2N4IA 1DLHA 4J4PD 4NWTL 1QO3B 1IGMH 3QEQE 1LDSA 1RUML 4PJXB 1FL3B 2OTUB 3KPRA 1T6VN 4ZD3H 2B1AL 4RAVB 2E7CA 2BRQA 1G0YR 5E8OA 5E8PA 3ILQD 2KBGA 5CKAA 3LPGA 2GSGA 3BPOB 1IM9A 1U8IB 4LCIH 5LGJA 4V1DA 4JKWA 3NN8B 1KIQB 5FYLH 2C9AA 3WHE1 2M1KA 3QUXC 4JZOB 4YXLH 4HUWA 4ONOA 5HYJE 1M05B 5DEFB 4G7YH 3D5OF 3W9EA 2FNBA 4WTXA 1YQVL 1HHHA 5KOVC 2H32B 4M7JH 1P2CB 4LHQB 4NP4H 5DJ6A 5ESQB 1IARB 1SJEA 5KSAA 1SEBA 3PV6A 3MRJA 5GGRB 4PJEB 4Z7QF 4LASL 2W0FA 4I5BA 2Y5TB 4U49A 5C3LD 2D31A 2DKMA 1ZHKB 1LEGB 3IDIB 1FBIH 5TQ0L 1OW0A 5K9KB 3P9MA 2HVJA 3EYVB 3MBEA 4NOFA 3GMPB 3RX5A 4Z8FH 5CILL 1BP3B 1B2WL 4JN2B 1TPXC 1HNGA 5DD5L 5IHZB 1FYTB 3FB8B 4HJGA 4PRHE 1AKJD 1XIWD 3I6LD 1A6AB 4Q2ZB 1GVIA 4PJDF 4XAKD 5HHVH 1U3HC 2GJ6A 3IT8D 4KDWA 4RZCA 5KBNC 2G2RA 2XZCL 3QQ9D 3ZE1E 5JHDB 3PDGA 1VKXA 2EDHA 2R2BA 4HIJA 3OB8A 1G7IB 3CVHA 3RIFK 4PP2B 3KYMA 1KTKE 2DLIA 3DYMA 3SKOB 1NLDL 4MD0B 4AL8H 1C1EH 2FHFA 4HBCL 2BNUA 4KFZC 5CJ5A 3ARDC 4PJGF 5DFWH 4POZD 3V5HA 4E0RB 3KAAA 2IH1B 5C2BL 2P8LB 1R5IB 1JYNA 4KZEH 5EOQH 3ARPA 2NW3A 4FMFA 1BBDL 3MJ6A 3NA9H 1YEHL 4QRPE 3V6BR 4NO5B 1QP1A 3ARTA 3FQTA 3BX7C 1FH5L 1NBYB 1MJUH 4EIGB 1XGRA 2QADB 4WDIB 5HI4C 2DQDH 3JTTB 3MV11 4YAQB 3RP1A 4W6WB 3VXNB 4YR6A 2Y6SD 4BSWB 5GRUL 4DWHA 3MJ9A 3QIBB 2DQFA 3ZYJA 3OQ3B 1J18A 3DI3B 1NUGA 4J23A 2EDXA 1DR9A 3SE9H 3VD7A 4MNGB 2X1OA 3IDMB 4MB3A 1MHCB 1QSZA 4KHTH 4NJ9L 3UZEA 3BW9B 4LNRB 5I9QC 4YNYB 5MEOB 3HE6A 2XA3A 5C9JA 5IFHL 4U3XA 3Q1SL 3UTSD 2H41A 4KXZH 5IK3A 3PJSA 1EV2E 3X14B 4LSTL 1QEWB 5E24E 3S96A 1A1NA 3KS0H 4U1LA 1YY8B 1EXUA 3QWOA 3I6KA 3PGCA 2BOBB 1JNNL 1MJ8H 1RIVL 5DQDL 3VDAA 1R3LA 2I07B 2VUYA 1J1PH 4RWYL 5A2IH 2ORBL 2Q76B 3D39B 5KSUA 5H94B 2YWYA 1R24B 1JIBA 3BPLB 4K7PY 3QIUD 1UWXK 4BZ2H 4EUPB 3LMJL 4M7LL 2O61B 2EKSB 2NX5A 2HFEB 5D2NC 3MRRA 1Q9KB 3V52H 2VR5A 4LLQB 4HFWB 2B5IB 1V7MH 2N1KA 2QL1A 1LD9A 4X98B 1KCRH 2JJTA 4LEOB 3RUGB 1VACB 3GHBL 4FQXD 4PJAE 4NQED 2CDGA 3TLRA 4YO0A 5HHOB 2DQJH 1WFTA 3ZDXE 3I84A 2GYSA 1GAFH 5IESL 5J6HB 1MWAB 3DXAA 4X0KB 4OLWH 4ELMB 2JB5L 1B4JL 1X6NA 3KR3L 5DK0B 3BPOC 1NUNB 5TH2B 1JK8A 1R3HB 1ONQB 1R3IH 1KLGB 3QI9A 5F7EL 3VA6A 1GH7A 1TJHL 4ZSOA 3KLHD 2AKRB 1NAMH 3LKRA 2PTUA 2EZ0D 1CGUA 4M7KH 5B38A 4WFHD 3WBDA 1FCCA 5ENWB 2R4RH 4LSSH 5C2UB 4XI5D 1JPGB 1F6AA 5I76B 1MRFH 2Z35A 3E6HB 4NUGL 4TNWF 4HG4K 1P7KA 3FAWA 3SQOH 2XQBH 3HG1B 4P5TB 4U0RB 5EO9B 4ZXBB 5DQ9A 5JNYA 3RU8L 1PY4A 3WXVH 5I15H 4OCWH 4K94L 2FJGB 5BS0E 3D9AL 3MRBA 4OAWB 4XH2B 4D8PB 3BH9A 2HKHL 3EYUL 5B4MD 1FGNL 4DN3H 1JWUA 2HT3D 3EHBD 2N7AA 2LV4A 3UTTD 1ODAA 1YJDC 3PQYA 3LAFA 4EN3A 2FGWL 3W39A 5DRZA 2VO5A 3WXWH 5ABDE 2EYTB 1QFWL 5DZNA 4R90H 4K7FB 2Q8AL 3U0TA 1BZ9A 2KZWA 1I9IL 2VLJB 3EO0B 1MH5B 4MQSB 2OCFD 3N1GC 4ODTH 1CBVL 3CVIL 1KPVB 15C8L 1EAJA 4Y5YC 4Z0BL 3NPSC 3X3GL 3KDMB 1W0YT 2ZSVA 5IB4B 3HRZB 5C0AA 2NY1D 5ICXA 1R6VA 1JCKA 1BFSA 3DVIA 3W2DH 1YMMD 3EJZD 3SDDA 1RUQH 3O3DB 4EUPG 2X4NB 4TSBH 4ZS7H 5DJYA 4A2MA 1HIML 5F7HA 1L0XA 3WV0A 3JTSA 4JZNA 4MDJA 5EUOF 1NCBH 1XCQB 4WHTB 2CKNA 3TNMA 1J05A 2VDRL 3C6SA 4YX2L 3SDCC 5HHME 4NOBA 1YA5A 4QWWC 2D7QA 4PV9A 1KG0A 3Q3GA 3U4EA 4MXWH 4JHZA 1TCRB 3KPOB 3X12B 1P1ZA 3DMMB 5TGBA 1AGDB 4K07A 4LL9A 1MAJA 2FO1A 1CFTA 1OQOA 3MREA 2QADC 2E9BA 4M7ZB 1JGLL 4FN0A 4NWUL 2YHGA 3T3MF 3QUYB 1PGRB 2HRLA 2MKWA 3SOBL 1N8ZB 1EA9C 4KDVA 3QIBC 1YEGL 3F65A 3TBTA 1E4WL 1QVOA 3HB3D 1DBML 4LF3B 1S7UB 4PJGA 1HHKB 1T2QH 4XXDB 4Q9QL 2WIIB 4NNXA 2HLAB 4Y88A 4BJLA 1OP3H 4JHBA 2DDQL 4JJ5B 4UOW1 3LKOB 2QSVA 4JFYB 3ARBA 2FATH 2ZJSL 1YEKH 2ATKA 2J8UF 3GMMA 4F7EB 4R0LB 5CHNA 2XA8L 3EOYG 3TT1H 1JPTL 1KN2L 1U42A 1RURH 2D9QB 3OMZA 2H9GA 3P0YL 4RFEB 4JDZB 2ZCHL 4LPUA 3OKEA 1J87A 2PXYA 4JFXB 4Z7VE 5DHYA 5SWZB 3E2HB 1SYSB 2BSTB 4WFFD 5GRXG 3PGDB 3Q6FB 4HMEA 4F7MB 3D3VD 3BPLC 4NRZB 5IBTH 5F93C 4P5KA 5KVDL 4N90D 4Y19B 5L7XH 5C08A 3FCTB 3P2TA 1EX0A 3QDMD 4XWOC 3O2WH 5FEBA 3MRPA 3QDJD 4BYHA 3QEUA 4HCRA 2B5IC 3WHXA 1NAMA 5FYKL 3WYRA 2ZZUT 1BOYA 5E00B 4F7TB 1J8HA 1Y6NR 1CG9B 1T20A 5GZOC 2B0SH 1D6EB 4RGOL 4U4BA 4UIMA 1JMXA 5I1HL 1PW3A 3MLZL 5CSBA 4TYUA 5F7WC 3ILPA 5I1KH 2P8MB 3EGSA 1H3TA 1KCUL 4HUKB 5D93B 1U3ZA 2A2QT 4X6CE 5DSCA 5E8DH 5I17A 1FZKB 3CLFL 1U8JB 1W72H 1EAPA 2NY7H 4WU7B 5ANMB 3BESR 4PTTB 1FHGA 1N5YL 3SCMD 3K7UA 1IILE 3A0OA 5FA4B 4QTHB 5EU6E 3PWUA 1QA9A 1CLYL 1AGBB 4DFIA 2B4CC 2K9UA 4UI2A 4P5TC 4ZXBC 1VEPA 3O0RL 3RVUD 4JN1L 1UJ3A 2L0DA 4KMTH 4FQHB 4JQVC 2JJWA 4JM2F 3MGTA 3N1QC 4UDUB 2NXYD 4PLNC 3ZLQC 1H15B 2ZUWA 2ID5A 4N5ED 4PJXF 4X7TB 3V0VA 1CD1B 3BSZL 2ERJB 1DLFH 5IMKA 1NGPL 2DQCH 5KSVB 2VH5L 4GJTB 5H2BA 3A6OA 3QNYA 2EDTA 4IOFC 2FX7L 1NBZB 2H3NB 1P5UA 3HKFA 3B9AA 3ARWA 3REWB 3VXMA 2AJXH 2H8PB 2VXQL 4LLDB 5KSBF 3EDKA 3O3EB 3QRGL 4PJHE 3QXUA 2EDRA 5FYJD 4HK3N 5CKGA 1CT8A 3VMOA 5I0ZA 2FB4H 5LQBH 5I1CL 4KQ4L 4QY8B 5ALCH 4G3YL 4QRRA 4ZYKA 1UWGH 3DYPA 2X1PA 2AK4B 2DICA 4P57A 2VLKA 2Y07L 1KENH 5T1DL 1EFXD 1OGTA 1JHKL 2QHRL 5ITBH 1F45A 3LN5A 4U1IB 3C2SA 4CMMB 3HNSL 2E8YA 1I9JL 1A6VH 2V2XA 2AABH 4DK6A 4M7ZC 1CDBA 4FP8L 3DX7A 4LMQE 3MOAH 5JO5B 2VN4A 4ZFZA 3QUXA 4QHKI 1BREA 3TIDA 1IC4L 3G6AA 4OZHB 1F3RB 4PJ7B 1P4BL 4M1CD 5F21B 4WW2B 3HZVB 2HVKA 3U2SB 4NQTA 4N8VB 2DWDB 2JCCB 5FYJL 1G7JB 3M17A 3BKMH 5TPWH 2A74A 4JKPH 4KQ3H 3F8UB 4KUCD 5DUML 4N5UA 3MV7E 2YXMA 4X8JB 1GIGH 5ESVB 4R0LC 4WFGD 1MJJB 4N0UE 3HLAB 3T4AA 4BFEA 3RI5F 3H9SE 3T2OA 1MAKA 4LU5L 1ZANL 1HHJB 4AK1A 5GPRA 1HSAA 1FPTL 2H32H 3E2HC 4X9BA 1EBAA 5GGSY 4PJ5A 3B2VL 3JWOC 5T3ZD 3IDYB 2HLFC 1U3HA 1IFHH 1Y0LA 2DLGA 3LHPL 5DJAB 1JF1B 2VDOH 5D7JA 1XCTB 1QSFB 4HS8L 4NPYA 2W91A 1J8KA 1UXWA 4HF5L 3IKCA 2BVPB 1MJ7H 35C8L 3TWCH 4YQXH 4O02H 2D03L 2O5ZH 4AQOA 3TBWA 4XNZB 1YJDH 3IXTA 3CXDL 1YYML 3OKNB 4H0IA 1ZLWK 4P49A 4JO1L 1W72A 3QRFM 4PR5A 3K2UH 5F7KC 3ARDA 1MFAH 1N3NA 5F3BB 1A1OB 4WU5A 1DQLL 1J9CT 2YUZA 3T77B 3OXRB 3EJJX 4XCFL 1LP9B 1UH3A 3S36H 1BVKA 5T3XE 2CLVB 5DA4A 3RNQB 1HH6B 1ZVSB 4LIQH 4LCYA 4Q6YA 3RVXD 2H26B 3PE9A 1ORSA 4M4RA 2QV2A 2X4PB 1XF4A 5HDLA 4M3KB 4TSCL 3MRGA 4XX1E 5D93C 1JPFA 3DVNA 1X5LA 2XFXA 3KYOA 2IAND 2O5YH 5T3ZL 3SGJC 3NIDE 3BKYH 2EE2A 3HCVA 4FFVD 1QR1A 1G9ML 4L1DA 4ESKA 4HGMA 5DQJB 4G9FA 3X13B 3UTOA 2JK5A 1CVRA 1J86A 1T7YA 3VXQB 3U6RA 3STLA 1TFHA 1KIRA 3GHEL 3VRLE 2NQCA 3PDOB 4DVBA 1H8OA 2ZSWA 3HE7C 4J3TA 4HW6A 3RDTD 3BUYA 4DN4L 3VXRD 3UAJD 1FJ1B 3O41B 4OM1H 3KWWB 1A6TB 3R06A 2ZUXA 4N8VG 1HH9B 5KW9H 3QG6B 4J6RH 3LEXA 3RUGF 3F12A 2FX9L 3MLYL 4EJ1C 1IT9H 1KXTB 1CIDA 2E7HA 1QLFB 2LQRA 4PREB 2ERJC 3IJHB 3BWAB 2Q7YA 43C9A 5C0CD 2QR0B 4L4TA 1P7QD 4XWGL 5DUPL 2WZPD 1SJHB 4OZIE 2JB6B 3G5ZB 2BSSB 3A6CH 1VEMA 3CU7A 5C9KA 4S2SB 1KELL 4XNXH 5CBEB 3RPIA 2X40A 1W8OA 4D0BB 1FL6B 3OPZL 5D2NA 5IHUH 3O6KL 4R7NA 2OTWA 1G7QB 1G9NL 1UB6B 5T1KA 4XPGH 4I2XE 3MRDB 2AVGA 1TVDA 3V7AG 4HLZG 1A6ZB 3MLWH 1QO3A 4D9RD 4HHAB 5DR5L 4PJXA 1FL3A 3S8WA 1DQJB 3F58L 4K23H 4L4VB 4RWHA 5E6ZA 5TFSH 4WNQB 3RQ3A 4RAVA 4GAGH 1AD9A 4EUPH 5ICYB 2DD8L 4UNVA 4GRLD 4JO4L 2EIZB 4QOKE 1FP5A 4AENB 4YLQT 1P84K 4BSVB 3NN8A 1CXEA 1F02I 2FR4B 1MCDA 5MEPB 1A3LL 5HYQB 3ULVD 4JZOA 2WUBL 5KSBA 1M05A 4WGVB 3O4LD 4M6AA 5DEFA 3BRDA 3QDGD 3UTSB 4G6AC 2H32A 1P2CA 1PJ9A 3HFMH 5ESQA 4WW2C 4JDTH 4OSUH 5I1GL 2BERA 4FTVE 3H7LA 4OI9A 1KCKA 3JV5A 5GGRA 1ND0B 1MWAH 1GOGA 1T83C 2D3VA 2Y5TA 1JRHI 1CDHA 2R0KH 1T5XB 4R4FL 3QPQC 3RGVB 1LEGA 2YXFA 2A1WL 3FJTA 5K9KA 5HI5C 1CGWA 1V7NL 2OP4L 4HIXL 1OAZH 3WL9B 4KRPB 5IGXH 1K8IB 4C56D 3C5SB 4MXQD 3SGDI 1FYTA 2ZUYA 3FB8A 2BK8A 1UEYA 1RJYB 4ORGA 5ISZE 4Q2ZA 4WVRA 3ZYIA 5IB1B 2IALB 3IDYC 2B4CH 2XRAL 5E7FA 4Y5YA 3DBXB 4G5ZL 5JHDA 5JMRA 1I7ZA 4I77L 3ULVL 1VB9A 5EA0L 4Z7UE 1GCFA 1G7IA 3UJJL 4PP2A 4K2UH 4NQEB 3SKOA 4MD0A 4RFOH 1ZGLM 1MI5E 3L7EB 4PD4K 4XNZC 2DLEA 4ZPTB 1JHLL 4DFHA 2P4AB 2B2XL 4Z77B 1IGFH 1LDPL 1OTSC 1S9VB 5J11B 4LVOB 5I19L 2AP2A 5K9JL 4E0RA 4XPTL 2IH1A 2UUDH 2R9HD 1ZXQA 3CDCA 3SDCA 1U3YA 2P8LA 4HH9B 1JNLL 3FRUA 3VE0A 4GSDL 4G6JH 4P2QD 5E2UL 3G5VB 5HTSA 3EFFB 4WHDA 1J5OL 3O6ML 5L8LB 1QRND 1DQDH 5HDQH 2D7TL 2ZOLA 2HKFH 4FS0A 1NBYA 3P3YA 1D5XB 4WDIA 5JQ6H 5FGCB 5JHLL 1OAYH 2CR6A 3MFGB 3VXNA 1TJIL 4YAQA 1QQDB 4BSWA 4ODHL 4DAGL 2GK0B 1RUPH 3V6FB 5I71B 2ZG3A 3QIBA 3WDHA 2JJUA 4P3DB 1CF8L 2IADB 4EDWH 3IDMA 4YZFE 5FCUH 2EXYD 1H3VA 3UTTB 1YEFL 3BW9A 4YNYA 1BZQK 5MEOA 5E08H 3WS3B 4LPVA 3KJ6H 1KC5H 2V2WB 3NCFB 3AS1A 3WDIA 3N1FC 3BHBA 3U0PB 3ZT6A 1FVCB 1QUNA 5GRJL 3VFTB 4L8DB 5C0RH 3X14A 3BE1L 5A2LH 4F7PB 1OCWH 1QEWA 2BRRH 3FFCD 4WW1A 2I27N 3OAYH 2NY1B 1YY8A 3F7VB 1KN4H 3O8XB 3DLQR 2BOBA 1VFOA 3ZKMD 4J3XA 3SGKC 1YMMB 2I07A 2UWEF 5DK2B 4QRUB 2Q76A 3D39A 4FRWA 5B8CB 1BLNA 5H94A 1R24A 4J8RA 2Y1VA 2EE6A 3CSBA 4EUPA 1DL7L 4AG4L 4XPHL 3O9WD 2J5LB 2FD6H 1GPOH 4NGHH 5FB8B 2HFEA 1INEL 4YHOH 4ZTPH 3RGHA 1Q9KA 1MRDL 4LLQA 2VQTA 4HFWA 2BSED 1BBJA 2RFXA 2R2CA 3OGCB 2IJ0C 4LEOA 4MA1B 3RUGA 5D7KE 4R96B 1DSFL 3JWOH 1U6AL 5HHOA 3IETB 2BX5A 4QKXB 4OGZA 1A7QH 3AS3A 5J6HA 3MLUH 1MWAA 4X0KA 4K71C 2EDOA 3MV9B 1WWAX 5DK0A 3BZEB 4CU6A 1N0XH 5TH2A 1R3HA 1ONQA 4D9LH 5BJTB 2VXSL 3FOLB 4U3CA 1KLGA 2VAAA 5A3ID 5CSGA 1FFPB 4HX1B 1RJLB 4UINL 3WJLC 2AKRA 4X4XB 2QQNH 3IAQA 1OVZA 2R2HB 5TQ2L 5ENWA 4WO4D 5EFIB 3S7GA 2Y4SA 5EU3A 4AJ0A 1UM6H 1IEBB 3WNNA 5LGKA 4MNQE 1FORL 3E6HA 4P5TA 1NMBL 5EO9A 5BZWB 4ZXBA 2VSDA 4U7MA 4NO2B 4D3CL 3RGVC 2CGRL 4OAWA 2ZOKA 4XH2A 4D8PA 1T4KA 4PJCE 4JQVA 4DGVL 3DPBA 3GMLB 3GSOA 2G5RA 5IVOA 3D3VB 1AFVL 1NL0H 2RQ8A 4KRPC 4S0TD 4XP1H 4K7PH 1KIPB 1CFBA 2HTKD 3W82A 4UNTA 3WLBB 4K7FA 3QDMB 2FECL 1MCPL 3EO0A 3T1FA 2VLJA 1MH5A 4LARH 1QLRB 5CINL 1EO8H 1KPVA 4ZS6C 5J3HD 5ACZB 4HS6A 4KZDH 3KDMA 1DQTA 1YQ2A 3EZ8A 4TQEH 1XAUA 4QT5B 1CDJA 4QXUH 4LQFH 3O3DA 3T0DA 5GSVB 3TYFB 1J10A 1S3KH 2X4NA 5BRZE 1TZIB 5F1NB 4CW1B 3KPSD 3BZ4B 5J11C 1XCQA 1HE7A 4OZGB 4GKZB 5KVFL 4WHTA 3GZKA 4WW2F 3WCYA 2PYED 1JPSH 3H42L 5CJ8A 3ZKQD 5MENE 4QYOB 2NW2A 2AJVH 3WFEH 2QLVB 3KLHC 4AY0A 2FX8H 3MODL 4MHHI 3X12A 4FQIH 3T1WA 3QO1B 4G8GD 1AGDA 4JHWL 4HUVB 4PJEE 4LLVB 1V3MA 3SCMB 4J2XA 1RZKC 4XI5C 3RVTC 3G6DH 3OF6A 3PP4H 1SEQH 2GTWB 2VNCA 4P3CH 1N8ZA 1AXTL 1QNZH 1KCVH 4EDXA 1MFEL 1WICA 2WLZA 2XYCA 5I71C 3UPRB 4FHBD 4LCWD 1K4CB 2XKUA 3B8YA 3WKMH 3SE3C 4LF3A 3CFEB 1S7UA 3L5XH 1HHKA 4MJIE 1X5XA 2HT3C 3EHBC 4XXDA 3MACL 2WIIA 1VGEH 2NXYB 2HLAA 5DJZB 1H8NA 4JJ5A 1I3VA 4JFYA 4XPAL 2LU4A 1CE6B 3L9RB 2MKLC 4JM4L 1IBGH 4H8WL 1YEIL 1YC7A 2MNUA 3MUGB 4R0LA 4IRSD 2ZNWA 2BHUA 4Y4HC 4LKCB 4M9PA 4YDIL 3OX8B 5F96H 3GBML 4JDZA 1RHHB 1LP9F 3O8XC 4JFXA 1RUMH 5SWZA 5IV2B 1SYSA 2BSTA 3EJZC 5JR1L 3OKDB 1D5ZA 5EWIH 3PGDA 3Q6FA 4P2RE 5JOEA 5B8CC 1H0DB 2IH3A 3U30B 1DP0A 3T65B 3VD5A 1DANT 4Y19A 4HAGA 2BMKB 3FCTA 5D7LB 4CADB 2PNDA 4YBLB 4YHNB 2GIYA 3BD3A 4GH7B 3RIAK 3UO1L 1CGXA 1EFXB 4R26H 1ADQH 2RR3A 2R29H 3CU1A 5E00A 4F7TA 1CG9A 5DMIL 4Y2DD 1C12A 4CAGA 5JIPA 1D6EA 4LHJB 1SHMA 3KJ4C 4ODSH 4NBYB 2QSQA 1WZ1L 1EHNA 1TMCB 5TJWK 3QH3A 4JAMB 5TQ0H 4GXUN 1MREH 3HB3C 1TENA 1FZKA 4HLZH 3SGJA 4MGXA 5CILH 5CZVL 4JFHE 1YDPA 4FQPA 3VGHA 4JFFD 5DD5H 3C8HA 4R9HA 1UB5B 4DKEL 1MFDH 4PTTA 1G0XA 4XP5L 5D7IB 1V5JA 2EYSB 4PJ8B 3VG0L 4ALAL 5FA4A 4LSQL 4QTHA 3BVNB 3MCG1 1KEGH 3U4BH 1WCQA 2RB8A 2GT9B 3DECA 4MD4B 3HE7A 5DD1H 4OGYL 2IWGA 1DN2A 1Z6JT 4NM8H 4M1GH 1KT2B 2HH0H 3QWRA 3T09A 3TPKA 1L0YA 2VXTH 2Y36H 2NYYC 3BZDA 2P5WE 3EYSH 4UDUA 1Q0XL 5BV7L 1NFIB 4JANB 1AD0B 1PX3A 1FO0B 1H15A 1ZTXH 2NY3D 5D5ME 3VGBA 3MRCB 1RZIB 4O5LH 3H3PL 6FABH 1IAIM 4ZNCD 1I8LC 5HYJD 4AH2B 4XBEH 1M7IB 4JLRB 5MERA 4MAUL 1CGSL 4MZ2A 3T0BA 4CUCA 4O2CB 5L2JB 3VGGA 1NBZA 2H3NA 4ELME 3REWA 2H8PA 1CLCA 4QGTA 2DJSA 3SDYL 5D72L 2WQ8A 5C6WH 1CDUA 1DCLA 3O3EA 1NDMA 4TPRH 4GRWB 1OAKL 1E27B 1T0MB 4FQLL 4Q74A 4WCYL 4P23D 2YC1B 4AEHH 4LVEA 5I1AB 4HJ0C 1QLEL 2AK4A 5HVFB 4ZFOB 2IANB 5GHWL 5BO1L 1N4XH 2IPUK 4PJBE 3MLSL 4KI5F 4U1IA 1KB9J 4CMMA 3RZCC 5CJOL 3HG1E 4ZQKB 4OCXL 2G5BB 4I3SL 1LMKA 1FFOB 2L7UA 4WUUA 3IRZA 2R69L 3TT3L 4O2FB 5BZDB 2BVUA 4JDVB 5CLTA 5LKNA 1QYGL 1U95B 1Z0NA 2W9DL 3RDTB 2YD2A 1U8HB 5IW6B 3VXRB 3FN0L 3O11B 4OZHA 2YS4A 1JNNH 3DGGB 4NO0B 4PJ7A 4U6XA 2GTZB 3U83A 1G6VK 5E2JA 1FGVL 1MSPA 4WW2A 1XF3A 5DT1L 3U2SA 4NN7B 4N8VA 2DWDA 3UX9B 2JCCA 4BFBD 1T83A 3LMJH 4N5EC 5CEYB 4XP6L 4N0YH 1T1YB 4DW2L 2XPGB 4OD2B 4AM0B 5ESVA 3RFZC 5A16B 3HI5H 5C0CB 3T2NH 1MJJA 1P7QB 4HGKC 3HLAA 1UZ8B 1ADQA 3D48R 4HQQH 5BXFB 3NCBB 1HHJA 3W9DA 1OQXA 2VISB 1TXKA 3M8OL 4S1DD 4WY7H 5IMMB 2F53E 3U30C 4MCYB 1JF1A 2JELL 3LIZH 1XCTA 1QSFA 5IROA 4E9LA 1B4JH 3N1PC 3EOBB 3NIFE 2BVQA 4JG0L 4NYLB 2BVPA 3T3PF 4L4JA 4YBLC 3P11H 5DK3A 1MAML 1I1CA 3VFGH 3OKNA 5E4EB 3FQUB 3JV6B 5DURD 2VLRB 1WCBB 3TJEL 5F3BA 1A1OA 1DEEB 1A5FL 5C07B 1FNHA 4GRLB 3S88L 1ACYL 3T77A 3OXRA 3RBGA 5DLML 2XXMB 1LP9A 5L9DH 4GG6B 2CLVA 1FNEA 4M6MH 1OLLA 3RNQA 5I8OL 1HH6A 4Z95L 1ZVSA 4KC3B 2WANA 3FTGB 2H26A 3O4LB 2X4PA 1XF5A 2VDQL 1Q9LB 1FAIH 3QDGB 3ARFB 3EYUH 1NFDB 2CQVA 1YPZE 3RWGB 4XBPA 3LQAC 3IJSB 4CBPA 3DUSA 1D6VL 4LP5A 4URTB 5HDOA 3D0VB 1HNFA 3T0ED 5DQJA 3PWNB 2PO6D 4X7SL 3X13A 4PJ8C 4ODXB 5JW3L 3LKPB 2IPTH 2DTSA 1CBVH 1F4WH 2DQHH 3GSNL 15C8H 1QACA 4LDLB 3PDOA 4NNPH 1VENA 2CRYA 3S4SB 1D5BB 3CDFA 1MCOH 1J88A 1FJ1A 3B4NA 1MY5A 3O41A 1RZKH 1A6TA 1HH9A 2XIDA 1QFWM 3QCVL 5I8KL 4E41E 4I3GA 1NUFA 3QG6A 3HAEB 3EYFB 2AERT 5K59E 1INDL 3HI6L 4HJJL 5T5NG 1P53A 3BDBA 4UTAL 4NFCA 3O6LL 3S35L 1Z5LB 3UBXB 2FGZA 1QLFA 4NN6C 4YBQC 4YX2H 4PRDB 3SGKA 3IJHA 3BWAA 5D7SL 3FMGL 1ZVHA 2QR0A 4IEFB 3C5JB 1SJHA 3VFVA 1I9RL 2JB6A 3G5ZA 2BSSA 3TN0B 3KLAB 4S2SA 5CBEA 1NSNL 4KKAD 4D0BA 2DAVA 4GS7B 4LSUL 1FL6A 3VWJD 1I8KB 1MELA 4PBXA 3ZHDA 5C7XH 2PTTA 4FNLL 1JGVL 5EOCJ 2LABA 1G7QA 2DTMH 1UB6A 5BS0D 3RVXC 3MRDA 3VWKB 1QRNB 1YEGH 5DC9B 1A6ZA 1HINH 2DM4A 2F9BT 1CICD 4OB5L 1DQJA 4L4VA 2W0PA 3OG6B 4Q9QH 4WNQA 1LO4L 4YHPB 2FLBT 5IEKB 3EIFA 2YD4A 1XF2B 2GEEA 4OF3A 2EIZA 4TUJB 4NKOB 5JORB 4ZTOH 4BSVA 3WEXB 2OJZL 5DVNA 4B7IA 2FR4A 4FZEL 1MFBL 4BZYA 2IBBA 3SPVA 4OLZH 3WJLA 5HYQA 5MEPA 1G9NC 3QCTL 3CMOL 4N8CH 5F6HJ 3UTSA 2C4FU 4ONHB 2Q87A 4DCQB 1Z2KA 4NN7C 2R23B 1ND0A 3FFCB 2ZKHH 2PYFB 3H3KA 3QQ4B 3P30L 1CQKA 3BXNB 3VXUB 1YMHA 3RGVA 3TZVA 4PRPE 1GGIH 2Z4QB 4GKNB 4PGEB 1V3JA 3S4SG 5IT2H 4L8BB 4KK6D 4OZGF 3WL9A 4P9MH 3GKZA 1F2XK 4TVPE 4JGUA 5LWYL 4L8CB 5C3TA 3ROLB 3T4YB 5AG8A 5EPMA 1HZHL 1I7RB 3NZHH 4P99A 1SM3H 3IDJB 2IALA 3QUMB 3UBXG 3MLZH 4EQ3A 1E4XI 3SDAD 4KJPC 2EDNA 4P46C 1QG3A 2XTLA 5CBAB 4NQEA 1GGYA 4NBZB 4KWUA 1L6XA 5CIPH 3CLFH 1KB5B 3L7EA 1J0JA 3GBLA 3BGFB 2R1XB 3KXFE 4JVUA 5E4EC 4GT7A 4WEMB 3VGEA 4Z77A 1S9VA 1PD6A 1MHHB 1QR4A 3RVWD 1N5YH 1WAAE 4GRLC 2VITB 3GSQB 2AGJL 1F8TL 4RMSA 3HR5A 3BFOA 5F9JB 4HH9A 2WK2A 3STZB 1J1XH 3G5VA 4LPCA 2OI9B 4KRNA 3EFFA 1FSKB 1I75A 2R15A 5B3NA 4LKXB 1TTGA 5JXAL 1W8NA 4WO4B 3ARFC 2VDNL 4OJFL 3TBSB 2O93L 3MA9L 1MEXH 2FWOB 4Z7OE 3P4NA 5GGSA 4GMTL 2H1PH 2AQ2A 1T5WA 3QIWD 1QQDA 1X5GA 5T1LD 2RHEA 2GK0A 8FABB 4IHOA 3P0VL 2AJUL 4H88L 4I0PD 4HH8A 4CVZB 1BGXL 3V0AC 3NTCH 4P3DA 3SE3A 3A6BL 2IADA 4MHHG 1IQWL 1U36A 5I1EL 2IG2L 1NGPH 1OLZA 2DM7A 3UTTA 4G6MH 1NKOA 1BECA 4L9LB 3GJFK 3NGBC 3J8F7 1U92B 1MIEL 1BMGA 3FHQA 4MXQC 5CEZE 3LB6D 3U4AA 3WS3A 2FX7H 4HWZB 2V2WA 4JFDA 4BH8B 2IFFH 3U0PA 2PR4L 1RZJL 1FVCA 1KYOJ 7CGTA 4Y4HA 3VFTA 2CO7B 2MCG1 4L8DA 3QJFB 4N9OB 2X09A 1DFBL 1WISA 3F7VA 2DBLL 3TO4D 3D25B 3O8XA 5DI8B 5F72S 3DUHA 2Z31C 4YIQB 5DK2A 3K8MA 2Y07H 2VDPH 1FDLL 1JHKH 5EO1B 5B8CA 3FT4B 3TN0C 5SWQB 1KJMB 1FFRA 1RZGA 2PYEB 4GS7C 1GOHA 3I6GB 2R9HC 4QXTA 3W81A 5HDBE 5FM8A 5FHAH 4NZUH 3JSSA 2WNGA 2W0KA 4KUCF 4X6BA 4LGSB 4LDEB 3VFNB 3VWKC 3OGCA 1EJOL 1VERA 3G5YB 1N6UA 1UVQB 4G8GB 3MYZA 5F9OL 3MQIA 4R96A 3LV3A 2AXHA 2HA1A 2LTQB 3B9KD 4QCIB 3K74B 4IDJH 5FYJH 3V6ZB 3MV9A 3VXOB 3KGRA 1VHPA 3DOSA 4PFEA 4LCWB 1XR8B 3LH2L 4YEFA 3BZEA 3C9NB 3LN9A 4IRJD 5AEAA 3GSRB 3FOLA 4O4YL 3I6LE 3IF1B 1RJLA 2QSTA 4IBLT 2BZDA 4X4XA 4PB0H 1LVEA 1U0QA 3V8CA 2R2HA 4PGDA 5EFIA 1QSEB 1FPTH 4YPGB 2YUVA 4IRSB 1IEBA 3PL6B 3LHPH 5GGVL 3MLXL 3BMVA 1CYGA 2EIBA 3JUZA 3ALXA 4JPKL 5BZWA 4PJDE 3U7YH 3Q48A 2E6QA 4NO2A 3WNOA 1YYLL 1HQ4B 4XMKL 35C8H 5JPNB 3LQAH 5JZ7D 1BJ8A 5CIPA 3ABZA 3FQXB 1T7XA 3PHOB 3GMLA 3D3VA 1B88A 5L2KD 4UV7H 1LK2B 1KIPA 4YXHL 1TCMA 2MPAH 1FNSL 3WLBA 4XAWL 2MCPH 1JZ5A 3QDMA 5E2TL 1QLRA 3LCYA 4HPOL 2R4SH 1I8LA 4G9DB 5ACZA 1XZ0B 3MLTA 4MYWB 2P7TA 12E8L 1T21B 4QT5A 4X4ME 4FFWC 4OCSH 3PHSA 3L6FB 1ZLVK 4JY4B 4Y2DB 4LSRH 5GSVA 5T3ZH 5KS9B 2CO6B 4MAYD 1TZIA 3BGFC 2IPKB 3MGOB 4NQCE 5F1NA 5C0IB 3RBSA 3D2UD 4CW1A 1FO0H 1RUKL 3CDYA 1JRHH 1Q9OB 4PBVC 1YN7B 1F42A 1F11B 4OZGA 4GKZA 2YPVH 2YK1L 1YEJH 1FVDA 4LRIC 4OQTH 4FA8A 4OGAD 4P59L 2D2OA 4QYOA 3FHAA 1VESA 1ZEAH 3PWLB 5FGSA 4JFEA 1K6QL 4IRZL 5A3IC 2I9LB 4QHLA 2UYLB 1FSKC 1MHPL 3BJ91 3SGDH 4JFFB 3RA7H 2QQQA 3QO1A 4HUVA 3NZ8B 3OL2A 3RZCA 2W60B 1PQZB 4XVSH 4FQCH 1OAQH 4OLYL 3MV8D 1DBBL 2OX5A 5E8EA 2GTWA 2X4UB 1F4HA 5I30H 3HMXL 2J6EL 2CDFA 3UPRA 2F8OA 1K4CA 4R8WH 3TVMB 1CL7I 1W0VB 2DS4A 4JRXA 5JUEL 3CFEA 3GBNL 1DBJH 4YUEH 2RBLA 1XFPA 4XWGH 4XVUD 5FHBH 4CNIB 2CMRH 2OMBA 5DJZA 4KROD 2NY3B 3G08A 3NACL 1UA6H 2WBKA 1CE6A 3L9RA 2HTKC 1EUUA 3K81A 5T3XD 4JFQB 3MUGA 2C1PB 4H1LB 3VFUA 5SV3A 3GB7A 4LKCA 2WW8A 5HYJB 1VA9A 1Z3GL 5AUMB 5GRYA 1G9NH 3OX8A 4CN4A 4JY5H 3GRWL 3CNKA 1RHHA 5ADOH 1HYSD 2E7MA 3H6JA 2D7OA 5DR5H 3U1SH 5IV2A 1SYVB 5INCA 3K8KA 3OKDA 1EZVY 1JZ2A 1MNUH 2DMBA 3B6SB 1UWEH 3WJJC 1H0DA 2PCPB 5C09E 1TETL 4HFUH 4NJAH 4JHAH 3RAJH 1NFDF 2DD8H 4OD1H 4MZ3A 4NN5B 3TESA 4P23B 2BMKA 4H8WC 5D7LA 1MCJA 2ZP0T 1ZLSH 2FEDD 3KPMA 2VIRB 1ZHLB 1BF2A 2HTLD 1MFCL 1G6RB 5SX4I 4U1KA 1FRGL 4U7SA 1TQCB 4NO3A 4ERSH 5HYSB 2CUHA 3G9VA 3KNBB 4JAMA 2KDGA 1V7NH 1IGIL 1MVFA 1UM4H 1B0GB 1S7QB 1P4LB 3HRPA 3LZFL 3GSUB 3VFOB 1UB5A 1A02N 1MCHA 1I7UB 5D7IA 2EYSA 4LMQI 4PJ8A 5EO0A 3BVNA 2J4WL 2HG5A 4YFLI 4BA8A 2X1XR 3PL6C 4OCYH 5IB3B 3MRFB 1YMME 3WFDL 2D7MA 4YDKL 2OZ4L 1NMCB 2A9NH 3O3AB 3L3KA 1U9KA 4JE4B 4MD4A 3RWHB 3GSXB 4HGWB 5AYUH 1PG7L 2CXKA 2FZ3B 4ODVL 1KT2A 2D0HA 3IRPX 3BYTA 4M5ZL 1S9KC 2YUXA 2WUCL 4PB9L 5EUKB 3GSVB 4QNPE 2ITDB 4P4KC 1CZ8H 1NFIA 4JANA 5MHSD 1AD0A 4XCYB 1FO0A 1ZLUK 4DZ8B 3WFHB 4H1LG 2B8OT 4N9GB 2COQA 4OQTA 1RZIA 2HYMA 2R1YA 1JNLH 5EUOE 4TUKL 3WUZA 3CXHJ 3GSNB 5D2LE 4AH2A 5DURB 4JLRA 1F6FB 2D7TH 4O2CA 5AD0B 5L2JA 2Y9RT 1MCLA 3WIIH 5C0FB 2QKIB 4FTVD 4EI6B 1UKSA 1RJZB 5JHLH 1JNHB 4XNYH 5AAMA 5FK9B 3FB6B 1EZVX 1XGPB 1KGCE 4F9PC 1E27A 3IFNH 5EN2B 1A9BB 5GJTH 2ZPKH 3N9GL 5FYKE 5IB2B 4ZFOA 4MS8D 2IANA 4RDQG 4XC3L 1RU9L 2WINB 2IQ9L 1DZBA 1OP9A 1IVLA 1X5FA 5ISZD 3T0EB 2F58L 1LNUB 4AMKL 2G5BA 4FQ1L 5HYSG 5JOPD 1FFOA 3FONB 1AIFB 4QRSA 4KY1H 5BZDA 1CLZL 4JDVA 5FUCE 4JFZL 4RGNE 4WFFE 2J8UE 2VYRE 2EECA 1NCDL 1U95A 1RUAH 3HPJA 4PJAB 5D1QD 3VXRA 5IW6A 3ULUF 3O11A 3AC0A 4LAQH 3U9PH 2C5DC 3TVMC 3DGGA 4NO0A 2GTZA 1JVKA 4MWFA 3OGOE 3SKUD 4XBGB 3QDJE 2FBOJ 4A6YL 5CEYA 2F54E 1U41A 1DL7H 1T1YA 4GXVH 1BVLA 2VZ3A 2XPGA 4OD2A 4AM0A 1CTNA 1INEH 5GSRB 1BQUA 4YHMH 5I1DB 3SE4C 5CS7A 5A16A 1SMOA 1P7QA 4I18C 3MRLB 1P4IL 5LBSL 1MF2L 1U2CA 1UZ8A 5DD3H 3BYYA 5BXFA 1N6VA 4FG6D 3MCKA 5EZLB 2VISA 4Z7WE 2VJXA 3VWJB 2J8OA 4MA3B 1YNKL 5DO2D 1XR9B 5EU7E 1G7LB 1I3GL 3NH7L 4MCYA 5BS0B 1NAKL 1BD2D 3EOBA 4NN5C 4CGTA 4P23C 4NYLA 4P46A 1CICB 1MHEB 3PP3K 2MTPA 1LO2L 5JW4Q 3U7WH 1BOGB 3JV6A 2V6HA 32C2B 4PY7B 4MXVE 2VLRA 3QCUL 1WCBA 1ES0B 7FABH 5HHXL 1DEEA 5C07A 3LEYL 4GRLA 3VI4F 1OB1A 2CK0L 4UOW0 3QUMH 1TQCC 4GG6A 1FORH 5KJRL 4S1RL 1H8SA 1NCWH 2AS5M 5C0DB 3O4LA 4FQ2H 3QPXL 3P73B 3QDGA 3ARFA 3MRIB 1B9ZA 2XWBB 2O5XH 4JKKA 1NFDA 4PRBB 2C26A 4ZOBA 3RWGA 1EMTL 1U8QB 1KB5H 1CFVL 5E2VH 1IEHA 5TF1L 1D9KD 3SKMB 4HT1H 3D0VA 4FZ8L 3RL2A 3UPAA 4ODXA 4OFKA 4BQ9A 3LKPA 5KVGL 3EO9L 5CINH 1JP5A 1T1WB 1A6PA 3SDXB 4HIIB 3TJHC 3HC3L 1NMCC 4S1SL 3NFSH 5AWNL 5SX5K 1D5BA 3S4SA 3BRGC 1FV1B 2B39A 2C3HA 3RTQC 5D6CB 2DQGL 3M1BA 2YN3A 4S1DC 4NT6B 5J4MA 3EYFA 4YHIB 5F89B 3CFJA 5TDPB 4FXLA 5EORH 4OFDA 3SDAB 3PIQB 1Z5LA 3UBXA 3EO1B 2APFA 3H42H 4GBXD 2Z31A 4PRDA 1BEYH 2XTJE 4OZFG 3CMGA 1J12A 4PRAB 4UT6H 3OB0H 1H3UA 1R5WB 2D7PA 2DLFH 3ZE2E 2FHCA 3IGAB 3FO0H 3SJVA 3TN0A 3I9GL 3KLAA 1YN6B 2R8SH 4OLVL 3D85D 1I8KA 3B83A 1MCFA 4XPFH 3ES6B 1MFEH 3OR6B 5DEGA 5HGHA 3VWKA 3UYPA 1QRNA 1QFUL 4KK9D 4ORZC 1ERNA 1CXKA 1RULL 2EEDA 2PETA 4L29B 4PGJA 5LAXB 3BP5B 4KJWD 5DRWB 4GOSA 3ULSB 4YHPA 4WFGE 4LOUC 3H3BC 5ID0B 5IEKA 5T1LB 4OUUB 1XF2A 2V9QA 4I0PB 4H8WH 4WGWB 3RL1A 4NKOA 3THMH 5JORA 3HNVH 3QDAA 3WEXA 1HEZB 1CDYA 4Y4KD 3GBMH 1DQMH 4DKFH 3V5KB 4KVNH 3LVEA 5BRZD 4MSWB 4ONHA 2EDDA 2FL5B 4DQOH 4DCQA 5DJCA 2EYRB 1BQHB 5AYQA 3FFCA 2R0LL 1IGJB 2PYFA 3QQ4A 1V8HA 2AJSL 5ETUB 4X6CB 5GS2D 3CDGB 1KCSL 3TO4B 5KS9F 3BXNA 1FG2B 3VXUA 4RGMB 5F7MC 3M45A 2Z4QA 4GKNA 4PGEA 3BMWA 2Z93B 5FM5M 5HHQB 1UYWL 5E8NB 3UO1H 4L8BA 1LEIB 2UZIL 2P5EE 3C09B 4HZLB 3T08A 1UC6A 4WUKL 4HWBH 5EU6B 4L8CA 1W0WB 3ROLA 4KKAC 1DQQB 4M1DL 5DMIH 1CS6A 3VWJC 3KPPA 5ERWB 3DGCR 5HVHB 2M26A 3CC5B 3IDJA 3QUMA 3INUH 5DEZA 5LXGL 5C8JB 3ZO0A 4HAFA 4Y4FD 4ZNEA 2R0WH 4MJID 2PUQT 3BP4B 1CICC 3G5XB 3U36B 4XMPL 1VPOH 1KJ3H 5CZVH 1KB5A 2AXFB 2R1XA 3B9KB 4WTWA 2X1WL 3I2CL 3VRIB 3QXDB 1RZ8B 2YKLL 5ECJE 1MHHA 4BUGA 2VITA 1CLOL 4IRJB 2Y72A 1HOCB 3MUZ1 5F9JA 1XH3B 3JUYA 3WNLA 4AT6B 5T5FL 4XGZB 1OL0A 1DEDA 4X6DE 3HZMB 3C08L 4P2RD 2G9HB 2WWKO 3BUTA 3KYNB 1PSKH 3TBSA 4PJHB 3CD4A 5D8JL 5AAWA 2FWOA 1B3JA 3MLPA 4ZOAA 1CU4H 1Q0XH 4K8RD 5C0CE 1IGCL 1A1MB 1ORQB 2X9XA 5E9DE 4ONGL 2VZUA 5IJKC 5EBWB 2AJZB 1WZKA 1WWBX 8FABA 1XGYL 4CVZA 5IFAL 4BK5A 3TIEB 3P9LB 1VFAB 4JREB 4X7DC 1ZA3B 2DM2A 1R3JB 4KK6C 2PW1A 1U92A 1ZSDB 2E7BA 2IGFH 3G6JF 5DJDB 5L2KB 2NY6C 3BIKB 4HWZA 5ILTL 5F7DB 3GI8H 4NHCL 1WC7B 3RNKB 4OGXL 1BQHG 4BH8A 3MGAA 1ZT1B 3SDYH 4D9RE 4RDQF 4O9HH 2BC4B 3QWQB 2ZNXA 1QBLL 1NUDA 3QJFA 4UV4L 5D70H 3SDAC 2YD9A 5IIEB 3ZE1F 2VC2H 3D25A 5DI8A 4KAQH 4YIQA 3O45B 4JFHD 2BY2A 4DOHE 4MAYB 1S9YB 4QRTB 5EO1A 4XTRD 4K8RL 3SKJL 3WJJA 1H3PL 3D2UB 1BJ1H 1MCIA 2GITB 3BDYL 3FT4A 3MV7B 1KJMA 1IC7H 3R0MA 2KPNA 4LPWA 1RIUL 3ULVE 2Q86B 2PYEA 1DVFD 3NCEB 2B7DT 3I6GA 4H1LH 4JO3L 3U46B 4N0UB 3JWDC 4XVJH 1ED3B 1WLHA 3MPCA 4YHYB 1JHTA 3H9SB 2P42B 1JYXA 1L7TL 2VTFA 4TSAH 3BDXA 1MCQA 2W9DH 2XWJB 5C71A 3VFNA 1YZZA 3G5YA 4KGLA 1UVQA 5DS8B 5L88L 1KFAH 2P5WD 3EDDA 3MV8B 3GUTB 2CH8A 1Q94A 1DBKH 1IKFL 3WO3B 3B5GA 3V6ZA 1GOFA 4PG9B 2B1HH 3VXOA 5L0QB 2IFGA 4C56E 3K0WA 2HWZL 3GIVB 4WJ5B 3C9NA 4UQ3B 1U8KB 1I4FA 4OI8A 2I5YL 2QQLH 4QLRA 3RKDD 2A9ML 3IS1X 3LB6C 4KROB 1MCKA 4U1MB 3LEVL 4HWBA 1G6RH 2NY5C 2EC8A 2E27H 5HGDA 3TM6A 4UDTB 1QSEA 4YPGA 3AS2A 3LKSA 1NKRA 25C8L 3VFPB 1F4YH 5ITFA 2QQKL 3PL6A 3S3JA 1MPAL 4ODUB 4M48H 2JELH 5F1IB 5SWSE 1C16B 4M61B 1WJ3A 5B22A 1I1AD 4JQIH 1HQ4A 1MCNA 1UT9A 3CX5K 5DFVD 3SHSA 5JPNA 4H20H 4O00A 4OBSA 4RX4D 3D1MC 5DWUL 3RWCB 5LG1A 3FQXA 4XRCB 2BDNL 3PHOA 5F70A 4P4KA 1FQ9C 2OL3L 4Y1AA 3HN3A 1PAMA 1T7ZA 4P2QE 1YECL 2NTFB 4HIHA 3SE8H 3KLSA 3SGEI 1OF2B 5HPMB 2IAMD 4LLMB 4G9DA 5CGYC 1OM3L 2YEZB 1XZ0A 2A77H 1EGJH 4OCRL 4XPBH 2VZSA 1T21A 4JPWL 1MCBA 4HBQA 4HV8B 2BVYA 3L6FA 1ZVYA 4JY4A 4L5FL 5FGBC 5SV4A 4EBQH 5KS9A 2XQYG 3WDJA 2ICWI 3PGFL 2APVA 4PJAF 2IPKA 3MGOA 3B9KC 3F6IA 4RISL 1JYWA 1Q9OA 4F9PA 5CD3B 1YN7A 3OAUL 1F11A 3FQRB 3OJDB 4IRJC 4OZIB 2A6KB 3PWLA 2OSLB 1CXIA 3QZWB 2I9LA 2UYLA 1AJ7L 4OFPA 4JFFA 1QRKA 1UCBH 4JGMA 4HLJA 2W60A 1BFOB 3V0WH 4Q9RL 3L3JB 2W0LA 3BKJL 3WD5H 1KBGL 4I2XB 2X4UA 1INDH 1E4XH 5FYKU 4HJJH 4YDVB 4AIZB 3HNTL 4YGAB 3QEQA 2NY2B 3TVMA 1W0VA 3WE6A 5JZ7C 3ZKSD 4JREC 4BELD 5E94B 3NFPB 4CNIA 1QFPA 4TTDD 1ACZA 2UWEE 4G6KL 2Z92B 1TNMA 2VDMH 3ZSSA 1EDQA 1NSNH 1OAUH 1WEJH 2C7UB 3CFCH 4JFQA 2C1PA 4H1LA 4XX1G 2H6PB 3SE4A 4DTGL 4UTBH 4I18A 1DBAL 3DI2B 4KRMB 5HYJA 1KPRA 4LGPB 5AUMA 1AR1C 2ICEB 3OG4B 4NCC2 4XCEB 1EUTA 4OB5H 2ADJB 4FTVB 1SYVA 1UH4A 2X10A 2ZWLT 3C8KB 4MAYC 3B2UD 2FCBA 4I8DA 5DD6A 1BFVH 1B0RB 3TPUB 3VFMB 1OAXH 1MIMH 4P23A 2EDLA 5E2WL 4DUXA 5E0QA 3IXAB 4ZO6A 4LBEB 4GW5B 5DVLA 5EZIH 4YHYC 5J12B 1FE8L 2ED7A 2VIRA 3CX2A 4PRHA 4M7LT 4OZFH 5ISZB 1ZHLA 2ZUUA 4E41D 1G6RA 5I8CB 2CXGA 5DFTA 2ZUTA 3BEVB 2NZIA 5TE6H 4LSPH 2BCKB 4NKIL 1XGQB 4HMCA 2M8XA 1NGXB 1JI1A 2Y23A 3FRPG 4Z7UB 5A1AA 4JFOB 5I1IH 4UB0L 5HYSA 3E8UL 3V9FA 3WFCH 5D1QB 5IG7B 5TDOB 2QJDA 3KNBA 3QZWG 3V6OE 3GO1H 5KSAD 4OIIH 3C60C 1CK0H 1KV3A 1U8LB 1B0GA 1F4AA 3R0NA 1S7QA 4XVUC 1F5WA 5IFJB 5IQ7L 4JPVL 1P4LA 4KROC 2X41A 3GSUA 3VFOA 1D5IL 1FL5B 2DL2A 4AIOA 3GI9L 1I7UA 4LGRB 1HZHH 4EIZC 3ZYZA 5CUSL 3LQZB 4QRPA 4F33B 5IB3A 3MRFA 5ACMA 3RWDB 3NFNB 2Z9TA 3DROB 3O3AA 1F13A 5ICZB 2ADFL 1EGJA 3RWHA 4FOMA 3GSXA 4HGWA 3KPSE 4U1GC 3RTQA 1HYSC 3ARRA 2GJ6D 5EOCH 1J7VR 4HUMB 4WUUE 3TV3L 5EUKA 4F57H 2BSRA 4Z7VF 3GSVA 4XCCH 5DA0B 4APQD 3D18B 2CK2A 4DZ8A 4PY8I 2DI8A 4ZUWA 3WFHA 1BD2B 2CPCA 1RI8A 1YEDB 3KYKL 1Y6MR 4ZUSA 1F8TH 4PLJC 5J7CC 1C5BH 4G8GE 1B4RA 4W6XB 2RCSL 4Q0XL 5FYJU 5HSFA 4KUZL 4UBDC 2VWEE 3F7RA 5ADPH 4UT7H 4WI4A 3JV4A 5JXAH 4YHKL 4LFHD 3T2PA 2HTLC 4XNUH 5I8EB 5AD0A 2AV1B 1UM5L 1CXHA 1CFSA 2QKIA 4OJFH 4U6VH 4LCWE 4PUBL 1RJZA 5GGTL 5I18H 1PZUB 1JNHA 5FK9A 2XZQL 4ISVB 3FB6A 4EI5D 5CCKH 3OXSB 4PRPD 5EN2A 2AJUH 4H88H 3SBWC 1A9BA 4YEEA 5IB2A 4L1HA 1IQWH 1WBYB 4G7VH 4PP1C 4K3JH 1J1OL 4XCNA 4K3GA 4Y5XB 1D9KB 5HJ3B 5C0BE 1IGTB 5EIVA 3CVHL 3MJ7B 4L9DA 4NM4H 4UIKH 2HJKB 4A2LA 1LNUA 3F62A 2PR4H 3JWDH 2V5YA 3FONA 4EEEA 1AIFA 4M5YL 3HUJE 4FFYL 5DJXB 3HE6D 1AO7E 3W0WE 2L7JA 3A67H 1HXMA 4OLUH 2A73B 5EC2A 4LLYA 4KI1A 2NY2C 4PJAA 1HKLH 1MLCB 4G80B 3ARYA 4QXGL 5ALBL 3MCLH 1J0IA 2CIKB 5E6IB 1J0YA 4K3EL 3NPZB 5DMGD 3ELAT 3GMRB 4NNYB 3EOAB 1AY1L 3EYQC 4HKZA 3LRSB 1LEKA 5GSRA 1I3RB 5I1DA 1ZT7B 3MRLA 5D1XC 5EB9A 2HRPH 2I60L 4EXKA 3DTXB 3MJ9L 4HKBA 4OZFA 2G60L 2NX5D 2NY5H 1GGCL 2FEEL 4I9WD 1L4IA 3IU4L 3D85B 3QFJE 5F9OH 5EZLA 1AE6H 3OWEA 3VWJA 3IAGC 4M62L 4J7RA 2YUWA 4MA3A 1CN4A 4Z76B 1G7LA 4PGZA 1RMFL 3C5ZD 4KU1A 5BS0A 1UACL 5E4IA 2ADGB 1P6FA 2IC2A 4PJHF 3DX6B 5EBGA 4PJCB 4M6OH 5E95B 4PTUB 4XC1L 1CL7H 1CICA 1NDGB 1BHGA 1A14L 2YPKB 5FUZH 2VDKH 4O4YH 2DQTL 2OBGA 5CEZD 3F7QA 1QOKA 1VEOA 5J12C 4TNVK 4OTXL 1BOGA 1A4KB 1CD8A 5J6GB 1IGML 1OP5K 2NR6C 3RX7A 4AEIH 2VQUA 2YRLA 4ZD3L 5FUOL 1C7SA 4XNMB 2KZ1B 4Y4KB 5FO9A 3ARUA 4JPKH 1KUMA 5D1QC 1WVZA 1NJ9A 4YFLF 4ZO9A 4LCIL 4XMKH 1OOAA 5BRZB 3MRIA 1I9EA 2XWBA 4PRBA 2IQAB 5D71H 1A7PH 2N7BA 5FYLL 4DVRH 3TCXA 2HMIC 3SKMA 3IKKA 3HPLB 2Q8BH 3V4VH 4CN1A 3UJIH 5IJKA 4G7YL 5MENB 1UKQA 4M7JL 3GMNB 1TQBB 2R56H 5A43C 1T1WA 1FFNB 1O0VA 4HPOH 5CEZL 4HIIA 5HVWA 3GKWH 1FBIL 1FV1A 4R97B 1JZ4A 1JN6B 4FG6C 5SX4H 5BVJB 5D6CA 4HS3A 4KMLB 5FKAB 4Z8FL 1N0LA 1OGAE 2WWKT 1KJ2L 1A47A 5DO2C 5I74B 5FGRA 3JVGC 5C0AD 4YHIA 1JUFB 5F89A 5TDPA 3BRFA 4Y4FB 4EOWH 3SDAA 4JG1H 3PIQA 2YK1H 3VXTB 3EO1A 3SDDD 4MJIB 2MMXA 5HHVL 3IDXH 4PRAA 3PG2A 1R5WA 3JZ7A 3IGAA 3CFIC 4O51B 1FC1A 1YN6A 1SBSL 1OTUC 4LHUD 3WSQH 1LO0H 1S7WA 4GMSH 4UILH 4AL8L 1IAIL 4KI5E 4KJQD 3V4UH 4CL7A 3QEGH 1GGTA 2MHAA 3EOTH 3E0GA 1RK1B 3ARZA 3OR6A 3LD8C 2J6EH 4Z7VA 4XT1C 4P2YA 4P2RB 4OIAA 1DDHB 1P7HL 3O2VL 4L29A 4KZEL 5EOQL 2DB8A 5LAXA 3BP5A 4YHZL 2Y7QB 2ICWB 3NA9L 1D9KC 4Y5XC 3ULSA 4B5EA 1J0ZA 3S3PA 4C59B 5T1MB 5ID0A 5IEHB 5T1LA 4OUUA 3L5WB 4M8VA 2F5BH 1A7OH 1MJUL 5BQ7B 4PLOB 3IFLH 3ZHKA 2DJ4A 2DQDL 3O2DH 2V5RA 1O7VA 3AMLA 2VDLH 3U48A 4KGJA 3ZZ1A 1HEZA 4X4ZA 3ARBD 5IM7B 1I7TB 4OKVB 4F37K 1A6WH 1AQKH 3VRLF 3V5KA 5HYEA 3T0XA 3CSYB 4MDIB 2NXZC 4NQCD 3UYRH 4MSWA 4KHTL 3VI3E 5E6IC 2FL5A 1IAOB 2V7NB 2EYRA 1BQHA 5FM5O 4NQDE 2OJEB 2VABB 1IGJA 4MJ4A 3ROOA 5ETUA 3MROB 3LOWA 2DWEB 1HQRB 3N85L 4XVTH 1NCNA 1CCZA 1ETZB 2Z93A 5HHQA 5E8NA 3MYJB 4JY6A 2ILLA 2LVEA 5IR1A 1LEIA 3EJYD 1BFTA 2JIXD 5AG9A 4HZLA 5DYOA 5C08D 3LS4H 4HKXB 1SVZA 4W70A 1NGWB 5EU6A 1MJ8L 5T3XH 1J1PL 1DVFB 5IOPB 5ERWA 3CUPB 3OAZK 4LSVH 1P84J 3CC5A 1TLKA 5C8JA 3H7BA 4BZ2L 3KPNB 1JWMB 3QSKB 2NMSA 3BP6A 4CDHA 3G5XA 2CDEB 4KH2A 2P5WB 3T0EE 5FGBA 3V52L 4KJWC 1ZMYA 2AXFA 2XZAL 3B9KA 2EDJA 5D5MB 1WITA 2V5TA 3VRIA 3QXDA 3T8XB 4I4WB 5HI3C 4MA8H 4KKLD 1IAII 5GISH 4K9EL 1FZJB 2DQJL 4IRJA 3CH8A 4KRLB 4G8IA 4NZDA 2OK0L 4YWGH 4YDKH 2OZ4H 4Y4KC 1RIHH 4OLWL 4XGZA 4HMDA 5CEXB 3ORJA 2HT2D 1KIUA 3HZMA 1FIEA 1R3IL 2G9HA 5HGGS 3KYNA 2ARWA 4PJHA 3EKCA 4HCRL 1FNGB 5C09D 1OHQA 1NAML 3K4DA 4NQUA 1HK6A 4M03A 4M7KL 3VRJB 1A1MA 1ORQA 1Z9OA 2R4RL 2AJZA 4LSSL 5EBWA 4RA0C 1I1AB 1X5IA 1ZGLB 5BW7C 5TE4H 4MB5A 3P9LA 4Z0XB 1MCCA 3HI1B 4TUKH 3UTPE 1MRFL 4PJBB 1V3LA 4FXKB 1ZA3A 3SQOL 1R3JA 2XQBL 2AK1H 1ZAGA 5I15L 4OCWL 5E5MA 4HEME 2YSSB 4MVBD 5DJDA 3BEWB 3QHFL 3BIKA 2CLRB 5F7DA 3RNKA 1N6QL 1WC7A 5AZ2H 1WFNA 1BM3H 4DN3L 4WHYG 1ZT1A 2ICCA 4M8QA 2IAMB 1DN0B 4M93B 2BC4A 1CTOA 4Y4FC 1REIA 3WXWL 2J6EA 4JZJB 5IIEA 4R90L 1S9XA 4LCUB 3O45A 4PRIE 2YA1A 4MAYA 1S9YA 4QRTA 4J3SA 4NSKB 1UADC 3D2UA 2GITA 2EDEA 3MV7A 1S78D 3C87A 4QRRD 4ZAKD 3E6FB 1PKQE 3W2DL 2F58H 5JPMB 3MOQA 2VLKD 2F19L 4KJYB 4TSBL 3U46A 4N0UA 3O2DA 4ZS7L 1ED3A 3H9SA 1NCBL 5J0BA 2XWJA 3GNMH 4P4RB 5JIHA 5DS8A 4QF1B 2BNRE 3MMEB 1KULA 1QD0A 2F53B 4NQXB 2E8ZA 3OJ2C 3SN6N 4MXWL 4R2GD 3GUTA 3JV0A 3QUXD 4K8RC 1NBQA 3SDXE 4C4KT 4G42B 4ZO8A 3L7FB 4QHKJ 2V17L 3GIVA 4XB8A 3CLEH 1K2DB 4UQ3A 1T1ZA 1U8KA 4UZGA 3V5DA 3TA3B 5I1JH 2HFGH 3C60A 5CD5C 2DL9A 3BISA 4OFVA 2E9WA 4YZFF 1PBYA 4U1MA 3BIBX 3RWJB 4RMVA 3DRTB 4PGBB 4UDTA 5IVXE 5EZOH 3IFPA 1T2QL 3CZJA 4ELKB 3VFPA 5I66B 3L5JA 1KGCD 1I3GH 4ODUA 1A3QA 3DV4B 1S8DA 5F1IA 3K1DA 5J89A 2VLME 2FATL 3QHZH 4M61A 5JOFB 5FYKD 1YEKL 1YPZB 1VCAA 1G1YA 3IFOB 4PJ5D 1Q8MA 5GGQH 1N2RA 1RURL 1SY6H 5D7JD 3RWCA 2VZVA 3FZUC 3I50H 3STBA 3FOMA 1P5VA 3TBVA 4X7FC 1B6DA 1DVFC 4BQBA 3B9VA 1GRWA 4P2OB 3L3DB 4RGND 3MJ8B 1A7NH 1HHGB 4Q97A 1OF2A 5HPMA 2DQIH 1WT5C 3P77B 1F3DH 3NABH 4LLMA 4S1RH 4TRPH 4U1JA 5E8PB 2OZ4A 5L7XL 5LGHL 2QSCH 1UKTA 2GSGB 2E9IA 1F97A 2AJYH 4YC2B 5LGJB 1QFWI 4E41B 3O2WL 1KF9B 3H0TB 4P5MA 1VADB 4X6EA 1NBVL 1CFVH 4Z78B 4HWUA 1F00I 4PJFF 1JGUH 3TEUA 3ZKND 1EH9A 2F54D 5GJSH 5EIIB 5D1ZD 4UQ2A 2Y5EA 3GJEB 5CD3A 3FRPA 5KN5B 5J1SC 3QUKA 2MFNA 3SBWA 1HHHB 5EU5B 3FQRA 3OJDA 4XP9H 3EO9H 4Y5VB 5HI4D 2A6KA 2JF1A 2OSLA 1SMAA 4RBPH 5I1KL 4KKCC 3QZWA 1F58H 3RKDC 2Z8WC 3RY4A 4N1CA 3P9MB 5E8DL 4L3EE 1NC4D 2HVJB 1BFOA 4CMHB 3WMSA 4WEBH 5KVMC 2W9EH 1W72L 4I2XA 1S9WB 2NY7L 4U6YA 3SO5A 3C6LD 5MI0B 1ZV5A 1I1AC 4G43B 5DFVC 2GJ6B 4NBXB 4OLXH 5GRVK 2G2RB 5E94A 4APQB 3NFPA 2FJFB 1U8PB 4U0RC 4YE4H 3CVHB 2Z92A 3I9GH 4JR9H 3KYMB 4QOKA 2X9WA 3LKNB 2YPLE 4L4TD 4KMTL 1S7XB 2D4DA 3L5IA 4QGYA 2ZCLH 2VOTA 2Q20A 2H6PA 3MBXH 2IAMC 4M93C 5D1XA 4OV5A 2RGSA 1MFNA 3V5HB 2ICEA 2NZ9D 4JZJC 5EBMB 1QFUH 1WWWX 4JO2H 3V2AR 1DLFL 1KYOK 1AHWB 2DN7A 3PHQB 1RULH 2ADJA 4FTVA 5F7UA 4MLIA 2DQCL 3C8KA 1HI6B 5T1KD 1TVBA 3HZKB 1ZT4A 4JM2D 3FQTB 5GZND 1B0RA 3GIZL 4EI5B 5JXED 4PRPB 3QNZB 3QA3B 5DJ8B 2BJMH 1XGRB 1BIHA 2AJXL 2CJUH 4LBEA 4GW5A 4N0CD 3WFBH 4KDTC 1EVTC 2FB4L 5ISZA 2C4XA 1UWGL 2Z8RA 5I8CA 4ODBD 3BEVA 3TH4T 1KENL 4PJEF 1XGQA 4CVXB 1WGOA 1NGXA 5JLZB 2AXGB 4M43H 5ITBL 1R0AH 4Z7UA 4HK0A 4JFPB 2VRAA 1UXSA 4LDOB 1CFNB 4IMKC 5C9JB 2AJSH 4OCMC 3DMMC 5D1QA 5TDOA 1KCSH 5IG7A 1A6VL 5IK3B 2XTJD 3DURA 5L2KE 1MI5A 5K9OB 1U93B 4ONFH 4TTGA 1CE1H 3KXFB 5IHLB 3TA3C 1S5IH 1U8LA 3QQNA 3QUYC 1SY6A 1LO3H 2UZIH 4TTDC 1JMZA 1S7RB 4WTZG 2W59A 2WLYA 1BJMA 1BZ7B 4RCAA 3WO4B 3LQZA 4F33A 3RWDA 3BPNB 1FAKT 5TPWL 1FYTD 3NFNA 3DROA 1E6OH 4JKPL 5DMKA 4KK8C 2NX5B 1CWVA 1A7RL 1GIGL 2OR9L 3L95B 1T6WA 2H2SC 3LSOB 3JVGA 3OR7B 3I2CH 3C5ZB 1S7TB 1T2XA 4OT1H 2PW2B 4ETYA 2P46B 1KNOB 3HC4H 43CAB 4YO0B 1YEDA 1CLOH 2UY6A 4P2OC 2FIKB 2Q6WA 5T5FH 2VDOL