1BQLL

Structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
b'DIVLTQSPAIMSASPGEKVTMTCSASSSVNYMYWYQQKSGTSPKRWIYDTSKLASGVPVRFSGSGSGTSYSLTISSMETEDAATYYCQQWGRNPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYHEL-5 FAB (LIGHT CHAIN)
molecule tags Antibody/antigen
source organism Mus musculus
publication title Refined structures of bobwhite quail lysozyme uncomplexed and complexed with the HyHEL-5 Fab fragment.
pubmed doi rcsb
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1995-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bqlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bqlL01
1QUNA 1CLOH 2C7UA 4BUHA 4PR5B 1P9MC 2BVPA 4Z7UE 1T21B 1HH6A 1MFEL 2EIZA 3O8XB 5AWNH 2DRUA 4NP4L 4NM8L 1MUJB 4GRWE 1ROWA 2YBRA 1FRGL 5E9DE 3ZYJA 4H1LG 3BSZH 5DHYA 3PDGA 5A2FA 5DURD 4OZ4A 4YIQA 3HG1B 1UA6H 3RUGE 4JPIB 4O9HL 4U6VL 3NCCB 3WKMH 5DLML 1VKXA 2QQLH 2X1OA 3PWPE 1PZ5B 3EO1B 1KTDB 1FO0L 2IPUG 1YEEL 1NUDA 1U6AH 5C70A 2XTJB 1F58H 2BVOB 1P7KB 4WVRA 1G7LB 3KPPA 4KVCL 5LQBH 2DM4A 5CGYD 1BAFL 5DUPL 3TWCL 1QFPA 3QI9C 1AD9A 4MS8D 3U6RB 5DQ9B 4YBLB 3DURA 4PG9B 3O3BA 3TVMA 3LN4A 4JAMB 3T2NH 2VXVL 4HIEA 5C08A 1FBIL 5GIRA 5I2IB 2VLMD 4N8VA 4AK1A 4UV4H 4KJYB 3N1GC 1JHKL 3H9ZA 2VDPH 3G6JE 1U8MA 1QFHA 4WO4D 1J05A 2APFA 3QDJD 4H1LH 4E0RA 1M6OA 2EH7L 4NHCL 4I5BA 4YPGA 3SKOB 4K23L 1JF6A 1VGKB 4O2FA 3X12A 2FLRT 4L9LA 4PJGA 4LEOA 2GTWB 4OZGF 4LCYB 2MTPA 3LN4B 4UIKL 4GG6B 3S6CA 1CWVA 3O3BB 1YDPA 4M3JA 3VRJA 3WUWB 4AQ1B 4JFYA 2V5RA 3MA7B 4N90E 4DQOL 4FQLH 1BQLH 2ZSWB 4YHKL 4YHYB 1RVFL 4XZUB 1C5CL 1O5DT 4RGND 5T33H 5E8EA 5FO8B 3ZKSD 3MRNA 3CC5A 2ITDA 4P9MH 3SDAC 3CLEH 4WO4C 4YEFA 2I07A 4JN1L 3U1SH 1N6QH 1U3HB 4R26L 2ADIA 1A7PL 2XYCA 4PP2A 4PGCB 1GGYA 2D7OA 3OR7B 4O2EA 3CCHA 5E0QA 5ILTH 2Y23A 4RGNB 4DUWA 1QFWI 4K7PY 5IT2H 4LMQE 1MJ8H 3CSGA 2HRPH 3F6LA 2AXGA 4G7VL 3D85A 3ARBC 1UVQB 3WLWC 2PW2A 4WHTB 3DVNA 2FX7L 4G9FB 1K8DB 1WZMA 1A7QL 2V2XA 4H8WH 4PR5A 1SBSL 4UQ3A 4OLXH 5IVXE 3DJ9A 5ACLA 1QNZL 4Z7NF 3RWGB 1JRHH 3FFDA 4FXKA 3L5XL 1AI1L 4YDIL 4CKVX 43CAB 1I9RL 5A1AA 1MQ8A 1YY9C 3TBTB 3PGDB 1RZJL 4ZAKB 3MFGB 3DMMD 1MJUH 1PG7X 2VDKH 1VFAA 3KYOA 4ODUA 1VERA 1ONQA 1FVEB 4QRQA 3QZWA 2A6KB 2ICWA 2QQNL 2QQKH 4FTVD 5CBEA 3UC0L 1FFOA 4LL9A 2V2TA 3IDUA 1HYSC 3IVKA 3BE1H 1NL0H 4MD5B 3BHBA 1MCOH 2BNRD 3HUJE 1AHWB 1N4XH 3I3EA 1MAJA 1EO5A 3I02A 2OTUA 5TPWH 4UUJB 3LCYA 1A5FH 1WLHA 1RZFL 2VUYA 3MREA 2AKRA 5EN2B 3RWDA 1X7QB 1HH9B 2A73B 4R4BA 2Z91A 5INDB 3LQAL 1U92B 4K7PX 3V0VA 4NKIH 2F53D 5JNYA 3TO4A 4PRHA 4POZC 3QQ9D 4MYWB 2P43B 4HXAH 5HHOB 1NBYB 4N0YH 4U0QB 1FNSL 4P3CH 1IEAB 2D03L 5E70A 1DBKL 2A6JA 2EXWC 5C0FA 4PJCE 1YEFL 2CIIB 4ZPTA 3LKOA 3WE6B 2ZUYA 5IFHL 3BDBA 5KG9A 1MREL 2A0LD 2J8UE 4LLMB 3MR9B 1CICB 5BW7A 3GRWL 3KNBB 2P47B 2R1XB 4XTRC 5DFVD 3QJFA 1YPZA 1XCQB 2BNQE 5T5NF 5JW4M 1X5KA 4Y4FC 3QHZL 1SJVA 1U8NA 3ZYZA 2UWEE 4P3CL 1DN0A 1UB6B 1F2QA 4TUKH 4NZUL 3QA3B 1ZVYA 3MTRA 1IC4L 4PP1D 3GB7A 1MLCA 2GY5A 3C87A 4WW2C 1S9YB 1WWWX 2IFFL 3W81A 5SWSE 1PFCA 5ELIA 4NQXA 3P0YH 3C2AH 1FFQA 3LQAH 4BH7A 2LFGA 2R29L 3FO1B 4ZNEA 1T7VA 5JDSB 2F19L 1EGJA 3OKEB 1DDHA 5DHXB 4W6YB 3NFSH 1NC2D 5DD0H 4R8WH 2NR6D 4LPUA 4J4PC 3KHQA 1DBJH 4HK0A 1F6LL 4H0IA 5FOBB 3ECBB 2FJHA 5C7XL 5JDSA 4Y4KD 4OZHF 4BH7B 1NBVH 1YMHB 4ZFZA 2H6PA 3U0PB 7FABL 5GGVL 4GAGH 1BIIA 3ULUL 4WI4A 4F7CA 4WW2A 2XA8L 1T1YA 4Q6YA 5C0BE 3NTCL 4Z78B 3GB7B 4PJ8A 1AGEB 2XKSA 1FQ9C 5IB1A 2CXGA 1FPTL 1ZA6B 1MWAH 1BQSA 3PWVA 4J3TA 5JQHC 1N4XL 3MRKB 3IDJB 1EHLL 1MJUL 4PJEE 1CLZH 1OF2A 1DQMH 3TCLA 4XCNB 2HMIC 2JTDA 5TF1H 4JVWA 4WTXA 2A6IB 4IOFC 3LKRB 4MDJA 1KJMA 3S35L 4CMMB 1SBBA 3VXSD 4RWYH 4YBQC 1OTTC 2W1NA 2F54E 4XAKD 1WBZA 4YQXL 4K3GA 4FZEL 3GSRA 1EFXB 2A2QT 5FYJD 4FMFA 4I77H 2VOTA 1TTGA 3E2HC 3G6AB 4F7TB 1JYVA 3TYGH 4JRXE 2HJFA 4M62L 5EZJA 4JQVC 5GGQH 2BNQB 3J7HA 1MWAA 2P5WB 4AL8L 4XBEL 2APWA 3AMLA 1JHTB 2XQYK 1G7PA 3JBG7 4DCQA 2BJMH 2L0DA 4RAHA 4DVBA 3FT3A 2OTUB 2M8XA 5D72L 3OKNB 4FP8H 5CKGA 5T3ZL 1U8PA 3GHBH 4JFEE 4RGOH 3VCLA 1A4KB 1RZJC 3LMJH 2XKNA 1EERB 3KYKL 4M43H 4AH2B 2H26B 1NKOA 1KCLA 5HDQL 3F58L 2Z4QA 5DRZB 5C0CA 1LP9B 2EYSB 2BSRB 1QRND 3DVGA 1RK0A 2FIKA 1Q9WB 4B7IA 3ZDZE 5GGSB 1FNEB 4G42A 1GSMA 3MUY1 3T0AA 1IT9L 3L5WB 3CH1A 4ZSOE 3RU8H 3L3IB 3VRIA 3F58H 5TQ2H 4GMTH 1BD2B 2NYYC 1N6VA 2NTFA 4IIQB 3FO9B 5KTEL 1OW0A 1IM3B 2DMKA 4ONGH 2Z35A 3DBXB 3QBTB 4TVPH 2J8OA 1N6QL 5L2KE 1T6WA 1U8HA 3BQUC 5JW5A 3EDEA 2YWYA 1WC7A 2XWBA 1QLFB 1B4JL 5KAQF 5IEHA 4NRZB 1ITCA 1I1CA 4QXGH 2DYPB 5IVZA 4PJFE 3BD4A 3MCKB 1RJZA 2G2RA 3BZ4A 1VB9A 3ZHKA 1TCRA 5GS1A 1Q0YL 2RCSH 4NQVA 4ZUTB 3MUZ1 4ERSH 3UBXA 3BZFA 3MV8B 1CZ8H 5IGXL 3K3QA 2P5EA 4HS8L 1ZGLA 3T2NL 4UILH 1U93B 4PBXA 5KANG 3AS3A 1Z9OA 1JZ3A 5GGUB 4Z7UF 3ULVL 2VERN 2AEPH 3TF7C 4KKAC 4OD2A 4U6HB 5D2LF 3K80A 5JR1L 2IPTH 5JHLL 4PJHF 1KENH 2GSGA 1RK0B 5B8CC 4IS6A 5CZKA 4J1UA 4NZTL 2DTSA 1MHPL 1SJEA 1NAKH 2LTQC 5EWIH 5LXGL 5T1MB 3VXQB 5MP6H 5GS1B 4F80A 4F7EB 4XNQB 3S3JA 5CINH 1SM3L 2EC9T 1QSEE 3DHMA 4G9FE 5F6HJ 4JLRB 4FQ1H 1ZLSH 4QRSB 3S37L 3P0YL 4K9EL 4MQXD 1YEDA 4ZD3L 1YY8B 4XP9H 1J10A 1GZQA 2JELH 2OL3B 1YYML 3ZE0E 3C5ZA 1ZA3B 3FO9A 4YGVA 3IJYB 3WXWH 3MV9E 3QQ4A 5EOQL 4TNVF 3TIDA 4I5BB 4KXZH 4YPGB 1A6WL 5A2KH 4U6VH 5JO5A 3L3HB 3MRGA 1E4WH 3F62A 3WSQL 1FNHA 4I3RH 2WWKT 3EJYC 2DQUH 1J0IA 1DL7H 2AK1H 1K2DB 3SGJA 4KKBD 3VXRB 5ITBH 2HLFC 5FUCC 1LO0H 1UCBH 2IMMA 5DJYB 3BGAA 4HJGB 1NAKL 1EJOL 3MQIA 5I1IH 3MRDB 4YHNA 4XMPH 4U7MA 3OZ9L 1L9MA 2YMXL 1QO3B 5K9JL 3MV9A 4LLYB 2R2BB 3QXDB 2ZKHH 4O9HH 5EU6A 3C5SA 2YS4A 3QWQB 4P5KB 4CVXA 1MRCL 1P69B 4KROD 2AERT 5CINL 2DLFL 3SDCA 1AKJD 1T2XA 4PGJA 5IHBA 1PZ5A 3EO1A 4XCEB 4QNPE 2NMSA 4Y2OA 4JPVL 5MEPA 4WIQA 4PJBF 4PD4K 4LSQH 3RHWF 3ZT5A 3IXAB 3MFFA 1DVFB 2WBJC 4KUCF 4JFFA 3QDGA 1F11B 2BVEA 1CE6B 1EEYA 1X6LA 1OAQH 3C5SB 1RIVH 3V6ZB 4LRIA 4MWFB 4R0LA 5KVFH 4U3HA 5JW3H 4GSDL 1WCQA 1S9WB 3T0WA 3QUML 4NJAH 4QOKD 5IB2A 2AI0L 1CFTB 3OGCA 1PKQE 5KZCD 2F8VA 3MRBB 5JIIA 3K2MC 4PGDB 2E8ZA 5IB3A 4MJIB 3UDWA 3UTSE 5T5FL 1IC1A 4MJIA 2GTZA 4LPCA 4TULL 1W72B 2EKSB 3CX5K 4NWUH 4QRRE 2BVTA 4KFZC 2BMKA 3VFGL 5C0DA 3VXMB 3ZKNC 1MCOL 1G6RL 4L4VA 5DJXA 3QWOB 3UMTA 4QOKB 1V7MH 3QIUB 1Q38A 3CSYB 3SE8L 3PHSA 1U8IB 3Q5TA 4Y4HA 4RFEA 5M7QA 3LEYL 4LCWD 3NPSB 1NJ9B 2X2YA 3NPSC 3QDGB 5E9DB 3STLB 5CJXC 1IC7L 1MCIA 3RIFF 3S35X 3C5ZB 4XXCA 4JFDD 2BHZA 1TVHB 2AK4D 5FK9B 1GZQB 1H3WM 4PJIF 5CD5C 1M7IB 1BBDL 3GJFA 2NX5A 5DVNA 3UTTA 4HF5H 4OQTH 3DV4A 2BY0A 2C4FU 5EZOH 4NQXB 3D18B 1KEMH 1Q9KA 3V0VB 4UOW1 1ZV5A 2P8PB 2A9ML 1JIBA 3WV0A 1CFBA 4FQ2H 1N3NB 1IC7H 3MROB 4LVNC 3B9AA 4ZYKB 5I75B 2NZIA 3GEWB 4JY4B 3VGAC 1A02N 3VG0H 1T1XA 3RTQC 4Z76A 1QSFE 5DC9B 4WUUD 3LPGA 5DHVH 3KJ4C 3MRJA 2DLHA 3DO7B 3MRRA 1IC5L 4C56D 5CBEB 5GGUA 5E6ZA 5LGJA 5EOCH 5DWUL 2W60A 4X99A 1MJ8L 4P59H 5F1IB 1ZVSA 5I30H 4YHZH 1Q9OB 4JDTL 1KXVC 3QXUA 4NQVB 4ZUTA 4WW1B 3B2UD 3OHXA 1BLNA 1FYTB 4KRMB 4MHHI 3CLEL 4OAWB 3V5KB 2EDEA 3B2VH 4EXKA 5IEHB 5INDA 3PGDA 1W72H 4XH2A 3SGEH 2R0LH 5AZ2H 1CK0L 3QIBC 1G7JA 4JGJA 4JHWH 3PL6A 2A0LC 2D3VA 3OHXB 3CMGA 3OJMB 4HBCL 4MDIB 4F58L 4Q9RH 5L6YH 4ZUVA 2KZ1B 3IDGA 1KLFA 1NANI 2YXFA 1PW3A 2LVCA 2ARJQ 2Q86A 4PV8B 3UO1H 1YEHH 3W82A 4DTGH 2XFXB 3FOMA 4S11A 1FFOB 4QHKI 4KK5D 3CXDH 5FDWB 4H0GA 1IMHC 4RISH 3P73B 4M7LH 4OZIA 4P46A 1PEWA 3S37X 1VA9A 4KKLD 1IKNC 4NFBA 5E99L 4S0TD 4KUCD 4HIIA 4MGXA 5IJKA 4K7PL 2IMNA 2CIKB 4GBXA 3IDXH 3PQYB 3BDXA 1EA9C 4ZO8A 1I1FA 2GK2A 1F13A 3QIBA 3GK8H 1IGFH 5EG6C 2YPLA 4JFHD 1IAIH 1KB5A 2QLVB 1CBVL 5DVOA 4ODWA 4XZUA 1AP2B 1UFUA 3D3VE 1Q9KB 1PAMA 3U2SB 1HHKB 4X6BA 1BM3H 1XF3A 4L8BA 3G08B 4NQEE 3FB8B 2DBJA 4PLNC 4XCCL 4WW1A 1MHEB 1VEMA 1EFXA 2BRRL 3BH8A 4QTIL 3WO3B 2V2XB 2FH6A 1KJ3H 3FMGL 2FX9L 4LSUH 4HCRH 3TT1H 4CMMA 2J6EL 3OAUH 5DJ6A 1CXFA 5C0RL 2FNBA 1YN7A 1YECL 3DO7A 3CXDL 2Q8AL 4NDMA 3H2WA 1OF2B 1Q9WA 4N8CL 1OPGH 5E4IA 3QRGL 3PDDA 5F3BB 1A7BA 5A2IH 1R6VA 2JJSA 4HKBA 4RA0C 1OGAB 5F93C 4CUCA 1EGJH 3WCYA 5I18L 4M6NH 4BZ1H 5F8RC 3P30H 5IB3B 3UJIL 3DECA 5K59F 5HTSA 4LHJB 3U0PA 1I9EA 3IRZA 5JHLH 1YN6B 3DX6A 3GZKA 1MCFA 4MD0A 3B2VL 4MNQB 4R3SB 4TTDC 3BT2L 4FQ1L 2H8PA 1J1XH 1ORQB 2PO6D 3EKCA 5FA4A 3ZE1F 3QEQB 5CKAA 1JWUB 4JDVA 4P23A 3EYQC 2XT1B 4KDTA 5DEZA 3FB6B 4QT5A 5KSAD 2Y9RT 5DC4B 2GJ6B 2JJTC 2WUCL 5D6DA 3MOAL 3QNXB 1A47A 4PJAB 2H1PH 1NEUA 1F6FB 2Y7QB 2NLJB 5FYKH 3QDME 3OMZA 3MRKA 4U1MB 5IMKA 4G9DA 3KXFE 2VMFA 1V7NH 2HRLA 3MRIA 5BVPL 4E41A 5DA4A 4PJXE 1H3XA 3QFDB 1OD7A 2C3VA 5D7LA 1AD9B 1CF8H 3HNTL 3QEQD 1MCWW 3F7QA 3HN3A 4GRMB 4ZFGH 5HGGS 5KSBE 3OJVC 1F42A 2D7PA 1KLGB 4XPBL 2JB6A 1OP5H 1J0ZA 1OQXA 1X5LA 2ED8A 4M6MH 5D6DC 1X4YA 2PTVA 3QAZC 3F7YA 1UB5A 3CD4A 2JJWA 3I6GA 4BFIA 4K94C 5F70A 1NANH 2DQEL 3C6SB 3CVHB 3MV8D 2Z91B 1ZHNB 3CJJA 2FO4B 3T0XA 5HYQB 1P4BL 3F12B 1TXKA 1T21A 4XPHL 3SCMC 1WBYA 4XNQA 4MB3A 3V6BR 3H42L 3HE7A 4X8JA 4LSSL 2OZ4L 2AI0H 5LGHH 1RQ5A 3E0GA 4GFTB 1SJEB 4P9ML 1P1ZA 1AGBB 3QCVH 5F89A 1OB1A 4HAFA 2R1XA 3MRGB 2PR4H 3L3HA 4HS3A 1YN7B 3T0DA 1KGCE 4UTBH 1INDH 2XY2A 5IM7B 5ANMA 3QHFL 4K71C 5IQ9B 4TSBH 4PJ7E 3HZYB 2XNAA 3Q5OA 4JCLA 5DUBA 1RFDL 3UBXB 4XCFH 1DQDH 1FG9C 1MRCH 5BO1H 1C1EH 3K8LA 5FA3A 2X89D 4X80H 3WLBB 3RPKA 1P2CA 1MCLA 4RAVA 4XXDA 3C5ZC 4K7FB 1DLFH 3G9AB 5IVZB 1J11A 4M5ZL 4KVNL 1N59A 1NMCC 2WBJB 2R2HB 1FYHB 1JTPA 5IOPB 3SDXA 1AXIB 1W0YT 3BO8A 3ARTA 3IJHA 4ZTOL 4PRBB 1NGPH 3LKQA 4UQ3B 1YEIL 4C59B 2VDRL 2CIKA 1R3IH 4H20H 4L8DA 4YXKL 3NAAL 4DGVL 4YBLC 3DXAA 2GSGB 2H32A 3DXAD 4HUWA 2WAHA 5J13B 4TUOA 4DKAA 1FNEA 3K2UH 4XP5L 4F57L 3RZCD 1YMMD 2JIXA 4JRXB 2O93L 3FB5A 3KPQA 3LH2L 5E5UB 3TM6A 4JZOB 2DJUA 1IC4H 3WEXB 2OJEA 1NAMH 2H26A 2Z0BA 1OAXL 1A3RL 2L7JA 1H3GA 1CS6A 1S3KH 4H26A 3D39E 1G7MB 4R7DB 1ZANH 3OXSA 3JV4A 2ID5A 5FGRA 5L8KB 4ELKB 2ZSWA 1P6AB 4PFEA 4OTXH 3ZTJH 3FOLA 5FUZH 1G6RB 2JB5H 3O3DA 1RIUH 3QUMB 4PGEA 4HWBA 2UYLA 3ARDA 4Y5XB 4APQC 1LK3H 2FX9H 1B2WH 4LCWA 3SOBH 4DEPC 1DBAL 2GHWB 4EOWH 4D3CL 4NZUH 4XNYH 5EBLB 2NTFB 4Y88A 5FUOL 3GMQB 4HDIB 2AK4A 4JJ5A 4LEXL 5D2LE 5D6CA 4I0PB 2HP4A 1PG7L 3X3FH 4LIQL 2H2PC 3HB3D 4FNLL 1FL3B 4LVHB 4MA3A 4QRRD 4WFED 5CILH 1DEEB 2GI7A 5DYOA 5HHPB 3RVXC 5CHNA 2ZCKL 3MO1A 2QADD 2V2WB 3OKYA 5GZOD 4BZYA 1JPFA 4J6RL 1HWGB 1JYXA 1HN1A 4LCWE 4TNVK 3GNMH 3MROA 2AEQH 2DQIH 1DQJA 3N9GL 5ALBL 3I75B 3DURB 1S7XA 4BQ9A 1R3JA 4HGKC 5SWSB 2AEPL 2D4DA 2YD3A 1MHCA 4PY8J 4QRPE 1S7WB 2QR0A 3W11D 3MLTA 3ULSB 2E7LA 1KG0B 1KT2B 2R0ZL 4J12A 5I71C 3P4LA 3KS0H 4JHAL 4F15C 3G04B 1G1YA 2VDQH 3RI5F 3KJ6L 5TF0A 4NCC1 3HMXH 5HHMD 1OP5K 3C6LC 1O7SA 2BP3A 2F54A 2KKQA 3ABZA 1H0DA 4JN2A 2XXMB 2Z9TA 4JZNA 1ZLUK 2VLKB 5KZCB 2PYFB 4FFVC 5FKAB 4H5SA 1KN2L 4HULB 5DHYB 4M48L 4NNYB 3RWFA 1WVZA 2H9GB 1MEXL 4PJCB 3SDDB 4QRPA 4PJBB 5C3TA 1FLRH 1A0QL 1IGTB 2C4XA 4BZ2L 5JPNA 3HFMH 2E9IA 4WU5A 2BVPB 4R97B 3IU4L 5EUKA 3O0RL 3R8QA 2IALB 4ZFGL 2NXYC 5MI0B 2R56L 3ARQA 3TZVA 3S36X 4PGEB 1FLTX 4UV7H 1A1OA 1ZVHA 4IRSB 1CICA 2WMPA 3T77B 4OFIA 3QAZB 3QPXH 5IR1B 4LGPB 5CGYC 5D4QA 3U48A 2XRAH 4AG4L 1ACZA 3OPZH 1KELH 3GMOB 3N1QC 4M03A 4RGOL 5C9JA 1K9TA 4MNGB 1OVZA 1IZKA 2A6JB 1CIDA 1JZ5A 3BH9A 4KROC 4LOUC 2ADJB 4UT7L 3SKUD 5JXAL 1XF4B 1HXYA 3VFMA 4LLUA 4KAQL 1I4FA 5GGQL 5EUOF 1TQBC 2WINB 4EI5C 5IBUG 1T5XB 1WTGT 4HIXL 1JVKA 1F6AB 5KS9E 4WFHE 4RAUA 5MEQB 4D9QD 5IESH 3KPNB 3DUUB 4J8RB 1VESA 1KLUA 4N0UA 3I02B 4X9BA 4XNMB 4OF8A 3CVIH 2J88L 2X4UA 4OCNC 1INQA 2PXYD 3IFLH 4OGAD 3PIQA 2F5BH 3QCUL 4MD4B 2DL2A 4QHLB 2GAZB 2GITB 3K7UA 1WFNA 2VZTA 5IF0B 2VITA 2R2HA 4GKNA 1R0AL 4UDUA 5JOFA 1YNLL 5FO7B 4LASH 1NBQA 2X70A 4NN7C 2XWTA 1AD0B 2J8UF 2YWZA 2DQFB 2QKIA 1IEAA 1MVUB 1VFBA 1NBYA 1J8HA 4N1HB 5F1KC 4LLVB 1T0NB 3DETD 4YX2H 1CQYA 5I0DA 5DMKA 1T5WA 2PTTB 3C2AL 1MAKA 3BEVB 3O6ML 1CL7I 3BW9A 4P2CG 5FOJA 2PYEE 1G9NC 4KQ4H 2IFFH 4RGNE 1BAFH 5DUPH 5F7UA 3KDMB 1ZTXH 2X4SB 2AJ3A 4HCRA 1JHLL 3QI9B 4N8VG 5BOZG 3FFDB 5ITBL 2EDJA 4XP5H 1J0JA 3B6SB 3O9WC 3P4OA 4L4VD 3MBXH 4Z5RB 5J7CC 3W5MA 5BZDA 4Z7QE 4OLYH 3NN8A 2G60H 3DVIA 5DT1L 4FNLH 2QSQA 3GBML 3MJ8A 2IGFL 1ZHNA 5KW9H 4NPYA 4OZHE 1WCBA 1S5HA 3S96B 1S3KL 1R3KA 1MNUL 4N0YL 2HTLD 1VCAA 4PP2B 4FFZH 3OSKA 1SEQL 1FJ1A 3DRTA 1J0HA 4I3RL 5DFTA 5DT1H 3DUHA 2E27H 3TBTA 1C1EL 1IAIL 1SJHA 3R06B 4KJQC 2GUOA 5BZWB 3Q6GL 2BC4B 4P2RB 3CK0L 5L6YL 5IVXA 2IAMC 4HKZA 4YXLL 3ZLQC 4JQXC 3MLPA 3IJSA 3TCXA 4NRYB 4LCYA 4Z6AT 4LCCB 2IH1B 4U1GB 1J9CT 1TJHH 1IQDA 3KXFD 5B4MC 3P9LA 1F6AA 3RX8A 3F7PC 3RNQA 4PBWD 5DVKA 1C08A 3PWPD 4ZODA 2VN4A 5GGSA 3VFMB 2FYYA 2XZQH 5HPMB 4YE4H 6FABH 1HYRC 1FYTE 3EO0B 4U1JB 2CQVA 2IQ9H 5B39A 2BNRE 5K9KA 3QFJE 5D1XD 3U7WH 1U3HA 4DN4H 2X4NB 3PWPB 2I07B 1MFCL 5JUEH 1JWUA 4LSRL 1T1WB 1UQSA 1UKQA 1CK0H 2A6DA 3QUXD 1JGLL 4XI5D 1JGDA 1TMCB 2EDLA 5L0QB 4OLZH 4R2GD 2OZ4A 3SDAA 4AZ8A 4NBZB 1NGWB 5I73B 5DQ9A 4NNXB 1I9RH 5EH1A 4NKMB 3RZCB 3EYSL 2WQRA 4OIAA 1JL8A 3MRQA 1RUAL 4HS8H 1FDLL 3F5WB 3EOTL 3QP3A 4FQHA 5IW1B 5FHBL 3ULUE 2A6DB 5SWZE 4GKZA 1OM3H 1TENA 1IEHA 1ED3A 3L3JB 5TFSH 2BRQA 3JWDC 1B88A 3PABA 2CDEA 3STZB 4RMWA 1T0MA 2ICCA 1EAPA 1LDPL 5HDQH 3TV3L 1MI5A 1Y6MR 3RA7L 5HSFA 4HBQA 3X3GH 3D2UB 1DFBL 1Q72L 1FDLH 3GHBL 3VXOA 3RWJA 1J87A 1QEWA 5C86A 5DEGB 4X98A 1T03L 1JMXA 1RMFH 4QTHB 1UH4A 3ARSA 1ZHBA 4CN4A 3BH8B 4R7NA 4LHUG 3QG7H 2LAGB 4GJTB 3VJ6B 4U1NA 5EO0A 2NY5L 2NXYB 4K3JH 5B8CB 1T1YB 1Q9LA 4CDHA 5F1SA 1NGXA 5E2UH 3HAEB 3BPLC 3ISWA 4XVSL 4ZFZB 4NKMA 3RZCA 3HPLA 3LS5H 2FATH 2FJGA 2PNDA 5DJZA 4X9HA 1G7QB 2UWEA 4OZIF 1I1FB 4PIRF 1TZIB 5IFAH 4KV5F 1HINL 3FAWA 3I3DA 3UYPA 4F9LC 2P24B 1RJLA 1XGPB 4HIHB 1JFQL 3Q6FB 4GXUM 3RP1A 3QULA 3TFKC 3ULVF 5F7MC 5C07A 5TE6H 5EDXA 3TJHC 1BQHG 5ESVA 2ARJB 3BEWA 1FL3A 5HHVL 2IG2L 3KYNA 2X1PA 4DN4L 1FHGA 4QY8B 1U91B 2VDQL 1GZPA 3WDIA 1T2QH 4DZBA 1IGCH 1RZGA 4CU7A 1T7WA 4YHOH 3GSNL 2DLIA 1XH3B 3HNSH 1A9BB 1N8ZA 5I1JH 1G0DA 3LQZA 2FH8A 2ZG1A 4MLIA 1R5VA 3PWNA 4OFVA 5E2JA 4OFPA 1K3IA 3O3DB 4F2MA 1OOAA 3BUYA 2FB4L 5MERB 5ALBH 3MRPA 1BEYH 2WP3T 4JY5L 1FO0H 3R0MA 5D7JC 4LLVA 1IEBB 3FQWB 3NFSL 5I8CB 4KRNA 1PSKL 3EYFB 2D9QB 1JP5A 3D1MC 4NOFA 4ONHB 5HGHB 3VXSB 1GC1L 3K4DA 1KIPA 4JDZB 4P23C 2VDMH 5EOQH 5ACZB 1T20B 1ZT1A 2DM3A 4MS8C 5SX5K 4DAGH 2CXKA 1LO5B 3RDTD 2DQJL 3UXFA 1MRDL 1KLUB 4I9WE 3BKCH 1GXEA 4U3XA 1MFBL 1BZ9A 1AR1D 3VDBA 5T1LB 2BSSA 4L3ED 4Y16A 3U46A 2AV1A 3MC0A 1T20A 1ZT1B 3GSOA 1JPGA 4Q0XL 3S3PA 3VW3L 2ERJC 2R8SL 3O2VL 5SWQB 2KQMA 2B20A 2DOCA 1DUZA 1A5FL 2AJSH 1IBGH 4X0KA 1U8QA 2WLZA 5C0JA 3PHQB 4QRPD 1NDMB 1AH1A 1ACYL 4F7MB 4XHQA 1YNLH 1J1OH 4MAUL 5ISZD 5HJ3B 2YUVA 1KN4H 1OAKL 4HV8B 4XP9L 1T0NA 4FXGB 3H7BB 3I6LD 3MYJB 1S7UB 2HKFH 4KVNH 1LILA 5DEFA 1VHPA 4HEPG 3T04D 4ZUUA 5BCAA 1TQCB 2XQBH 4WCYL 1LDSA 4GW1A 4X0KB 4ZAKA 3L7FA 1IGFL 4YAQA 4HKXB 3ES6B 1I3GH 2HTKD 1BWWA 4AEIL 5EWIL 5LXGH 1DJSA 2GTZB 2HH0H 1ZKAA 4LHUA 3S97C 1FZMB 4LSPH 3ZDYE 5CP3H 4ENEC 4GRWH 2R2EB 4NN6B 1RZJH 4QRPB 2OR9L 4P9HH 4DKEH 4M5ZH 2H32H 3O6FB 4QRTA 2ZSVB 4NNYA 3RWFB 1HE7A 1ZLVK 3CFEB 5BO1L 2AJXH 2X4PB 3V7AE 1E27A 2Z8WC 3VE0A 4AJ0A 4EKXA 3HE7D 1AIFA 2YR3A 3OPZL 1VFOA 4H8WL 1F4XL 2LU7A 3RU8L 4P5TB 4J7RA 4YEEA 3F7YB 1MOEA 5JA8B 3QXAA 3HCVB 1IL1A 5IMLA 4NGHL 1U8KA 1ZT7B 1OGTB 1A6ZA 3RPIB 3SKMA 3MACH 4K94L 2Z31C 4L4TD 4UT7H 2E6PA 1CCZA 5E8EB 1F8TL 2FEDD 5FYLH 4GRMA 1FNAA 4HPYH 3LVEA 5EU5B 2A9NH 2OJZL 3G5YA 1AI1H 3MRPB 2BVQB 1MIEH 4XP4L 4IRSA 3MRFB 1CI5A 3MCLL 1YDPB 5IG7B 5T3ZH 3BP6A 3EBAA 4NQCB 2VKWA 1HHHA 4RRPA 2A38A 2ZCHL 1IFHH 3VXSE 4PRPA 3ALPA 3HZVA 4N0RA 3CDGB 1CF8L 3HNTH 5KS9F 1S9VA 3FT2B 2P45B 3HI1B 1EV2E 2AJZB 5EC1B 2Q8BH 2P5WE 2APVA 3SKOA 4PJ9D 2BK8A 3INUH 3GKWH 3V52L 2GQHA 5C0AD 2ILLA 5D1QB 3DARA 3WS6C 1ZLWK 1RV6X 1QPXA 3MCLH 1OT2A 3MRLA 4KJYA 4MNQE 1A21A 4PTUB 1IGML 4P3WA 1CDGA 1S9VB 3FT2A 3RWIA 1XIWA 4F9PC 2R0WL 1C5CH 5T33L 1OTUD 5ERWB 3CFBA 5GS1C 5DRXB 1YY8A 4JFEA 4TRPL 4N68A 4YHLH 4E42A 5IP4A 3DETC 4HW6A 1KT2A 3HNVL 3ULSA 3HPLB 5BVPH 4UNTA 1S7SA 1DLHA 3U7WL 4JHAH 4Z0XB 4RZCA 4PJHA 3R0NA 1JTTA 3QDHA 2BVOA 3C08H 3EZ8A 4PJFF 4KJWC 1RD6A 3VFPB 4ELMA 4WI3A 3B9EA 3DRQA 5T1DH 5LAXA 4MNHB 4AEEA 1WISA 5I17A 4IJ3B 4LSPL 1FAIL 2EYTA 3WIIL 1OD9A 4JM2D 2QADB 4JM2A 3EDJA 2NW2B 2V2WA 3MLWH 3TN0D 4M93B 4WWKA 4NO5B 3SOBL 4LPYA 4YNYB 2DBLL 2BVYA 4RGNC 3UTSD 4Z7WF 5DD3L 1HH6B 2EDBA 4LCCA 3SDXE 3W9DA 5AYUH 6FABL 1N64H 1M05B 2VLRA 3ZL4L 2C3WA 1GHFH 5C0RH 2ADGA 3MLVL 4LDEB 3LPFA 1UZ8A 1GGUA 4L29A 1P4LA 5EBMA 7FABH 5B38B 2WNGA 2CK0H 4HJ0D 5DQDL 5I66B 5IWLA 1AP2A 2YXMA 2BNUB 5AWNL 1EO8H 4BZ1L 1II4E 2CGRH 5I6XB 1MFNA 3IDMA 3BPLB 3IF1A 3S88L 4HX1B 4Q58C 4R4NC 3VXMD 2OTWB 3IAQA 2EKJA 4JM2C 5EULV 2NY7L 1QD0A 1UQSB 2AXHA 5IV2A 3SGEI 1NKRA 1DZBA 4WWKC 4ZDHB 3L5IA 1E4WL 2Y6SD 3JWNC 4JREC 5EU4B 3TJEL 2J8UB 4FQXD 5SV3A 5SWZB 4LGSB 4HS3B 3QUKB 5SWQA 3RIFK 3F7RA 4G43A 3V5HA 1OAXH 1UH3A 1ZSDA 3AXLA 4NQSA 3B6SA 3P4OB 4O02H 1OP9A 3PP4H 5C1MB 3FQNA 4XRCA 1L0QA 4ZUVB 1C12A 2P49B 5F9WB 4AIZB 3H6JA 4U7KA 5D96C 5KSBB 1A1MB 4G8GB 4HWNA 1I8MB 1YEGL 1F02I 5HYJA 1CBVH 4WHYG 1JF1A 4PJ9B 5LKNA 2D7MA 4YX2L 2IBZY 1S7RA 4YXKH 2JKXA 4HUXB 3FHQA 4D9QE 5KSAC 2KPNA 1UM5H 5E94B 1X5YA 5TPWL 5EOCJ 3WIHL 2NY2B 4M8QB 1S8DB 4RMSA 5DK0A 1QSFA 2HN7A 4MXVE 5FA3B 3FFCE 1FJ1B 4MXWL 3DI3B 1UWEL 5FECA 2DQHH 4FTVA 3IU3A 4NKIL 1DLFL 2IAND 4BH8B 4D8PA 1NAMA 3MGTB 3UYOD 3H42H 1JWMA 1MCPL 5D7LB 3K1KC 1UWGL 4P2RE 4WW2F 2HVJB 2AEIT 4KRLB 4WV1C 1XFPA 4Z76B 1I7ZA 3WJLC 4CJ0A 3QQ9C 4Z7QF 1WWAX 5BZDB 4I2XA 3UZVB 1UXWA 4PS4L 5DI8B 4GW4A 2IAMB 4EI5A 4FFWC 3BN3B 5IB1B 4MCYB 3DYPA 1F97A 2D4FA 2MHAB 1EEQA 2PCPB 4M61A 2ARJA 4OT1H 3BX7C 4OZHB 3O8XD 3X3GL 1OAYH 3UJTH 4HWZA 4LNVA 4ZDHA 3AS1A 1IT9H 2X4QB 5A16B 4QOKE 1L7IH 3M07A 4DGYL 1TVBA 4OUUA 3WMSA 2X4TB 2HTLC 5HYEA 4KMLB 3MJ9L 1NCWL 3QQNA 5GZND 1FAKT 3UJTL 1D6VH 2MNUA 3BRFA 1J8HD 4TN9A 2MSPA 1DP0A 1I8KB 1KTRL 2E6QA 4FFWD 4APQB 3NZ8A 1WWCA 2YSSA 3ME0A 2C3VB 2PYEB 3QEGH 4LKCA 4NQDD 2X4UB 2F15A 4ALAL 3GKWL 2ICES 4PYGA 3P4NB 1RVFH 5KVDL 4GLRI 1JNHA 4NGHH 2CKBB 2PETA 1RIHH 4MJ6A 1NPUA 5BS0A 2Z92B 3HMXL 5E03A 5IT2L 1U95A 4XAWH 3PWLB 5EU7C 1FGVL 4NQDB 4ODHL 3C60A 3EDFA 5D9SB 4ZPTB 4RMTA 3GJEA 1H3PL 3NOIA 4U4BA 4QXUL 1A8JH 1RUMH 3U30C 4K71B 2VAJA 3IFPA 5IB5B 4GKZB 3L3GB 3HTLX 3PL6C 1CFNB 3TBVB 4Y1AE 1VFMA 2DKUA 5D7JA 1XGTA 2UUDK 4MAUH 2QR0B 3TO4B 5E08L 4YDVA 3VD5A 3I85A 3VXNB 5JA9A 4R3SA 3BGMA 4ELMF 2VB5A 4KPHL 3IFNL 1INEH 1X5GA 2FEEI 1NGWA 1QFOA 2X9YA 4KK6C 2YD6A 2UVEA 4ZO7A 1QTYT 2XZQL 3X14A 3NTCH 4HG4J 1QHOA 2IPUK 3NIGE 3MJ9A 4RX4D 3MBEA 1T7XA 2ZKHL 2X4NA 1NBZA 3PWPA 4PP1C 1UADC 4KUZH 4C55A 3FFCB 4NNPH 1FFPB 3IGAA 3GDBA 2PW1B 25C8H 3AB0C 1MF2H 1QLEH 3MUGB 4GXUN 3GNML 4CNIB 3ZHDA 1J88A 1KTLB 1YUHA 4NWTL 5DZLA 4DFIA 1LO3L 2X4OB 5DLMH 5FCSH 3WS3B 5GJSL 3VXPB 3P9LB 1GC1H 2DQUL 1X5ZA 3M8OH 1IJ9A 2XTJD 3LQMA 1HSAB 5CS7A 2Y5TA 4GRLB 1I85C 2IH3A 2VKXA 3RVWD 3S88H 4XPAH 2W65A 3WXWL 3QDMA 3OAYK 3PXJA 4XC1L 4ZPVB 4QRSA 3LN9A 5ID0A 4XBPB 4OZGB 1IBGL 4Z7UB 1DQLH 3RWGA 4JG0H 4KRPB 1F4YL 4ODSL 5T1MA 3QXAB 4WUKL 4GBXC 4HGWB 4GBXB 5F97E 2OJEB 3REWA 5E56A 4JZOA 2YD4A 3MV8E 2EEDA 2CRZA 3KGRA 4PV9A 5AG9A 3KPLB 5E8PA 2J3SA 5CHNB 1LEIB 3QUYD 4ZMAT 1AXSB 4CDGC 4KROB 4WI8A 1EBAA 1D5IL 4PB0L 3W11C 1YYMH 3CGTA 5KOMC 5CJ8A 2R4SL 1XGUA 4M7LL 4Y8AA 4K9EH 3U4AA 2CLVB 2F5BL 4KY1L 5IVNA 4UIMB 3SDXB 3GO1H 1GRWA 4HT1H 4Y5XA 2ORBL 5DRWB 5ISZB 4R0LC 4XP6H 1RHHA 4GBXD 3GMLA 5FXCH 1FN4B 5CUSH 2GFBB 2YPVH 1JZ2A 1L9NA 3O4LD 3KLAB 4H25A 3C9NB 1AGCA 4GUPB 5D7SH 2D31B 3BVNA 4TSCH 5HJ3A 1ERNA 4HXBL 2QJDA 3VRIB 3L95B 3L5WA 2YN3A 3IFLL 3E3QE 4LFHD 2O5ZL 3P2TA 1PDKA 5FYKU 1D5BB 1FZKA 2OR7A 5CBAB 2NXZB 1MJJA 3DOSA 3MUGA 1NFIA 2LV4A 5TE4L 3CFCL 2HYMA 4RBPK 5DJ0B 3D69B 5FYLE 2FR4A 1S5IL 1NFDB 3L3DA 5HVWA 4U31A 3MLRL 3OJDA 2ZJSH 4WJ5A 3RY4A 1XGYL 5KVDH 2PR4L 4YK4B 4WGVB 1SEBA 1CFTA 2AAVA 3BQUD 4P5MB 5E8NB 3SY0A 1G7PB 1LO5A 4NCC2 5CD3A 2V7NB 2NY0D 3CDYA 2YD8A 5F88A 1OTUC 3EGSA 3SKNA 4BZ2H 5ACZA 4QYOA 4UAOC 3H0TA 1KIPB 1G7LA 3ARPA 1K6QL 2VL5A 3DMMB 1RUQL 3I50H 1NCTA 2WQ8A 3DV4B 1P2CB 2AW2A 4L3EE 3NCFB 1M7IA 1PEZA 4PJDA 2AGJL 4K94H 1FIGL 2D2OA 3RAJH 4PJEB 3RVUD 4Z95L 3AM8A 2R0KL 4X83A 3ARVA 1YMMB 2XZZA 3QEHB 2GT9A 3BJ91 1BGXH 5F3HA 3L3OA 5ANMB 3UCRA 2B5IB 3KYMA 5IJVB 5IR1A 5IM7A 4XPGL 2YPLE 3S3SA 3V0AC 5C0BB 2GJZB 1FLRL 3EFFB 4L5FL 5A2LH 3MRMA 4OV6F 3LKSA 4DN3H 2RGSA 3BQUB 2VDOL 2CKNA 2BMKB 3VXMA 2H1PL 2OR9H 5TF1L 3RWCA 2P8LA 1I3RB 3HC4H 3LEXB 5LWYL 4ZG1A 5KSUB 4Z7WE 3MNWA 3SKJH 3ZHLA 2XN9E 3OGCB 1QBML 2ERJB 1VPOL 5DMGC 2OM5A 5CSZA 1QSEB 5CIPA 4MXQD 4OLWL 4I77L 3ET9F 4ZUWB 1MPAH 4E41D 3TO2B 4UT9L 4HWBH 4OF5A 2DI9A 2GT9B 4R9HA 5ETUA 3MFFB 4MA1C 5CILL 1CDJA 3GJFH 3I6GB 1KC5L 1DUYB 2DQHL 1A14H 1XCTA 2NY4D 3EZJB 1XZ0B 5LVEA 3UPCA 2ICEB 5GGRB 4G7YH 3IXTB 5GS0C 1NGYA 2VQUA 4M3KB 4BFEA 4RNRB 4P5KA 1EHLH 1CICD 1S7WA 4LP4A 4D3CH 3HAEA 4Y5YC 4ODBD 4AMKH 2DDQH 1CG9B 1SYVA 1JN6B 4A6YB 4X6DF 5TDOB 1RY7B 5FM5M 5IKCA 3C2SA 3E8UH 4X4XB 1KGCD 4Y5XC 1DQJB 4OCRL 3UPAA 3PQYD 1ZT4B 1WITA 3WKNA 2ZOLA 3QJFB 1NFDA 3L3DB 4LEXH 3CAFA 1K2DA 3IFOA 1KJ3L 2J2ZA 3D2UA 4U6HA 2FHCA 2R9HC 5HHOE 3D2UD 3T3PF 1JWMB 4JFXA 3M17A 1OCWH 5T1KD 2HT3C 1BFTA 5J11B 1U3HC 1BD2E 5DD1H 5I1EH 1J18A 4ZOEA 2ZUVA 3GMQA 3V6OE 3CXHJ 5F9WC 4I4WB 1N64L 2NY2D 1XF3B 3IAGC 4NQTA 5IK3A 3T0EE 3L6FB 4ZQKB 3KXFB 1DQLL 1G9NL 1L7TL 4Y4FB 4HUXA 2B2XH 5F9JB 1WSST 1U6AL 3KPRE 5DK3A 3TNNA 1CL7H 4P2RD 2PO6C 4DUXA 2R15A 4AIZA 5H35B 3BKYH 1YMME 3MUJA 3MV7A 4HSQA 1C12B 1BREA 3WNKA 3BHBB 1YA5A 3EYQD 1CGSH 1NDGA 2C9AA 3QNZB 2E5EA 3MLXH 4YZFF 1RSFA 2LE9A 3HLAA 1CT8A 1INEL 4NUJA 1U2CA 4LQ1A 2AP2A 4HBCH 1MJJB 2NZ9C 1VPOH 3OKLB 4G8GD 3P4MA 2D0FA 1BFOA 5ESAA 2QTEA 1U8LA 4JFQB 4DOHE 1G0XA 3TN0C 4O2CA 5HHQB 1KCVH 4R97C 1HCFX 5I1KH 3JWOC 2AQ3A 5IVXB 2A77H 5E6ID 3T65B 1IGMH 4XGZB 2EDQA 4XWOC 5BS0D 3U2SA 5TQ0L 3DHJA 5JIKA 4QHUA 3IDNB 3O6FC 1TTUA 4EDWH 2JK5B 4F7TA 4DKDC 5IVXF 3RAJL 4O2CB 5HHQA 4JY6A 3LSOA 4OZFA 2E6JA 2EXWD 4PJ7A 3ARDD 3DVNB 5CLTA 4M7LT 2QQKL 1U8LB 4U2ZA 2NY3D 4Z9KB 1BFOB 2BSED 3QJHB 5EZIH 2I9LA 3K8MA 5JORA 3T4YB 4NUJB 3PNWA 3PUCA 3WFCL 5DC0A 2YN5A 2Z4QB 5D1ZC 2XFXA 3FOMB 4JY4A 1CDIA 2XKNB 2ADIB 3MACL 4HGWA 4Z7OF 4WV1B 5GS2D 1FP5A 2VIRB 4I3SL 4CVZB 3F6IA 3TBWB 4RMRA 4F7CB 1YNTB 3W2DL 5C0NC 2X4SA 3NGBB 3QI9D 2FO4A 2DWDB 1L6ZA 1U3YA 2APTA 1K4DA 3DIFB 2NNAA 3TJHD 5INCB 1MQKL 3HUJA 4AENB 4QF1B 1KIUA 2OMNA 1TVHA 1TDQA 1U36A 5FK9A 3V5KA 1EK3A 4IRJA 4RWYL 1OW0C 2JLLA 3UYRH 4ZOBA 3G6JB 2NR6C 3L3GA 1MCQA 5ETUB 2VLJD 1UJTA 1WTLA 5BMFL 3FO1A 2FWOB 3FB7B 1U8IA 5DR5L 5F1IA 2X70B 3TYGL 4E0RB 1I7RA 4MVBC 3FN3A 1HWHB 3LKRA 2IBZX 4X6CB 1NC4A 4R26H 3FFCD 2Q87A 2IPKB 1G7IB 1AQDB 3EOAA 4NM4L 5BJTA 2W0LA 3TCLB 2E8YA 3BGFC 3BN9D 4HPYL 2L4OA 1BJMA 2VQTA 1BQUA 2VZUA 4PRPB 4WNQA 3MLYH 1PVHA 4PB0H 4DQOH 3ESVF 3B8SA 3HR6A 3KNBA 1ITBB 1AQDA 4R0LB 3GSXB 4Q6IB 3NBNA 1C16A 4KQ3L 2BNQD 2PN5A 2CO6B 2EC8A 3RNKA 4S0SD 5HI4D 4BSVB 4XB8A 4D9LH 2CLZB 2FD6L 5BRZE 2LU3A 1CFNA 5C0FB 3HG1E 4JB9L 1CIUA 5IB5A 1U8JB 1I9JL 5C6PB 2OK0H 4LIQH 4NHCH 5EUOA 2J6EH 1B0WA 1JMZA 4YDJA 1SEQH 1F3JA 4KV5E 5JTWA 3RNKB 3D25A 3BAEH 2Q76A 5FF6B 1IKFL 4O4YL 5F7NC 3NFPA 5EZLA 4YXLH 1TJIL 1U95B 3D87B 5F7FA 3QO1B 1UWXH 2EYRA 2ZOKB 4I0CC 3BP4A 2OS7A 4Y19E 2Y1VA 4UUJA 2AABH 3WFDL 2DIAA 5C2BL 5DGRA 4GAFB 4WV1A 2O61A 1KIQB 2A74B 3ARED 1Z3GH 1MRDH 1TETL 4JG1H 1FCGA 1FVDB 2NX5D 4O02L 2V9QA 4ZOCA 5J11C 3EYUL 5D1QC 5J6GA 3GMNA 1MF2L 1YEEH 4NQDE 5IFJB 2W92A 5C0EB 2A1WL 3ZE2E 1UZ6E 4U1HA 5B3JE 1TJGH 2WBKA 5KJRH 1IAMA 3NAAH 2I27N 1XF2B 1FH5H 2CMRL 1K3ZA 5DD6A 3Q3GB 1EVUA 2C3GA 4ZS7H 4YJZL 1B90A 4L4VE 1HQ4B 3V5DA 4H88H 3GGWB 5JOPE 2EICA 3SKNB 1MAMH 1HYSD 25C8L 2W07A 2VDML 3KPOA 5T1LA 1YQVL 3BP7A 1QFWH 3OB8A 4JVPA 4ZFOL 4RISL 4M4RA 5DJYA 3VDAA 3QWRD 3X13A 3OR6A 4J1UB 4RQQA 4LAJH 3C6LD 2QSTA 4X4MA 3P3YA 2YHGA 5F1OB 1UEYA 2DKMA 4YHPA 4MA3B 3EYVA 5HHPA 5HGDA 4FQIL 3RDTA 4WTWA 2V5SA 3VFTB 1O7VA 4P4KC 4M9OA 5E95B 1HHIA 5FKPB 2VSDA 3GMPA 5F7EH 1NMAL 1KV3A 4D0BB 4JRYE 1H3PH 4ODXA 3C08L 2FECI 1BJ1H 1UYWH 5EIVA 2EDYA 4PJ7F 3VXRE 1FGVH 1QLFA 1RZ7H 3NZHH 3BUYB 4EN3D 4HIJB 4JDTH 3TC9A 4IMKC 4XVSH 4FA8A 1N2RA 1IVLA 2Z35B 1XR9A 1FYTA 1N5AB 4LEOB 4YXHL 1H3VA 4F7EA 2Z8RA 4M1DH 1HHIB 1RZKL 5IHUH 1BQHA 3BDYH 4HPOL 2UVFA 4V2CB 4QRUA 2X1XR 1EVTC 4QY8A 4MNGE 5H94B 3Q1SH 1UYWL 4ZAKD 1Q72H 2FIKB 4ONGL 1GL4B 4HKJA 1SBSH 5C0AB 1HILA 2NXZC 4PJDE 4ZS6D 4BSWA 2GSIA 4C4KO 2GK0B 3HC3L 3DXAB 4P48A 3SDYL 3DGCR 3QEUA 3GJFK 2XQYG 4TPRH 1T1XB 4HQQH 3B8YA 1KEML 5I2IA 1ZT4A 3DYOA 3NVQA 1XF5B 4R90L 5L7XL 5KSVB 4HG4K 3IJHB 3NIGF 3EDKA 4A2LA 2N7BA 1CDCA 3MCKA 5IBLD 2DYPA 2BNUA 1LEKB 3GI8L 3VXNA 1AY1H 4UBDD 4D94A 4NKQB 2H2PD 3HB3C 1S7SB 3QPQD 1HQ4A 3OL2A 2A77L 4FQCL 1P7KA 5DD6B 4L29B 5EBMB 1PD6A 2YD5A 3S4SB 3RHWK 2EH8L 4GMSL 1ZHBB 3KPSA 1K8IB 3WS6A 4J3XA 4AL8H 1I1AB 1HHGA 3QO0A 4JPVH 4MA7L 5DJ8B 4Y4HB 3EFDL 4JM2B 4IM8A 1C8PA 3MOBH 4Y1AA 4CNIA 3QIUA 3GO1L 3QIUD 1UENA 2EE2A 3T0BA 3MNWB 4EVNA 2PO6A 3RWCB 2OMBA 3UBXI 4X4XA 2EXYC 3OZ9H 4KK9D 5C08B 3G5XA 3RL1B 4RZCB 1Y18A 1BIIB 3EO9H 3VG9C 1TLKA 1S9WA 4QNPF 3T0ED 1PLGL 3EJYD 1LK3L 1WIUA 5I1CH 4LCIH 2AXFB 4RMQA 5I1AB 5IJKC 5D96B 3MLXL 3RGVC 1FFNB 1VADB 1CE6A 3GSQB 2HLFD 4JFFB 4X6EA 3ZZ1A 1YEGH 3O6LL 1LP9E 4X6FB 3QFJA 3WHXB 3IFPB 3LRSA 5GRUH 1OCWL 4JFED 4TVSa 5ICZA 4QTIH 5GS0H 3EO0A 4DK6A 3C60B 3IKCB 1G0YR 3EGSB 1QRNE 4WEUD 2VXQL 3CX2A 3QRGH 3O3UN 4YHNB 3LD8C 3IDJA 4OTXL 5IWLC 5DI8A 3MRIB 3MV11 4JGUA 5GISL 4WNQB 4V1DD 5MEOA 5IHZA 3BQUA 4OI9A 3RTQD 5D2NA 5J3HD 1FZOB 2A1WH 3O3AB 3M1BA 4HK3N 4NM8H 4QWWC 4LLMA 4AQOA 3R06A 1OT1A 2MQCA 4NC1C 4HKXA 1HK6A 4YAQB 5F3HB 4BQ6A 4UMGA 4NT6B 4TUJA 3MLUL 5GGVY 3SKMB 1QRNA 1PKOA 3NA9H 5SX4H 4HK0B 4WFFE 5D1ZA 3IAPA 4LLDB 3LIZL 1A9EA 3ZKXC 3I2CH 4QHMB 5DJ2A 1G9MH 3BZEB 5H2BB 3SN6N 5GJSH 1AXTH 2Z8SA 5E1AA 1PGRB 2HFGH 5ALCH 4PY7A 2DDQL 1LO2L 5EPMB 4E41E 2X4PA 3VE0B 3CFEA 2NNAB 3SBWC 1QSZA 1QBAA 2V5YA 1X7QA 4EDXA 2BY2A 4GAYA 5I73C 5GJTH 4OIBA 5HXMA 5HYJB 4RDQG 2HJKB 4Z77B 4WHCA 2A83A 4Z5RA 5HHXH 2VIRA 4CVZA 5D7IF 3VFVB 2IAMA 3DNKA 3KAAA 5EOTB 3CZFB 1KYOJ 2CD0A 4L5FH 4BQCA 3MRCB 1A3LL 2V2TB 2DMCA 3FCTB 4XCFL 3GI8H 4R96A 5EU7E 4LAQH 4KK5C 1CGYA 4HIXH 1WICA 4Y4KA 3OF6A 1LD9B 3MR9A 1T22A 2VL4A 5BMFH 1W2KT 5SV4A 2GEEA 4ODUB 1X4ZA 2C1PB 2NY1B 4MZ3A 3NCBB 4QHMA 2RAMA 4RMVA 4GRLD 1AGDA 5JZ7D 4X8XA 5BQ7B 1BOGB 2XWTB 4LU5H 2WWMD 4UINL 4AM0A 1T89C 5FYKE 5ID0B 5ISZA 2X7LA 4IDJL 2NY1D 1ETZB 5E4EB 4D0DB 3FO0L 4MD4A 4POYA 1HH9A 1XGYH 2NTSP 5EA0L 2N1KA 1XGUB 4CMHB 3DBXA 3PQYA 2P7TA 1UT9A 4UT6H 4K3EL 3S34L 1EEZB 5I1LB 3KPRD 3IVKB 4UINH 2E7HA 2NW2A 3V5HB 3WNMA 1XR8A 1WZKA 2XRAL 4JFFE 4OGZA 2RBLA 5FDWA 2YA1A 1FFPA 4I0PD 4JKMA 4OFKA 4JKPL 1TZHA 4Z7VA 5DJCA 1RJLB 5HI4C 3SO3C 1EHXA 5AYQA 3RL2B 1W8OA 3QDMB 4LHQB 4X5LA 3EYOA 5CJBA 4Z7WA 1KTKE 4D0CB 2PXYA 3B4NA 5T5NG 4XWGH 2X5PA 1A9BA 4RGMB 4LCUA 3QZWG 3O6FD 3OKMB 4JKLA 3FZUD 2C1OB 3DUSB 5FM5O 5J13C 3SDCD 3D3VA 1GOGA 3RI5K 3MOQA 2CLRB 3CK0H 4WWKB 4MDJB 2AXGB 2D0GA 4PRPD 3ILPB 3IS0X 4JQIL 1DE4B 2NX5E 2FSEB 2ICWI 4HHAA 4MB5A 3QULB 5A43C 4XNZC 2FRGP 1OSZB 3KWWB 3I2CL 3NCMA 4N90D 1H0DB 3GSNB 4JN2B 3RKDC 4K2UL 1JE6A 2RQ8A 4M7JL 1ZA6A 2AEWA 1ED3B 4PG9A 4X6CF 3Q48A 4U49A 1NGZA 1UGNA 5DJZB 4HH9B 4MCZA 3MXVL 3PJSA 4NSKA 2R1WB 4URTB 4OD1L 1E28A 1DLHB 3ARBD 5CJOL 2DQTL 1JF5A 2H6PB 5BW7C 3QQ3A 3ROOB 3F7VA 4BM7A 2P8MB 4Q0XH 3VW3H 4ISVA 5B8CA 4JZJA 5FO9A 3VD4A 1TNMA 3GBNH 4NKDA 3TH3T 3CFBB 3U0WH 1K5NB 5LBSH 3BKYL 1Y0LA 5DEGA 4PRDA 5D93C 2X9XA 3MRHA 5KN5A 3ARBB 4KMTH 4IRZH 1E6OH 3GSNA 1HI6B 2R69L 1TJIH 5ICYA 1B6DA 4ZNEE 2VH5H 4HUUB 1HILB 1JPSH 5FHAL 3BISA 5ANME 5B39B 2W0PA 2X05A 1KJ2H 2APXA 4HUNB 4CVUA 2CLRA 3LOWA 4P2QB 5I1HH 4XVJH 5GXBB 2ZUUA 4S1DD 3PABB 3U9PL 1OWRM 4EBQH 3LKNA 4HDIA 3M8OL 2P8LB 3LPWA 3RNQB 1AO7D 4PUBL 4LHUB 5TJWK 3ZDZF 4NKOB 2FD6H 1PSKH 1P5UA 5I16B 1LO3H 3ILQC 1XCQA 2E9JA 1N2RB 4PJCF 5DRNA 3VRLF 3L7FB 4KI5D 3WJJA 2COQA 3CSPA 1QR4A 2CJUL 2CDGA 4WUUA 4YR6B 1JNNH 3RL2A 1EEYB 5DVLA 4F57H 4YC2C 2EH8H 4NHUA 5CMAB 5IBTH 1VENA 1JGDB 3IXAA 5J6HB 4PLKC 4FTVB 3THML 3ZKXB 4QHNB 3NABH 3V4UL 2G5BA 3P9MA 3UAJC 3QDJB 5IFAL 3CPLB 4IRJC 4M7ZB 1V3MA 4M7ZC 3EFDH 1QHPA 4JPIA 3UPRB 4PRHB 1NCUA 4YHIB 4M61B 3CU1A 1P4BH 1AIFB 2FYYB 2E7LC 3QUXA 3CFKB 3BYYA 3PGFH 4KI5F 3HZKA 5JR1H 3QG7L 1AKJA 3W0WE 2R4RH 4PGZA 1CGWA 5K9OA 2CR3A 3MLZL 1MPAL 2DAVA 3VXRA 4OBRA 3ARUA 1ZSDB 3EOYG 2RCSL 3W39B 1FVCA 4P23D 3V5DB 3FQRB 4NBYB 1RZKH 2R23A 4B7LA 1Q0XL 5F9OH 5L88L 1UKSA 4KDTC 4S1RL 3HC3H 5TFSL 3H7BA 1E6JL 2ARWA 3G9VA 4LKXB 1V7NL 3BVNB 5J6HA 3O41B 4W81A 2AJYH 4O58H 3HS0A 3HPJA 5EZIL 2PUQT 3DX9A 4LNRA 4V2BA 1RHHB 1DUZB 3FQRA 1AR2A 1HOCA 4P2OA 4R90H 3GM8A 2YD7A 4Y4HD 3UTZB 1JNLL 2B1HH 4PJ5E 1KJ2B 4H1LA 4OQTA 4LSVH 2J7LA 4PRIB 4JCMA 3VXQA 1LNUA 5GRZA 4RWHA 1AKJB 1UXSA 2YUWA 1M1SA 1V8HA 4IS6B 4LMQI 3KYNB 4S1QH 4XNUL 1A7PH 4Q9QH 2EYRB 3BEWB 3WHE1 5CJ5A 2EXYD 1JGEA 1J1XL 5JIHA 1WQVT 4LQFL 2OJZH 5DVMA 1IZJA 2BCKB 2V7HB 3NFPB 1S9XB 1XGRA 1AGFB 3VFSA 3MXWL 1BVLA 1CDYA 3LB6D 2MWCA 1U93A 4XNXH 3DRQB 1BQLL 3MV8A 3DXAE 3VFPA 1MSPA 1FIEA 2BY1A 2ESVE 4LLDA 3RJQB 4N9GB 2VABB 5E6IB 3BKJL 5MENA 2IADB 3MNZA 3RTQA 1F3DJ 2VDNH 5EO1B 1MFAH 4X7DC 2FJGB 3QUYB 1PKQB 1P84J 3K74B 2R0ZH 4TOYH 4MJ4A 3SJVB 4RGMC 1RZIB 1SQ2N 4LSTH 3SCMA 5CEXB 2FBJH 3U4BL 3HE7C 5T1KB 1NBVL 5IHZB 4PRHE 5C71A 1TITA 1U3HD 3EOBB 1FC1A 5I1IL 4HJJL 1R3HB 4TUKL 4L8SC 4LLQB 3V6FA 4Y0GA 4O2FB 1QA9A 4JANA 1A3QA 1U91A 3PWJB 1OLZA 4FTVE 3Q6GH 1F90H 1Q94B 1A6VH 2EYTB 4YDLC 2VAAB 1OL0A 4XHJC 5LAXB 3QWRA 5KAQG 4MQ7B 1A7NH 2F9BT 1A6WH 2ED9A 3DTXA 1XGPA 1LQSR 2XG5A 5C09B 3TA3C 2W38A 4OD1H 2EECA 4WFEE 2HT2C 3CIQA 4JM2F 2YC1A 3QR2A 4Y5VA 5DK2A 4CU8A 4ETQA 1EJOH 5HBBA 3U0TA 1DBJL 3TVMB 2H8PB 5I1AA 4XCCH 3T77A 4NZRL 3MRFA 5E99H 3JTTB 2JELL 3ZYIA 4FQJH 1T1ZA 1N26A 4PJ9C 5CP7B 5C92A 4FFYL 5SWSA 4QEGA 4ZFOA 5JPMA 5GGRY 3OAUL 4UBDC 1EUUA 3CSBA 3L5JA 4NRXA 2QHRL 1KTDA 4FQJL 1A6TB 4N0CC 2D9CA 3PP3K 1S7QA 1T3FB 3IFNH 3H7LA 1NQBA 3T3ME 1ULVA 3SDDA 1FNSH 4G6AD 4NZJA 3RX5A 5KVMC 3DGGB 3GFUA 2M26A 2Y4SA 3V2AR 1LK2B 2XTJE 4J3OC 1E27B 3MO1B 1DE4A 2P1YA 4KQ4L 3OG4B 2XTLA 4J4PA 4OCYH 2VLKA 3QB7C 3CDGA 4L9DA 4DVRL 3T3MF 2CDEB 3EOBA 5FIEA 4TTGA 3KPSB 3ZE0F 1A6TA 2O5XL 1F90L 4OLVH 1JBJA 1QSVA 3OTTA 1BZQK 4K7PH 1KG0A 4KKAD 3MLTB 3SCMB 3BKJH 2VDKL 3G5YB 1QBMH 1H15A 4APQA 5EU5A 3RY6A 1PKQA 4TRPH 2R0LL 4YHLL 2H3NB 1T1ZB 5C0IB 2VR5A 4PRIE 3DRTB 3B5TA 4ZFFA 3HCVA 2VC2L 4PBVC 4Y19B 5A16A 1QBLH 1RK1B 5CIPH 2UZXB 4XNUH 2P42B 5SX5H 5HGAB 4KMQA 4WENB 3ZDYF 2X6MA 3CFIC 1ZWIB 4Q9RL 1WCBB 4OZHA 2RHEA 2BCKA 1YZZA 1BGXL 1CXEA 4CADA 4JRXA 1HIMH 2Q8BL 3RZWA 1Q94A 2X4RA 4F33B 3E2HB 5EOTA 5I1LA 1JCKA 3VFWA 3TH4T 4CAGA 3IDGB 1U8NB 4IOIB 4IDJH 4UTAL 5K93A 3QISA 1S7TA 2W91A 4ONFH 1R5IA 4AEHH 3BUTA 2VR9A 3D39D 4HKZB 4ODHH 4P9HC 2ENYA 3T2OA 3H3PH 3RX7A 4M48H 4Y4FA 2CH8A 4GW5A 2YUXA 1FL6B 5J3HC 5C0CE 1BD2D 5GRXG 2F54D 4XAKE 5DMKB 3JV4B 2YKLH 3MLRH 2CIIA 2DQEH 3IU3B 1C5DB 3TPKA 2JCCE 4I4WA 4L1HA 5D2LB 4KJWD 1CD8A 3GMRB 4DGIH 3OG6B 2EDRA 2FCBA 3MJGX 2P5ED 3FB5B 3KPQB 1ODAA 5JOFB 1MCNA 4XPBH 1U92A 3S96A 1T22B 2IEPA 2V7HA 2BJML 1KN2H 1WFOA 4Z7VE 3BESR 5GSVB 4O00A 4Q74A 5JMOC 4XBEH 2FZ3A 2HRPL 2EIBA 3N9GH 3MRCA 2HVKB 3CZFA 4N0UB 1N8ZB 1I1YB 2I9TA 3VXUD 1A6AB 4UIKH 1DR9A 3VFWB 4P4RB 4L8SB 1EEUA 4Z7OE 3DV6A 3H3BC 4JKKA 4HJ0C 4Z77A 3AXLB 5HYFA 4LLUB 3U1SL 5JLZA 5IMMA 4OI8A 4TQEL 5HVGB 2ICWB 3HC0B 3AU1B 4V1DA 4XNZB 3BD5A 2K7PA 2E7MA 3HE6B 3FQUB 3UZQA 3P9MB 1T5WB 3IDIA 3Q0HA 5I8CA 4WI9A 1EDQA 4KVCH 1KBGH 3VFGH 3BPNC 3BPNB 1BBJB 2C3HA 4DK3A 3SGDI 4W4OC 3VWJD 3IDMB 5B22A 1MI5E 4KZEH 2JB6B 5FO7A 1QSEA 2X44D 2AJVH 1ORSA 2G5RA 3VFUB 3HA0A 3UJJL 5I74B 2WWMC 1P1ZB 4ODSH 1UZ8B 3ZSTA 3WO4C 2NY6D 2O61B 5T3ZD 3QIWB 5MEOB 1P4IH 1BECA 4X98B 3MNVB 1A64A 3GSVA 2X89A 2ZOKA 3QSKB 1UM5L 3O11B 4U05A 5L8JB 1P7QB 1Z3GL 4CJ1A 1BVKA 4LRNH 3ILQD 1YJDC 2IAMD 5EFIB 2XZAL 1D5MB 2HG5B 5C2BH 1IAOA 4HIHA 4KRPC 2VE6B 2P24A 4N0FB 2NY7H 3ARFD 4LVOB 4UU9A 1YEJH 2B4CH 2DQCH 4OSUL 5F7DA 1LE5A 4MSWB 4G9FD 4JFOB 4KKCD 1FNGA 1X5FA 2UWEB 3BAEL 4ISVB 4HWEL 4HJJH 3KLHD 3DYMA 3X11B 1A2YB 2YRLA 5CP3A 3FONB 4U1GC 3K2UL 4NNXA 2AJUH 3KVQA 1A6UL 1OARH 4JRWA 5TDPB 4OD3L 4ODTL 4U1NB 3WFDH 1UC6A 4U7SA 2QQQA 1UG9A 2Q7YB 2UWEF 2VLJE 4A6YL 4WO4B 4NQCE 3G5VA 1FV1B 4X5WB 3KPRB 1JPFB 2DD8L 2CGRL 3B3IA 3HZMA 5LCVH 2FSEA 4B5EA 4LARL 1NEZB 4YFEA 1NLDH 1CLOL 1NCCH 4Y89A 2YRPA 1T0MB 4P49A 1T66D 1I7RB 4AEFA 2F8OA 4XMLL 3ELAT 4HFUL 3QQ4B 4TQEH 1KCRL 4DZ8A 5I1JL 4LQFH 4OQ1A 2VLLB 3KPRA 4JDVB 4P23B 1GGIL 2VXSL 3G5ZA 2BDNL 1N5AA 4CBPA 5B39G 3F5WA 1MFAL 5IEKA 4EJ1C 4AENA 5IBUB 3T2QA 5CJQL 4I48A 5CEXA 3EYOB 2P8MA 1AJ7H 3MUHL 4WEBH 1TTFA 1I8LA 1HXMA 3MLYL 4RX4A 4QXTA 4Q97A 1KENL 3PXHA 4MCZB 8FABB 1A6ZB 4U6XA 3A6BH 1U8KB 1ZT7A 4JVUA 3DSNA 2VXTL 4PJGE 2FO1A 3S34H 1ZHLA 1IAOB 2CUMA 5KOVC 1GYAA 3ARGD 2P48B 3KPLA 5ADPL 1BVKB 4NUGH 2RFXA 1X5HA 1SJXA 3I3BA 1X5JA 1ZMYA 2J4WH 1H9VA 4OIIH 5I19L 1E4XH 1BBDH 4XX1G 4IHOA 3TZVC 4M5YH 3GI9H 5DTFB 1KSRA 1TPXC 3T4AA 5EBLA 2DQGH 2G2RB 3CUPA 3CH8A 4X6BB 3AS0A 1RULH 3SGDH 4F8QA 2Q3AA 3QUMA 1JUFA 4HIJA 4Z7WB 5F7HA 5TDNA 3Q3GA 2BSTB 2EDHA 4AT6A 1QLRB 1DQML 4ELKA 1Q0XH 1WAAA 4JFDE 2YD9A 3GRWA 4FXGA 3GMPB 4G5ZL 3QXVA 4HV8A 4ACPA 3ALXA 4M43L 2YD1A 5FYJU 3HI6H 1AE6L 5D71L 3VXPA 4LVHC 1Y6KR 1RUAH 4FP8L 4PLKD 4YE4L 4YQXH 1NDMA 4KK9C 3GMNB 1EFQA 2HT4D 3V6OC 1D6EA 2WK2A 3SPVB 1CICC 5CEYB 5AZEH 2EH7H 4OM0H 5DRZA 1URLA 1MHHB 3L3KA 2GITA 5D7JD 1FYTD 4MX7A 1JGLH 4HC1L 4LPXA 4XHJD 4JPKL 3UX9B 3IB4A 4TULH 1MLBA 3E6FB 3O45A 3MV7E 4LAQL 3CFJB 3RZCC 2MKLC 1H3UA 5FGBC 5F9JA 3KLDA 2ZUXA 4Z0BL 5ADOL 2WUBH 3S4SG 1FNFA 1SMOA 2PTTA 4YHIA 4UZGA 3PDOB 3VXSA 4WI2A 4LCCC 3ZKND 3W0WA 1GAFL 1BFVH 4JQVA 2N4IA 5DJ2B 5BQ7A 5FUOH 1I3VA 3ROLA 3BIAX 2NY5C 1WBZB 2DI8A 1C7SA 5J1AA 1G9NH 4IOSD 2B8OT 43C9B 2MPAL 3HRPA 1W0VA 3B9DA 1A7NL 1Q1JH 2X9WA 5C0EA 3TNMB 4HGMA 3A67L 3N1MC 1ND0B 3ZTNL 3QUYC 3SE4C 5JMRA 4FFYH 1ZANL 5DDHA 3I6LE 4L4VB 2ATPA 1AHWC 2NXZD 4ZYKA 4NZRH 2IALA 4OCMC 1IAKB 4KDVA 1WV7T 3V9FA 4J3SA 4DAGL 2YD2A 1B2WL 5HHMB 5DQDH 15C8L 4PJCA 3GSUA 4JGMA 4G6JH 5IBLC 2LU4A 3LN5A 4XC3L 2PYFA 5E2VL 1TQCC 4JQIH 5HGAA 2W9EH 1MCWM 3VH8B 5J57B 4YDJB 3VXUB 4X6DB 4PREB 3BZEA 3NIFF 1BHGA 1NGPL 5F6HI 2ZUWA 5J4MA 2EDDA 1P4IL 3TO2A 2X09A 5CSGA 5KSAA 1MCKA 1GAFH 1K4DB 5GRUL 2B4CC 5F7YC 1H8OA 3HHRB 3GSUB 3MJ6A 3QXDA 1RUKL 1EBPA 1QRKA 2L7UA 1S7XB 3QA3A 5EO0B 1CDUA 1IAKA 1E4XI 1QG3A 2XIDA 4ERSL 4NBXB 1KCSL 2ATPB 4KXZI 4OF7A 2F5AH 1Z6JT 5HYIA 2H9GA 3TP4A 2HVJA 4NDMB 3VI4F 3HC4L 5D7LD 4HHAB 5LWYH 1JRHI 1HNFA 2HA1A 2BFVL 4X6CA 3U36B 4N5UA 2IPTL 5IQ7H 1B0RB 1CQKA 3L3OB 1D9KD 4HEME 3KPSE 3H9HB 3KYAA 5CEZE 4BQ8A 5JO5B 5D6CB 1ZHKB 4XMKL 4JY6B 4UT9H 1J7VR 4JO4L 2P5WD 3QFJB 3QUZB 4EUPA 3U83A 1T2QL 35C8L 1U42A 3ORJA 5C0AE 4K3HA 4UT6L 2VL5B 2I5YL 5D7IB 4AY0A 3TA3D 1NL0L 2PXYB 1FGNL 4D0CA 1QP1A 2B0SL 1R3LB 3DIFA 3C8HA 1EHNA 1BFSA 1FL5A 4F15B 2ZUQC 3RBGA 3QIBB 3BPCA 5TE7L 1F3DH 1ZEAL 5KSVA 1CD9B 5KSBA 3BRDA 1DBMH 3KPMA 4Y2DD 1M7DA 3Q1SL 4MA1B 1MIEL 3OKLA 3ZTJG 3SDAD 3AM8C 4OZIB 3PNWB 1NFIB 4G80B 3ZO0A 4LSVL 4JRYA 2BXZA 4Y1AB 5J1TC 3RIAF 4JRYD 1SY6A 1L7IL 4HQQL 3QDMD 4QRQB 1F2XK 1FVEA 5IW3A 3QG6B 4PV8A 4Z7VF 3L95A 4LF3B 1IQDB 3TA3B 5H37G 4AEHL 1I1AA 3MV7B 1BZ7A 1JRHL 1C7TA 2NY4C 1MCPH 1FZJA 1J1PH 3FO2B 4JO4H 3VI3F 1G7JB 4UTAH 1ZS8A 3FZUC 3RQ3A 3G08A 4P2RA 1CR9H 3MA9H 4POUB 5J12C 4D0DA 4OGYL 32C2B 5E7BA 5FCUL 5BV7L 1N0XL 4NFCA 1HHKA 4XMLH 1F8TH 5C9KA 2BVUA 3U4EA 4U6YB 2Q6WB 5CFHA 4C57C 4U6YA 2Q6WA 4JLRA 2B0SH 4OAWA 4KHXH 5ADPH 4FXKB 1AJ7L 5JW5B 1ZK9A 2Y06L 4G3YH 1CLYL 1D5ZA 1AGDB 1Z9MA 4ENED 1SYSA 4G9FA 4UDTA 4LRIC 3OKDB 3SO5A 4LF3A 2AJXL 3BYTA 3P0GB 4NO5A 2W60B 4X99B 5GSRB 1CGSL 3QIWD 1S5HB 4JFXB 5E2WH 4DJMA 1LVEA 3S35H 3MRJB 4HK3J 3AY4A 2DIBA 1KPVB 5I17B 3FJTA 4YZFE 1CU4L 4WFGE 1YNKL 5GGTH 4WTZA 1JHKH 3IKKA 5AAWA 2Q86B 3CVHL 3CC5B 4MJID 5DSCA 4PJHB 4N8CH 2Y36L 2VXSH 4XPFH 2R29H 4EDXB 4ZPVA 3KDMA 5F8QC 3V4UH 4EBQL 1S78D 4G6JL 1WC7B 2ZZUT 1JYWA 3V8OA 4YWGL 4X7TB 4GOSA 2DQTH 5D7IA 5ABDE 1WBXA 3VWJB 3H9SA 4PJ5B 1XCTB 4YDLB 5E2TL 1J1OL 1DUYA 1I9IL 3W5NA 3G5ZB 1UB5B 2CO7B 3QUZD 3BMVA 4I18A 4M6NL 3QUZA 4EUPB 3STLA 2DD8H 3EDDA 1IQWH 1KXTB 2EDNA 4NQCD 1DVFC 2QQLL 2FGWL 4YWGH 1ZVSB 2APBA 1NCDL 5D1QA 4GKSB 2EE6A 4M1CD 2ZNXA 1NEZA 4MJ5A 3EJJX 5HGBA 3CLFL 4OCWL 3VI4E 1HKLL 1R3IL 4HCRL 2HFTA 3IDXL 2IANE 3G5VB 4X5WA 1KCKA 3KPMB 4M6AA 1DANU 3SGKA 1P6FA 1RZ8B 1MFEH 2VH5L 1OP3H 3MODH 1MCBA 4QHKJ 1EHAA 4NZTH 1R0AH 4HXAL 4PJIA 3EFFA 1IGJB 3ARGA 2Y7QA 2N7AA 3VXTB 1CFSA 3IKCA 2W0KA 3O6MH 1A7RH 2CUIA 1IGYB 4YDVB 4P57A 4TNWF 3KPPB 5D7JB 1DVFA 3O4LB 4PGBA 4BELD 4G6KH 4QT5B 1DVFD 3MYZA 3FB6A 3FQTA 1RFDH 5FOBA 1XF2A 1FSKC 1MCHA 4U0RC 3O4OC 3V4PL 1U8JA 1PY9A 4Z7NE 1WIOA 1EO8L 4I0KA 5E5MB 2WANA 3EJZC 4P57B 3SEPA 4NO2A 1IGYA 4V1DE 4M7JH 3GSXA 5J6GB 4MD0B 3S8WA 2OK0L 1B4JH 2FBJL 4PLJC 1QKZH 4Y4KC 3QWOA 3PWVB 5C08D 4WJ5B 1GOFA 1AFVH 3U82B 4U1MA 5IMKB 1H8NA 2NLJA 3B5HA 4J3VA 2Y06H 3CDFA 4G3YL 1J8HE 1G7IA 1I8KA 2QBWA 5F96H 2DQDL 1JNLH 3QNXA 1ND0A 4NN5B 4G6FD 5T1DL 4EXPX 3BWUC 5ESQB 4UQ2A 4BJLA 1CE1L 4MAYA 4NJ9L 4KHTH 2F58H 4OUUB 3LKOB 3WE6A 1TVBB 4I1NB 5E8OB 4AYFA 1W8NA 5L2JA 4BQBA 5J1AB 1OWWA 4S1QL 1BP3B 4F3FA 4U3CA 5EUOB 1AE6H 4WWKD 3K1DA 4NKDB 1WBXB 3UZEA 3VWJA 4DGIL 1ORQA 3E1F1 3PHQA 1JI2A 2GFBA 5L7XH 3U7YH 2CLZA 4M1DL 4M93C 3ROOA 2D7NA 4Z95H 3RKPA 2QSVA 5HYJE 5A40E 4UNUA 2BOCA 3TBWA 2YPLB 1OAYL 2UZIL 3VGHA 4IMKA 1ZE3C 1I1YA 2I9TB 1NUFA 3MLZH 3OKKB 3T1FB 4HZLA 3GSWA 4M6OH 3GM0A 3RA7H 5CCKH 3QPXL 2GK0A 4U33A 3TNMA 3LDBC 5DMYA 4OLZL 3ILPA 5HVHC 1I1RA 3IDYC 4G7VH 5D7SL 3UTQA 1T4KB 2AV7B 1FGNH 3SPVA 3CNKA 3C60C 5H94A 3L7EA 3QIUC 4DOHB 2W9DL 4OZFB 3BZFB 4UI2A 3D48R 5J89A 2EDWA 3OKMA 5KANI 4UB0L 5DGQA 3VFOB 3IJYA 4OT1L 1FORH 2ATKB 2D31A 5GZOC 3GUTA 5EB9A 4L3AA 4D9RD 4I2XE 2J5LB 4KY1H 4CN1A 5T1LD 3E6HA 3CX5J 3HR5B 3GMLB 1CN4A 3HI5H 1CD1B 4GRLA 3WL9A 3WJLA 1PJ9A 1NLDL 1MAML 4G8GA 4WI5A 1I8MA 2YPVL 3KJ6H 4JFFD 2ATKA 1T2JA 5FKPA 1FPTH 3JV6B 2MQ3A 5C09D 1FBIH 1CFQB 1IGIH 2QL1A 4FQPA 4YBQD 1MHHA 5HI3D 3WIHA 3THMH 5HGDB 3T0EB 4G80A 4YHPB 2B1AH 5C0CB 2WZPD 4EUPH 3RGVA 5ECJE 3VCLB 1AR1C 4RA3A 4LARH 2DQJH 4L8DB 4HZLB 4Y2DB 4YFLF 4F7PB 4BFBD 3L1OL 3OWEA 2B4CL 2DQCL 4OSUH 4R8WL 1K4CA 3BP7B 3KHOA 3UTTD 2KUTA 3WKML 3WL9B 5LBSL 4FN0A 5F7WC 5JHDA 3CMOH 2E27L 2P8PA 2H3NA 3B43A 3L5HA 2W0FA 3E6HB 4QXTB 4OGXH 1MFBH 1D9KA 2HKHL 1EJ6A 1VDGA 3WUZA 1KJ2L 5LGKA 5DTFA 4IHOB 2ICWJ 5MEND 4XC1H 1RPQA 4J3WA 4F3FB 5DJDA 3RWJB 1RHFA 2PYED 3X12B 1RIUL 5IQ9A 1T4KA 2AV7A 4OCWH 5LGJB 5GISH 3RIAK 3C8KA 3ZKMD 2WLYA 3WNNA 4AIOA 1LK2A 3T3PE 3SCMD 2VDLH 2EYSA 3OR7A 4O2EB 5E7FA 2EDKA 3LZFH 4PG2A 4Q9BA 3T08A 1A4KA 1NDGB 1XGQB 2OR8A 4N8VB 3VWKD 1N5YL 1KXQE 3TFKD 1I9IH 1WBYB 5JPMB 5IMOA 3VGBA 4WWID 4WW2B 1KEGH 5TE6L 3KJ4B 4DCQB 3D0LB 4KJPC 5J8OA 5JDJA 5L9DL 1CXLA 3BKMH 1FL5B 3MLVH 5D2NC 2OBGA 4RNRA 3WUWA 1TIUA 2BNRB 3VD9A 1NFKA 3N85H 1V5JA 4JE4B 1PX4A 2C5DC 4OFYD 2IANB 5MEPB 5D2NE 2OL3H 4UNVA 1Q0YH 1A9EB 1OAUL 4GG8A 1REIA 5K9KB 4MMXC 1FC2D 2EZ0D 4PJAE 2BOBB 3PHOA 4XVUC 3C8DA 4HUMB 5BXFB 3G6JF 2XWJB 2EDXA 1QA9B 3IFOB 4P4KB 3QFDA 4MCYA 1X9QA 2GJ6D 4UB0H 3MRDA 1BJ1J 3NH7L 4OLWH 4OLXL 4WO4A 5TQ2L 1ADQA 5DR5H 4F37K 1NCBH 5F9DC 3NGBC 1NLBH 3BP6B 5IG7A 3RVWC 2J4WL 3V95A 1KYOK 5J1SC 1A7OL 2BVQA 3NZ8B 1CYGA 1CG9A 1L6XA 5ID1B 3QFJD 4HF5L 3PHOB 4OQTL 5E6YA 5ITFB 1YMMA 2JIXD 3O0RH 5E00B 3TPUA 3UROR 3AB0B 1KB9J 5FECB 4JFOA 3LRSB 4JREB 4Y8DC 4S2SB 3H9YA 3KS0J 4CVXB 1DANT 3MGAA 4APQD 3W0WD 5E94A 5DURB 3VXTA 5INCA 4RRPG 1QYGL 5L88H 1FIGH 1CGTA 1JPTH 5D8JL 5JLZB 2HWZH 2YBRB 4TSAL 2PXYC 2GW5A 3I50L 2EIZB 3O8XA 5IMOB 3LEXA 5DD5L 4HD9A 3DX8A 1J5OL 2UY7A 1C5BL 1RURH 4JN1H 4NQEB 4XCYB 5M94B 5FDYA 3A6BL 3QUMH 4NJAL 1ES0B 2R1YA 4FRWA 3ES6A 5ISZE 1JZ4A 2AJ3B 5CSBA 3QUKA 2JE8A 5C0BA 1GCFA 1IAII 5CZVH 4M02A 4ZUSB 2EEAA 3RVVC 12E8L 1YY9D 3PQYE 1WEJH 4M62H 1S7UA 2OL3L 3S5LB 5J06A 5DZNA 4I18B 2XXCB 5IV2B 3HE6D 35C8H 3LSOB 1SYSB 2O5XH 1FO0A 3H9SB 4PJ5A 4G6KL 4PJ5D 2JCCF 1V3JA 1S8DA 4DVRH 2B7DT 1FN4A 3DMMA 2OXGA 3NA9L 3MOAH 4WEMB 1NUGA 1RIVL 1ZLVH 1BWMA 3U4EB 1TJHL 2V17H 3FRUA 4U1KB 1P4LB 1S7RB 3GHEH 3H8NA 3PIQB 1DEDA 1INQB 1R5IB 5C0GA 2VLRB 5I75C 1A1MA 1E6OL 2IJ0C 4OZGE 4FQXC 5GRVK 2CMRH 2D7TH 2QHRH 2FEDC 2DN7A 4L3EA 3D85B 1B9ZA 1LEIA 3D69A 2FR4B 2NY3C 4YC2B 2RFXB 3V79C 4OLYL 3WFEL 1XF1A 3LS4H 4XVJL 5D7IE 4C83A 3JWOH 3GK8L 5CEYA 5GSRA 4KWUA 2OLDA 3BRGC 4MNHA 1D5IH 4TVPE 4ORZC 5E24E 5EU4A 3SE9H 3EYUH 4AH2A 1ONQB 2I26N 1EXUA 1D5ZB 5D2LA 1B0GB 1RJYA 3N1PC 2SEBA 2IQAA 4KKLC 1WZ1L 2HJLB 4ZTPH 2RB8A 4G6ML 5FGSA 5C0ND 1KUMA 3TNNB 1HXMB 2Y72A 5A3IC 1BVZA 1D3CA 4R4FH 1G84A 2LABA 4JM4H 2P5WA 3ULUC 1ZS8B 4KZEL 3PWNB 1G7HB 2OTPA 1OQOA 1KPRA 1MJ7H 4I0PC 4LHUD 5I16A 3R8BB 3TA3A 2VLLA 1SHMA 4XPAL 2E9WA 1R5WA 1W72L 1K8DA 3C6LB 4F33A 5KW9L 1UVQA 1IRAY 4JRYB 4YGAB 4X7SL 3O6KL 4MVBD 3EUUA 1UJ3B 4LLWA 4RFOL 1A4JB 3UO1L 3B9KB 1ZHLB 4R2GC 4X6DE 3MBEB 1RJCA 4XVTL 1FV1A 3VXUE 5HI5C 3X13B 2P46B 4JFPB 1T04A 4YHZL 3X14B 1IKFH 3OKKA 4O4YH 3T1FA 3OXRB 4KAQH 1JHLH 2Q7YA 4NC0B 4QO1A 5EOCL 2MCPH 1FAIH 3WIIH 1M4KA 3ULUF 1G7QA 5E2WL