1BQLL

Structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPAIMSASPGEKVTMTCSASSSVNYMYWYQQKSGTSPKRWIYDTSKLASGVPVRFSGSGSGTSYSLTISSMETEDAATYYCQQWGRNPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYHEL-5 FAB (LIGHT CHAIN)
publication title Refined structures of bobwhite quail lysozyme uncomplexed and complexed with the HyHEL-5 Fab fragment.
pubmed doi rcsb
source organism Mus musculus
molecule tags Antibody/antigen
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1995-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bqlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bqlL01
3X3FL 5JOFA 4HUXA 1BQSA 4GKSA 1XZ0A 3V7MA 1PKQA 2C3GA 4L4TA 2F5AL 2OP4L 3U30B 4KMQA 3ROOB 3QULB 2NR6D 2AJXL 3NGBB 4R97C 2AABL 1ZAGA 1OGAA 4LQ1A 4UIMA 2B2XH 5T3XD 3MRLA 4MS8D 1P5VA 5E8DH 2EYRB 4UV4H 4HF5L 1VDGA 1INDH 1MCBA 5I1CL 3AS1A 1WBZA 2IANB 3QT2A 3VRIB 5I73C 3V0WH 5J3HC 4PJEB 1VFMA 1OM3L 1QSEA 4O00A 5GGSY 5JPNA 4NFCA 5IV2B 3MJGX 4PBVC 5T3XL 5I30H 2HRPH 2WINB 3SGKC 1WICA 5DRXA 1E6OL 3V5HA 4P59H 4ZXBD 3QUMB 4QOKA 3LKOA 4NNPH 1T7WA 1GIGH 3BPCA 2XWJA 3BH9A 3JV6A 2HFGH 5I1HL 2B8OT 1E4XH 4BFBD 3VXRE 4DKEH 3QXUA 3WKMH 4NRYB 3MRBA 3FQUA 3RA7H 4LHUA 4PJ5A 4G6MH 4IOFD 3WFBL 4G42B 1BM3L 4I9WE 4JO1H 4X7SL 5FB8A 4HX1B 3MOBH 4JHWH 4EXKA 4JQVA 2QQNH 5LWYH 2HKHL 3M17B 3EYVA 4KU1A 1RK1B 2V2XB 2JB5L 1QO3B 2VZUA 3VXME 1YN7B 5KS9A 1T04B 5IB2A 2JKXA 2LABA 4ODBD 1IAIM 4JRYB 3S9DB 1IFHH 4PJCE 4BSWB 1YJDH 3WXVL 3ALPA 4G7YL 1NFIA 2AVGA 5EC2A 2ATKA 1T0PB 2GQHA 4Y4FB 3X13A 1FNLA 2XRAH 3S3SA 1JCKA 1IILE 4KV5F 4ZUWA 3P77A 4MLIA 1IBGL 1N8ZA 4QXWA 4BM7A 4ZYKA 1J7VR 4OD2B 2VLLB 1GZPA 4TTDD 4Y19A 1FCGA 1DTUA 1SJVA 4MXWL 3O2WH 4U1MA 2RBLA 3QUXA 4LGSB 2J88L 5L2JA 3TIEB 1I9JH 1RZIA 5HPMA 1DBAH 1U93A 3IB4A 2BVPB 1XAUA 5EBMB 5D93B 4G43A 4LF3B 1ZK9A 5DJCB 1JMXA 5L8LB 1IKFL 1DLFH 2P45B 1INEL 1A3LL 1FDLH 3SE8L 1CF8L 3EFDH 2FATH 4RFEA 4PRID 2Q76B 5I6XC 1ND0B 3RZCA 2ADJA 4FTVD 5ANMB 3B2UD 4J3TA 5I1EL 3HS0A 4YHKL 2G75A 3IFOB 5IFAL 3DGCR 2YMXH 3BO8A 4U2YA 4DZ8A 3OGCB 1KTDB 2PW2B 2Z91A 5C9JB 3OJMB 4HEME 5EZLB 4PLJD 4PGBA 5FO7A 2NW2A 1FGVH 1B4JH 1GOHA 1IGCH 5EOTB 5LCVH 4HH9B 4LCYA 3T0WA 1CWVA 3KPRD 2DTSA 3TA3C 4GG6E 5HHMD 1YY8A 3DIFA 4JRWA 4LKXB 4UAOC 1MWAB 1WAAE 4GXVL 5ID1A 1VENA 2QL1A 5D1ZA 2IPKA 1MCHA 5ESAB 1J86A 1CXIA 5I1AB 1FBIL 4NKIL 5DRWA 2DDQL 3L3JB 2AGJL 2J3SA 4NM4L 1JZ3A 3QCUL 4JVPA 4L4VA 1WISA 5KZCD 2K7QA 3DO7B 5F7UA 2C26A 1PQZB 5J6GB 5C86A 2A1WH 2VH5L 3JWNC 4OCYL 3RVVC 1UVQA 3SHSA 1J10A 1V7MH 3BZEB 4WFHE 3CVHL 4NC2B 4XPTL 2JCCB 4JY6A 3KLHC 5JOFB 4HUXB 25C8L 2DM3A 1CDIA 3Q3GB 5I71B 4E41E 4GKSB 1XZ0B 2BRRH 1R0AH 1PKQB 4L4TB 4AY0A 5A43C 2NY6B 5F72S 5BRZD 4LPYA 3ZSTA 4D9QE 3ZE2F 1MNUH 2PXYB 1HDMA 2MMXA 2UUDK 3KPOA 4UIMB 3MRLB 3TIDB 1F45A 2X5PA 3OB0H 5F7LB 1FL3A 1W0YT 5C0NC 3WS6C 1WBZB 4W4NA 5CD5C 1QSEB 3C8KA 1I9RL 3WE6A 5JPNB 2XZCL 1JZ8A 5SWSA 1BEYL 2D7NA 4FXGA 3MXVL 1YMHA 3BP5A 5KSAC 5D96C 1MJUL 5MHSE 2GUOA 5DRXB 2MHAA 5DEZA 4PY8I 5JIKA 5JHDA 4QOKB 3LKOB 1T6WA 3BPCB 4HKJA 3JV6B 4IIQA 4NKMA 1N6QH 3GMMA 3JV0A 4LSRH 2EIEA 3O6FB 1RVFL 3FQUB 4LHUB 5CMAB 2OI9C 2IAMB 4EI5A 1CL7L 2BJML 1IZJA 4JO2L 5FB8B 3KPTA 3ARGA 4MCZA 3FMGH 5E5MA 3GHBH 4Y5YC 5J0BA 1KG0A 4PJ8C 4JM2F 4K2UL 3IFLL 5BOZG 3EYVB 2PETA 5IHUH 1U95B 1DQLH 1ZANL 4R4BA 5KS9B 1ZTXH 2DRUA 5IB2B 4YDLC 2XTJB 4P9HH 2YWYA 5TF0A 1NFIB 5EC2B 1RJYA 3HNVH 2YPLD 4PTTA 2WM0A 5DZLA 3WNNA 3X13B 3A6OA 1CICA 4DGYH 4ZUWB 1SBBA 3P77B 5BVPH 2V2WA 1N8ZB 5HYSG 4YC2B 1JZ7A 1HHKA 1O7SA 2YBRA 5EU5B 2AI0H 4M5ZH 4G9DA 3ARUA 1KBGL 5D7JC 1GZPB 2NY0B 4KJPC 3UJTH 2OLDA 3SDDC 1KFAH 4U1MB 2CH8A 3QUXB 5INCA 3PHSA 4ISVA 4ZQKA 5L2JB 3BJLA 3UTTE 1BFOB 3NCFB 1RZIB 3Q1SL 3KJ6L 3GSVA 4FQJL 4XTRD 5KVFL 3SO3B 3GO1H 4G43B 4IBLT 4R26L 4NKQB 4M4PA 3VCLA 2EXWD 5T1DL 4OLYH 4PLNC 2R4RH 4M8VA 4K71B 5ITBL 3W5NA 2JIXD 4QGTA 3RZCB 5CGYC 5C0DA 1FNSH 3IXTA 4ZPTA 4K7PY 5CJ5A 1A9EA 3QHTC 2DICA 2G75B 3RTQC 4AT6B 3BO8B 2QSQA 1JTPA 1C7TA 4DZ8B 4MNGE 1UZ6E 2VWEC 2CIIA 1XF5B 3A0OA 3QUZB 4KMLB 1Y18A 2DQTL 3AB0B 4G7VL 4PGBB 5FO7B 4NRXA 5J11B 2NW2B 5GXBB 5K9QG 3PWLA 5I1KL 4LCYB 2DI8A 4XP9H 4MXVE 1FIGH 5EU4A 3MXWH 3TV3H 3DIFB 4L29A 4JFYA 4JVWA 1L0XA 4K8RL 1MH5A 3OKYA 2J5LB 4WFGD 2IPKB 4X7CC 1KIUA 3QO0B 4N0FA 5D7IB 4U7MA 3DUUA 4QCIA 4KUZL 4L4VB 4I3RL 1WQVT 3TYFA 4MJ5A 3QZWA 2YUVA 2FX8H 1MUJA 3OG6B 1JWUA 2P42B 4U7SA 5JIPA 4JY6B 5FYKH 2AJYH 2FB4L 4NZUH 5EU6E 1S8DA 4KKLD 5D1XA 4KKBD 3MUHL 4LGPB 2CGRL 1YYLL 5L9DL 1VFAA 3GFUA 4G6KL 1G1CA 2VXQL 3WJJA 1S9KC 4F15C 3UO1H 4YDVA 1FL3B 3MLYL 4G6AC 4LSPH 3ZT5A 2OK0H 5J89A 1ZVHA 5C0BE 4JN1H 4XBGA 3C8KB 1CT8A 2W38A 3WE6B 3U9PH 5BQ7B 1OSZA 5K93A 3OG4B 5SWSB 2ICCA 1QBML 4FXGB 4J3SA 5GJTH 2BXYA 1YMHB 3BP5B 2GUOB 1GGTA 1Z9SA 5DJ6A 2MHAB 4P5MA 1F3RB 5EU3A 3L5WA 4PJ7B 2WBJA 5JHDB 4GMSH 5GZND 2N7AA 1CG9A 3MTRA 4HKJB 3V6OA 1PEWA 3ESUF 4KI5C 4NKMB 4UNTA 2QQLH 3GNML 4OI7A 2WBKA 4K23H 3MV9A 2GEEA 5SV3A 4AM0A 1CDHA 1GSMA 5GGTA 1YEEL 2IPTL 2PO6C 1HHIA 3C5ZA 4EI5B 5D6DC 3O9WA 3SKUD 3K2MC 2B1HL 4MCZB 5T1KD 5E5MB 7CGTA 4S2SA 1KG0B 3AFLA 4R6UA 5FYLL 1I85A 3CDFA 1HHGA 5BV7B 2ZCHH 4R4BB 3P0YH 3O8XC 5GS2H 2DQEL 5C0CE 6FABL 2CKBL 4TPRL 3FN0L 1LMKA 4BZ1L 1RJYB 3LKNA 4PTTB 1T1ZA 1M6OA 3WMSA 2F5BH 4R7NA 4Y4KD 2HVKA 1CICB 1OGTA 5BCAA 3B83A 1QBLL 2V2WB 1X5AA 1N3NA 1OAXL 4OD1H 1SYSA 2VL5A 4DOHB 4FRWA 4YHYC 1X7QA 1HHKB 2LAAA 3EYQD 2YBRB 4G9DB 1MCEA 5DJAB 4RGMB 4LSVH 5HYJD 4DQOL 3INUL 1C5CL 1U92A 3GBNH 5INCB 3HAEH 4ISVB 1J5OL 1HI6A 4G3YH 3DTXB 3GSVB 3X12A 1JFQL 1IKNC 1KJVA 2DQFA 1CGXA 4K55A 2PTTA 4P5TC 1L9MA 4LCWD 3ZKMC 1TJHH 1MQ8A 3WN5C 4F58H 2HT2D 2P47B 4FS0A 4CN1A 4PD4J 3MRRA 5SWQA 4BELD 1AI1H 1WF5A 4ZSOA 5C0DB 3IXTB 4ZPTB 4NC0B 5EBLB 1KSRA 4M5YH 1T2JA 5ESQA 1A9EB 3D48R 3UC0L 4M48H 5F89A 5E08H 1X5JA 5KSBF 4XZUA 1IJ9A 5KOMC 1Q9OB 4G8EA 5CZXD 3WFEH 2V7NA 4DKFH 1BP3B 1KB5L 2CIIB 2J4WL 1Y18B 4JFDE 4PJBA 4NRXB 5I2IA 4YDIH 4NHCL 3PWLB 1FFOA 3VXRD 2UUDH 5ALCL 4K9EL 3P30L 1VCAA 1MIEH 4FQQA 4JFYB 3VI3F 1MH5B 3OAUH 2P8LA 2R39A 2OQJA 4QTIH 2R29H 1RZJH 4N0FB 3U0WL 4I9WD 4DCQA 3DUUB 2P8PA 4S1RH 3ZYJA 4TNVK 3TYFB 2VQ1A 4PJ9C 3QZWB 2EYTA 4U6TA 4K3DH 4HGKC 2R0LH 1MUJB 4ODTH 1JWUB 1BGXH 3F5WA 4L9LC 1V3MA 2W92A 4GJTB 2FGWH 4HPOL 1JRHI 1OTTD 4U4BA 1A1NA 4F9PA 3TEUA 3B8SA 1S8DB 3T09A 4NP4H 2XIDA 4RISH 1FLRL 5TJWK 4JFFD 4OKVA 1OF2A 3QIUD 4MAUL 3T3MF 2LAGB 1VFAB 5L7XL 1BF2A 1J11A 2BY0A 3ZL4H 4YNYA 4P2RD 1GHFH 2VIRA 1A64A 4RAHA 4YDVB 3EO9H 1DBBL 3SKMA 3QDGB 1KXTB 1A3QA 2VDNH 3VFVA 1DP0A 3L7FA 1G6RL 1PLGH 4XBGB 1CT8B 5CLTA 3W82A 4XVUD 4FQ1L 4YWGL 3ULVC 2E8ZA 1OSZB 4XXCA 4ZS7H 4YK4C 5FIEA 3GI8H 1TMCB 3PWVA 5I16A 3SE3C 5CEZD 3E3QE 3GSWA 5DJ6B 4J3UA 4P5MB 5EU3B 3L5WB 3SGKA 4YPGA 4C55A 5DMGC 3HI6L 1CG9B 2VDOL 3IU3A 4N0RA 1ZMYA 3BN9C 4YBLC 3QIBD 5BZWB 5KSBA 1MAJA 3SQOL 3MV9B 4MA3A 4HJGA 5L2KD 4AM0B 2A6DA 5B8CC 3QBTB 2NY7L 4OUUA 4XBEH 5HDBE 2IQAB 1HHIB 3C5ZB 3MNWB 3S8WA 3O9WB 2R0ZL 1R5WA 4JO3H 3EOAA 1UA6H 5E2TH 3BEVA 4S2SB 4CVZA 2LFGA 3PE9A 4ZFOL 4XNMA 3CDYA 3GRWH 3JV5A 4XMPH 3BSZH 2L7UA 2CK0L 1J0ZA 5AUMB 3L3GA 12E8H 2ZUSA 4OM1L 1SQ2N 3QHFH 4N5UA 5KSUB 1KGCD 3MJ9L 3ZZ1A 1U8LA 1CFSB 3NCJH 4KHTL 3NZHL 3LKNB 1T1ZB 1JYNA 3WNKA 4R7NB 1NUFA 4HSQA 4U1GC 2HVKB 3MRFB 5E2WL 1N6VA 2VUYA 4MD0A 4IMLB 1N3NB 1MQKH 1ADQL 1SYSB 3BGFC 3PV6A 3RVTC 1X7QB 3SDYH 1LK2A 3AREA 3N85H 5IBUG 3QPQD 4GLRI 4E41D 4P9HC 1C12B 1U92B 2NY2B 5I18L 5J56B 1MRFH 4OCLC 1KYOK 5DD1H 3WSQH 4X4YA 5IOPA 2DF3A 2I60H 1QQDA 1HI6B 1PZUB 1C1EH 2VLKE 1KJVB 1KLFA 1YNLH 4OLVH 3NH7H 2XYCA 2DQFB 3T2NL 4ZTOL 2PTTB 2VL4A 1K85A 3O6LL 3TT1H 1OD7A 5BS0E 1UWGL 2DM2A 2QR0B 4X9IA 4PRHD 1QFOA 2CD0A 3IFNL 3MRRB 2ZUQB 3H3BC 4HUVA 4ODVH 5TPWL 5SWQB 3GUTA 4ZSOB 2Z31C 4TOYL 3TVMD 5IQ9A 1ZHBA 5ESQB 4WVRA 5F89B 4ALAH 2ORBH 2AK4A 2ZUYA 2A9ML 3JWOC 4G8EB 1KPVA 2HFTA 5SV4A 5K9KA 4PJBB 3SGEI 5I2IB 1IEBB 2OP4H 4JFEA 1LK3L 4WV1C 1FFOB 2VKWA 1UM4L 3E2HB 3JUZA 2X4RA 2AJXH 3O3DA 5DLML 2AABH 4FQQB 3TH4T 5CJXC 2E9IA 3GIZL 4LFHG 2P8LB 2OQJB 4NIKB 5I1CH 4YHIA 1JGUH 4DCQB 2P8PB 4ZPVA 4V2BA 3TCXA 1OM3H 3GSNL 1JNHA 5F96L 2EYTB 3CVIH 5T3XH 4WFEE 3F5WB 4WW1A 3T2PA 1OT2A 3W81A 4PJAF 4ZOCA 1E6OH 4FHBD 3K46A 1A1NB 2QHRH 1A22B 4N0UA 4GBXC 2BVEA 2XKSA 2BNUA 5I1HH 4POYA 2ZNXA 4QRPD 1FPTH 5HYQA 1OF2B 4UU9A 4ZXBA 3ZMRA 4XPHH 4F7MA 4P46C 1QSVA 1Y6NR 3EYOA 5KBNC 1UKSA 1F97A 2IF7A 4YNYB 3BKYL 3WFBH 3UTPE 2VIRB 1RULL 1KB9J 3IS0X 5F70A 3W39A 4X4ME 5F6IC 3WFHA 1EX0A 1I9IL 1KC5L 2BC4A 3SKMB 2IGFL 4FFWD 1QHOA 3TT3L 3UYOD 3VFVB 2EICA 2HKHH 5E8NA 5F7KC 2JB5H 4PB0L 4M1DH 4ZD3H 1CN4A 1LP9F 2X4PA 2ED8A 2FBJL 3P0VL 3PWVB 4DTGL 5IHBA 5I16B 4HJJL 3HPJA 1AIFA 4G7YH 3GSWB 2FYYA 5D1QC 4HBQA 3DMMD 1N4XL 4Z7UA 4MVBC 5HHOD 5IKCA 3IU3B 4D2NA 5CBAA 2OZ4A 3V6ZA 1CLCA 1MVUA 4MA3B 5EO9A 3VXOA 4Y1AA 2A6DB 5FYJE 4HQQL 4JPWL 3D18A 5F93C 4OUUB 2CR6A 3RL2A 2AQ1A 1DBKL 4KTYA 3DSNA 5FFLA 3D39D 2EDLA 1JNJA 3EOAB 4MXWH 4OZGF 5IBTL 2ADFL 3KYNA 3BEVB 3T2QA 4CVZB 4QRUA 2CLVA 3FAWA 2X40A 3GMNA 4CU8A 1UWEL 3L3GB 1KV3A 2FGZA 5TH2B 5T1MA 4ONFL 3AAZA 1Q72H 2DLEA 1U8LB 1IKFH 1EFXD 4M43H 3HUJE 4ZS6C 1U8KA 2DLFL 4ZUVA 3RIFF 3T8XA 1BAFL 5DJXA 2M2DA 2RIKA 1A3LH 3SE8H 1CF8H 2HJFA 2YPKA 1QBBA 1B88A 2Z35A 4MD0B 2VLRE 4PJAA 4JFPA 3RQ3A 1EXUA 1XT5A 1CK0L 1EEZB 5I1EH 3PV6B 3GSXA 4U49A 1MRDL 4HIJB 1LK2B 3AREB 1RUPL 4PRIA 4NYLA 4YHKH 2VKXA 3Q5TA 4J3OC 5F7HA 4S1DD 5DZNA 4WUUA 3MV11 1NH6A 1TLKA 1IC5L 3BUTA 3O2DA 3L95A 1E6JL 5I1JL 2WWKT 5D7JA 2VDLL 1VPOL 1T1WA 2V9TA 4X4YB 5IOPB 3C60C 2VERN 3SDDA 1QQDB 1CVSC 1BOYA 1LO2H 1P4IL 2HT3C 3STZA 1A6AA 4NQEE 1H3VA 4GXVH 2Q7YA 3KPPA 3OR6A 2DMCA 2BNRA 3LQAH 3T0EE 1FBIH 3T77A 2DDQH 4RQQA 5I76A 2AGJH 1LP9A 4NM4H 1AR1C 1IM3B 1AP2B 3QCUH 4EDXA 3JVGC 4RZCA 4HUVB 1ZVSB 5C0AE 3GUTB 4DGIL 5IMLA 4OCYH 1ZHBB 5IQ9B 5I1LA 5I6XB 2A0LD 3CVHH 3H9HA 2M1KA 4YFLI 2AK4B 4TQEH 4K7PX 1KPVB 3C6LD 25C8H 4KI5F 5K9KB 4ZMAT 3SY0A 3RTQA 1LNUA 5ADOL 2X70A 4JFEB 3UTOA 3WNPA 3QEHA 1KEMH 2X4RB 3O3DB 4EXPX 1J0YA 4KFZC 4WNQB 4HJ0C 2I9LB 4KDVA 1KCRH 3TNMA 1U3HD 1ZA3A 2DBLH 3C09B 1YNTA 4PRBA 1JZ5A 3ZHLA 2R56L 4UAOB 1AGDA 4J4PC 4YBHA 4YHIB 4OCMC 1W8OA 3DARA 1G7LA 4ZPVB 4OD3L 5JA9A 1QSZA 4NKDB 3BPNC 2YA1A 3WIFA 1BZ7B 4HWZA 1T0MA 2XZCH 4L3EA 4LSTL 4GW1A 1I7TA 1TVDA 2WLYA 3O4LD 1BEYH 4WW1B 2ZUVA 3MXVH 3D0LA 4JFOA 4R4NC 3ABZA 1MJUH 3S36X 4FFZL 2CDGA 3LEYL 3OKLB 1N26A 3KPSD 1FC2D 4N0UB 4U05A 4DKAA 1FNGA 2BNUB 2C3XA 2VOTA 1QACA 5HHQA 1J8HA 5HYQB 1B0WA 4UU9B 4ZXBB 1PG7W 4F9LA 4F7MB 3VI3E 1X5XA 2EE6A 1KACB 1RVFH 3EYOB 5IW3A 1P7HL 3VI4F 4OZFG 3MV8A 3EJYC 2BJMH 3L3IA 3W39B 1J12A 2C3HA 3WFHB 4JO2H 4HAGA 2NYYC 2BC4B 5FGBC 4K2UH 5E8NB 1OP5K 5DC4B 3U1SL 1S9WB 5DVKA 5HBBA 1ZANH 5I17A 3C2SA 2X4PB 4AENB 4M62L 2DL9A 2BOCA 3DROA 5EOCJ 2H32H 4UI2A 3HPJB 5FUCC 2FYYB 4UV7H 2PTUA 1V3KA 4Z7UB 1PBYA 5IKCB 3QFJA 5CBAB 1XGUA 3GK8L 3V6ZB 2JJWA 1F4WL 3I3BA 2GYSA 1SY6L 3UBXG 1MVUB 5EO9B 3VXOB 4U6VL 4Y1AB 3DPBA 2YUXA 1KCVL 5CSBA 3D18B 2WMPA 2XN9A 4LASL 3JUYA 3RL2B 2X1QA 1KBGH 1T2QL 4RFNC 2NY3D 2Z8RA 3SCMD 1N5AA 3KYNB 1PG7X 1U2HA 4QRUB 3G9AB 5D6DA 2R1YA 3JTTB 2X6MA 5KAQF 2CLVB 2Y6SC 3GMNB 1MFAL 3CSBA 1KLGA 3O3UN 4FQJH 5ICZA 3EO0A 5CSZA 3BWUC 3FTGB 5T1MB 3AAZB 3I6LE 3DHJA 1YQ2A 3MRNA 4ZUSB 1XCTA 4LAQL 3IT8D 4R26H 3O8XA 3L7EA 5T1DH 4YDLB 2JJVA 5FHAH 1U8KB 4HDIA 4ZUVB 3KGRA 3T8XB 4LSUL 3WHE1 4AG4L 5DJXB 3VWJC 5ITBH 3H9SE 3ZO0A 2HJFB 2YPKB 3KPQA 2QKIA 2Z35B 1CE1L 3MNVB 2D7TH 4YDJA 4JFPB 1EXUB 2EXYC 1Z0NA 3IDYC 4WI3A 2O5XL 4NPYB 5C1MB 2Q7NA 4HCRA 4PRIB 4S1QL 2JIXA 4NYLB 2VITA 2J2ZA 1N64L 2BXZA 3N1FC 4WUUB 4ODSH 2D7MA 1IEAB 3JWDH 2DQTH 4TUOA 4WHDA 4G7VH 1P7QD 1W0WA 3L95B 4FABL 4LVOB 4M9PA 5D7JB 3FN9A 4G5ZL 4RMQA 5I1KH 3LN5A 4HC1A 2H3NA 1WVZA 2CQVA 5J1AA 2RJMA 2PNDA 1S7TA 1A6AB 3DX9A 2Q7YB 4K8RH 3OR6B 4WO4D 3KPRB 5JMRA 2BNRB 1ZGLB 5D5MF 3MZGB 5HHMB 3T0XA 3T77B 2HKFL 4RQQB 1TQCC 1FYTA 1MCWM 4P5TA 5I76B 1LP9B 3ULVF 1I1YA 2HWZL 4I3RH 4RZCB 5DJYA 2H1PL 2IBZY 1MCSA 3NIDE 4R7DA 5IMLB 2EC9U 2X1PA 3GHEH 2R2BB 3OX8B 5I1LB 5M7QA 4YBQC 2C1PA 1QPPA 3H9HB 3FT4A 4OFDA 3VFRA 3VXNA 4PJIF 2FB4H 1EEYB 3SY0B 4Y5VC 3RTQB 3HR6A 5ERWA 2BZDA 1L6XA 2N56A 3QEHB 4YIQA 4NO5A 5SWZA 4NQDD 5EUOF 2CGRH 4R2GD 1YYLH 1S7RA 2F58L 1ZLSL 5L9DH 4H8WL 1DCLA 2VXQH 3SDXB 1ZA3B 1EVTC 2F8OA 3DI2B 4FQIL 1K5NA 1YNTB 4PRBB 3LMJL 2G5BA 3U2SA 1AGDB 2QADD 4JPVH 2MPAL 5IGXL 3MLYH 1G7LB 4JVUA 4M6ML 3BDYL 4F9PC 4JDVA 5E70A 2PKDA 1OB1A 1I1CA 2MNUA 1T0MB 4L3EB 2XICA 4GW1B 1QRNA 1FO0A 1MFBL 2MSPA 5DFWH 3D0LB 1OD9A 4G6FD 5F7WC 4L9LA 2CDGB 1V3JA 2BVUA 2XV6B 3T08A 3HLAA 1J0JA 1G9NC 1WFTA 4U6XA 3GNMH 4F7CA 5HHQB 1P7KA 1J8HB 5HGHA 1DVFD 4JDTL 2DD8L 2WWMD 4MCYA 1RUML 2FX7L 5K9OA 1YEEH 2IPTH 3MV8B 3L3IB 4HG4J 1G7MB 5CWSA 2B1HH 2SEBA 1GAFL 4F15B 4Y2OA 3T0VA 2LV4A 2H32B 2Y4SA 3UZVB 1FJ1A 2A9NL 2E7CA 5DD5H 2VLKD 5D2LF 5D5MA 1ZXQA 1A7PH 2DQEH 2BOCB 3DROB 2CKBH 3DWTA 3FZUC 3FN0H 5E94B 1RD6A 4BZ1H 5DO2D 5DRNA 5ENWA 2VN4A 4YJZL 1T89C 4B53A 1U6AL 1E4XI 1XGUB 4O9HL 5KSVA 2FH6A 1EMTL 5ACZA 1QBLH 1OAXH 5FM8A 3U9UA 2XA3A 1OAQL 4PJIA 5EG6C 2C5DC 4QT5A 2XN9B 3EHBC 4GQ9L 2AXGA 4YO0A 1ZEAL 3UDWC 1RPQA 1Z6JT 4OFPA 1EIBA 4RMVA 3NFNA 2HMIC 4MJ2A 2LU7A 4WI2A 5EUOA 4DQOH 2OR9L 3INUH 1C5CH 4JRYE 1N5AB 3KLSA 1BQHA 3MV7D 2O5YL 3NCMA 1D6EA 3FB6A 3LKRA 1KLGB 1J5OH 3TBSA 5ICZB 5CSZB 1JFQH 3EJZD 3VGEA 3MRNB 5F9WC 1JYXA 1XCTB 2LVEA 3L7EB 1N7ML 3TZVC 4GSDH 4H25A 4HDIB 3QCVH 1FORL 5JOEA 3KPQB 1NBVL 1MAKA 2QKIB 2OL3L 4OCRH 5I8OL 3TWCH 3FHQA 4YDJB 5IF0B 5IVXF 1UXSA 3TCLA 4DK3A 2JIXB 4JRXA 4W6YB 3UC0H 2VITB 4ZUUA 1JRHL 1A7QL 1YNKL 2QQKL 1KB5H 2J4WH 1IGIL 1BIHA 4JKPL 4TUOB 3RBGA 1W0WB 4E5XA 4NHCH 1AO7A 4TTDC 1VKXA 2APFA 3LN5B 3ARVA 1QP1A 2H3NB 5ALCH 1BQLL 5E24E 2GFBA 1AE6L 2JELL 5EZOL 5TE6L 2B20A 5J1AB 1G0XA 1S7TB 3DX9B 5E03A 1SEBA 4IJ3B 1F90L 4DFIA 2KQMA 2FZ3A 3UTPD 2HLAB 5FM5M 4Z0XA 4N90E 4YFEA 4P5TB 1U3ZA 5D2LA 1I1YB 4G9FA 2P4AB 1NFDA 5DJYB 3HE6A 4N8VA 1ZT7A 3SDCD 2VR9A 2ZPKL 5F3HA 2BFVL 2F19H 1MCNA 4QRTA 3KWWA 3RI5F 2C1PB 2VE6B 3FT4B 2FJGA 3VFRB 4HPOH 4TNWF 5EPMA 1CR9H 3VXNB 3BFOA 5HI3C 4M3KB 2YHGA 3TH3T 3RWFA 3MLVH 3TP4A 1G7PA 4UTBL 5ERWB 3RGHA 2ICEB 1FLRH 5ISZE 4NO5B 2BY2A 4MAUH 3LAFA 4PLJC 1S7RB 1N2RA 3HC0A 1RFDL 3QXTA 3S35L 4WV1A 1YMMA 5L7XH 4AL8H 5FYJD 4RRPG 4CMHC 4LPVA 2G5BB 1UT9A 3U2SB 5CJXA 1DBBH 2YZ1A 3RVXD 1CD9B 2VDPL 3PGDA 1OP5H 2JCCE 5DFTA 4JDVB 1G6RH 4GXUN 4S0TD 4A6YB 1OB1B 3HI1B 4FQ1H 4YWGH 5I0ZA 2I24N 5FYJL 1QRNB 1FO0B 4L4TE 4DVBA 3N9GL 4DN4L 1QFUL 1RZKL 4L9LB 1NANI 1RIHL 3VW3L 1G6VK 3HLAB 2PYEA 2VDOH 3H9ZA 5IVXA 4NO0A 5IVZA 4F7CB 1P7KB 4Y0GA 2I9TB 5HGHB 3SQOH 2KKQA 5CEZH 5HYIA 5C07A 1PW3A 1MCLA 2NY7H 4GH7B 4WU5A 1QSEE 5K9OB 5J8OA 5F9DC 3QIBA 2V2TA 2W0LA 2R0ZH 1UYWL 2SEBB 2VXUL 3WFDL 2X89D 3ZDYE 4XVJH 3FFDA 3QAZC 1EGJH 1AD9A 1FJ1B 4P2QA 3WFZA 4OM1H 4N68A 2EKSA 5IQ7L 1RZFH 2D2OA 1X3DA 2PN5A 4KHTH 3MMEA 1F8TL 3NZHH 5ENWB 5JZ7C 4LQFL 2NX5E 2B1AL 5D1QA 5E2WH 1DJSA 5KSVB 2HRLA 5ACZB 3HC3L 4WFFD 4Q9QL 3U9UB 3RAJL 1ADQH 3LCYA 4XPGL 5JTWA 4PJIB 5DJ0A 4YBLB 3WD5H 2AXGB 4ETQA 5F71A 1TNNA 2EDEA 3NFNB 4O2CA 5KS9E 2C7UA 1ZSDA 2XTJE 3MOAL 1IRAY 5DQJA 3ALWA 4KAQL 4I0CC 4OTXL 1YN6A 1UCBH 5I18H 1I1RA 3FB6B 3FT3A 3LKRB 5TE7H 3TBSB 5B38B 5I8EA 1EZVY 2EH8L 2V5RA 4ZTOH 3QEUA 2Q3AA 4H25B 1XIWD 5E99L 1OTSD 2Y9RT 2EE2A 2R69L 1AGBA 4JAMB 1UWGH 4FP8L 4EDWL 1JF5A 3GB7A 4C83B 3IFNH 4LCWB 4Z18A 4JCMA 2FCBA 3OMZA 5TPWH 4TOYH 5F44A 1QKZL 4U1GB 4CKVX 4OGXL 2RQ8A 1UXSB 3TCLB 2GHWB 4JRXB 2CPCA 4ZUUB 1EHXA 3BGFB 2O61A 4ONOA 1QOKA 2F53A 2DQJL 2GK0A 4WDIA 2BMKA 4E5XB 5AZ2L 4K3EL 1AO7B 1LK3H 1VKXB 1U8NA 1IGTA 1UM4H 4Z7WA 1S7UA 2IQ9L 1T66D 5DLMH 4BKLA 2GFBB 2EEDA 3DRTA 3MLXL 1SEBB 3C60A 3A6BL 3GIZH 3I50L 2FZ3B 3SE4A 2MQ3A 1RJLA 3ZKQD 1DN0A 2GTZA 1G9MH 4Z0XB 2HTLD 3WLBA 1MHHA 5D2LB 4G9FB 5B39G 3GSNH 1NFDB 2AJVL 4X99A 5IT2L 5F96H 3HE6B 4N8VB 1ZT7B 3I3EA 5F3HB 4RGNE 1A5FL 3JVGA 3KWWB 4NRZA 2FJGB 2ZUUA 5EPMB 3CZFA 4YR6A 3V0AC 4OGAD 3RWFB 1IQWH 4TRPH 4K8RC 1X44A 1HNGA 1PZ5A 1U8HA 5D7IE 2DM7A 1A6WL 1N2RB 3HC0B 2AQ3A 4WV1B 1YMMB 1GC1L 4UIKL 3BKYH 3NAAH 4L4VE 4QRPA 5IB5A 5HVGB 2ENYA 3QIUB 2NY4D 1KC5H 1IC4L 4HMDA 3BPOC 2IGFH 4M7ZC 4HIIA 4P2RB 4HH8A 1NC4D 1P5UA 1V5JA 2E7LA 3R0MA 3V4VL 1JTOA 4UT6L 4J8RA 4ELKA 5JW4R 3P0VH 4F8TA 2FBJH 4DTGH 4Y8AA 4DVBB 5EC1B 3MLWL 4IRJD 4XPAL 2PYEB 3RWJA 3LKSA 1BD2E 2BHZA 3H9SD 3VA2C 2IFFH 2DJ4A 4M02A 4NO0B 5IVZB 4FXLA 2J8HA 3DMMA 5DZOA 3BKML 1OCWL 1MCWW 1IM9D 2XY1A 3BQUD 5C07B 4HQQH 4JPWH 3RU8L 3MR9A 4KKBC 4Z7VB 2RHEA 4RX4D 3CMOH 1DBKH 4M6NL 5DR5L 3QIBB 3QR2A 1HXYA 2V2TB 1V05A 3B9VA 4KPHL 5IBTH 2ADFH 3FFDB 1M4KA 2Q6WA 1ETZA 1AD9B 4PJ7E 4P2QB 1UWEH 4HV8A 3CXHJ 4KMTH 5H8DA 4ETYA 3QWRA 4K94L 2EKSB 1AFVL 3RWCB 5HVHB 3HN3A 5C2UB 3MMEB 2HT4D 2OJEA 4X6BA 4KTEL 2DLFH 1BAFH 5JIIA 5IMMA 4NQSA 5D1QB 3QDMA 2E6JA 2KQNA 2OMBA 5E0QA 2DLGA 1CK0H 4GRWB 5DJ0B 4I0PC 4ETQB 1RZGB 3Q0HA 1FAIL 1DBJL 5HVFB 3D3VA 4O2CB 2C7UB 1ZSDB 4OQTA 5TF1L 5DQJB 1IC5H 4P2YA 1FZOA 2GTWA 4CW1A 1YN6B 4TVPD 1E6JH 5I1JH 1KPRA 2VDLH 1E4WL 2ZUWA 3HB3D 3FT3B 3M1BA 2J8UB 1LD9A 3LQZA 3OB8A 4D9LL 2W9DL 1P4IH 3B9KD 4IRSD 5I8EB 2IWGA 4I18C 3CLEL 3ARBC 3EIFA 4KRPD 2ZSWA 4G80A 4NQCA 5C0FA 3QEUB 3FOMA 3RHWK 2PW1A 5HGGS 4DOHE 3LPWA 3OXRB 5DDHA 4FZEL 4RMWA 5IW6A 5MEPA 1X5HA 3GB7B 4XHJC 1DE4A 2AJ3A 3VWJA 5GGQL 4PJDF 2CKNA 3MBXL 4OQ1A 4Y4KC 4LSSL 1G0YR 3LSOA 4WEUD 2VZOA 1DQJA 4PRHB 3OKDA 1UZ8A 2WLZA 2O61B 2HA1A 1ACZA 3TVMB 3X14A 1KTKE 2F53B 2A77L 5KTEL 2GK0B 4WDIB 2BMKB 5ADOH 1Q8MA 4OZFH 1RZ7L 1U8NB 1ONQA 1IGTB 5IMOB 4Z7WB 1S7UB 1F58L 4BKLB 4POZC 2IAND 1FLTX 3BXNB 1MY7A 3QNXB 1VFUA 3DRTB 3C60B 5GISL 1QHPA 4M8QA 4LP5A 1EUUA 4CVWA 1DBML 2R56H 1JWSA 3STBA 1Y0LB 2J1KA 1GVIA 1RJLB 3GJFA 1DN0B 2GTZB 1CDYA 4MJ6A 2EDNA 3WLBB 1T4KA 3RX5A 4F7EA 3QH3A 5BOPA 1L0QA 3NCCB 4X99B 1SJEA 4BSVA 3CUPA 5JA8B 4LSTH 5IJKA 4XAWL 4K3JL 3KHOA 4NRZB 3NA9L 2IBZX 5DQDL 5C8JB 1INQA 4F2MA 3CZFB 4FFZH 4P3WA 4YR6B 4K9EC 3C8HA 4X9GA 4NN7B 3R06A 1RIVH 2I25N 1PZ5B 3QUML 1B3JA 3H42H 1IT9L 1T3FA 1U8HB 4O2FA 3ARXA 2ZUXA 4D94A 1N59A 4JFHE 3AUVA 4OLZL 4QRPB 3L5JA 5IB5B 4BSJA 4PP1D 4GRLC 4UDUA 2G5RA 1NLDL 3H7BA 2DJSA 1OY3B 4JRYD 4HIIB 1J1XH 3OTTA 2OYPA 4APQC 3F7RA 4J8RB 5HY9A 4Y4FD 4M62H 3BPNB 2VXSL 4BYHA 3B9DA 3FO1A 4F7TA 1DQQA 3VWKA 3F12A 4AEHL 4NN6C 3BRGC 3LS4L 1E28B 2NXZC 3RWJB 1YEKL 3CZJA 3LKSB 1MPAL 1OTTC 5C9KA 3GK8H 3DMMB 1SY6H 2EIBA 4MJIA 4KZDL 3MRHA 4U6VH 3QDGE 2KZ1B 4JG1L 3RDTC 3FFCA 3MR9B 4LASH 4JQXC 4K7PL 1IGYA 2IJ0C 1T2QH 1HXYB 1HOCA 1X5IA 3VFUB 3HCVA 4Y2DC 1HEZA 1N0LA 2Q6WB 4EBQL 1ETZB 1MFAH 3FQNA 1BVKA 3OXSA 2A38A 3KXFE 4XVUC 4YHPA 4LAQH 2NPLX 4G8GA 1A9BA 3QEQA 2OJEB 3MV9E 4X6BB 4LSUH 4AG4H 1AY1L 4OCXL 5IMMB 4ZNCD 4NQSB 3M8OL 4YH6A 1OHQA 3B9EA 1CE1H 3QDMB 1T89A 1KTRL 3GGWA 3ELAT 1FVEA 1R5IA 5KVEH 3OGOE 3S36L 1I3UA 1N64H 2P43B 4FNLH 4ZO8A 3EOBA 5IB4A 1YEIL 4MHHI 1FNFA 1FZOB 2GTWB 4M61A 3UDWA 4CW1B 1H3UA 1KPRB 4TYUA 5ADPL 4FQPA 4G5ZH 3M1BB 5JXED 1LD9B 3LQZB 2FDBP 4E9LA 2EZ0D 4H0GA 1EBPA 4X7TB 2ZSWB 4G80B 4NQCB 5C0FB 3FOMB 1LE5A 2MCPL 2PW1B 1KCSL 3UAJC 1MWAL 2HKFH 3UROR 5IW6B 4KH2A 1GL4B 3A67L 5MEPB 3IKKA 3TZVA 4KK5C 3V6FA 2HWZH 1DE4B 1Z9OA 2AJ3B 1RUQH 2H1PH 4QWWD 4N0YL 3MV01 5DEGB 3FCTA 4RWYL 4KJWD 3WV0A 2D0GA 1DQJB 4XXDA 1A02N 3OKDB 1UZ8B 3KJ4B 2H8PA 3NIGF 3X14B 1OGAD 2CMRH 5DVMA 2EDXA 3VD3A 1ONQB 4OLEA 3SJVA 3UYPA 3C6LB 1T03L 2DS4A 2F58H 1ZLSH 3NOIA 1TTGA 2OCFD 4V1DE 5I9QC 4L8DA 2FLRT 4FQIH 3DVNA 4M8QB 3LMJH 3U4EB 1MI5E 4KKAC 2OMNA 1JWSB 2VQUA 4FQXA 3GJFB 2MPAH 5IGXH 1TZIB 4U1KA 4M6MH 3BDYH 4MJ6B 3V0WL 5BZDA 3WHXA 4F7EB 3QH3B 5HYFA 2EDDA 5CCKL 1SJEB 2M8XA 1UGNA 3CUPB 2ATPA 2K3TA 4QOKD 1IZKA 4PJBE 4JZNB 1MFBH 1VACA 1INQB 2QHLA 4F2MB 4Z6AT 3T3PF 2VLMD 4NNPL 3QDHA 1H5BC 4LHUD 4PJ5D 3REVB 1LGVA 3R06B 3BOVA 1QLEH 3UTZB 5GGVH 1JHLL 4JGUA 1E4XL 5DYOA 4MMXC 1BVLA 1T3FB 4O2FB 3AMKA 4JDTH 4U6HA 1NUNB 2DD8H 4J2XA 3FKUS 3PIQA 4Z7NF 3BKCL 1J9CT 1RUMH 2FX7H 5I1IL 3GMPA 4UDUB 4U0QB 3LIZL 1ZA6A 3IDXL 3WJLC 1J05A 3H7BB 1GAFH 4PJGA 1MJ7H 5LWYL 3QG7L 1CLYL 4JREC 3VMOA 4HULB 4LVHB 2A9NH 5HY9B 43C9A 1YJDL 4X5LA 3VG9C 5A2IH 4KJQC 3VFGL 3FO1B 4F7TB 3VWKB 3F12B 3ARQA 1NLBL 2CK2A 4GW5B 3OBAA 2ZNWA 1U6AH 4O9HH 5E5UB 1EMTH 4PGJA 2NY0D 4Y19D 1IL1B 4MJIB 1JYWA 3MRHB 1OAQH 3KDMA 3P4OA 4OIAA 4KROC 1NPUA 4N9GA 3FFCB 3OKKB 3QUXD 4ZOBA 4U7KA 1ZEAH 1IGYB 2AEIT 2EO9A 5DC0A 1HOCB 1JNLH 2OR9H 3B2VL 1MOEA 2R15A 2AEPL 3HCVB 2O5YH 1HEZB 3UCRA 3SBWA 2R9HD 2EDBA 3DX6A 1DBAL 4LHUG 4CU7A 4RMRA 3FQNB 2D9QB 2NY3B 1BVKB 3SCMB 1GGBL 3OXSB 3WO4B 4GRMB 2XZQH 2VQTA 3L3KA 4UNUA 2DQDL 4OAWA 3VD7A 4G8GB 5MI0C 1A9BB 1N7MH 3QEQB 1OAZL 4QO1A 5GSVA 4QNPF 3EFDL 4M93C 4XNXL 2KZWA 1NBVH 4X7EC 2OL3H 5F7NC 5I8OH 3FO2A 3RWEA 3VRLF 3ZKSD 3GGWB 3HNTL 1FVEB 5AEAA 1R5IB 3U6RA 1A7QH 4MD5B 2ITDA 3EOBB 3QQNA 4UQ2A 4DAGL 5ABDE 1IGIH 4JKPH 5D72L 4M61B 4Z76A 3JZ7A 1B4JL 5H35A 4NZJA 5D1ZD 4L8SA 5DJZA 5HPOA 1UB6A 1BQLH 1BWWA 1AE6H 2JELH 1YPZF 1JPFA 5TE6H 4AMKL 5F1NA 4DVRH 3SDAC 3DETD 4L4VD 1F90H 4X6DF 3SQBA 2Z4QB 5MENE 3ARRA 3IGAA 5CIPA 1LE5B 1EZVX 1RHHA 2X4SA 1TTUA 2DOCA 5HDLA 5IB3A 2UZIL 3TZVB 3V6FB 2W60A 3MRIA 3SGJC 1ES0A 2JTDA 2ZPKH 2RCSL 3FCTB 2BFVH 4ODUA 4EI6A 3EUUA 4JKMA 4HUMB 3FQXA 4XXDB 1XF1A 5J9PA 3VXSA 3DYMA 5DJ2A 2H8PB 2OTWB 5M94B 3WDIA 1JN6A 3AMLA 4UTBH 4MSWA 3HG1A 4HLJA 3SJVB 4OZHB 5IW1A 4MNQE 4OKDA 4XRCB 2NLJA 5C0RL 1RFDH 4Y8DC 1X5GA 4U0RB 5I15L 4L8DB 2VSDA 4U6YA 3DVNB 2R1XA 5CP7A 4NJ9H 1YEFL 4R2GB 4FQXB 4V2CB 2VZ3A 2DQUH 4WUKL 5SWSD 4U1KB 5BZDB 3VG0L 7FABL 3WHXB 4PS4L 2VDPH 1CIDA 4LLWA 4PJDE 4JHAL 5ESVA 2ATPB 5JHDD 5FYJH 8FABA 1VACB 3FJTA 1EK3A 4PREA 3GMLA 3N9GH 4DN4H 5B4MD 4MA8L 4W70A 1KELH 3ZDXF 1QFUH 2E7HA 4LLYA 1I8LC 1BVZA 1T7XA 3VW3H 2A0LC 4NDMA 2EDWA 2P1YA 2CDEA 1WSST 2O5ZL 5DYOB 3ZT7A 4EI5D 1BVLB 4EKXA 5JW3L 2GJJA 3U46A 3ARGD 4U6HB 3L3OA 3O45A 5T3XE 1TQBB 3PIQB 4U3CA 4FXKA 3FQWB 4PGEA 2WBWB 4UMGA 4GKZA 4ZAKD 3BVNB 2DWEA 3HE7A 1ZA6B 5KN5A 3GHBL 1J05B 4PJGB 1YPZA 4D0CA 3CIQA 3GBLA 1DQLL 4HZAA 3S3JA 3MRCA 4X6DA 3VFTA 43C9B 5GS0D 1F6FB 4WCYL 5L6YH 1CICD 5IQ7H 5BV7L 3EDFA 2YA2A 1WWCA 1SYVA 4LQFH 3BWAB 4DGYL 3E6HB 5KW9L 2B1AH 1RIUL 4Q6IC 5BVPL 3VA6A 3PF2A 2HP4A 2NXYC 1II4E 3RAJH 3KDMB 3P4OB 4XPGH 4NQTA 2E9BA 4N9GB 2AI0L 2W65A 3WLWD 5C0IA 1OSPH 5FYKU 3PQYA 1WBXA 3MOAH 3SGEH 5TDPA 4KAQH 1Z9LA 4OTXH 2X4NA 3PWUA 1A1OA 2YN5A 4EUPA 5BVJB 3W0WA 4I2XA 2XPGA 3DX6B 5E9DA 4O02H 4Z7UE 4OF7A 2VLJD 1N6UA 4YHZL 1NGPH 2P5EA 3MBEC 3MV7B 3QAZB 1L9NA 2XQYG 3L3KB 4OAWB 3MJ8A 5D7LA 4U1JA 1DANT 1ZHLA 5GSVB 4Y1AE 2R69H 5KJRL 3O6KL 4FP8H 4EDWH 2GY5A 3CJJA 3ARDA 3EDDA 1CDBA 3FO2B 1WCBA 3RWEB 1M7IA 1QKZH 3WO3B 2X10A 4ENED 3CAFA 5K9QI 2VNCA 4RA3A 2P5WA 1VEOA 2ITDB 3PJSA 5AG9A 4I0PA 1V8HA 3U4AA 3ULUE 1CGUA 4Z76B 5AZ2H 1KNOA 4K3EH 5H35B 1CDJA 4L8SB 3MCLH 1FIGL 5FM4A 5DJZB 3TV3L 1UB6B 1G7IA 2IQ9H 1JPFB 1GH7A 5F1NB 1XF3A 3LHPH 3MLXH 3NN8A 3I50H 3QUKA 1F11B 3NFSL 4I18A 2MFNA 3ARBA 1GGYA 1RHHB 2X4SB 3K8LA 3CX2A 4PRIE 4I3SL 5IB3B 5HGDB 3MLPA 2W60B 3MRIB 1JZ6A 1KUMA 1IQDA 5IT2H 1ES0B 2EDRA 3PXJA 3BEWA 1HYSD 2ERJC 4LEOA 2D0HA 2GSIA 4EI6B 4LLQA 2ZCLL 3FQXB 1NDGA 4OV5A 2BSRA 5D1XD 4PJCF 3VFPA 1MCPH 1ACYL 2AJYL 3VXSB 1FVCA 5DJ2B 4FMFA 4JDZA 1B6DA 3UZEA 3BGAA 2AERT 5IUSA 1JN6B 4TSBH 4KK6D 4MSWB 3N0PB 3IJHA 3H3KA 3HG1B 3KPRE 5IW1B 2PR4H 1ORQA 2NLJB 5HHME 1A6WH 3K1DA 4WI6A 5FM5O 1GC1H 4DWHA 3MYJA 4LARL 4UIKH 1KN4L 4U6YB 5J4MA 2R1XB 5CP7B 1NCUA 4HLZG 1MRCL 3K8MA 4LSPL 2AEQL 2X05A 5ITFA 3BDBA 4WO4C 4LLWB 5K9JL 1Z2KA 3QISA 1OAUH 3U9PL 5ESVB 3V4VH 2WBJD 2V5MA 3L3HA 8FABB 2FRGP 2EIZA 2BNQA 4XGZA 4PREB 4IOIA 3BYTA 2ED7A 3MLWH 3MV9D 3SDXE 3R8QA 4NDMB 4H8WC 4XPAH 3T2OA 3E3QC 3QZWG 5TGBA 4XCCL 5BRZE 2CDEB 1AXSA 4N5EC 3HKFA 2HJKA 2RFXA 3U46B 1OCWH 2XQBL 3L3OB 3O45B 4Z5RA 3F7PC 1HIML 3RU8H 4FXKB 4PGEB 1HNFA 3C6SA 4GKZB 4M6NH 5DR5H 3MRGB 4L3EE 5C6WH 2DWEB 3HE7B 5KN5B 5GGTL 4X9HA 1EO7A 1YPZB 3AM8A 4X0KA 2BCKA 3VMNA 4GRLA 3ZTNH 1OAYL 3THML 5J13C 3ZE0E 3CFJA 1KJ2H 3RUGE 2WUCL 3MRCB 4M7ZB 3VFTB 1VFBA 4K94H 4GG6F 3SKNA 1I1AC 5CJQL 1HHHA 1AFVH 1RURL 2AW2A 1J8HE 1WAAF 4KVCL 3K2UL 1HKLH 5GGVY 4KTEH 3RNKA 1SYVB 4C54A 3HHRB 2QBWA 1Z5LA 3VXMA 5A3IC 3GJEA 4PJCA 2VAJA 1FSKC 2DB8A 2NY2D 5DHVA 4L9DA 1EHLL 2WUBL 2W65B 4QLRA 1XH3A 5C0IB 3HZVA 4OSUL 3RDTA 3PQYB 1WBXB 5TF1H 5J6HB 1JIBA 3RJQB 4WHTA 5TDPB 4NC1E 2X4NB 3PWUB 1A1OB 1E4WH 4EUPB 4I2XB 5GSRA 2XPGB 3TESA 1LHZA 5E9DB 1KCUL 3TJHC 4D9LH 1T83C 4PRPA 2W9DH 4Y2DA 1V7NL 1NC2A 3S96A 3ZE1E 2P5EB 2PUQT 1I8KB 5T1LA 4QHKI 5D7LB 4U1JB 4E0RA 5CZVL 4B41A 1HH6A 2IMNA 4IRSA 4TVPH 2EDJA 4FZEH 5B3JE 4XVSL 1Y6KR 3T4YA 2Q8AL 3ARDB 3FB8B 1ITCA 1WCBB 1XIWB 5GGQH 1M7IB 3HMXH 3MBXH 2WZPD 4LSSH 4WEBH 2P44B 4H20L 2QSTA 2P5WB 3WFEL 4ZFZA 2R2HA 4ZFOA 3PJSB 4I0PB 2A77H 1OP3K 1HWGB 2LE9A 1KNOB 4S1SL 1CFVL 3RKDC 4S0SD 1F58H 1G7IB 1A7RL 1NCBL 3MJ9A 4GAFB 3CC5A 1XF3B 5GISH 3NN8B 4FFYL 1DBMH 3QUKB 3V95A 1ZHNA 3LKPA 3LN4A 4I18B 5HSFA 2YRZA 4S1RL 4LPUA 5CEYA 3IDUA 2JB6A 3PHOA 4U1HB 1FRGL 3IXAA 4GG6A 4WWID 2FX9L 1WAAA 1EEUA 4LEOB 5F7DA 1BGXL 4JY5H 4K3JH 4XAWH 4LLQB 1CFBA 3NA9H 4WW2A 4OV5B 5DQDH 2BSRB 2FR4A 3DJ9A 3VFPB 1A7NL 1R3IH 1FVCB 2C4FT 4M6AA 4JDZB 1K9TA 1PVHA 4N9OB 4L5FH 4P4RA 4RISL 3LV3A 5D6CA 5TDOA 3QUMH 1UKTA 1IT9H 3X3GL 1NCCL 3ZL4L 4WFGE 3MYJB 5FOBA 3TO2A 1GHFL 2IBGA 3C87A 4PD4K 4OI8A 3VFWA 1CDGA 1NLDH 3GBML 4B7IA 2E7BA 5ITFB 3ILQC 3MGTA 3LPFA 4ZS7L 3DVIA 2NY4B 1RJZA 3L3HB 3MODH 2VXVL 4NFDA 2BNQB 1UM5L 2VXSH 4XGZB 4IOIB 1NC4B 4RDQG 4AEHH 3SKOA 1D5MB 1YEKH 5TGBB 1MPAH 4RBPH 3ZKXC 1AXSB 2HJKB 2RFXB 5CP3H 1H5BA 4KZDH 2J12B 4Z5RB 4I77L 1D9KA 4JG1H 5C2BH 3HNSL 5D2NE 4K7PH 3C6SB 3G5ZA 5FA3A 4JO3L 3VXPA 1QRNE 1KJ2B 1IM9B 1QFWI 2LU3A 1UZ6F 1UM6H 4WIQA 4YXLL 3GRWL 3GM8A 3LB6C 4UBDD 3MLUL 4M1CD 2BCKB 2YD3A 4GRLB 4X0KB 3QYCA 4WU7A 3CFJB 1VESA 3WJLA 1HSAA 1RZKC 3EYSL 2XQYK 12E8L 3WIHH 4MXVF 1VFBB 1O7VA 3SKNB 1C08A 1HHHB 3U82B 1B2WL 4UB0H 4W81A 1IAOA 1JF6A 5EORL 3NMEA 1CDUA 1RU9L 3RNKB 5DGQA 3RPKA 3ESVF 4HHAA 1AY1H 4LSQH 4OCXH 3ARED 3VXMB 4NN6B 1XGPA 1PAMA 5HGBA 5KG9A 2NXZB 3GJEB 5JOPD 4XHQA 4IMKC 1QLFA 4LEXL 5DHVB 3SDYL 2VZ1A 1P4BH 3S36H 1XH3B 3HZVB 4OF5A 4G8IA 5DS8A 5JORA 2DQIL 35C8L 5ADPH 5DD1L 1T22A 4P5KA 5GSRB 5CUSL 4MXQC 1U8QA 4QRSA 4GKNA 2V17L 3T0AA 4PRPB 4GG8A 3H0TA 1GGUA 3NH7L 1NC2B 3S96B 5E5RB 3QI9A 2XT1B 5T1LB 4KHXL 5EN2A 3WIIL 4E0RB 1UADC 1HH6B 1KCSH 4IRSB 1MWAH 2DQCL 4WI4A 3UTTA 5DSCA 3LDBC 3A67H 1RHFA 3T4YB 2EYSA 1D5ZA 2AK4D 5FHBL 4ODVL 3T0EC 4TSCL 2GI7A 1FFQA 3T4AA 4HS6A 1ZLUK 1MHPL 1AC6A 3X11A 5F9OL 4DEPC 4JFED 4XP5H 2DYPA 5GRZA 5HYJE 4ZFZB 2R2HB 5EU7E 4HWBA 2UZXB 5HTSA 1TZGL 3OAZK 1LO0H 4YGVB 3TA3D 1T03H 4KUCF 1SJXA 4Z8FH 3IAPA 1WJ3A 1U41A 3FN3A 3CC5B 4MNGA 2CO6B 2ZP0T 4LCWE 1ZHNB 3LKPB 2H26A 3LN4B 1JGUL 3SDAA 1FG2A 5CEYB 1T1XA 2JB6B 3PHOB 2CR3A 4MNHB 4ZOAA 3IXAB 5F97E 5CCKH 3RVVD 5BW7C 1FFRA 3RWIB 3CVIL 5F7DB 2O93L 1AGCA 4YEEA 5JR1L 3SGJA 4WW2B 1AO7E 3KLHD 1XGYH 5DHYA 5D8JH 2QHRL 4AYFA 2G60H 3CH1A 1F00I 1ZHKA 5GS1C 1Z9MA 4P2OA 4P4RB 1JHLH 3LV3B 1FPTL 5D6CB 5TDOB 3B4NA 3I6GA 4XPHL 1CTNA 3S37X 1BLNA 1IAKA 4G9FE 3BKCH 5FOBB 3TO2B 1PY9A 1NFDE 5C0ND 4ZNEA 4OZIE 4LPWA 5K59E 5I1IH 1KCKA 2X9XA 3VFWB 3LIZH 3OKNB 5F1KC 3IDXH 5CD5D 1HKFA 3QQ4A 4P4KC 1FN4A 2WNGA 2CLRA 1Q94A 3QG7H 1CLYH 3CFCL 4XNZC 5IFHL 1TNMA 3MGTB 1K3ZA 2R0WL 3ES6A 4M1DL 1OW0C 4ZD3L 1RJZB 4DW2L 2HTLC 3OV6A 2HTKD 4O51A 1DZBA 3BZDA 3VFGH 1MFDL 1DQDL 2DQGH 1NLBH 1EAPA 5C0BA 4Y1AD 3DSFL 5INDB 4OCWH 1DFBL 1FNHA 4NZRL 1LO4L 4JFFE 1I8LA 1YECL 3D6GA 4ODWA 2R23A 4KDTC 4W68A 3VMPA 2OZ4L 1D9KB 1T2XA 4PG9A 4P2RE 1K8IA 5JQ6L 3NTCL 1GPOL 3CU1A 5FA3B 1NGYA 4OI9A 3VGGA 2GW5A 3VXPB 4PJ8D 3B2VH 1QR1B 4QF1A 3VGDA 1C16A 1QEWA 3ULUD 1WIUA 2AEPH 4OT1L 2NZIA 2QQQA 4WU7B 1HSAB 4Z7OE 4HPYH 4O4YH 1GGBH 2PYEE 3NIFE 2P8MA 5CEZE 1C08B 1J8KA 1Q72L 3O0RL 1CBVH 1S7VB 1IAOB 4M43L 2DQDH 1OAZH 3VXQA 1CQYA 4KGLA 3VG9B 3ULUL 4HHAB 5C07E 4I0KA 4KQ4L 4XNXH 4Z7VE 4ZTPL 1JPTL 2I5YL 1XGPB 3O81A 4IRJC 5HGBB 5KG9B 5C0CA 3EKCA 2XY2A 1QLFB 4WUUD 4MQSB 5L2KE 1KB9K 3RGVA 3HNTH 4Q6IA 1EERB 3P9MB 1F4XL 5D7JD 5B22A 4P2QE 3SDDD 1BBJA 3L6FA 4QKXB 4G8IB 4DAGH 5DS8B 5JORB 4OFYA 1HE7A 5D72H 1OP3H 4FQ2L 4TTGA 3CCHA 3CXDL 1T22B 4P5KB 3IAGC 2OR8A 1MCOH 2BNRD 1U8QB 4QRSB 4GKNB 3C8DA 3O2DL 1LO2L 3QG6A 5JXAH 3E1F1 4GG8B 3H0TB 4ORZC 1KGCE 4AMKH 3V7AG 3QI9B 4JO4L 4NKOA 3DV4A 5EN2B 3LQAL 5DVOA 4NO3A 1ULVA 3MACL 3MBEA 4GRWE 3UTTB 5DSCB 1A4JA 4PLOB 2EYSB 1D5ZB 2UZIH 4M1GL 4MX7A 5CGYD 4RSVA 3U0TA 1GGIH 1JP5A 5H2BA 2B4CL 2HLFD 3T4AB 2RCSH 5HI5C 5DK0A 3RTQD 3X11B 3GI9H 4TQEL 2J8UE 4PFEA 3QRFM 1NANH 2H2PC 2BDNL 1B9ZA 5HD8D 1KEML 3N1QC 2DM4A 2VTFA 4JJ5A 3ZDZE 2V9RA 4MB4A 3WUZA 5C0RH 1BX2A 1KCRL 1OGAB 3PNWA 2DBLL 3KPMA 4OM0L 5I15H 4MNGB 5JW5A 4NM8H 5EBGA 1ITBB 5HDBF 1YEFH 1OL0A 2H26B 1ZGLP 4L3ED 1U8MA 1KJMA 3SDAB 4WUKH 4KRPC 1FG2B 1T1XB 3VG0H 4PRHE 7FABH 4PS4H 4XMLH 3DLQR 3ARFC 4JHAH 2YA0A 3TBTA 5CBEA 1T5XA 1A2YA 4BUHA 1TPXC 4GO6B 2GY7B 3PWPD 5DHYB 3BKJH 4MA8H 1J8HD 4G6JH 4JM4L 3V5HB 5EIVA 5FGCE 2YK1H 2XWJB 2KDGA 3CH1B 3U30C 1ZHKB 3BH9B 4P2OB 2O5ZH 4Y88A 3MV8D 3I6GB 5JW3H 2UWEE 3MRBB 4PJ5B 1BLNB 1IAKB 1JL8A 4G6AD 5EA0L 3WHE0 5GRJL 5T33L 2CLRB 1Q94B 2P48B 4TUJA 4XWOD 4ZAKA 3ES6B 2YRLA 5L0QB 5GJSH 3DX8A 2VSCA 3QUYC 4O51B 4PJFE 3DOSA 3QFJD 4WCYH 5BV7H 3S4SA 2ATKB 3KS0J 3VDAA 3MRPA 1DEDA 4UV7L 3UBXI 5C0BB 3U36A 4U1IA 2IPUG 1D3CA 2XN9D 3PL6C 4QRPE 5KW9H 1RIUH 4QYOA 4ODWB 2R23B 2FEDC 3GMQA 4ZYKB 2PO6D 4C4KO 1JPGA 4PG9B 1K8IB 2BSSA 1PD6A 4LCIL 1X6NA 3VJ6A 4GT7A 3GDBA 4Y19B 1FZJA 3RHWF 2W0FA 3HRPA 5CSGA 4H26A 1C16B 4CNIA 5ID0A 1QEWB 4FG6D 2OJZL 4PP1C 3O8XD 3FO0L 5HPMB 3WYRA 1U93B 3TN0A 2ZG3A 2F54A 2IALA 3UJIL 4YHZH 2P8MB 1LO3L 1W72A 1I3VA 4J3WA 4DFHA 5FHAL 3VXQB 2D7PA 5FV1L 2DJUA 3QNYA 5HHOE 2VLJA 5KJRH 1JF1A 3O6KH 1AGFA 4RFEB 5E2VL 3EGSA 3G5YA 3L9RA 2D7TL 2K1MA 2ADJB 5DA4A 5C0CB 1ZE3C 1ZLUH 3HS0B 3RGVB 1JGEA 3K8KA 4Q6IB 2F9BT 5CILL 4IRZL 2NXYB 3D39E 2LTQB 5GGRA 1BBJB 1GRWA 2Y25A 3L6FB 4ODSL 2Z91B 4J6RL 1NMCB 3JWDL 4HCRL 4MAYA 2DQHL 2P24A 3EZJB 3ECBA 3OAZH 1G7HA 3EJJX 4Q7DA 2I07A 1QD0A 4HLZH 5IWLC 5D93C 3QG6B 1YY8B 4O5LL 1FYTD 2ZOKA 4P5TD 3ZKMD 5ID1B 3BZFA 4X9FA 4JM2A 4NKOB 3QDME 5D1ZB 3DV4B 3WEXA 4NO3B 5E4EC 3NFSH 5DRWB 3MBEB 1G7JA 3MCG1 3CFKA 1A4JB 1CD8A 4I3SH 4Z78A 4MX7B 3U0TB 3HZMA 5H2BB 3MLSH 3GHEL 2VO5A 3V9FA 1UVQB 2F8VA 5DK0B 4R90L 2ZCLH 5JHLL 2EC8A 4XC1L 1OQOA 5BS0A 2IH1A 1ACYH 5SWZD 3T1FA 2E7MA 4P9MH 1VEMA 1DEEA 1UEYA 2BVOA 1JV5A 4J1UA 1HDMB 3KPOB 2R8SL 4LIQE 1BX2B 2Y7QA 5E6IA 3KPMB 4CRPA 2NMSA 5JW5B 3TH2T 4LARH 1JZ2A 1KN4H 4X6CE 1A8JH 3W9EA 1MRCH 1A4KA 4JPVL 1QRND 1QFHA 1U8MB 1KJMB 2R2EA 2AEQH 1F2XK 5K9JH 4MZ2A 2EO1A 3TBTB 3BP6A 4LLVA 1T5XB 1A2YB 3V4PL 3ZSSA 3K80A 2DMBA 4A6YL 5I71C 1BJ8A 1FO0L 4PY7A 4WI7A 3HUJF 2NY6C 4IIQB 4XCCH 3GMMB 3RVUD 4D0DA 5FK9A 2PXYC 3U0PA 2Y5TA 4ELME 3RWGA 4PUBH 2XQBH 4P0DA 1HIMH 1BJ1J 3IETA 1E0OB 1S3KH 4HK0A 4QHUA 3ARGB 5F7YC 4KGJA 5GGTH 3IJSA 3ULVD 4ZAKB 1OAYH 3QQ9C 3THMH 3O6ML 1JGDA 5DD5L 2WUCH 5CJ8A 5E95B 3O4LE 3M07A 4LMQI 3DNKA 1A7PL 3DX8B 6CGTA 3O41A 3CPLA 4X4MA 5CJQH 1RURH 3LY6A 3P9LA 3S4SB 1UACH 5E4IA 1EPFA 3AXLA 3MRPB 3K2UH 4KVCH 5DMGD 3KPSE 1NFKA 3U36B 4U1IB 2NY1C 2OS7A 1EJOH 3O6FC 4QYOB 3MNZA 3GMQB 2UY6A 4U1NA 1D7FA 1JPGB 2IAMC 2BSSB 1EHLH 3D85A 1YEGH 2WUBH 4QRRA 1JK8A 1JZ4A 5I1DA 2YUWA 1FZJB 4OSUH 5D70L 5JPMA 2W0FB 1H3WM 5ID0B 4H26B 1FAKT 4TUKH 5JW4Q 1YJDC 1SM3L 4ZQKB 2GJ6D 1JHKL 1SBSL 3VGHA 5C3TA 1KCUH 2XTJC 3TN0B 4JLRA 4MA1C 4HT1H 2F54B 4GMTH 2IALB 1OQXA 1V7NH 5J13B 1W72B 3ZKNC 3VCLB 1RMFL 2KPNA 4GSDL 3MGOA 3QCVL 5CZVH 3QNYB 2VLJB 3NVQA 4X83A 1AGFB 4ZODA 4XVSH 4YFDB 3FFCE 5DI8A 3EGSB 4JRXD 4OCRL 2APTA 2Q8AH 3TWCL 5A2FA 1DSFH 1CS6A 2UYLA 3O11A 5AYQA 4YC2C 3RVTD 3TFKD 2FHFA 4UT9L 1JGEB 4HG4K 1AO7D 4IMKA 4H20H 3LD8B 3N06B 1QNZL 5GGRB 3MGAA 4MAYB 2P24B 2XKNA 4WWKA 2VLRA 3ECBB 1G7HB 4S1SH 1CFVH 4G8GE 3FO9A 1KIPA 4K7FA 5EU4B 3RIAF 4L29B 1A7RH 1NCBH 3MLZL 1G9EA 2HFFA 2ZOKB 1FIEA 1FL5A 4NWTH 4G9FD 2R9HC 3BZFB 3V52H 1S7QA 4JM2B 3HE6D 4RMUA 2CDFA 3EZ8A 4FFYH 4TSAL 3WEXB 3IDJA 4K71C 1MJJA 2AXHA 1JJUA 1G7JB 4QCIB 5T5FL 3WKNA 4P3DA 3CFKB 1FNAA 4YQXL 4JZJA 2Z8VC 1NL0L 3RZCC 1FRGH 1NGQL 4MJ5B 3RNQA 5B38G 2FX9H 5T5NF 2Z0BA 3HZMB 4NQEA 4U3XA 4JZOA 2F19L 2CSPA 1UEMA 3T0EA 3L3DA 5BS0B 1CR9L 2A73A 2IH1B 4Q9RH 3QUZC 1A7NH 3T1FB 3AB0C 4RGNC 2BVOB 5J11C 1NMBH 3MLVL 1YMMD 1M7DA 2EKJA 2YUZA 5C0AA 3V0VA 5D1XB 3MQIA 4J1UB 4IM8A 5DRZA 2FD6L 3IDNA 1ZWIA 4AL8L 2Y7QB 5E6IB 2D4FA 4Z7QE 2J5LC 3X3GH 1NCCH 4LCUA 4CJ0A 5B3NA 1CVRA 1YDPA 4KK8D 3W9EB 1A4KB 4KJYA 1QFWL 3GBMH 2R2EB 4JPKH 4X6EA 5KVGL 3DECA 3BP6B 4LLVB 1HK6A 1KEGL 5EH1A 4ZG1A 2VXVH 2PYED 5F7FA 1UM5H 4U1SA 3SJVE 4OZHE 4NO0D 2IPUK 4NOBA 3RY4A 4GBXD 4PY7B 2WBJB 3RIFK 3JBG7 1A3RL 5C07D 4N8VG 3X17A 4D0DB 5FK9B 1FL6A 4NQDE 3U0PB 3B6SA 5JO5A 2Y5TB 3T04D 3RWGB 2VDMH 5F7MC 5CEZL 2X2YA 2OBGA 3KPNA 4I77H 3MYZA 1NMAL 3I02A 1VEPA 1EUTA 3HNSH 1G0DA 4IS6A 4HK0B 4ESKA 4P2QD 4Y7MA 1FZMA 2CO7B 3KPLA 5HHNA 5I66A 2MWCA 3IU4H 3IJSB 4YXLH 4XVJL 3MROA 2YWZA 3MLUH 5GGUA 1HHGB 1EGJL 2HAZA 3EYSH 2FLBT 4P4KA 4NUJA 3O41B 3CPLB 3G6JE 4P23C 4XX1G 1RZFL 1B2WH 3IRZA 5D1QD 5F6HI 3P9LB 1OW0A 4KK9C 3CDCA 5EORH 3AXLB 2WAHA 2ZOLA 4MVBD 1RU9H 3MJ6A 2H2SC 1S9YA 4YFLF 1M6OB 5JUEL 4LDEB 3T65A 1OGTB 2VL5B 3MNZB 4U1NB 3NIDF 4LEXH 4F37F 1BFVH 4HKXA 1CXFA 3WD5L 3V5DA 3D85B 4QRRB 1JK8B 4KDTA 5I1DB 3VGFA 1HQRA 4OCNC 4KWUA 5JPMB 1NAMA 3V6BR 3P0GB 1UCBL 1TETL 2DQIH 35C8H 3LN9A 5EOCH 5CUSH 2JJTC 5TE7L 1KCLA 2I26N 2V17H 3X12B 5C09A 4GW4A 3BPLC 2XOTA 4F80A 1TENA 2A6JA 4ZS6D 4KHXH 4YZFE 3WIIH 3S5LA 3MGOB 3D9AL 2DQCH 1CICC 1WEJL 1U8IA 2EDHA 3GSRA 5DWUL 1CFTA 2E6QA 5DI8B 5LBSL 5FHBH 3HZYA 5I74C 2UYLB 3O11B 1P2CA 4TSCH 4CMMA 2F53D 3FRPG 1P6AB 5HDQL 1MHPH 1H3GA 1MY5A 5F9OH 1XMWA 4RGMC 4XZUB 1G84A 5GS2D 2V7NB 1Q1JH 1X5FA 2C3VA 2XKNB 4H1LA 4WWKB 3MV7E 3CSYA 2GSGA 2CXGA 1TZGH 3C60D 1T5WA 2ID5A 3FO9B 1DN2A 1KIPB 2AKRA 3ME0A 4K7FB 4OCSL 5E8OA 1IAII 4LLMA 1F4YH 2HFFB 4Y4HC 4N8PA 1S7QB 2E9JA 3TA3A 2K9UA 3IDJB 1ZT1A 1MJJB 1G9ML 2DAVA 3S7GA 4P3DB 5IMKA 3BRDA 1VGKA 5DVNA 2W9LA 4JZJB 2N1KA 2VQ1B 4NCC1 1SVCP 2B5IB 3RNQB 1WT5C 4NQEB 2CUIA 5DD6A 4JZOB 2QTEA 2NTSP 4HUKB 5JR1H 4CADA 3F7YA 3L3DB 5CKGA 1QSFA 4Q2ZA 4PJXE 4EZMA 2Q86A 1IQWL 1AR2A 4DEPB 2FO1A 1M7DB 4TRPL 3RRQA 5C0AB 2N4IA 3BP4A 3V0VB 4OKVB 1T6VN 1YUHA 4M9OA 4AIZA 5DRZB 1NUDA 5A2JH 3IDNB 3RVWC 1ZWIB 5LKNA 4HS8H 3EO1A 3K4ZA 3TF7C 3NAAL 1S9VA 3JV4A 4XC3L 5LGJA 4Q0XL 1YDPB 4J4PD 4R97B 3Q5OA 1WUNT 4KC3B 2OM5A 4KJYB 5DJDA 4AQOA 5I8CA 5L8JB 3UXFA 4X6EB 3L7FB 3CFCH 5IFHH 3ET9F 3WS6A 3I3DA 1DL7L 2R0WH 2AJUL 5H37G 5I73B 2YD2A 4DW2H 4EN3C 3ARFA 1TVBA 1P6FA 5H94A 1HYSC 1MFDH 1DQDH 2EEAA 1LO5A 4YPGB 3DSFH 3QXVA 5KSAA 5IBLC 4KKCD 1DFBH 3ZYZA 2IFFL 4NZRH 1LO4H 1FL6B 3B6SB 1YECH 1UCTA 5KSBB 2YOCA 1A7OL 4HJGB 4FQHA 3KPNB 2OZ4H 3ARPA 4PBWD 4L1HA 1NCNA 5JQ6H 1NAKL 3EJYD 1S7XA 3NTCH 1WC7A 3CMOL 4EIGB 1GPOH 5GHWL 3IFPA 1R5WB 5I66B 1FZMB 3KPLB 3DUSA 3QWRD 4KTDH 4XNMB 2J6EA 3VXUD 3MROB 4B0MM 4OT1H 2CUHA 2D31A 3DVFA 5I19L 4Y5YA 4KMTL 4P4KB 4PJ8A 4NUJB 1B0RA 3GKWL 3O0RH 3R4DA 2DBJA 4CJ1A 3QDMD 2NZ9D 3QUYA 1S9YB 3ULUH 4KQ4H 4ZTPH 3T65B 1JPTH 2I5YH 4PB9L 3FAXA 2ZWLT 3D3VD 3V2AR 5LVEA 4U3HA 1GOFA 3PL6A 3C5ZC 3MUJA 3QIWC 3V5DB 1F4XH 3O9WC 3TPKA 4KVNL 2BHUA 1HQRB 1NAMB 3LS5H 4FQ2H 2Y6SD 2YD7A 3D1MC 3CXDH 4YDKH 4NQCD 4OQTL 2OTPA 4NO2A 1Q0XL 2IG2L 3O2DH 1L7TH 5C09B 4GW4B 4M3JA 4J3VA 4RNRA 5ETUA 4JO4H 4DJMA 3SOBL 1MAML 1QUNA 3HR5A 3VWJD 1EV2E 3S5LB 3MACH 4UDTA 1U8IB 4HWNA 3GSRB 4EOWL 5C71A 1CFTB 3BRFA 5DMKA 1O5DT 4M1GH 2B0SL 2EXYD 4WFFE 2JCCF 3HZYB 4LIQL 1FFNA 1P2CB 4CMMB 2B4CH 2Y36H 1BBDL 4DUWA 3U7WL 1R3HA 4I2XE 5FECA 4JKWA 2VLLA 2C3VB 4JKLA 2AXFA 4H1LB 2BDNH 3CSYB 2GSGB 3CXHK 4WRLA 1MIML 1T5WB 1N0XL 1YY9D 2AKRB 1UH2A 3S6CA 2WV3A 4OF0A 5E8OB 1A6ZA 4LLMB 3TIEA 5DEFA 4OZGA 3KNBA 4OM0H 2K7PA 3TA3B 3UTQA 2UVEA 5CGTA 2IFGA 1REIA 4MA7L 3MA7A 5IMKB 1VGKB 1ZVYA 2ZUQC 1U3JA 1XGQA 1JNHB 4M7KL 3UPCA 3N1PC 3ZDYF 2Q1EA 2Q76A 5DD6B 1ND0A 1S7WA 1JI2A 1VA9A 1SHMA 3F7YB 3QXAA 3QXWA 3WUWA 1NGZA 1QSFB 4JM4H 4Q2ZB 5DK2A 1H8OA 4LLUA 2Q86B 4OBRA 4Y16C 3V8OA 4RIRA 5GS3A 4NNYA 3PWPA 2EC9T 1RIVL 2DWDA 4I13B 3E2HC 5EZLA 3H42L 3H8NA 1Q9KA 1S78C 2V9QA 5DT1L 3S34L 4AIZB 1RZJC 3T0DA 5HXMA 1KXQE 5EOTA 3W9DA 4RAVA 3EO1B 4OFVA 1S9VB 3D0VA 3JV4B 3MFFA 3G04A 5LGJB 4MQXC 4HXBL 5GQBA 1R24A 5CHNA 5EA0H 3UTSA 5GRJH 3U79A 5DJDB 4I1NB 5KS9F 5ISZA 5I8CB 5T33H 2V7HA 1J1XL 1K3IA 1IAMA 2F15A 2WW8A 4PGZA 3VWKD 2AJZA 5DD3L 5HHVL 4NGHL 2ICWA 5J6GA 3ARFB 3Q48A 1TVBB 5H94B 1AIFB 1F3JA 3F6IA 5KVDH 1LO5B 1NSNH 4MJID 3I2CH 2MKWA 4LSDA 5KSAB 5D96B 4HAFA 3Q3GA 3FFCD 3SGDI 1TJGL 1IARB 5AAWA 3TYGL 3I6KA 2JE8A 5C0JA 3PDOA 3CSGA 1K6QL 2X1WL 4FQHB 3QHZL 2PXYA 5LAXA 4LL9A 1S7XB 1WC7B 1URLA 2H6PA 2BRQA 4PPTA 4LCIH 3K7UA 3QXDA 3IAQA 1G9NL 3TIDA 1LDPL 1F2QA 3IFPB 1KULA 2HJLA 1OPGL 3NABL 2OI9B 3DUSB 1RAMA 2PO6A 2BNQE 1LWRA 3ARYA 4XMKL 2MQCA 2OJZH 4XXCC 2CRYA 2D31B 3FO0H 4G8GD 3QEQD 4Y5YB 5IHLB 4PJ8B 3FZUD 4UOW1 1B0RB 3UJIH 3S3PA 1LO3H 1DLHA 1KPUA 3HZKA 4HBCH 4HD9A 3QUYB 4YUEL 1CZ8L 3RL1A 2APVA 1QG3A 2W1NA 4QTHA 5E2VH 2APBA 3TPUA 2CJUH 3QDJA 2X44D 4PJAB 4YE4H 4MZ3A 2ARJA 4PV9A 3GSUA 2RGSA 3ZYOA 3EHBD 3CX5K 3PL6B 3GSXB 5KVEL 2GIYA 3O6FA 5CILH 4H88L 3RI5K 4IRZH 2QLVB 1CI5A 2HMID 2XZAL 1MFNA 1JVKA 4PJHE 3DYPA 3F65A 4QXGL 5CMAA 2NX5A 3QFDA 4TNWK 4FNLL 1LQSR 2RR3A 2IAMA 3Q6GL 4J6RH 4HCRH 1JYVA 1P9MC 2DQHH 3BD4A 1T1WB 4O58L 1NCWH 3SDDB 4NO2B 5JW4N 3STZB 4BQ8A 4O5LH 4Z0BL 4Y5XC 5D7IF 1U95A 4C58B 4M1CC 4HC1H 3TZVD 4RNRB 3KPPB 5ETUB 4MGXA 2HYMA 1IKNA 3HR5B 2VN7A 1F3DJ 5EIQA 1TCRA 2CUMA 4UDTB 2EDTA 2D03L 3HFMH 3K1KC 4GXUM 4RCAA 5DMKB 4ONGH 3WN5A 4JANA 1NKOA 4MMZC 4EDXB 4L4JA 1RUQL 4P57A 5HVWA 1FFNB 1EFQA 2HN7A 2FL5A 3AREC 4R90H 2VUOA 4LOUC 1R3HB 5JHLH 4ZOEA 4XC1H 5FECB 3SJVD 2X4TA 4I5BA 1DQML 2XA8L 4PRPE 5EU5A 3FQTA 3QCTL 1LNUB 2AXFB 2CMRL 3AROA 4TVPE 2X70B 2Q8BL 3D25A 1PJ9A 1PY4A 3BHBA 1J1PH 4M7JH 4ZDHA 3TO4C 4FQXD 2R8SH 1FC1A 3TNMB 1A6ZB 1BFOA 3EDEA 5DEFB 3ORJA 3KNBB 4OZGB 2VDKH 4GOSA 4X7DC 3UTQB 2W07A 3WDHA 5SX5K 3MA7B 1MHCA 1DDHA 5LXGH 1XGQB 5E4EB 3WIFB 2BSED 4M6OL 4FMKA 4HWZB 5BMFL 5IESL 1I7TB 3V4PH 4WI5A 3G6DL 4PJ7F 1S7WB 5FO9A 4PJ9A 1GJIA 4JFOB 4A6YH 3QXAB 5HI3D 4JFZL 3WUWB 1K8DA 1NGZB 4FFVC 4U2ZA 5D9SA 1FO0H 5DK2B 4LLUB 4AT6A 1XFPA 3KR3H 4RIRB 1NBYA 4UBDC 1WWBX 4NNYB 1QLEL 2XG5A 3PWPB 1FNGB 2DWDB 3LPGA 5GGVL 1XF5A 3QUZA 1W0VA 1Q9KB 3SEPA 2IANE 1Q9LA 2Y07H 3W9DB 1K2DA 3D2UA 2EE9A 3C09C 4RAVB 1IVLA 4PJEE 3D0VB 3IRPX 3MFFB 3G04B 4GUPA 2NR6C 2XKUA 1R24B 3UJJH 5CHNB 4JE4B 3UTSB 4AEIL 1MJ7L 4MS8C 5ISZB 3B3IA 2V7HB 4GFTB 3QO0A 5D7IA 1WWWX 3BN3B 3O6MH 4XI5D 2AJZB 3L5XL 5I17B 3W11D 3H9YA 3O2VL 2ICWB 2KBGA 4JB9L 2VR5A 1YZZA 1F3JB 4PP2A 4WTZA 4NCC2 5SX4H 3LVEA 2YKLH 4DUXA 3NA4A 3SE3A 4MJ4A 3ULVH 3QFJB 5EWIL 1P84K 4ZXBC 3WBDA 5IM7A 2YN3A 1SEQL 3I6KB 5C0JB 3PDOB 5HI4D 3WL9A 5LAXB 1NEZA 4XPBL 1QPXA 2VZSA 2H6PB 3QXDB 4JHZA 5B8CA 1BD2A 4C56D 2HJLB 1JNLL 4IOFC 5D70H 2PO6B 1CXEA 1FE8L 3GMOA 1SM3H 2R1YB 3PWJA 1F6LL 4YXHL 1JHKH 1SBSH 3DX7A 5J1TC 3QNZA 3EO0B 4N1HB 5CINL 5BQ7A 8CGTA 1DLHB 1KPUB 2XZQL 3HZKB 2GJ6A 3O8XB 1RMFH 5JZ7D 3VD9A 2HTKC 3RL1B 4P23A 5DF0A 4QTHB 5DUMH 4PJ7A 2XZZA 3TPUB 4Z9KB 3QDJB 4X6FA 2X9YA 5MERA 2W0KA 3RKPA 2NY1B 2ARJB 4PV9B 3GSUB 1Q9WA 1GYAA 4UT9H 3TBWA 1AQDA 3OHXA 5FYJU 5FO8A 5A40E 3K3QA 1S7SA 2NX5B 3QFDB 1QNZH 4YHYB 1MCQA 1Q38A 2DN7A 2JJUA 2ITCA 3DV6A 3ULUC 3MLZH 4DVRL 4C59B 2JJTA 2DIBA 3QEGL 4MA1B 5ANME 4TSAH 3NCBB 2BVTA 4FQCH 1TCRB 4NSKA 1FYTB 5T5FH 4YQXH 3WN5B 1NL0H 4JANB 1NGQH 3V8CA 3VXSD 4P57B 4R7DB 2HN7B 2FL5B 1RI8A 1UC6A 1AKJA 2EDFA 1LEGA 3HG1D 2Z31A 3B2UC 3OWEA 2X4TB 4I5BB 3DVGA 3JTSA 5HDOA 4L8CA 3FQTB 4LVOC 3ULSA 5DJAA 3BMWA 3BE1H 3D25B 4N8CH 2ICWJ 4YIQB 5SWZB 3BHBB 3LQAC 4ZDHB 2FD6H 5KANI 3JWOH 3DTXA 1K5NB 4NJ9L 2B4CC 1XF2A 2DQUL 4Y4HA 1QFWH 3CD4A 1MHCB 1DDHB 5A16A 1CGSL 2XI9A 5FA4A 4FZ8L 5EZJA 2AQ2A 5KVGH 5LGKA 2ARWA 1U58A 3GJFK 32C2A 5HHXL 1KEGH 4JQIH 1PKQE 5FO9B 2IH3A 4PJ9B 1YEJL 4EEEA 1WT5A 5EBLA 1K8DB 3GZKA 1KELL 5D9SB 2HLFC 1R3KA 3LH2L 1OGAE 1NBYB 4K8RD 1A3RH 1Q9OA 4U6XB 1W0VB 4RGNB 3QJHA 4GBXA 3HE7D 4HKBA 1Q9LB 1K2DB 3D2UB 3H3PL 3ZLQC 1WK0A 4MCYB 5HD8C 3OJDA 1NMAH 4GUPB 1I7UA 4P46A 1IC7H 3T1WA 2YD5A 1MFCL 4X8JA 5CWSB 4JY4A 4M7LH 3B3IB 4AJ0A 1OAKH 4J23A 2AV7A 3VH8A 4QOKE 5IR1A 5C08A 1WIOA 4CN4A 5D5MB 4YHML 4XVTL 5L6YL 2R0KH 4LRNH 2AK1L 4YK4B 4PP2B 5E1AA 2VLME 4X8XA 5DRNB 4EN3A 1BPVA 4PJ5E 5EDXA 1IGML 5JUEH 1A6VH 4NUGL 2XWTA 4F9LC 4ZNEE 5IM7B 3EYFA 3AS3A 1VHPA 3PQYD 4KZEL 4LVEA 3U83A 3WL9B 1KN2L 4QT5B 4P49A 1NEZB 4YO0B 5GPRA 4NNXA 2BOBA 1FGNL 3W0WD 2H45A 1OSPL 5E9DD 1OOAA 5B8CB 1BD2B 3SO5A 3G08A 5EUOB 4GRWH 4BH7A 1QYGL 4UT7L 3QP3A 1BQHB 2P5ED 1TETH 3GMOB 2ZG1A 1D6EB 3BT2L 3PWJB 5IEHA 3QDGA 1FH5H 4O02L 3DX7B 5D7LD 3TBVA 3QNZB 1IAIL 2EDKA 3DXAD 1NGPL 2W0PA 3HRZA 4NC1C 4XWOC 1A14L 1IGFL 1RSFA 2AJSL 2GJ6B 3PGCA 3ARDD 4WI8A 3D9AH 4P23B 1WEJH 1QBAA 4WEMB 5DWUH 5C6TL 1T0NA 4LDOB 5LBSH 4BQ9A 4X6FB 4Y19E 5MERB 2P5WD 1I3GL 2X1OA 3KXFA 4BK5A 5LGHL 4I0PD 1Q9WB 5HDQH 5FYLD 5BZWA 3TBWB 1AQDB 1H0DA 3OHXB 4PJBF 5FO8B 1S7SB