1BQMB

Hiv-1 rt/hby 097
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
430
structure length
430
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 82
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqmB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmB03
3H5UA 4EBCA 1RTHA 2VA2A 1FKOA 4IFVB 2HWHA 4TN2A 5KG2A 4YR2A 4ED3A 2E9TA 2WOMA 1EETA 3DYAA 4XO0A 4O3OA 3BSOA 4F4ZA 3SFGA 2V0NA 4DL5A 3MECB 3GV7B 1S49A 4ED7A 3EPIA 3E01B 3FFIA 3I0SA 4TY9A 1S1XB 2D3UA 1S6PB 1RDRA 4K4YA 4FBTA 3CO9A 3KK3A 3KK1A 2R2UA 4ZP8A 4ECSA 1U09A 1S9GA 4NLQA 5CYMB 4ZVGA 2B5JA 5KG6A 2ASLA 1TKTB 1YVFA 3DI6A 4RW6A 3DM2B 3DRSA 1QAJA 3HVTB 4WXWA 4ZPAA 1T94A 1TQLA 3DLEB 5KFLA 3LP1B 2RDJA 4Q0BB 2YNGA 4NLTA 4YMEA 5EWFA 3BGRA 4NLGA 1T03B 1TKZA 4QWAA 1FKOB 5CYQA 3G6YA 3T5KA 1FK9A 2WOMB 1EETB 3DYAB 5KFRA 4NCGA 5EDWA 4QW9A 4DL2A 4IRCA 5DQHA 5DQIA 2D7SA 4Q44A 4Y2CA 2AGPA 5F8GA 2JEGA 3CJ3A 3FFIB 4ICLA 3JYTA 5KFFA 1RT1A 3GIKA 1HARA 1JLQA 3M8QB 3Q8QB 4DG1A 5T14A 3KK3B 3KK1B 4J9RA 1S9GB 2B5JB 1TVRB 3I0RA 3KLHA 4U7CA 4Q8FA 4XPCA 4TYAA 2RDIA 3DI6B 4RW6B 2FJXA 1RTJA 1RT7A 4IFYB 3TVKA 5L9XA 2HNZA 3KHGA 2O5DA 3QZ7A 3GIMA 5DLFA 5EUHA 4YQWA 1JLFA 1LWEA 4B3OA 5HBMB 4H4MA 3BGRB 1T05A 3BSAA 1N5YA 4RZRA 1RTIA 1S1VB 4MK9A 4ECVA 5KFUA 5KFCA 2HNYA 5KT4A 3QO9A 5CYQB 4K4ZA 4WYLA 3HHKA 1FK9B 2OPRA 2CJQA 5J2QA 3OL6A 2XC9A 2YKMB 2W9CB 4RU9A 4R5PB 3GIJA 3CJ2A 4ICLB 3ISND 2BQUA 1GX6A 5KFOA 2WHOA 3GILA 4DG1B 4H54A 4O4GA 3OSNA 4IRDA 4MKAA 2D41A 4EBEA 4K4UA 1S9EB 1TV6B 5HP1B 3RBEA 1JLFB 1C1CA 1LWEB 4ZHRA 4B3OB 3QGGA 1T05B 1N5YB 3I5AA 1UWBA 1DTTB 4ZP6A 5F8IA 3MR2A 2HNYB 1S4FA 3QO9B 2AGQA 3MFHA 5KFHA 3DLKA 5KG7A 3DDKA 4NLSA 2OPRB 3M9OB 5J2QB 2IJFA 2FLPA 2FJWA 5F9NA 4PQUA 1BQMB 1HPZA 4Y2AA 2R2SA 5KFEA 1ZTTA 2B43A 2IM1A 2W9AA 3GQCA 2C2DA 2FLLA 2JEFA 2WK4A 3TAMA 1VRTA 4RW9A 3QIDA 4NRTA 3RAXA 1ZETA 5F8LA 4O4GB 2J6UA 1D1UA 1D0EA 4ED0A 3QIPB 2BE2A 5KFVA 3MR6A 1HNIB 5C25B 1S1WA 4WE1B 3G6XA 1RAJA 4IH6A 4ZHRB 4MFBA 5KG0A 1RYRA 4JV1A 1MU2B 1JLEA 1SH0A 2BQ3A 4OL8A 5KFNA 4R8UB 3NL0A 4ZMMA 5D3GA 1RT4A 3NAHA 5KG4A 3PJWA 2UVVA 3PW4A 3BREA 1QE1A 2FLNA 1TKXA 3MECA 1S1UA 4ECTA 3DRPA 5EWEA 1LWCA 3PJXA 1TL3B 3FSIA 5KFKA 5KFDA 3QZ8A 1TP7A 4HYKA 3C6UB 1IKWA 3KHRA 3OL8A 3MF5A 4MIBA 2J6SA 1S6PA 3TAMB 5KFXA 4RW9B 4XPEA 3KLIB 1RA6A 4MK7A 1JXLA 3KLVA 1NHUA 1TKTA 5KFPA 4O4RA 3SFUA 1C0TA 2ASDA 1S1WB 1C1BA 3NBPB 5JXSA 3SI8A 4ZVEA 4RNHA 4F4WA 5F8NA 3C6TA 1DLOB 1JLEB 4ECRA 1T03A 3JSMA 5KFAA 4WZMA 3MTKA 5D3GB 3OHBA 1RT4B 2RKIB 2VG7A 3H5XA 1RTDA 1SH2A 4J9PA 1QE1B 3OLAA 5EWGA 1TKXB 2ALZA 1IKXA 1S1UB 4IH5A 2RF2B 3DRPB 3RB3A 1LWCB 2ASJA 3LALA 1IKWB 3MEGB 1BQNA 4JV2A 4KFBB 3CDEA 3M8QA 4WXOA 1TVRA 4NLYA 2B6AA 1K1QA 1C0TB 1QAIA 4QWBA 4IFYA 2IA6A 1C1BB 4TQSA 3PR5B 4NLXA 2AGOA 2GIRA 2AX0A 4PUOA 1I6JA 3KLFA 3C6TB 3LANA 5HBMA 3JSMB 1S1VA 5DG7A 1IKYB 2GC8A 4EYHB 4DL3A 1FKPB 2VG7B 4MK8A 2XCAA 1RTDB 3LAKA 4M95A 3KMSA 4O3PA 3OL7A 3OHAA 3QLHA 1S0NA 1IKXB 1MMLA 2YKMA 4NYZA 5I42A 5KFQA 3G6VA 2W9CA 4URSA 4R5PA 1BQNB 4O44B 1HQUA 4WFYA 3M9NB 3H5YA 4ECXA 4MKBA 3PHEA 4K4TA 3CJ5A 2BANB 4WFXA 2WRMA 4TY8A 2B6AB 3V6DB 2F8EX 2QV6A 2EC0A 1DTQA 3QYYA 4ZPCA 2ILZA 3KK2B 4QWDA 1EP4A 4ED2A 2R8KA 1CSJA 3MR5A 5KG5A 3BR9A 3FDSA 1S9EA 4ED1A 1TV6A 3IRXB 5HP1A 4PUOB 3KLFB 3RB6A 1RA7A 2VG5B 3V81B 1N4LA 5DGBA 1DTTA 3CJ0A 1S9FA 4H4OB 2FVSA 1J5OA 3T5LA 3N6NA 2V4RA 3QLHB 5KT2A 5I42B 4URQU 1BQMA 5I3UB 2R8HA 2ATLA 3CJ4A 5KG1A 4J9KA 1LW0A 4X2BA 1HQUB 3ITHA 3FQKA 4KB7A 4KV8B 2C28A 4ECWA 2UVWA 2OH2A 3CDUA 4FS1A 1HMVB 4TY8B 3IG1A 3CDWA 3QIPA 5C5JA 1DTQB 1RT3A 1EP4B 1HNIA 2AWZA 5C25A 5KFBA 1WNEA 1LW2B 4WE1A 5DGAA 4K50A 3MEEB 1W25A 4GC7A 2WONB 1KLMB 4MIAA 3KLGA 4WZQA 5C42A 2AX1A 4IQXA 1MU2A 3RB4A 1RYSA 3OLBA 1JX4A 5HLFA 4R8UA 4KO0A 1J5OB 2ZE2A 2R2RA 3T1AA 1XR7A 5L1LA 3N6LA 1SUQB 4NLWA 4Q45A 3CWJA 1IKVA 2W7PA 3M8PB 3Q8SB 3PZPA 3T19A 1LW0B 1TL3A 4KKOA 5DG8A 3PW2A 2YNFA 4ZPDA 3C6UA 4IG0B 4RW7A 5J1EB 3ITHB 4KAIA 4ZP7A 3KJVA 3KHLA 4J9LA 2IBKA 2V4QA 3DOKB 4I7FB 3KLIA 2FVQA 4YR3A 4O3RA 1S97A 3HVAA 3VQSA 4ED8A 5JUMA 3IG1B 3RAQA 3CVKA 1RT3B 4EO6A 1T3NA 1HNVB 3NBPA 4K4VA 5L1KA 4ZVHA 2OPSA 4Q43A 2W9BA 4EEYA 3G86A 5KFSA 4IG3B 3KLGB 5C42B 3IGVA 4EBDA 1DLOA 3H5SA 1HYSA 5HLFB 3GV5B 4KO0B 1S6QB 3LP2B 3BQ0A 2ZE2B 2RKIA 2CKWA 3H2LA 2C2EA 2J6TA 3UPFA 4LSNB 1JLAA 1S10A 4QWCA 3V6HA 4KHMA 3DLGB 5KFTA 1IKVB 2RF2A 5KG3A 4KKOB 2R2TA 2YNFB 3MEGA 4RW7B 3T5JA 3ISNC 3KJVB 3E51A 3LP0A 4KFBA 4LSLB 1K1SA 4K4XA 4DL6A 4QWEA 5J2PA 2OPPA 3UR0A 3DOLB 4ECQA 1RT6A 1JKHA 2IAJA 3KLEB 2W8LA 1HQEB 2XI2A 1QUVA 4G3IA 4J9QA 2OPSB 2W9BB 4FS2A 2WTFA 4QW8A 3UQSA 2W7OA 1HYSB 3D28A 1S0MA 1IKYA 3HKWA 3PR4A 4J9NA 1FKPA 2HMIB 3DMJA 1R0AB 3V6JA 1N6QB 1JLAB 2YNHB 4RUAA 5KT5A 3NMAA 4PWDB 4K4WA 4ZP9A 2JLEA 4O44A 5KT3A 3LP0B 3FRZA 3M9MB 2JEJA 5J2PB 2OPPB 2DPJA 3H4DA 1RT6B 5C24A 1JKHB 1NHVA 5KFYA 2BANA 2IAJB 1ZTWA 3V6DA 2XCPA 3KK2A 4Y34A 3IN5A 2VG6B 4ZVFA 4O3NA 2IJNA 4J9MA 3IRXA 3Q8PB 1GX5A 2VG5A 3V81A 4F4YA 3FQLA 2QE5A 5F8JA 4H4OA 3DMJB 2I5JB 1JLBA 4RW4B 2GIQA 4JUZA 2HWIA 4IRKA 4ECUA 5KT7A 3BSNA 2OPQA 2YKNB 2R8IA 2C2RA 5I3UA 3RBDA 5KFWA 3NAIA 5KFIA 3PVXA 1SV5A 4J9SA 4KV8A 4TXSA 5K14A 5C24B 1HMVA 5FDLA 4I2QA 3ICLA 4RNNA 1LW2A 2E9ZA 4ED6A 1RTHB 2HNDA 3MEEA 2WONA 1KLMA 2IC3A 4ID5A 1XR5A 2IMWP 2UVRA 4NLOA 1S48A 2E9RX 1REVA 4DL4A 3PW7A 4IOBA 1JLBB 3T5HA 3I0SB 1SUQA 4MH8A 3QGIA 5KFMA 4RW8A 2XGPA 2OPQB 3UDLA 3BQ1A 4F50A 2R8GA 3M8PA 5HROA 4LQ3A 1SV5B 1C0UA 1RT5A 2UUTA 4QPXA 4IG0A 5J1EA 1XR6A 2I1RA 4NRUA 3D5MA 2D3ZA 4EYIB 3DOKA 3DRSB 4I7FA 5K14B 4DL7A 4URGA 5FDLB 4I2QB 3KOAA 3MR3A 2YNGB 3LAMA 2WB4A 4WFZA 4IR1A 2FVPA 1HNVA 3MFIA 1TKZB 1S0OA 3V4IA 2HNDB 4RNMA 4FBUA 4K4SA 3IS9A 4U6PA 2AU0A 2IC3B 4IG3A 4ID5B 4KSEB 2C22A 2FVRA 3N6MA 4NLVA 4NCGB 3CIZA 1REVB 3GV8B 4WYWA 5KT6A 1S6QA 3LP2A 1C2PA 3Q8RB 2BQRA 4I2PA 5J2MA 1TL1A 2FJVA 4LSNA 3JYTB 2JC1A 5KFZA 4RW8B 4ECYA 2YNIA 4IDKA 1RT1B 4HKQA 3DLGA 3EZUA 1JLQB 3NGDA 3H59A 3H40A 3RB0A 5HROB 4KE5A 1Z4UA 1C0UB 1RT5B 5DLGA 5KFJA 3I0RB 3KLHB 4O3SA 4IKAA 2JC0A 4LSLA 3I5CA 4NLDA 2XGQA 1RT7B 1RTJB 3DOLA 4NLRA 5J2NA 4JV0A 1S1TA 5L1IA 4Q8EA 2HNZB 1JIHA 4NZ0A 3KLEA 1HQEA 3BQ2A 2VA3A 2ZD1A 4H4MB 4TYBA 3V4IB 1RTIB 1OS5A 4KHRA 3H98A 3IS9B 1RT2A 3DRRA 3MEDA 5KFGA 2IM2A 4G1QA 3BSCA 1JLGA 4O3QA 3OSPA 2IM0A 4M94A 3KHHA 2HMIA 4I2PB 4Y3CA 1JLCA 5J2MB 1R0AA 2BRLA 1TL1B 1NNDA 4TLRA 1N6QA 1LWFA 2YNHA 3QGHA 2YNIB 4IDKB 3H4BA 4IR9A 2JEIA 2FVCA 4ZPBA 3V6KA 2BR0A 4NLPA 4PWDA 3BJYA 2R8JA 1VRUA 2ZKUA 4KBIA 1KHWA 3HVWA 5J2NB 1S1TB 5F8MA 2WCXA 1N48A 5F8HA 4YP3A 4J9OA 3NKYA 3GIIA 1C1CB 4RNOA 2ZD1B 4TQRA 1UWBB 4LQ9A 3I5BA 2VG6A 4YR0A 1RT2B 1KHVA 3DRRB 3MEDB 4IFVA 5DG9A 3KNAA 4G1QB 1JLGB 3DLKB 2XI3A 4RNFA 3PW5A 2UVUA 4ECZA 2HAIA 2XWYA 4R0EA 5DQGA 2DPIA 4PQUB 3TQ1A 4EO8A 1JLCB 2I5JA 1HPZB 2BRKA 3E01A 3GYNA 5L1JA 3EPGA 1LWFB 4RW4A 3PW0A 3KMQA 4GC6A 2W8KA 1S1XA 2YKNA 2ILYA 1VRTB 3OL9A 5F9LA 1IM4A 4RUCA 4DEZA 2AQ4A 5CYMA 1VRUB 4IH7A 4NLUA 2BE2B 3IGNA 1N56A 3DM2A 3HVTA 2IM3A 1SH3A 3DLEA 3LP1A 4F4XA 4Q0BA 4MFBB 2V9WA 2UUWA
chains in the Genus database with same CATH superfamily
2HHVA 4CLSA 4UOGA 3CIMA 1O0PA 3LF0A 2KXFA 1QVFR 1U2RA 1S1XB 2M0GB 5HL7Q 2HWTA 1FDNA 2G9OA 3MAAA 2WSEC 3CJQA 4ZP8A 2C1EB 2RHSB 4ZVQB 2B5JA 4ZIWA 1X31C 2DIUA 1S99A 3K57A 1QSSA 4QWAA 1LK7A 5ETTA 4DL2A 3DYAB 1FWKA 4IRCA 2DITA 3EE3A 4Y2CA 4OLOA 3ONQA 3J7YU 2DEIA 1EHWA 1NAQA 4RW6B 2IYIA 1V6HA 3N9UC 3M6XA 3GIMA 4ZPWR 4FF2A 1LKZA 2NXJA 4ECVA 3RRGA 4FNHA 5KT4A 3OR1A 4E98A 3OTEA 2PIIA 2H48B 2D41A 2J7UA 5D4PA 5HMYA 3M2UB 1VBKA 5D77A 1KQFB 3TP2A 3CD5A 4B3SJ 1OYDA 1HNZJ 2RS2A 4I0WA 3R27A 2MZSA 2IHR1 4Y2AA 2R2SA 5LSRA 3M4XA 4MJKA 5DDRC 5B0EA 1CJVB 4LF5J 5AJ3J 4O4GB 2YWKA 1KTQA 1TK8A 4OHYA 2E5HA 1OPIA 3PJWA 5BYSA 2DHSA 4CDIA 3DHWC 4Z7YA 1E6YB 1YK9A 3EVMA 3QZ8A 2CPZA 4QIFA 2CQPA 2ZH6A 1MSWD 4WCEQ 1PAUB 5H1SV 3SI8A 2PDAA 1JLEB 1SIZA 2MKYA 2E1MC 3HHEA 4WKYA 4DV0J 2OLWA 3IBWA 1P1LA 4ZVOB 3GG1A 3CCES 4C8YA 2R7QA 3I4HX 2KM8B 1UWAA 4CLKA 4DR5F 1VIXA 1RAIB 3GB0A 4OQJA 1F0XA 3SIPB 1WG5A 5DJBA 3ENAA 2BANB 2ZOGA 1R7IA 4B9VA 4D3GA 2V50A 1I3OB 3PG9A 5HP1A 3RB6A 5C2CA 2BJ8A 4OHVA 2MHEA 1JJHA 1HQUB 4NXMF 2C28A 3CSKA 2I0XA 5C25A 1W25A 4M1KA 1HI8A 5LSLA 3D0IE 2HGMA 5I3PA 4R8UA 2NZCA 2VL1A 1XR7A 5L1LA 4Q45A 2YPZA 2UXBF 5ETRA 2JZ5A 2KH9A 2RRBA 4NASA 1S97A 2J8AA 2VPYB 1T3NA 2LQBA 2CKWA 3Q24A 2CPEA 2F63A 3PXGa 2RF2A 4C9DA 2QL9B 3ISNC 3IAS9 5J2PA 2DNHA 1VRQC 3G2XA 3J7YI 4ZVRB 2C3YA 4L3KA 1FKPA 4TKTA 2XLKA 1R0AB 1NB2A 1YLXA 3PACA 1AA1B 4K4WA 3LP0B 3CMAS 5IT4A 4XTTA 3FRYA 3O44A 4N8NA 3Q8PB 2V68A 3BPDA 2EC2A 1N52B 1F60B 3DMJB 4JUZA 3DU6A 2FGCA 8RUCA 2A18A 1XNRJ 3CCJS 4OX7A 1HLWA 3NRBA 5C24B 5E3QA 1Q7YT 1RTHB 2CRLA 2HQIA 2F7VA 2OMLA 4OJHA 1REVA 4C7QA 1SUQA 5KFMA 2XGPA 2HRTA 3RW6A 5L9NA 4AFFA 2P9GA 1HNWJ 5FDLB 3GFYA 3RAMA 3LAMA 1HBOA 1GXTA 3D4JA 2ZBRA 2CAJA 3Q8RB 3G71S 1UW9A 4M5HA 4ECYA 4HKQA 3M30B 2JC0A 4UY85 1RTJB 5L1IA 3R1LA 5A2QU 4WBFA 3TZXA 3UE2A 1CQNA 2XNRA 4LVOP 2YNHA 2YNIB 5GAGU 1EJ7L 1QAXA 3SMZA 1VBYA 4Q2LA 3MEDB 4QIEA 1ZAWA 4KR0B 4PZVA 1VC6A 3MM9A 4DCJB 1WF0A 1VRUB 5KTQA 4WKRA 3W3SA 1S49A 3BBFA 3HHLA 2KU7A 3QSIA 5IWAF 3ILOA 3OJSA 2AZ1A 3BV8A 2B0GA 3NOCA 1CJTA 1YJRA 5HANA 3CO9A 2XO6A 4TLQA 3KK1A 1U09A 1GMWD 3SZ2A 3TRGA 2CWXA 3L3CA 3DLEB 2A6MA 2CJKA 1T03B 1FF2A 1FK9A 5EDWA 4PG8A 4FYVB 4Q44A 5G4DA 1N33F 2IPOB 3GIKA 1V5VA 2ZH2A 3QZ7A 1S6OA 3BSAA 4ILMA 4RZRA 1AXQA 3K59A 1EQMA 3ZTRA 2CJQA 4C11B 4R5PB 2DNMA 3DOMB 2BACA 3VTIA 4DG1B 3BO2A 3N28A 4QU7A 2KG1A 1M1GA 1RWXB 3OV7A 2XMWA 3QO9B 1X4CA 5BR8F 3ET6A 4ERDA 2IM1A 1GNKA 2ZDPA 3GONA 4LVNP 1SXLA 2UXCJ 3RBXA 3I56S 2K1RB 3BR8A 2VKZG 3FZ2A 1OY6A 4OYZA 1AUSL 2XMKA 3M32B 5JMNA 1F2HA 3TYTA 4OFZA 4YOEA 5JXSA 4F4WA 2VD3A 2VG7A 1RTDA 1N0VC 4P73A 3I96A 5B0BA 1SKRA 1DAXA 1WKJA 1BQNA 3EGWB 2L08A 3AODA 3O8WA 3N0VA 5IC4B 1CJUB 5GMDA 4GVLA 5E3CA 4YS2A 5CHCB 2O3DA 3A8IA 5A8WB 3GSDA 1Y7PA 4K4TA 4U7UD 2YWEA 2ZWPA 3NCRA 1F6TA 3VAJA 3V6DB 4G1PA 1YBAA 4M5LA 2RRAA 2A3JA 2VJUA 2VFSA 5DGBA 2BM0A 5GAGI 4H4OB 5I42B 4URQU 1Q79A 1LWXA 1LW0A 5IWAJ 3VHQA 3D67A 2CPDA 5KFBA 5D0EA 1YJUA 3P6YC 2GW8A 1QUPA 5IM0B 1E6YA 1KLNA 3N4WA 2YNFA 1NZAA 4J9LA 2MSSA 4I7FB 3VQSA 6AT1B 4P6QA 2BZ2A 1N33J 2GHVC 1WUUA 4Z7CA 3GV5B 4KO0B 3TA0A 1M90T 5BXIA 4X64F 3GG0A 4P10A 3KJVB 1K1SA 4NMLA 5CZXA 3CD6S 2A6OA 1UJ5A 1Q8LA 1NK4A 4YEAA 2LA6A 1YJWS 2ZH9A 3PRBA 2WTFA 1X0FA 2PT0A 3CC7S 1NB7A 3TEGA 4F0HA 2FJAB 3Q83A 2YPYA 2OPPB 2ABYA 1JKHB 2BANA 2Z56B 5LL6d 4G65A 4ZVFA 3HSGA 4P74A 1SQEA 3ZFVA 2FZGB 4M8LA 3EZ5A 1JLBA 3VGTA 1Z2LA 4MKYA 1WDTA 3C19A 5KFIA 4DUYJ 2IBOA 2FHMA 1TFYA 1NLKL 1VK3A 5K8OA 1FJ7A 2GMJA 4OYAA 2JJ4D 3I0SB 3BQ1A 3MOJB 5RUBA 1RT5A 5F3ZA 1XR6A 3D5MA 4X4PA 4FDFA 4KGZB 4URGA 4MT1A 5B08A 4P9SA 4G1IA 2XYGB 2CQDA 4KSEB 5GADU 2XY6A 1TAUA 3MPVA 2DIVA 3P4UB 3A4TA 2MLXA 5DRKA 5DLGA 2DHHA 4CRJA 2W2OP 2HNZB 2KFZA 3CF5Q 1WHVA 2N3OA 2NPFA 2DGQA 3H98A 5D78A 2H51B 4O3QA 5CCMA 4LFBJ 4B3MJ 1N36F 4ELTA 1JLCA 1R0AA 1LNQA 4NWBA 4NLPA 1KDNA 1KOOA 2ZC3A 3DGPA 1N5TA 2MZTA 1U1LA 2WCXA 2CVEA 4G1QB 2V2KA 3GLJA 1MWYA 5FLXU 5C7PA 4RUCA 2HGLA 5D4NA 4W90B 1R8CA 3AT1B 2VFRA 1RTHA 4DL5A 5CCLA 1WJ9A 2V8GA 3EX7B 2CUYA 2UUCF 3SDEA 5A6PA 4J9UE 2YKOA 4WXWA 2FY1A 3LPYA 4QW9A 2L9WA 3OR2B 4OJGA 2DNRA 1DHMA 2RILA 2HZAA 2F9DA 2L48A 3M30A 1AFIA 1TKDA 4N5SA 1RTJA 4KH1B 3Q8YA 5L9XA 2BABA 2O5DA 4ZVSB 2EVZA 3BGRB 4MK9A 4USMA 4JI2F 1Q8IA 5ETSA 3HHKA 2Z4PA 2EFQA 2OO4A 3GIJA 1K8AT 2CJYB 3MMCA 1PBUA 3OSNA 2BEFA 1S9EB 1SC1B 2G0CA 1JLFB 4W98A 1DTTB 5F8IA 1S4FA 3M1VB 2BMBA 1U1MA 3N5FA 1K73T 3QIDA 4X62F 4ED0A 1YBTA 4M63A 3G6XA 4MKVA 4DSKA 3FZBA 1QE1A 2F3JA 3CJTA 1TP7A 2RAQA 4FPRA 2N4CA 4B02A 2XY5A 1T03A 1GXLA 3LA0A 3H5XA 2DGTA 1X5SA 1H7XA 4M5GA 1NBEB 3L7PA 5HMZA 1ZBTA 2QL5B 4RPFA 5GADI 2ROGA 4NLXA 3PRDA 4PUOA 1I6JA 3AD7C 3CXCR 4C11A 3G6VA 4NYZA 2R7XA 4R5PA 1FEHA 1U1KA 3W9HA 2J7KA 2F8EX 2J9EA 2B8QA 4ZIVA 5EN1A 4BC7A 3HCXA 1WTBA 1VQMS 1RWNB 1BHNA 1HKAA 4EGLA 5KT2A 4DR4F 2H1YA 2FY8A 2OH2A 2HFOA 1LFPA 2IY5B 5AE2A 4DX5A 1RU1A 4EMDA 2RQMA 1XEZA 1AFJA 3OLBA 2H9ZA 3IWXA 2R2RA 4NLWA 3QPIA 4UY8T 2E7XA 2BA9A 3LUYA 3UN5A 3W5ZA 5C2GA 3M32A 3DOKB 4YR3A 3U02A 3RAQA 3O6QA 2LVWA 4K4VA 1O6XA 4Q43A 4DR7F 2FC9A 3MEKA 2C2EA 3HI9A 2J0XA 4QJVA 1N34F 4I69A 3D3BJ 4CZCA 2OAUA 3KLEB 4J9QA 2ZOFA 1RHQB 4FVCA 1X9WA 1CJUA 2RUGA 1JLAB 3CCLS 1FVSA 2UXDF 4HR2A 5A8WA 1Z2ZA 1RJJA 4W92B 2ZHAA 2QO3A 2PEBA 3V6DA 3TZWA 4ZCLA 1UL3A 3QWPA 4USIA 3C2PA 1HA1A 5HAOA 4H4OA 4Y0FA 3R9LA 3KUGA 1OY9A 4WTOB 1GT8A 3LGNA 3HLUA 2Y1JA 1S48A 1MW7A 3PO4A 3QGIA 2R8GA 4RW8A 3NGKA 2ZHOA 5IM0A 2EEYA 4ZLLA 4PYDA 4I7FA 4DX7A 1VGYA 1HBNB 2HNDB 1TAQA 2J0WA 4DV3F 2C22A 1Q16B 3Q86A 2BUNA 1UVMA 3CIZA 4WYWA 1QTNB 2QMWA 2GJ2A 4KE5A 2DB1A 2IYGA 4NLDA 3A13A 1QM9A 1JIHA 4I67A 2VA3A 3IS9B 4DWIA 4K7QA 4A8XA 1U49A 4M94A 3TWZA 1GTHA 3H4BA 3BJYA 1Q4RA 2HFZA 3BS9A 1C1CB 3DRRB 3G4SS 1WOPA 1NJZA 1UZDA 2QYGA 5FIIA 2ILYA 4A8SA 4JI8F 1NK6A 3HVTA 3R5GA 2KDOA 4IFVB 4YR2A 5IT9Y 4XO0A 2W4DA 5D4LA 2FJEB 5AT1B 3EPIA 3I0SA 1XMBA 2HSEB 3QT5A 4DV4J 2K7KA 2V63A 1S9GA 4CLTA 2ZUGA 2M7SA 2MEWA 3RRKA 2C2OB 1N34J 5KFRA 3CJKA 2VF3A 2XZDB 3M8QB 1HR0F 2X3GA 2Y1LB 4IO9Q 2CJ9A 2HNZA 4HH1A 2DGUA 2AHOB 4ID8A 3NCQA 4K4ZA 4TNOA 2OPRA 1R43A 2MQLA 3NEKA 2I2YA 5B09A 1RADB 3H2UB 3D68A 3FGVA 3I5AA 3HM9A 2C3OA 2CDQA 3MTJA 3ZTOA 3PFEA 3T9NA 1RU2A 2CQHA 1OIAA 2RMLA 3RRHA 4X4VA 5D15A 3MR6A 2JFDA 3LO3A 3UCZP 3IXQA 4OL8A 4M5MA 2AJ0A 3GU0A 3SCIE 1UP1A 1MNEA 3K5OA 4NPOA 4KYZA 5KFKA 3EJMA 2VFTA 2NXEA 3I55S 4CLLA 3SFUA 1YSJA 3BBBA 3UR3C 2GQCA 3R97A 2OGUA 2QFJA 3OR2A 5E0OA 4J9PA 4FXVA 4FF1A 4N41A 2MY7A 3T9ZA 4KFBB 2J5AA 2HIQA 3GJTB 5A0YA 2DNOA 1NPKA 2Y8WA 5GMKa 1ZZNA 2DNLA 1HBUB 4K5RA 2N82B 1U1NA 1BE4A 3BM7A 4IOAQ 3KG0A 2AYEA 2M70A 1DARA 3HT0A 4URSA 2XS2A 3B6BA 3GFZA 2AT1B 3QGPA 3QRPA 4DX8H 3QYYA 1S9EA 4KC5A 4B9TA 3KLFB 1U25A 4GVBA 2YY3A 1DTTA 3JQMA 2Z2LA 2A2CA 3M1VA 4DV5J 1RAFB 2V4RA 3QLHB 2D3O1 1ACMB 5ETOA 3AFGA 1DTQB 5JJBA 1KLMB 1NKBA 1RWMB 1J5OB 2ZE2A 1I5OB 2FD2A 2QJ3A 1L3KA 2W7PA 5HSPA 3Q8SB 2A10A 4KAIA 3W64A 4KPYA 2QFIA 3AB2B 5C42B 3DLBA 1OSDA 1HR0J 1RWWB 2H5EA 4LSNB 2R7TA 2Q6BA 3CCMS 4DL6A 4KTQA 1KN6A 4ECQA 1V3RA 1RT6A 1Y11A 3FK4A 3G6ES 2HURA 4FS2A 3DU5A 4FF4A 2WVFA 2F8HA 3D6HB 1AZSA 1SIWB 2Z57B 4GO7X 4OI6A 2MKJA 2A0FB 3MCNA 2PMZD 2E44A 2DHGA 3H4DA 3ELHA 4C8ZA 4ZVPB 2HFNA 2VG6B 1JMTA 2KXHA 2BBEA 1FFWB 2QE5A 3W2VA 2DTJA 2DCLA 1VQSA 2HPUA 3QBCA 4NOHA 4DFPA 5DM7Q 2XS7A 1RUSA 3KUHA 1FX2A 3QMQA 4RNNA 4JI5J 4XK8C 4ED6A 2D69A 3Q22A 2D1CA 2D9OA 2UVRA 2RD5C 1TL7B 2PI5A 3CCVS 4JBCA 1H38A 2MKHA 4DR3F 3M6VA 2VOOA 4FF3A 3DOKA 5K14B 1UAWA 2ZH1A 1S57A 4PG7A 4RNMA 4QR0A 2FVRA 4NCGB 2OEKA 3VAGA 2QC3A 1CS4B 1SKWA 1KP6A 2U2FA 5HROB 3KLHB 2XMTA 3EGNA 4NLRA 1BMQB 1BXNA 3KLEA 1RAAB 1NU4A 7FD1A 2IM2A 3IC1A 2C3UA 3B54A 5A8RA 4ETXA 1NNDA 1S5ZA 3QGHA 3RU0A 1P1TA 1KHWA 4JI3J 3HVWA 1V3SA 1IBKJ 1WI8A 3M6UA 4I64A 5A8KB 3KNAA 2XI3A 2VFVA 1U0HB 2BW7A 5DZ6A 2AJ2A 2B4OA 1HPZB 3E01A 3NGTA 3BGLA 3IGNA 1JXEA 2FTRA 2GGPB 3MMJA 2V9WA 2VU5A 4RBTA 1L3VA 1WKLA 3IR5B 2Z0GA 2UV8G 3BSOA 2KFNA 3DCAA 4B3TF 1UJ4A 2IRXA 4PCQA 2V2QA 3W60A 3SEOA 4OX6A 3EUNA 5CYMB 4LRFA 1TQLA 2IJRA 1HBNA 1U2CA 4CLWA 4X4TA 4DV2J 4OZ2A 1FKOB 4CH7A 2DRDA 1EETB 2VC0A 1ZOTA 5DQHA 4F4AA 3Q8QB 3B8HA 4C98A 1NUEA 1B0TA 2BKPA 1DZ5A 1X4HA 3DI6B 1A7GE 4CIOA 2BVZA 2VASA 2LYVA 1T05A 1M1KT 5KFCA 3R1HA 1R8BA 1VR6A 2CPFA 4ELVA 4UQTA 2BJ9A 4RWXA 4U95A 5K5MA 1SB6A 1TV6B 2BJ7A 1C1CA 1LWEB 4B3OB 2OELA 1H2UX 5KG7A 5J2QB 3AOBA 1PCAA 3T1HJ 4CP5A 3OXLA 2FLLA 2JEFA 1YIJS 4DV7J 1FVQA 2ZH5A 4OZLA 3NS7B 4EUVA 1YRTA 1FWPA 3ZZYA 3NL0A 4DUZJ 1S1UA 4TVAB 3SSQA 3C6UB 3KHRA 5H9FJ 3OL8A 3TAMB 4J9VA 5EGYA 2UU9J 2RUSA 2LCWA 1S1WB 3G82A 4X84A 2N3LA 4DR1J 3BKTA 2RKIB 1SL1A 3PNIA 1X4AA 1WTFA 2V8HA 1IBCB 3ILIA 3M8QA 2K3IA 4OYXA 1U4BA 1VQ5S 1K1QA 1C0TB 1C1BB 4KH0B 2AX0A 2RQCA 3LANA 2B4PA 5DG7A 2WZ1A 1T95A 2MQNA 2XCAA 4RR5A 1NDPA 2K06A 3UD4P 5KFQA 1JNRB 1FJCA 1H2VZ 3D6MB 4RX6A 4UUXA 3B82A 3H5YA 4JYAF 3W1YC 1PYSB 4ZPCA 1M0SA 3DDNA 1RA7A 2QMUB 2HFUA 3N6NA 2IRYA 3VGUA 4KIAA 1KBRA 2ATLA 2HHHF 3N5BA 3ITHA 4KB7A 2AJQA 2UVWA 2F4VJ 4TY8B 4LFCJ 1WNEA 1VLOA 1YZ6A 2O1PA 1HIYA 3CO0P 3IRWP 2VICA 1VQ7S 1M5VC 3CD7A 2BV3A 3T19A 4DR6F 2WSFC 4LIRA 5K8PA 4CQ1A 2ZH3A 3HVAA 4ED8A 3MM8B 3IG1B 1NZ8A 2BYCA 1LOUA 4UF4A 4YY3J 4C6AA 2JLFA 3FBBA 4BCAA 2XQCA 1JK9B 2WVDA 2V94A 3H5SA 1RCXB 4PYAA 3A1YG 2J6TA 1XMQF 3V6HA 3TNVA 4QZVB 3RBZA 4DX6A 4KFBA 2YH0A 5CAAA 3GE9A 4NCAA 4ILRA 2DR9A 3D7SB 3PYEA 3ZXWA 3W7BA 2MZQA 1U1OA 4F4YA 2CNNB 2XSFA 3U27A 2C2RA 1FJGF 3NAIA 3L09A 3TAQA 1MROB 2I9SA 1KLMA 3FSXA 4ID5A 2IMWP 2GAHC 1PJ5A 1B7FA 4LBIA 5ITHA 1VOMA 2KFYA 1QAYA 3NGRA 2ZZTA 2RQ4A 2V34A 4I6WA 3D0GE 1I94J 5B0DA 2YNGB 2NR0A 4OX8A 3M2VB 5ETNA 5HK4A 4I2PA 4N77A 4LSNA 1SC4B 1RT1B 3HULA 3RB0A 2C2MB 4NZ0A 2L3MA 2ZD1A 2MHNA 4N7TA 3V4IB 1UVKA 2OP5A 5MAOA 3OSPA 3OBIA 2IM0A 1YI2S 2DH7A 2JEIA 2H4WB 2JVOA 1W7WA 2GAGC 5F8MA 1LFWA 5DDOC 2CPIA 4TQRA 4NL5A 1HD1A 2YXLA 2VG6A 1UCNA 4OIXA 3SYZA 4C3LA 4HT7A 3FMWA 4KJIA 4GKJF 2W2PP 3KMQA 2YX1A 2W01A 4ED4A 1N5QA 2BE2B 1CJKB 3DM2A 4FYYB 4Q0BA 1NPRA 3I9V9 3OD2A 2R42A 1RHKB 1NH7A 3PFOA 2LQ5A 3RW7A 2WOMA 3MECB 1DURA 1B0VA 4ED7A 3OTOF 2Z8QA 2QA1A 2ASLA 2YKPA 1HNXJ 4L76A 3EZOA 1F9EB 4NLTA 1HHQA 3VAKA 3MPUB 1RHJB 2LMIA 4NCGA 3JSRA 3M05A 1V3ZA 3FFIB 3LTOA 1UKUA 1WC0A 3FCWA 2KXNB 4RL1A 5IS2A 3KLHA 1QVGR 4OV6A 4CO0A 2RDIA 4IFYB 1U1RA 5EUHA 2KRRA 2BM1A 1N5YA 3C15B 4RLEA 1S1VB 5GVQA 3GCXP 1NJIT 2LQ9A 3OL6A 2N4DA 1SC3B 2WHOA 3NS5A 2ADCA 2RU3A 3P49B 1TR0A 4A8QA 1WEYA 5H9EK 1RP5A 3A8KA 4F2SA 1URNA 2HQ3A 2RHQB 1OO0B 3P8BB 1ZA2B 5A8KA 4M5DB 4NLSA 2J0QD 3K8WA 4F04B 1HPZA 3GQCA 5KFEA 2N7CA 3NS6A 3KUEA 5CQGA 4A46A 1ZETA 2HBYB 1D1UA 3HD2A 1RAJA 2GGPA 1Q8KA 4WPAA 3PW4A 3FC9A 3DRPA 3MMBB 1HW8A 2Y8YA 3D1OA 2DK2A 4B3RJ 2UUAF 2O01C 2NPIA 3FCVA 2G4BA 3MM5B 3JSMA 5D3GB 2B9YA 1OQ3A 4IH5A 2MGZA 3CGIA 4CT9A 1M5PC 2XLJA 4C3KA 4L72B 1H3DA 4NYOA 3SV3A 5LMNF 2B9WA 1PYOB 3J7Z5 5M2UA 3Q23A 3I4PA 4MK8A 3LAKA 3TANA 3J80U 3M9NB 4ECXA 2DNKA 1TV6A 5SZTA 2CYYA 4HH0A 1B3TA 2CQ4A 1F9HA 2AEFA 3K8VA 4JI4F 2DY9A 4WP3A 1FNMA 3ZC4A 4OHZA 1RT3A 1WC3A 2XS5A 2W2NP 2ZNYA 5D0GA 2XWXA 4RWWA 4CNYA 2KT5A 3THVA 3N6LA 1RI7A 3C8YA 4HI1A 2ZJPQ 3C6UA 1AW0A 2FVQA 1HNVB 2DKOB 3OVSA 1AUDA 5E41A 5HLFB 1PYTA 2XZWA 2RKIA 3G9CA 4QWCA 1Q81T 4DQRA 3PY8A 3E51A 1RSCA 4DSEA 3D6FB 1UFWA 2W8LA 4G3IA 5ETLA 1K0TA 1HYSB 1TMJA 3B4MA 4JI6J 2E5LJ 2JOQA 3O3LA 1KC8T 1KFSA 1Y5LB 3M9MB 3MMAB 5HQLA 4CO1A 3U1LA 3Q2TC 1UEUA 4KRWA 3FQLA 1ELOA 2C3PA 3M2RA 2OPQA 4HDHA 3RBDA 1FERA 3OQ2A 4FXWA 2ZM6F 2LEPA 1HWLA 4P2XA 2GMHA 4JOUA 2CADA 3ZZRA 2UUAJ 3MAQA 4IOCQ 3HHLD 2WVEA 1C0UA 2CVIA 3DXSX 3S8SA 2LXFA 4A8WA 2M52A 3MM8A 4RUHA 3AY0A 4CTAA 2IC3B 5E3RA 3PX6A 4NYPA 4G6VB 4GO5X 1C2PA 3CD0A 3H59A 4LF7F 4ZCIA 1BUXA 2ROPA 1NJWA 1S1TA 1JQGA 1JXVA 4WIIA 2YH1A 4O0NA 3BQ2A 4B9UA 3MAHA 2W25A 4X65J 3CPWR 4FN5A 2VBYA 4LF2A 4UZCA 5LJ5Y 1NKCA 5SUHA 5LM7E 4ECZA 3I9ZA 2QEXS 1GTEA 3ZZOA 3OT9A 4JI7J 3DRXA 2IM3A 3LP1A 1XNQF 2UUWA 5DZ7A 4LF8F 4EBCA 1MROA 1RZMA 4B9SA 4ED3A 1YG0A 2GO9A 1TK0A 1YJNS 2W2QP 4CLPA 2CWKA 4USVA 4DS5A 1FX4A 1IXKA 3A8JA 3T6BA 3A3NB 2DO0A 2YNGA 1AROP 2HG4A 4NLGA 5CYQA 3E2EA 3PYGA 1DQ9A 3VV2B 4QQBA 2FHJD 1GEHA 4ETZA 7FDRA 1RT1A 4WK1A 4DFMA 2KN4A 2ZJRQ 1XMOJ 4Q8FA 2AJFE 3VVTA 5DLFA 1D8YA 5HBMB 2LDYA 4ZITA 2VODA 3C16A 4ICLB 4JI0F 1GX6A 1Q95G 1VQNS 1VHFA 2P9EA 4ZP6A 2ZM6J 2FDNA 1CBKA 2DR7A 2I8EA 4X4NA 2PA8D 2R7RA 3VVUA 4RW9A 2EBGA 3CCTA 4USWA 5F8LA 3HHDA 2BE2A 4DI6A 4CM0A 1CJKA 1PC4A 4YDDB 4ZHRB 3MM7B 4MTPA 3MECA 2DYAA 1LWCA 2V2ZA 3PJXA 3TVYA 1IKWA 2JDJA 3WX4A 2OIHA 2KZMA 3DC2A 1XK8A 4WZMA 1R3NA 1RT4B 2G2YA 3OLAA 2ALZA 4PG4A 2EK6A 1F2GA 3HT3A 3LALA 3MEGB 4IFYA 1TZ0A 4LF9J 1S1VA 4DUTA 2MZ1A 1OQ6A 4V19X 3MWBA 2DR8A 1S0NA 1IKXB 5HMWA 5HI7A 3FMBA 4O44B 4B3SF 1HNZF 3SQOP 3M8ZA 1FA0A 4LF5F 5AJ3F 3IM9A 2XMUA 2R7WA 5I3UB 2POKA 1H7WA 4X2BA 3TEHB 5GAHI 1V9OA 4R0JA 2MMYA 4K50A 2KT2A 1GMVA 2WONB 4MIAA 1WC5A 2VJVA 1ZAVA 3M6WA 1UEKA 1Y10A 1WF1A 4KKOA 2GVDB 3MMBA 5DG8A 4IG0B 4DV0F 4AE5A 1RABB 2HFVA 2VBXA 2H65B 4OMFG 4OJ3A 1S4EA 4OI2A 4RW7B 4QWEA 2IAJA 3VAHA 5ADZA 1GXUA 3D28A 4W4MA 2HMIB 4AQYJ 1KQKA 2KHCA 4C4WA 1YKWA 4PWDB 3CCZA 3Q2SC 1RTZA 1BGXT 3ZZTA 4ZJLA 2ERRA 3KDNA 1RWVB 3IWLA 4UTGA 3GZ7A 4LIWA 4EWTA 1VCTA 1X4BA 3TJ8A 4KGKA 2FC8A 1IWAA 2JWNA 1WEXA 4I56A 3H2VE 1NJXA 3FEZA 4AD6A 4MH8A 1MG7A 2C42A 1SV5B 1PIEA 2UUTA 3Q0AA 5LT5A 4EYIB 1VBZA 8AT1B 1VQKS 4WFZA 1HNVA 1D9AA 3HKZD 3GIRA 1ZM2A 4FBUA 2GNKA 2AU0A 4X66F 3VR1A 3JTPA 2LA4A 5J2MA 2CPHA 4ED5A 2AYMA 2QG9B 1GH8A 3A8EA 1W26A 2B8PA 5J2NA 1SQGA 4ZCMA 3TW0A 1RT2A 1NSKL 2C2ZB 3A12A 5D8HB 3MUTP 1PGZA 1LWFA 2BOPA 2HBRB 4ANDA 2XYHB 1B99A 4C0OC 4KBIA 4C97A 1NDLA 1A6LA 2YKQA 2MTLA 1XNRF 2CNKB 4ZS6A 2DJWA 3TZYA 1ZAXA 3GMGA 4PG6A 3VZIA 2AJ1A 4ZLJA 4YUDA 5U47A 2G2ZA 3CC2S 4HACB 2OFHX 4TN2A 2AZ3A 2BJ3A 1HNWF 3M8RA 4O3OA 3AQOA 2V0NA 1Q0NA 5EX0A 3C14B 3KK3A 2AMCB 4OYMA 3J7ZT 1FD2A 3NGUA 1XC9A 3UNGC 1S12A 1Y4ZB 5GAEI 2DRAA 5KFLA 2ASYA 1AT1B 3HJVA 3HZEA 1RQ0A 3POTA 5T14A 4MYUA 4TYAA 2ZBQA 2KYZA 1IR1A 3C66A 3ISZA 2HNYA 3F0NA 3GP9A 3PKMA 2HVHA 1T9VA 1Y3JA 2DISA 2CQ1A 4MMOA 5GMEA 3HSZA 3D66A 2BQUA 4H54A 3UFCX 3EGZA 2PE8A 1NK0A 5ETMA 4YHHJ 3M8WA 3OXFA 4HI2A 5IQQA 3CJRA 3FNNA 2QSWA 4F3QA 2C2DA 2KB2A 2F65A 3HHLC 4YB1P 3BGUA 1TELA 2EFNA 2GVZA 4FP9A 3Q8VA 2JX2A 3N01A 1SH0A 1IVZA 5KG4A 1T9WA 4F7VA 1TKXA 3MF5A 3WX8A 4X66J 3KDOA 4CH1A 2Q3PA 3KLIB 1NCLA 1JXLA 4O4RA 1NO8A 1IBMJ 3NBPB 3CE8A 4I6YA 4ZVEA 4A4JA 2ZOMA 1KQGB 3OHBA 5L8RC 1VMBA 4H4KA 2R9LA 1Y9OA 3GYXB 3UDEA 4MIWA 2VQEF 3JS9A 5AE3A 4CH0S 2AGOA 3C6TB 4DV1J 5HBMA 1YWXA 2MQ8A 3R7BB 3O2IA 3BF4A 2HS0A 4BS2A 2BX6A 2G1HA 4NX9A 4DU8A 2FJDB 2B6AB 1UVNA 5DDQC 3KG4A 3IRXB 1EARA 1N4LA 2MY8A 3WBZA 3CCQS 2UXCF 1NMEB 4J9KA 1FTCA 2PN6A 4F4KA 2M2BA 4KT0C 2XO7A 3ZZUA 1WOSA 1EP4B 3KLGA 2AJ4A 1RYSA 3HJFA 3MCMA 2UUBJ 4CT8A 1IKVA 3M8PB 3V6KA 3KHLA 2IBKA 2V4QA 3W9IA 1VK8A 1Z1ZA 4DPUA 2W9BA 3PM9A 4M5JA 4ENOA 4DQPA 4NE9C 2J9DE 3W65A 3MEGA 3T5JA 4LSLB 2IDEA 4KPCA 1KTVA 4C8LA 2HQFA 2OPSB 4FXDA 3KYLA 4L3NA 2YWWA 3PR4A 4J9NA 1RWKB 3NNHA 1N6QB 4CCHA 1FRJA 3WIUA 3K5PA 2AV5A 4O44A 1AYEA 3FRZA 3U1MA 1DBDA 4Y34A 1NJYA 4J9MA 2XTJP 3AJ2A 4WP9A 5A6WA 2XB2D 2KJWA 2HWIA 4OYPA 2YKNB 1SJ3P 3ENQA 5I3UA 3UCUP 5LOQA 3FCHA 2HQCA 4LR7A 4I2QA 5AXNA 4LF4F 3OUYB 2WONA 3GTYX 2E9RX 3VALA 4ITSA 3UDLA 4NCBA 2GVDA 4IG0A 2D3ZA 4DPWA 1NXIA 4F2RA 1H2TZ 4DPOA 4EZ9A 5F0UA 2VQEJ 3ENVA 1TL1A 1JLQB 1RBOB 1P27B 4BBYA 2H54B 4EI2A 2KG0A 4O3SA 4OZNA 5KOXA 1BLUA 2Z58B 4I68A 3EICA 1F3VA 5KFGA 3VAIA 1JLGA 1GAOA 2HMIA 5IV4A 4IDKB 4DSJA 1NK9A 4ZPBA 4PWDA 2L41A 2R8JA 2M3DA 2ZH7A 5IC6B 4BWMA 1S0VA 3MHYA 3IBCB 1VIOA 4K8RA 2DXFA 4RNOA 2PD1A 3OW2R 1NDCA 3SCJE 4DUYF 2DPIA 4PQUB 2OJ3A 1S1XA 2CA9A 1VRTB 4GMKA 5LXYA 2MDAA 3G8TA 4QYZK 2MKSA 2HRUA 3DYAA 3GV7B 4HVZA 3DFEA 2FB0A 1KS2A 4RW6A 3K2YA 4X4RA 2LEBA 2I38A 4DV6J 3D6TB 4P2SA 2FPHX 2WVCA 3HO1A 2AGPA 3JXOA 2HHPA 3MAAB 4HHHA 4UOHA 2B5JB 4LFBF 4B3MF 2OHDA 3KHGA 2B4VA 3IM8A 3M2UA 4PKDB 2B7CB 3AD9C 2E7WA 2JNJA 4USTA 2XMMA 3NNAA 1CJVA 4O4GA 1IR0A 4IRDA 1KVKA 3QT7A 1TL5A 3OR1B 2AGQA 5KFHA 1X4EA 4LF4J 3WC2A 1W2BR 4P7VA 3PX4A 3RAXA 1D0EA 5KFVA 4C0BA 1JLEA 4DS4A 4ZMMA 2UVVA 3RGIA 1N5VA 1U45A 3G96A 3C14A 5KFXA 1PG5B 4MK7A 1R27B 1YDLA 2NYHA 4OI4A 4WFNQ 5F8NA 2Z30B 3R5JB 2SXLA 2KL8A 4DOZA 3FBCA 2X1FA 2QA4G 4WP8A 3DXBA 4PABA 1REGX 3QSYB 4TQSA 3B78A 2GIRA 2MQOA 1SL2A 1S77D 4M95A 3OL7A 4OV1A 5A76A 1HQUA 1KVJA 4PPZA 2ZC4A 1WEZA 2VOPA 2PI4A 3ULHA 3V81B 1WSVA 4J7CA 3CJ0A 1SJFA 5ETPA 1F9FA 2GIFA 3BDPA 1HWJA 3MR7A 2HHTA 3AOCA 1D8ZA 1HMVB 1X4DA 2VDIA 5C5JA 3PEJA 2DGWA 1T8EA 1K9MT 3AHPA 3I87A 2MJUA 1VI7A 1P6TA 1XWLA 4Z2XA 4WZQA 1MMDA 1VQOS 3WIVA 2B7BB 3AD8C 4DMZA 2BJ1A 1X9MA 4QIVA 3KNGA 3A3PB 4P75A 4USHA 4PQAA 2MLYA 4OX9F 3KLIA 3HK2A 5JUMA 2ZEJA 2V67A 1U2FA 2B9XA 3NBPA 3G86A 5MLCV 1IQTA 5IZHA 2V5HG 4KY3A 5KG3A 3EXYA 1ICEB 5L39A 4ZPTR 3LP0A 2ZH8A 2HVZA 4CWBA 2CQIA 2AW0A 2DD8S 4AL7A 4FYWB 1KQSR 2GO8A 3DMJA 1RAEB 3S7RA 4DF8A 4F8RA 5J2PB 2DPJA 1BY9A 5C24A 2VHGA 3ZZZA 3HP6A 3IRXA 1GX5A 3J80Y 1IBLJ 3PDNA 2XMVA 3BBCA 2WSCC 2F8MA 2ZZMA 3ZNJ1 1FO1A 5B0GA 2QYCA 3TI0A 5FDLA 5CA5A 4DSFA 2EWHA 3V4MA 1I51B 2AEJA 3T41A 1U02A 1J5EJ 3IR7B 3M8PA 3PIPQ 2QLXA 2I1RA 2V2VA 1X60A 5E3AA 3ILJA 4IR1A 1UFKA 3LGMA 2J0SD 4DN0A 1REVB 2Q66A 2YNIA 1U26A 4LSLA 1CG2A 2CPXA 3MEDA 1IN0A 4OJ1A 1X8DA 4QBUA 2XYPB 1T9XA 1N6QA 2EFGA 1PSDA 4ZJOA 3GCWP 3W2WB 1VRUA 2ZKUA 4LUBA 4LFAJ 5AXMA 4PEOA 5CD4H 1B70B 4YR0A 1KHVA 2L9NA 1NM2A 5HJYA 1ITPA 1WC1A 2HAIA 1U7LA 1RAOA 3EPGA 2YKNA 3HF5A 3OL9A 3EVOA 3PTWA 4IH7A 2LU2A 3BKFA 3DLEA 4ANEA 3TZZA 2E7VA 2HLUA 4OX9J 4C8KA 2P2CB 2YVSA 1YHQS 2M88A 3MM9B 2WB1D 2H5IB 3I82A 2QZ8A 4HHJA 3R6LB 1SKUB 1WDDA 2YWGA 3HHLB 1IJEB 3NLCA 2E29A 3PRVA 4Y00A 3JAMU 3DOMA 1JLQA 4DG1A 3KK1B 4KHPJ 5CZVA 2FJXA 2WW8A 2XEXA 3QO9A 1CQMA 1FK9B 4P2MA 3ETOA 1RISA 1ULRA 4I4BA 1K44A 4WK3A 1TUWA 3DGVA 1HFEL 2V8PA 3CT9A 1K47A 2K1RA 4DJBA 3H8YA 4PQUA 2UZAA 2IVFB 2WK4A 1VRTA 3IFEA 1H6KX 2LKZA 3TOQA 4WE1B 1G7CB 3IR6B 1LQ9A 1RWUA 4DV4F 1RYRA 3R5DA 4F0KA 3QJPA 3HHNB 3ET6B 1Y3KA 3FSIA 4EFAC 1KEKA 2B56A 3D1QA 1QTMA 4RNHA 1DLOB 1DRZA 2RNEA 1LXNA 2PO4A 3RB3A 4GRSA 5E5NA 2ASJA 2M8HA 4DPTA 4Y65A 2QA2A 2P6SA 1QAIA 3PJ9A 1WHWA 4DL3A 4EYHB 2VG7B 3ZO7A 1RTDB 4O3PA 5I42A 3B4DA 4C2MA 4CLYA 1BQNB 5KAKA 2VQFJ 3MM6B 4X4QA 1WKKA 3BH7B 3CJ5A 1QD1A 5LJ3Y 3TUIC 2VPWB 3MR5A 4IUFA 4A8OA 1S9FA 2QMXA 4ZN3A 3KKFA 2NXUA 1GK8A 1TUGB 1FTRA 2F40A 3HPOA 3UDCA 3ADAC 2FGOA 4FKYA 1JX4A 4KO0A 3LPEA 1MWQA 3TARA 1M5SA 3MOZA 1OWXA 3PZPA 1LW0B 3K5MA 3HZGA 4PWUA 5J1EB 3KJVA 1X0PA 3P3DA 4EO6A 5M2RA 3JSBA 3DN9A 3AB4B 1FEEA 2BOAA 1L3TA 2OFGX 4IG3B 1UA0A 2CQ2A 4EBDA 3D3CJ 2L9DA 4Y6IA 3D9BA 1D9FA 5IOLA 1SJ4P 3UPFA 4L6V3 1S10A 4OI3A 2YNFB 4ZN1A 4DL7A 4X4OA 2KT3A 2HS4A 4UUWA 4DL0C 2OPPA 1WC6A 2KKHA 1JKHA 2W7OA 1WOOA 2DGOA 1H0HB 3THPA 1N5SA 3AJDA 2CQ0A 2JEJA 2NUUG 1U6ZA 4DV5F 4QIGA 3IN5A 4JI1F 3V81A 5F8JA 3J81Y 1T0TV 1HL6A 4ECUA 2RVJA 2ZNZA 4U96A 1HMVA 4ZLPA 2GQ2A 2V69A 4EK2A 2NQPA 2DXEA 4A47A 3SQGB 3PW7A 1JLBB 1H73A 2ZZNA 2XG8A 3HFZB 2MKIA 4LQ3A 1VLYA 4OHWA 1JJCB 2X1BA 2XMAA 3QJJA 4K59A 4BWJA 3WQPA 4IYQA 1HHSA 5JVGQ 5E2QA 2LQJA 5D6GA 2NCKL 2FJVA 3SCLE 5KFZA 3V5RA 1RWPB 2JH3A 1RT5B 3CC4S 4TYBA 2QSFA 3ZTSA 3LOUA 4KHRA 4G1QA 2BJDA 1WHXA 1FNOA 2IVYA 2A1BA 3NY0A 3TX8A 4PXDA 2LLZA 5F8HA 4J9OA 4YN3B 3L95X 3HSJA 1K0VA 1UWBB 3M8SA 3TQ1A 4EO8A 1JLCB 3GYNA 1D09B 4JI5F 4GC6A 2JVRA 4NLUA 2NLWA 4ILLA 3DGPB 5LMUF 4WTYA 2CZ4A 1ZH5A 2DBBA 3MD3A 4MFBB 2DR6A 3FJ2A 5H9EJ 1YBUA 4R25A 3CDBA 1JWWA 4DZ6A 4TY9A 2KYXA 3HFKA 3N79A 5HATA 4LRAA 4ZVGA 1EB0A 1VQYA 1T94A 1NK5A 3BGRA 4C8MA 5CYJA 5DQIA 1XERA 3SDEB 5JVHQ 4J9RA 1VDHA 1HHTP 4PXBA 2NYIA 1PAEX 2DEJA 3HDSA 4YQWA 1JLFA 4L73A 2OSRA 4C8NA 4JI3F 1ZM9A 2XC9A 4JI1J 2GJFA 3CJ2A 1IBKF 4DR5J 2Q1LA 2OMOA 2D3OR 3AJ1A 1FD8A 4JB8B 1FDAA 2HVEA 4ELUA 4B17A 5IQ6A 1KVIA 3W2WA 4CO2A 5ETQA 4XIUA 3OXGA 3H7HB 4ATNA 4NA1A 2E1CA 2PEHA 1R8PA 4DCPB 5B0CA 1S76D 4DLEA 1TTHB 2B9EA 2XBPA 3MMCB 1FJEB 3VAFA 2RRNA 3MPYA 2CQGA 1YGYA 2QRRA 4NXMJ 1VHIA 3R7SB 4WU2A 2MJNA 2V8VA 3SSRA 4FPIA 4DV2F 4C0HA 4XPEA 3RJMB 3S6EA 5KFPA 2UXBJ 3FUYA 1U1PA 1SVDA 2FUG9 1QE1B 3NWGA 1YRUA 1M5OC 2HS3A 5HMXA 2GX8A 4Q7AA 4DXLA 3CULA 4QWBA 2DR5A 1HQ2A 4X4SA 3IO1A 1RAGB 2CJAA 1B64A 5K9FA 1FFSB 1U8WA 4FVMA 1WD6A 1R0BG 4DZDA 2XHCA 3QRRA 5G0RB 2H4YB 3MUMP 4WFXA 2WRMA 2QV6A 3KK2B 2GFFA 4M5NA 3T1HF 4L75A 4CLUA 4ED1A 4PUOB 4DV7F 1VQLS 5LMUJ 2QLJB 3W62A 3CJ4A 5KG1A 4DHVA 3H25A 4UW2A 3CB4A 2CFXA 4LRDA 4EU0A 3EVWA 4DUZF 3PEHA 1LW2B 4WE1A 3D2WA 1SKSA 2UU9F 2FQQB 4OYBA 2J9CA 3PW2A 4DR1F 3HX9A 3JQJA 4RBVA 4ZVHA 4U67Q 1J27A 3BZQA 1DLOA 2YWFA 1MN9A 2FIUA 3TJ9A 1JLAA 2IFXA 4KHMA 3DLGB 3KJNB 2FHJA 1TUVA 4ZCKA 2RJZA 3TUJC 1F1BB 3MUVP 3GWCA 2YBVA 2Y0BB 4X4UA 1KR4A 4J91A 3MM6A 3QFWA 5I3QA 4XDDA 3MD1A 3F56A 2ACMA 4MAKA 2DNPA 5ETKA 1EKRA 2ROEA 2LFVA 2OTJS 2F4VF 4LFCF 3P5TL 5KT7A 2AKWB 2R8IA 3K89A 4RBUA 3ICLA 3EYZA 2HNDA 4NLOA 2EFOA 1SJRA 4YY3F 5HN0A 2Y1IA 5J1EA 2G1DA 2EKNA 3AA8A 2MZJA 2WB4A 3IS9A 5DO2A 4IG3A 4NLVA 3W61A 3GJRB 4HT5A 2ADBA 3KG1A 2DGXA 4RW8B 5IT0A 2RE1A 2R7VA 5A2QY 4OI1A 1Z4UA 2GZOA 3I5CA 4HL9A 3R7NB 4JV0A 2M8DB 4HDGA 5I4MA 2VDHA 3DRRA 4OZ3A 2BRLA 2YQ1A 3UD5A 1UA1A 2VC1A 2P5VA 2MQQA 2GA7A 3NKYA 3GIIA 1M5KC 3MURP 3DDIA 5DG9A 4IFVA 4QYRA 1RBAA 2XWYA 2OTLS 3PW0A 1ZZFA 1IM4A 4RJVA 1QY7A 5AXKA 5BR8J 2ZJQQ 3H5UA 3EDQB 3V2UC 2E9TA 3K5NA 3SQGA 1QJHA 4OYWA 5T41A 1I94F 4N47A 3VCDA 1VQ8S 3OVBA 2D3UA 2R2UA 3I31A 4NLQA 3NXZA 1TKTB 1NK8A 3R8YA 5CXTA 2BW2A 3HVTB 1O5JA 2HHSA 3QT6A 4K5SA 5D0HA 1PJ7A 1UFLA 3JTNA 2QLFB 2M9KA 2XSJB 5EHHA 2NSCA 4HLBA 1S9GB 3L4BC 1TVRB 3OJUA 1RCOB 2CZ9A 1R31A 4CI0B 5LSOA 1T9TA 3HSDA 3W5XA 5KFUA 3QWUA 4WYLA 1RAHB 3CJKB 4CYUB 3T3FA 5KFOA 2IA0A 2MLZA 5LXRA 2W4PA 2M5YA 4K4UA 1U6FA 3GJSB 2E1PA 1UWBA 3TA2A 3OPKA 1VQPS 3DDKA 1X5OA 2OPRB 1C4AA 3DNCA 4V1Ak 3TQEA 4TU7A 1ZTTA 2HVDA 5F0WA 1RHRB 2XLIA 1DFDA 1HNIB 4XAKA 2G0JA 4MFBA 5KG0A 3LWLA 1X4FA 2QN6B 3MZIA 3NAHA 1HNXF 1S6UA 2BKOA 1FT8A 3LGHA 4HTIA 1SBRA 4AL5A 4ES3A 4ZA1A 1HBUA 2E66A 2V8DA 1J2VA 1SH2A 2EKYA 2DNGA 2IDLA 4PRFA 2HVIA 4F02A 1N8RT 3CDEA 2HZCA 2K2PA 2VB6A 4TU8A 3PCOB 3FEXB 4X64J 3OVAA 3JTOA 3KLFA 2GC8A 1Q82T 3OHAA 3QLHA 2F9JA 3IAM9 2JRSA 4YDXA 2C2NA 1TU0B 5A0YB 4FKXA 1DTQA 2ILZA 4QWDA 3BR9A 3L7UA 2K3KA 2HGNA 1HI0P 4GKKF 1J5OA 2HHQA 1DQAA 4QU6A 2R8HA 4PAAA 2DHAA 2D9PA 3UI3A 1R0CB 2QLWA 1T02A 5DGAA 4GC7A 3QT8A 3C3LA 5C42A 4GVBB 1NH8A 1BC6A 1RLDA 3JSYA 4B3RF 1NKEA 3MPDA 4WWSA 1MWZA 1FXRA 2V4JB 2HFSA 3MI7X 2E5GA 4D3HA 4WIQA 2CZVC 4ZK7M 5DETA 1XJWB 1X5TA 1FFGB 4DCOB 1S6QB 4CM2A 2ZE2B 2DY1A 2NS1B 1HWKA 2R2TA 1DY3A 3AAWB 1S7IA 1TFWA 2XI2A 5E7OB 1E6VB 2N7YA 3US5A 4QW8A 3AXMA 2AYBA 3CW2C 3BEGB 3SCKE 1WF2A 4DFJA 4A8KA 4JP8A 4NEYA 1QLNA 1QSYA 4O0IA 2P9CA 2K7JA 1HBMB 4RUBA 5G0RA 1RT6B 4Y2IA 1N36J 2XCPA 1KRPA 3KK2A 2OKQA 2AYGA 1HI1A 4FZVA 1PILA 3EXCX 1TL7A 1U0SA 2I5JB 1AZSB 4RW4B 1OSCA 4IRKA 3BSNA 4ES1A 4NA3A 3D54A 2OI2A 1SJ1A 4OI0A 5K14A 2JSXA 1LW2A 3TUZC 2PA3A 4FYXB 5K8NA 1G3OA 3W2VB 1CS4A 2KHDA 5HROA 4QPXA 3HMJG 1CC7A 4NMXA 4NRUA 3DRSB 1EAYC 2UUCJ 1Q53A 3R5AA 4U6PA 2Y0SD 1FESA 1LV5A 1P9YA 3JYTB 5BJRA 3DLGA 3RG6A 3I0RB 2HBQB 2P8IA 1RE1B 2QIFA 2XGQA 4JI6F 1N32F 2C2KB 2E5LF 3CMES 4UOFA 1OS5A 2QX0A 1G2EA 2G0IA 1BQXA 3BSCA 3GYGA 3W8GA 3T1YF 1VC5A 2MB0B 4DQSA 1U0HA 2LXUA 4LMZA 2VONA 4GKKJ 4Y28C 1Q7LB 4JI2J 3AA9A 3QNWB 3UWTA 2DCUB 4ZLNA 1N48A 3BGOP 1Y0HA 4P72A 4LQ9A 5FLXY 4DF4A 3DLKB 2V6AA 4HEA9 2OD4A 2VBZA 1Y00A 4MYTA 1U24A 5A8RB 4RU2A 5L1JA 2Z2MA 4DEZA 5CYMA 1UZHA 3IA0A 2VA2A 1FKOA 2V9KA 5KG2A 1S72S 4X62J 1EETA 4J90A 1U6BA 1ZM3A 3E01B 3AH6A 2JFKA 1S6PB 2WBMA 4NI2B 3DI6A 2QTWA 1ROFA 4LF1A 3NWRA 2K8GA 3G6YA 3T5KA 2BQ3A 2XULA 4F36A 2EK1A 1SPBP 5F8GA 3CCUS 3IP0A 2NXNA 3CJ3A 1RLCL 4XDCA 2IIHA 1HARA 4U7CA 4X65F 4B08A 1Y5IB 7AT1B 1CC8A 1LWEA 4B3OA 1SI9A 1U8SA 3GFHA 1FDBA 3WC0A 2HEKA 5J2QA 2CQCA 2XY7A 2Y3YA 3GILA 2CPYA 4AYBD 4MKAA 2HZVA 3OFGA 1QSLA 3G87A 4C8OA 1T05B 3MR2A 1FDDA 4JI7F 2W4CA 3MFHA 4FYDA 1ZPVA 2W9AA 3BN7A 2B43A 4LJMA 2UV8A 3NCPA 2DNNA 4UQGA 3TAMA 4LREA 3SSSA 3PV8A 2GJIA 3QIPB 3BDEA 5IV3A 1S1WA 4DR4J 2NXCA 1MU2B 4YB6A 2BDPA 2GHWA 1GMWA 1YJ7A 1PO6A 4KGXB 4ECTA 3FBEA 2EBEA 3A3OB 2CQBA 3VGSA 4WFBQ 4OZ0A 2X51A 1NHUA 1TKTA 4LBPA 1C0TA 2ZWOA 1C1BA 2YTCA 1OMSA 4ECRA 2Q6CA 3TVZA 1UMJA 2KTQA 1XMOF 1PBAA 2QT7A 1N32J 2QGFB 1S1UB 2B4UA 2XMJA 1F3FA 1FRMA 5DDPC 4DR7J 2XSJA 3BGFA 3T1YJ 4WXOA 1TVRA 3FSYA 3U1NA 4NLYA 3WZ0A 4LR8A 2NREA 3RUBL 3G82B 3JAMY 3BN4A 5IXUA 3FKBA 2FZKB 2HK2A 4CYUA 5HO4A 4A8YA 2WBRA 4ER8A 1IM6A 2E1AA 3VAMA 4LBHA 2PC6A 4TY8A 1Q5VA 4QCLA 2R8KA 3VF0B 2UXDJ 2HQDA 2X7IA 1YITS 1RHMB 3OTCA 2HHWA 1G4CA 1O8BA 2EG1A 2EG2A 4I1TA 3EMTA 4BDPA 2H5JB 4ECWA 2PGCA 2AD9A 3IG1A 3ZZPA 3LWMA 1HNIA 3I32A 1CVJA 2LECA 2C3MA 3UVJB 2XZTB 2A2DA 1ZYQA 6FDRA 3T1AA 2PMWA 3CWJA 5D4OA 1UVJA 2DXDA 4PR6A 6FD1A 4ZKAA 3ITHB 3R5BA 2EFPA 4E0DA 2ZVIA 2R7SA 3IMQJ 4EEYA 1T9UA 1RXOB 3THTA 3LQVA 4PPDA 1WELA 3G8SA 4LF9F 4DV3J 2OSQA 3E8OA 4OYOA 4TU9A 2VV5A 2CG8A 4O23A 1QUVA 4Q2MA 1S0MA 3VGVA 3V6JA 3QQCD 4RUAA 4E8UA 2XNQA 4C48A 2IJNA 5THWA 2GQQA 5CH7B 3T6JA 3KFWX 4Y2MA 1S59A 3ETMA 5KFWA 3ZNUA 3KTQA 1XIQA 1IQZA 2HK3A 3TO8A 2E9ZA 4JI8J 1XR5A 3M2VA 2DH8A 3ENWA 3T5HA 1CULB 2MQPA 2PFFB 2O66A 2V4JA 1GMUA 3V4IA 1FRIA 4ID5B 2J9DA 1S6QA 3H0PA 4QYZJ 2HHUA 2MXYA 3EZUA 4YFUA 4U9RA 3TAPA 1RT7B 4AQYF 1BD6A 1UETA 3WDOA 3AQPA 4H4MB 1E6VA 2ZDOA 2LXIA 3FVYA 4CNZA 4I2PB 4Y3CA 4ZVUB 5K8MA 1PKUA 3F44A 4AT1B 1UVLA 1HBMA 5L38A 3TX0A 4ZVTB 2ZD1B 1P9QC 2Q43A 2UVUA 4RNFA 1OPZA 3H90A 2I5JA 2BRKA 4RW4A 2GHPA 5F9LA 2I6WA 4A48A 2AQ4A 1VQ4S 1Y5NB 1CLFA 2GMLA 4F3OA 1JJ2R 2E1RA 1A0OB 4KGVB 4F4XA 3SBMA 2HWHA 2ACYA 3QJLA 3FFIA 4Q5VA 5IFMA 3CCRS 3BB5A 2BE9B 4KGMA 1LXJA 4BC9A 3DM2B 3DRSA 3F73A 1IWGA 4ZPAA 4Q0BB 4DFKA 1YZ7A 3C15A 3EWGA 2WOMB 2ZVSA 4QR1A 2KVIA 3J81j 3BYRA 3JYTA 2HKEA 5BYQA 3MCSA 2VUGA 1FE0A 1YJ9S 3I0RA 2KJVA 3W5YA 2HLTA 3O5TB 1S7HA 4M5DA 2CJXB 2OEJA 2YKMB 2VIHA 3M8YA 4CLFA 3P96A 4AUKA 1FE4A 1H72C 3K7RA 5D0RA 3RBEA 1N5YB 4WFAQ 2UP1A 3K0JA 3DLKA 5K20B 2IJFA 5F9NA 1BQMB 3C46A 3CTRA 3UDVA 2CJBA 4NRTA 4F67A 3BH6B 2EW9A 3X1LB 4JV1A 3MM5A 2Y1RI 2D74B 5D3GA 2CNLB 1FNXH 2CIMA 3NP5A 5KFDA 1RACB 1S6PA 2NUHA 4UT4A 3OFFA 4NI2A 1RA6A 1LEOA 4QPTA 3R2CJ 4HHUA 3UCGA 2NZ4A 1GQEA 4AXIA 5KFAA 3MTKA 5EWGA 1VJQA 4LRCA 3DRPB 4DPYA 4F26A 4JV2A 2FLOA 3CUNA 4F25A 2MKCA 2H3EB 3JSMB 1IKYB 2Q79A 1MMLA 2MGZB 4V19J 4K2XA 4YHHF 4WFYA 1C4CA 4MKBA 1PJ6A 3PIOQ 4WJBA 1VS3A 3IBFB 3PYFA 4ED2A 5B7WA 1YTYA 3FDSA 2VG5B 2FVSA 3T5LA 4FNIA 4ZDNA 2DGSA 1ZS6A 2B3TB 4AXJA 4PWWA 1T3OA 2AEMA 3CDUA 4FS1A 4DBQA 3UN3A 5HVHA 3QIPA 3MEEB 1RGVA 4IQXA 1MU2A 1B4SA 5HLFA 2DNQA 3DLHA 1LK5A 4WU3A 1IBMF 4DLGA 5FD1A 1RKIA 2YX4A 1VFJA 5J1PA 2DNZA 4O3RA 4J37A 2X1AA 5KOWA 3JQKA 1RT3B 4H4KC 2BKNA 4DR3J 1RWOB 3IGVA 2MPUA 1HYSA 3CCSS 4DPXA 3LP2B 3BQ0A 4B9MA 4C3MA 3H2LA 4JV5F 2KRBA 1APSA 4DV1F 3K17A 4K4XA 2CDRB 3DOLB 3MMAA 1HQEB 4IO1A 3IWNC 4EZ6A 2RH3A 3HKWA 1NPPA 2DGVA 5CABA 2JLEA 1WG1A 3R2DJ 1ZTWA 2ZBCA 4N56A 3CJ8A 3UNYA 3RR8A 9RUBA 2FYXA 3LH2S 1CEZA 2MQMA 4U8VA 1FXDA 4UZBA 1DJ0A 4OZJA 1OY8A 4TXSA 2DO4A 1OJ4A 4A8MP 2UUBF 4OYIA 3HXMA 4LSZB 2IC3A 1JNZB 3UVJA 4DL4A 2VKRA 3M2RB 2OPQB 1NK7A 2ZFHA 2DHXA 4ZOSA 3S1TA 2CQ3A 4PG5A 4B3TJ 3KOAA 2OUGA 2FVPA 1TKZB 4K4SA 2J76E 2BJEA 2F4FA 1EZZB 3N6MA 1FXLA 1VISA 1ZPWX 2ZKTA 2JC1A 3H40A 1ZA1B 2QA4S 1C0UB 5HVFA 5KFJA 3CJSA 1H98A 2JLGA 2W24A 1WWHA 2FHOB 4CTAB 3QATA 1RTIB 4M5KA 3ILLA 3SV4A 2RQKA 4TLRA 4RKUC 1P8GA 5E33A 2IRUA 4ZJQA 3UN2A 2RS8A 4OLPA 1S1TB 2COLA 3NGSA 1YQHA 1FKAF 5B0FA 1VQ9S 3G8QA 3WHIA 1EX8A 3JB9k 2ZBPA 3P45B 1NSQA 1RK8A 3OTDA 1X7VA 1RB0A 2VH7A 4P7TA 2DT9A 2IVMA 3MPWA 4ES2A 4K2JA 1Q5YA 1W2IA 1CULA 5FJ4A 2RSQA 4K4YA 4FBTA 2R3VA 1UVIA 1NSAA 1KOHA 1YVFA 4JV5J 1DQ8A 3GSIA 4S0MA 5T7LB 3LP1B 3NNCA 4YMEA 5EWFA 2RDDA 2D7SA 2JEGA 4ICLA 3KWMA 2VZ9A 1X9SA 3PO5A 4HTJA 1RT7A 1BWEA 3D0HE 4H4MA 5CYQB 2WVBA 2W9CB 2HQGA 2ZITA 3R3TA 5DS7A 2ATCB 1JJ4A 3OTBA 4N8OA 3PKYA 1HWIA 3SXLA 4DSLA 4ZHRA 3BPSP 4JYAJ 1HD0A 2RIJA 2PMHA 4QOTA 4DDFA 3Q89A 3M9OB 3C16B 3MM7A 3MDFA 1IR2A 3BKUA 2EI5A 3I6PA 4NXNF 3W63A 2ZBIA 2F5GA 2HHHJ 4IH6A 3TJAA 3D1HA 1L3UA 4P71A 5KFNA 2X3DA 4OZ5A 1RT4A 3BREA 2FLNA 1TL3B 2J6SA 4DV6F 4RW9B 1VJWA 1FRLA 3LW5C 4NZ6A 4ANCA 2ASDA 2PSZA 1X5PA 5F3TA 1BWVA 4DR6J 3MXHP 4LR9A 3PHTA 1N88A 1SCJB 3H42A 1SQFA 2WAQD 1IKXA 1LWCB 1EQ0A 1TL4A 4DU7A 1IKWB 2LEAA 5AXLA 1SJQA 2DH9A 3HD1A 4YB5A 1XMQJ 3PR5B 3PX0A 3TUPA 3GJQB 3BO4A 2EXUA 2YKMA 5E3PA 2J8SA 2FZCB 1HW9A 1D3WA 4L74A 4QR2A 1SC6A 2HW3A 2EPIA 1KNZA 2XM3A 3DHXA 2P6TA 1BQMA 3FQKA 4KV8B 1WC4A 1A9NB 1XBWA 1RHUB 2AWZA 1SL0A 1FJGJ 2AX1A 2O67A 2KM8C 1IJFB 4RW7A 3MCOA 4ZP7A 2ZHBA 2ZUAA 3CVKA 5L1KA 4DQIA 2LU1A 3QAEA 1URRA 4KKOB 4CO3A 4DSIA 1YX2A 1TK5A 3GR1A 5HVGA 2E5IA 3UQSA 1OYEA 1IKYA 3QAUA 4B9LA 1Q1KA 4ZP9A 1UTAA 4OZ1A 5KFYA 2IAJB 4F0MA 1Q8BA 4DN9A 3CMQA 2E5JA 2VG5A 2PFDA 1HWUA 4NXNJ 1WSRA 2KI2A 5EX3A 3K5LA 1MMNA 2GIQA 3W9JA 3NOGA 2GCFA 3PVXA 1SV5A 1WG4A 3NG8A 3RTVA 4ZPVR 2LP4A 4CO4A 4GKJJ 2IMOA 3MEEA 3UD3P 1FI4A 3E3XA 4USKA 2F1FA 1R89A 2R4FA 1VYAA 4BHQA 4IOBA 2M4MA 3EDRB 2CPJA 4UOCA 2Z2ZA 3OTOJ 3RZAA 3MFIA 2HYIB 1JB0C 1T7PA 2APOA 3GPAA 5J1NA 1L5UA 1AB8A 3GV8B 5KT6A 3LP2A 2BQRA 2BXJA 1Q86T 3NGDA 4YB7A 3DOLA 3GR0A 4Q8EA 2AIRB 2VPZB 1F5CA 1HQEA 4M5IA 1XTZA 3DLJA 4U8YA 3HVRA 5J2MB 2RU9A 2BR0A 1QDUB 1WACA 4A8FA 1IBLF 2HAFA 1GFWB 5J2NB 2DNYA 4YP3A 1RT2B 4HACA 1N0UA 3PW5A 4R0EA 3VWSA 2HRYA 2AF6A 3DLLQ 1LWFB 4RO0A 1VBXA 1NEEA 1TMMA 2RT3A 1UJ6A 1N56A 3AXKA 1KONA 1J5EF 1SH3A 2WW4A 1F5BA 3RYLA 4F4ZA 1UPPA 3SFGA 3RR7A 2FHKA 3TR5A 4E2FB 2B51A 1RDRA 4ECSA 3FEYB 5KG6A 1QAJA 2RDJA 1F5AA 2HIYA 1TKZA 2HHXA 2R7UA 2RB7A 4Z37A 1UW4A 2R7OA 1EIYB 5KFFA 3UO0A 3KK3B 4U7UK 4XPCA 3KJQB 3UW1A 5CD4A 2KO1A 3TVKA 2MSTA 1R8AA 1R6VA 1RTIA 1NRKA 5ETVA 2CXEA 4LFAF 1EKSA 5LMNJ 5F41A 1VC0A 4RU9A 2YX7A 3ISND 3POTB 4B9NA 4PXEA 4EBEA 3FBFA 5HP1B 1V5IB 3QGGA 5HQ8A 3DKDA 3KJFB 3U7JA 2HNYB 2J7WA 2FLPA 4N76A 2FJWA 3CCWA 4IQMA 2VBWA 5HJXA 2J6UA 2X1GA 3L9ZA 1N54B 2GS8A 5C25B 2YKAA 4PXCA 9ATCB 2U1AA 3NMRA 4LF6F 4USUA 4JI4J 3R6GB 5GAHU 4R8UB 1FHTA 3CDAA 4Y2KA 1NHKL 5EWEA 2KVQE 2QLBB 4HYKA 4MIBA 4DR2F 4K0KF 3KLVA 2DVIA 5T7LA 2GVZB 4WF9Q 1KSPA 3BYPA 3C6TA 3GFXA 3ZTPA 3M7VA 1YRXA 4KHPF 2VPXB 2QL7B 1TKXB 2RF2B 2EFVA 2GV1A 5M2PA 4LT6A 1RBLA 1MLAA 2B6AA 8ATCB 4NZ7A 2IA6A 3H20A 2YWHA 1XQIA 1YJVA 1FKPB 1G6BA 3VQTA 4USJC 3OFEA 4DQQA 3KMSA 2W9CA 3HFVA 1D9DA 3PHEA 3OFHA 2EC0A 4NEZA 1RKJA 1EP4A 1CSJA 5KG5A 3ZTQA 5H9FK 1IUJA 3CEDA 4CO5A 3PYDA 4I6AA 1ZM4A 3CDWA 1UPMB 2XHWA 1O51A 3RB4A 2JHEA 5HQMA 3ZZ0A 1SUQB 1NSPA 1TL3A 4ZPDA 5BYRA 1U47A 3QFHA 1HBOB 3DRYA 2OD6A 3F41A 2OPSA 2LQ8A 2KZZA 5KFSA 3KLGB 3AOAA 5B0AA 1B7YB 2W7AA 2JL9A 1U1QA 2BE7D 5KFTA 1IKVB 3KXDA 1FWLA 4CLZA 2YQ0A 4P2FA 2W2MP 3X3UA 1PC5A 3UR0A 2G2OA 2AP6A 1M1HA 1H74A 5L46A 2W9BB 2VQFF 4LF7J 1S79A 1R6YA 1XN9A 5AE1A 4J5OA 1UEVA 2YNHB 3BO3A 5KT5A 3NMAA 5KT3A 1NHVA 4OHXA 3OUYA 2OEMA 4O3NA 1X4GA 1M5HA 3O1LA 4LF6J 2ALYB 5IT9U 4J9SA 4KV8A 3S01A 3J81U 2MKKA 1KD1T 1B0PA 1CPZA 4DR2J 4K0KJ 3VZHA 3QRQA 1WI6A 1I1GA 1VQ6S 2W1BA 1WHYA 3P5BP 4F50A 1CJTB 4NA2A 1U48A 1XNQJ 4LF8J 2LDIA 2G13A 3J7A1 3K58A 2CG4A 3L7OA 4BLGA 1FRXA 4I2QB 3W66A 3MR3A 1S0OA 1WORA 1L3SA 1MN7A 2MYFA 4KQZA 4QIWD 3J7AN 1KFDA 5GAEU 2NSBA 2YQ3A 2DRBA 4IDKA 4P52A 4IKAA 4ALZA 1T9YA 2MZRA 1KKHA 3EGVA 1FCAA 4F3MA 2HBZB 3W8PA 2Z2YB 4AL6A 2CNOB 1KWMA 1T11A 1Q78A 3TA1A 3KHHA 1TL1B 3R5CA 2ZH4A 4IR9A 2FVCA 3MGJA 3EM1A 1FRKA 5DM6Q 1FRHA 4LRBA 4JI0J 1R8HA 1NDKA 1YJTA 3I5BA 1JLGB 1G1XA 2FJBB 5DQGA 3Q8UA 2W8KA 2Y9HA 3CNQP 2VFUA
chains in the Genus database with same CATH topology
3IA0A 2HHVA 4RBTA 1L3VA 1FKOA 2V9KA 3CIMA 5KG2A 1S72S 2VA2A 1O0PA 2MKSA 3IR5B 2Z0GA 2HRUA 1EETA 3DYAA 2UV8G 3BSOA 3LF0A 3GV7B 1U6BA 1ZM3A 2KFNA 3DCAA 2KXFA 4B3TF 1QVFR 1UJ4A 3E01B 4HVZA 3AH6A 2JFKA 2IRXA 1U2RA 3DFEA 1S1XB 2M0GB 1S6PB 4PCQA 2FB0A 1FDNA 2G9OA 2HWTA 2WBMA 5HL7Q 2WSEC 4ZP8A 3SEOA 4OX6A 3EUNA 5CYMB 1KS2A 2B5JA 3DI6A 4RW6A 3K2YA 2DIUA 1ROFA 4X4RA 1S99A 1TQLA 3K57A 2LEBA 1QSSA 2I38A 1HBNA 4X4TA 4P2SA 4QWAA 2FPHX 2K8GA 1FKOB 1LK7A 3HO1A 4CH7A 3G6YA 3T5KA 2BQ3A 4DL2A 1EETB 3DYAB 2XULA 2EK1A 2VC0A 1ZOTA 4IRCA 2DITA 5DQHA 2AGPA 4Y2CA 4OLOA 5F8GA 3CCUS 3CJ3A 3ONQA 4XDCA 3J7YU 1HARA 2HHPA 3Q8QB 3B8HA 4C98A 2B5JB 1B0TA 4U7CA 4X65F 1X4HA 1DZ5A 1NAQA 3DI6B 4RW6B 1A7GE 4B08A 4CIOA 2IYIA 1V6HA 2BVZA 4B3MF 4LFBF 3N9UC 3M6XA 2VASA 3KHGA 2B4VA 1Y5IB 3GIMA 4ZPWR 1CC8A 1LWEA 4B3OA 1LKZA 1SI9A 1T05A 2LYVA 1U8SA 3M2UA 4FF2A 4ECVA 1M1KT 3RRGA 4FNHA 3GFHA 5KFCA 5KT4A 3OR1A 4E98A 1FDBA 3WC0A 3R1HA 4PKDB 5J2QA 2B7CB 2E7WA 1R8BA 2CQCA 2XY7A 2XMMA 3OTEA 3NNAA 2CPFA 3GILA 4ELVA 4UQTA 2CPYA 4O4GA 4RWXA 4AYBD 2PIIA 5K5MA 1IR0A 4IRDA 4MKAA 3OFGA 1QSLA 2D41A 1SB6A 2J7UA 1TV6B 4C8OA 5D4PA 5HMYA 1C1CA 1LWEB 4B3OB 3M2UB 5D77A 1T05B 1KQFB 3TP2A 3CD5A 1TL5A 3MR2A 1FDDA 1H2UX 3OR1B 2AGQA 2W4CA 3MFHA 4JI7F 5KFHA 5KG7A 1X4EA 4FYDA 5J2QB 2RS2A 4I0WA 1ZPVA 3R27A 2MZSA 3WC2A 2IHR1 2W9AA 4Y2AA 2R2SA 3BN7A 1W2BR 2B43A 3M4XA 4LJMA 5LSRA 3OXLA 2UV8A 3NCPA 4MJKA 2DNNA 4P7VA 4UQGA 2FLLA 3PX4A 3TAMA 2JEFA 1YIJS 3RAXA 3SSSA 5DDRC 5B0EA 3PV8A 1FVQA 4O4GB 2GJIA 1D0EA 2ZH5A 3QIPB 2YWKA 4OZLA 1KTQA 3BDEA 5KFVA 1S1WA 4C0BA 1TK8A 4OHYA 1MU2B 1JLEA 4YB6A 1YRTA 4EUVA 4DS4A 2BDPA 2E5HA 3ZZYA 2GHWA 4ZMMA 1OPIA 3NL0A 3PJWA 5BYSA 2DHSA 2UVVA 3DHWC 1PO6A 1S1UA 4ECTA 1E6YB 1N5VA 3QZ8A 2EBEA 2CQBA 3SSQA 3G96A 1U45A 3C6UB 3KHRA 5H9FJ 3OL8A 5KFXA 3TAMB 4WFBQ 2CPZA 4QIFA 4OZ0A 4MK7A 2CQPA 1R27B 2X51A