1BQMB

Hiv-1 rt/hby 097
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
430
structure length
430
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords REVERSE TRANSCRIPTASE
total genus 82
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqmB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmB03
1S6QA 1UWBA 4M94A 3HVAA 4YR2A 3BSCA 1S9EA 2IC3B 4WZMA 1S1XB 3BSOA 5KG2A 1REVB 4H54A 2J6SA 4ECUA 1ZETA 4KKOA 4ECTA 1N5YA 5HLFB 3E01B 2D3UA 1EETA 2V9WA 4I2QA 3TAMA 1RA7A 4O4GB 1RT5A 3H98A 4NLDA 3T5JA 5J1EB 3BGRA 1NNDA 1QUVA 5J1EA 5L1LA 3GV8B 4IRDA 3GQCA 3DRSA 2BANA 2YKNA 2HWIA 2WTFA 3DYAB 1C2PA 4G1QB 3MFHA 3RB3A 3I0RA 4H4MA 3KLHA 2JLEA 4DL5A 2VA2A 1RTHB 1SUQB 3LAMA 5I3UB 1LW0A 4ZVEA 2WONA 3H5XA 2IM0A 4YR0A 1QAJA 2ZKUA 5DQHA 2IM1A 1C0UB 1C0TA 1QE1A 2BQRA 4IG0A 4FBUA 1U09A 2AGOA 2IJNA 3IGVA 4O3OA 2XC9A 3MR3A 5KT5A 5C42B 3NKYA 1HNIB 3FSIA 3UQSA 2AGQA 2HNZA 5HP1B 4Y3CA 4WE1B 2D41A 5F9NA 5KFAA 4TXSA 4EO6A 3RB6A 4ZPDA 3LP0A 1IKWA 4PQUB 3PW5A 4IQXA 2IM3A 3QLHB 5EWGA 4I2PB 3H5SA 3DOLA 2FVPA 5KG0A 2YKNB 4NLOA 3PZPA 5L1JA 1LWFA 1TV6B 2UUTA 1LW0B 4QWAA 3KLIA 1RTHA 5I3UA 1OS5A 5KFGA 4LSLA 1TVRB 4LSLB 4IFVB 1RT6A 4NLTA 4F4YA 3QYYA 1SV5B 1JLBA 2VG5B 1SH3A 1UWBB 3EZUA 3KHLA 4GC6A 5C42A 2FVQA 4DL4A 4KB7A 4DL7A 2DPJA 5T14A 4NLVA 4ID5B 5FDLB 1IKVA 1REVA 4IH6A 1JLQA 5KFYA 1QAIA 1S4FA 5CYQB 3H5UA 1S0NA 3T5KA 4IDKB 1J5OB 4PWDA 2IA6A 3OL9A 3QGGA 1RT1B 3UR0A 5KFPA 2FJVA 2W8LA 4U6PA 1JLGA 3MR2A 5DLGA 3MEEB 3KK2A 3QGIA 4B3OB 2BQUA 5F8GA 2HMIB 4TY9A 1S1TA 1KLMA 3E51A 1TVRA 2WRMA 5KFHA 1HARA 5F8HA 5KFWA 1SH2A 1TL1A 4Q0BA 1C1BA 4KAIA 3QZ7A 1LWEB 2YNIA 5KFKA 3ITHB 2B43A 4MKBA 4IH5A 2V4RA 3UDLA 4MFBB 1CSJA 4ECXA 2YNGA 4URSA 3NMAA 2AWZA 3JYTB 3LP0B 4Q8EA 4QW8A 3N6MA 1N48A 4K4SA 4QWDA 4ZP9A 2IBKA 2OPPB 1HPZB 4DG1A 1FK9A 1IKXA 1TL3A 2V0NA 3H59A 4IH7A 3N6LA 1IKXB 1TL3B 3OLAA 1T03A 2W9CA 2ALZA 3I5BA 4TQSA 5KFCA 2R8GA 1KHVA 1DTQA 2FJWA 3CO9A 4ED8A 3QO9A 4JV0A 4K4XA 4RUCA 1RT3A 1TP7A 5KT7A 4EBEA 4RW4A 4JUZA 4KSEB 4K4TA 3CDUA 3I0SA 2JEJA 2ZD1B 5C5JA 2YKMB 3CJ2A 3NL0A 3FFIA 3G6VA 3DRRA 4X2BA 5CYMA 4LQ3A 3ITHA 2FJXA 3UPFA 4NCGA 4Y2CA 5J2NB 5C25B 3BSNA 4KV8B 5C24B 4URQU 2XWYA 3OLBA 3RAQA 4F4WA 1RYRA 3C6TA 1N5YB 4NLYA 3JSMA 1JIHA 4RNHA 2OPRA 1C1CA 1HQUB 4EBDA 5D3GB 4FS2A 4RW7B 2R2SA 2JEFA 1DTTB 3IG1B 3KK2B 1S1UB 2VG7A 5J2MB 1TQLA 4H4OB 4MK7A 3OHBA 2YNHB 2WB4A 3KNAA 1EP4A 4J9QA 3IRXB 3KK3B 2W7PA 1T3NA 5EDWA 2I5JB 4J9NA 4ID5A 3PW7A 1LWEA 5K14B 5J2NA 4YP3A 3T5HA 4NLQA 1K1QA 3E01A 4K4WA 3DLGA 4NLXA 4KKOB 1HYSB 2JC1A 3JSMB 3MTKA 5KFZA 5KFMA 1HYSA 1RT7B 1IKYB 1ZTWA 3DRSB 4O3NA 4OL8A 3OSPA 3T19A 4KFBB 4ZP6A 1T94A 3HVTA 3KLFA 1DTQB 3CWJA 4TLRA 1VRTA 1JLAB 3RB0A 3C6UA 4IFYB 5KFXA 5HROB 1FKPB 4RW6A 1S6PA 3V81B 2WCXA 2XI3A 1SH0A 3CJ5A 2R8KA 4RW4B 4J9MA 2HAIA 5KFOA 4WFYA 1N4LA 3KHHA 1N6QA 3OHAA 4ZPCA 4MFBA 4I7FB 3MR6A 2R8JA 5KFFA 3Q8RB 1LWCA 4LQ9A 3M8PA 5JXSA 2OPRB 4MK9A 4FS1A 4O3PA 2CJQA 4NLGA 3C6TB 3GV7B 1RT2A 1NHUA 2W7OA 5J2QB 5EWFA 4O4RA 4G3IA 2BE2B 4R5PA 3LALA 3DRPA 5DQGA 5DQIA 4GC7A 1KHWA 3I0RB 4H4MB 1S48A 4K4YA 4ZPBA 4ED6A 4KFBA 3DI6A 3BQ2A 2AGPA 4YMEA 4B3OA 1RTIB 1VRUA 2B5JB 3G86A 3M8QB 3N6NA 2B6AB 2O5DA 4ZPAA 3I0SB 1R0AA 4TYBA 1EP4B 3FRZA 1GX5A 4O44B 4RUAA 3IRXA 3KK3A 3QIDA 2RF2B 5HBMB 3KK1A 2BQ3A 3KLGA 3IS9B 4TN2A 1S9FA 2FLNA 2JC0A 1WNEA 5FDLA 1MU2B 1MU2A 1HQEA 3HHKA 3DLKB 5CYQA 3OSNA 3KLEA 4PWDB 1HQUA 1NHVA 4WFZA 4RNFA 5DG9A 2FLLA 3CJ4A 3V6DA 5KFRA 2VG6A 2QE5A 4J9LA 4ECVA 1FKOB 4Q43A 4G1QA 1T05B 2C2RA 2FVRA 2BANB 1VRTB 3PW0A 3HVTB 4IFYA 3KLFB 4Y34A 3DI6B 2B5JA 1JLFB 1JLAA 1TKZB 1RTIA 3HKWA 4ICLB 3MEGB 4IFVA 3LP1A 4F4XA 4TY8A 4EYHB 4IRKA 1RT6B 2ASJA 3MFIA 1BQMB 5KFEA 1RDRA 3BR9A 2UVRA 4WXWA 2WOMA 2HNDB 3KJVB 3QIPB 5KFLA 4QWBA 1S6QB 2UVWA 4I7FA 3EPIA 5K14A 3LAKA 1N6QB 3GV5B 3MECA 4XPCA 4WYLA 1JXLA 2IAJB 1IKWB 4PQUA 4PUOA 1K1SA 4QPXA 2WHOA 4IDKA 2XCPA 3D28A 5KG6A 3M9MB 4ECRA 3V4IB 3DLEB 4KBIA 1RTDA 1HMVB 2RKIB 4IOBA 1IM4A 4RNNA 3FQLA 1SUQA 5KFDA 3GIMA 2W8KA 3KLHB 5KFUA 1S6PB 4RW6B 4RW8A 5J2MA 3V6HA 3C6UB 3TQ1A 5L9XA 4QWEA 4WXOA 1DLOA 5F8IA 1HNVB 3VQSA 4NLRA 1TL1B 3NBPA 2ILYA 1R0AB 5HBMA 5KT3A 2R2TA 1BQMA 4Q0BB 3GIKA 4O44A 2C28A 1RA6A 5KG7A 3GIJA 2IJFA 4KV8A 2HNYA 5C24A 4MIAA 2BR0A 1S0MA 4NCGB 2HNYB 3PR4A 3DMJA 3QZ8A 3PHEA 2C2EA 1LW2B 3RBDA 5HLFA 1N56A 4RZRA 2C22A 2XI2A 4KHMA 3H4BA 1RT2B 2E9TA 3GYNA 3KMSA 5J2PB 3RBEA 3V4IA 3Q8QB 4O3SA 5J2PA 5KFTA 4J9OA 4U7CA 1RYSA 4HKQA 3QO9B 3H4DA 2F8EX 4H4OA 2W9BB 3PVXA 3OL8A 5HROA 3NGDA 1RTJA 4RW9B 1QE1B 3ICLA 4DL2A 4FBTA 3PW4A 2UVUA 1YVFA 2WOMB 3MR5A 4NLWA 1Z4UA 2HNDA 3KJVA 4DL3A 5KG3A 2AX0A 3MECB 2BRKA 5C25A 2FLPA 1LW2A 1D1UA 4ED2A 4K4ZA 3SI8A 1EETB 3BGRB 1RT7A 4WFXA 3PJWA 2BE2A 4O4GA 4ZVFA 2VG6B 3OL7A 5J2QA 1T05A 1TKXB 4R5PB 1HMVA 2RKIA 4Q8FA 1JLCB 2OPQB 3MF5A 3MEEA 2HMIA 2YNHA 2W9AA 4ECSA 4RW8B 1DLOB 4EEYA 4YQWA 3CDWA 3Q8SB 2W9BA 2J6TA 1S1WB 4ZHRA 1S1WA 4NZ0A 3NAIA 1C0TB 1C0UA 3M9OB 2I5JA 4ZVHA 3LP2B 3KLGB 3D5MA 3LP2A 2E9ZA 4MKAA 3T1AA 3KK1B 3CVKA 1IKVB 4URGA 5EWEA 1JKHB 4EYIB 1XR7A 2E9RX 3DMJB 4J9KA 3EPGA 5DGAA 1S1VA 3V6JA 3MEDA 2WK4A 4KHRA 2YNFB 2OH2A 4XO0A 4I2QB 3TAMB 3PJXA 1C1CB 2UUWA 4K4UA 3H5YA 5D3GA 2ATLA 3NAHA 3DRPB 1TKTA 4TYAA 4WYWA 3QGHA 4ZMMA 4J9PA 1TKTB 3DYAA 3DOKB 1S1TB 3BREA 4Q44A 3KLIB 3SFGA 4ZVGA 1S10A 1JX4A 3KLVA 2R8IA 1JLFA 3LP1B 1RTJB 4RW9A 4IG3B 1RAJA 4Q45A 2GIQA 5KFJA 5F8MA 4NLUA 5KG5A 2ILZA 4ECQA 2IC3A 1BQNB 3GILA 1HNIA 4MK8A 2AU0A 5L1KA 1HQEB 3JYTA 5KT6A 4F4ZA 3BJYA 1RT4B 2FVCA 2IAJA 1FK9B 3RAXA 3PR5B 4DEZA 1IKYA 3V6KA 4IR1A 1TKXA 4NRUA 4JV1A 1XR6A 3LANA 2CKWA 4KO0A 1XR5A 2I1RA 4KO0B 1LWFB 1TV6A 2RDIA 1GX6A 4EBCA 3MEGA 4O3QA 1TKZA 2ASDA 3NBPB 2JEIA 5I42A 1JLEB 1HNVA 4HYKA 3CJ3A 3KMQA 5I42B 1S9GB 4WZQA 3FFIB 1C1BB 2ZD1A 2RDJA 2ZE2B 1JKHA 1MMLA 2XGPA 3GIIA 5KG1A 2XCAA 4ED1A 1S9EB 4ZP8A 3KHRA 1BQNA 4O3RA 4WE1A 2HNZB 2J6UA 4PUOB 1JLQB 4DL6A 3KLEB 3G6XA 1RT4A 3ISND 1RT1A 5F8JA 3DM2B 4R8UA 2OPPA 3KHGA 1J5OA 3IGNA 4RW7A 3IN5A 4Y2AA 5F8NA 5KG4A 3Q8PB 3T5LA 1HPZA 4DG1B 2R8HA 3ISNC 3SFUA 1JLCA 2OPQA 4IR9A 3DOKA 2R2RA 2WONB 5KFNA 2B6AA 1VRUB 3CDEA 4IG3A 4RU9A 4ICLA 4TQRA 5DG7A 4TY8B 1S9GA 2QV6A 4IKAA 2VG5A 2YKMA 4YR3A 3PW2A 4K50A 4NLPA 5CYMB 3TVKA 4RNOA 3OL6A 3BQ0A 4ECWA 1S1XA 2AX1A 3RB4A 2OPSA 5KFBA 5KT4A 3M8PB 5DLFA 2JEGA 2XGQA 4ED7A 5HP1A 2UVVA 4MH8A 3MEDB 3DLKA 3DM2A 4R8UB 2EC0A 3QLHA 4NRTA 4QWCA 2DPIA 1FKOA 2D7SA 3V6DB 1S1UA 2VG7B 3H2LA 3DLEA 2R2UA 1ZTTA 1DTTA 3IG1A 4M95A 3G6YA 1RTDB 2BRLA 4KE5A 2ASLA 2AQ4A 2FVSA 3DDKA 4LSNA 1W25A 4ECZA 1FKPA 3V81A 3M8QA 2IM2A 3FDSA 4XPEA 4IRCA 4F50A 1JLEA 3BSAA 1JLBB 4IG0B 2YNIB 2RF2A 5F8LA 3M9NB 3DRRB 3QIPA 2ZE2A 3HVWA 2V4QA 2GC8A 3CIZA 5DG8A 1S0OA 5KFVA 2OPSB 2YNGB 3FQKA 3DLGB 5KT2A 1LWCB 5L1IA 3CJ0A 4JV2A 1S1VB 1I6JA 3H40A 3DOLB 2YNFA 1RT5B 5EUHA 2VA3A 4K4VA 4I2PA 2HWHA 4ECYA 2IMWP 1T03B 5KFQA 1JLGB 2D3ZA 2W9CB 1S97A 4MIBA 5DGBA 3I5AA 4NLSA 4EO8A 1KLMB 1S49A 3BQ1A 4J9RA 4ZP7A 2GIRA 4RNMA 5JUMA 4LSNB 2C2DA 1RT3B 4R0EA 1D0EA 4QW9A 3KOAA 4NYZA 5KFIA 3I5CA 4ZHRB 5KFSA 4J9SA 4ED3A 4ED0A 1SV5A 3IS9A 5F9LA
chains in the Genus database with same CATH superfamily
2KXFA 3M2VB 3BSCA 1ELOA 5DS7A 4WZMA 2DGXA 4P9SA 4CLPA 5KG2A 1REVB 2HBYB 3NCQA 1WDTA 3FBBA 4C3KA 5HLFB 4C11A 2D3UA 3OXLA 2VU5A 4LVOP 1U1MA 1IVZA 2WVBA 2ZBQA 1R0BG 1RT5A 3HHLA 3EJMA 3BGRA 2X51A 3MMAA 2J0WA 2BANA 2AYMA 3PJ9A 1Q16B 3DYAB 1C2PA 1HHQA 1PCAA 1T95A 4H4MA 2ASYA 3KLHA 2JLEA 1Z2ZA 1YLXA 2HURA 5I3UB 1SUQB 3KKFA 4L72B 1E6YA 4NEZA 4OMFG 4ZPVR 4ZVSB 4F2RA 1NXIA 3E3XA 3H5XA 2IM0A 5A76A 4YR0A 1F2HA 2FZCB 4EFAC 5IT4A 2XM3A 4DX5A 4PXBA 3GZ7A 5A2QY 3N9UC 2KFZA 2P9EA 4JI5F 1XEZA 3BDEA 1TUGB 3FSIA 3HDSA 1E6VB 4P2MA 2AGQA 2F1FA 1WHWA 4Y3CA 2HVIA 4EO6A 3RB6A 3PW5A 1IKWA 1HWJA 2HQIA 2GHPA 3DFEA 3DRXA 4X4TA 1IBLF 5EWGA 2CQ2A 3ILJA 2WSEC 5JMNA 1KWMA 2XQCA 3TEHB 4NLOA 2R8JA 1LWFA 5EN1A 4QWAA 3KLIA 5I3UA 1OS5A 3FSXA 4ZOSA 5KFGA 5LT5A 1A0OB 4WU2A 2D9PA 5E41A 4NI2A 5GAHI 2RU3A 4NLTA 2G1HA 2BW7A 4DLEA 4F4YA 1D09B 3CCTA 2KN4A 1H74A 3DGPA 1JLBA 4PZVA 1UVMA 1SH3A 2FHKA 3EZUA 5E3AA 5D15A 4B17A 5C42A 2XMJA 3KHLA 2MKKA 1S0VA 1PJ5A 2GQQA 1GK8A 3MAHA 1IKVA 2J9EA 1REVA 1WHXA 2JJ4D 4HDGA 4IH6A 5FLXY 3BO2A 5KFYA 4JI4J 5ETKA 4QYZJ 5DRKA 2UZAA 4L75A 4PRFA 2F4FA 2OSQA 2Q79A 5CYQB 1RWOB 3H5UA 1XERA 1J5OB 4PWDA 1U49A 3TUIC 3PKMA 1RWMB 1RT1B 3KUGA 4HLBA 5HJXA 3VF0B 2CPYA 1BE4A 3W5YA 4U6PA 1ICEB 3GSDA 2LXIA 4DHVA 2C42A 2N4CA 5DLGA 3KK2A 4M5GA 4B3OB 3OJUA 4JI8F 2BQUA 1I94F 1YSJA 3TNVA 5C2GA 1U25A 3MM7B 4ZVQB 3GJTB 1PKUA 2XLJA 1HARA 1CJTB 1N52B 1JNRB 3A4TA 2CNLB 2I8EA 2VKZG 4F3QA 3SV4A 2B9YA 5IXUA 2DNZA 4OI4A 1LWEB 2W01A 3ITHB 3A8IA 4M5KA 4MFBB 1CSJA 4KTQA 1Y9OA 4URSA 2ZUAA 4L3KA 5HN0A 2XO7A 4DQSA 2N3OA 4LRAA 4C11B 4N5SA 3MM6A 4QW8A 4FN5A 4K4SA 4WP3A 5ETQA 1MLAA 1TAQA 1VDHA 2NSBA 4QIFA 4QWDA 1UWAA 4EU0A 1GXLA 4DPUA 1HPZB 1RU2A 4FVMA 2UUAJ 1IKXA 3H59A 3M6WA 2NYIA 4FYXB 4Q7AA 1IKXB 2KFYA 1UJ4A 3EVMA 3T1YJ 2R8GA 3QFHA 5ITHA 1NLKL 3CO9A 5HQMA 3NS5A 2VZ9A 2XYPB 3PYFA 4RW4A 3GCXP 4KSEB 1RWVB 1U24A 2VPWB 4K4TA 1NH7A 4LUBA 4X4VA 2CZ4A 2AZ3A 4X2BA 3DRRA 3OTOF 5CYMA 1F3VA 2MEWA 3FSYA 3RRGA 3MMBB 3UPFA 1HW9A 2APOA 3MMBA 4Y2CA 3BSNA 3RAQA 1VIOA 3OUYB 3KXDA 4ZJQA 3QBCA 2FHJD 2YWFA 3ZFVA 3CCES 3ZZTA 1JIHA 4TNOA 1KOHA 1C1CA 2GVZA 2VFVA 4XDCA 2E7WA 4EBDA 1VQ7S 3M1VB 1S59A 4RW7B 4LF4F 1HKAA 1B70B 1DTTB 3IG1B 1XC9A 4UOHA 1B0TA 1S1UB 1SL0A 3ZNJ1 3AB2B 3P3DA 1KNZA 4WP9A 4MMOA 5D77A 2JVOA 2DRAA 2R7UA 2HAFA 3PX6A 3H0PA 3VZIA 2V8VA 3IRXB 3KK3B 1WKJA 2WVDA 3F56A 4M8LA 1T3NA 2GQ2A 2I5JB 5A0YB 2VJVA 1UZDA 3RW6A 3PW7A 4DF4A 5K14B 2LKZA 3TJAA 4DR5J 3T5HA 4NLQA 1K1QA 2L9NA 3R7BB 2R4FA 1NHKL 1TMMA 2ZBIA 4FNIA 4OYXA 4ETXA 3Q22A 4DUZJ 4CO2A 4TVAB 4KKOB 1VLOA 3NWRA 5G0RB 1RABB 1U0HB 4FDFA 5KFZA 4YB1P 1RT7B 3DRSB 1VJWA 2RDDA 3M8WA 5GADU 3OSPA 3T19A 3UCZP 1FX4A 3HJVA 2J76E 1YRXA 3MEKA 1JLAB 2KZZA 4IFYB 1V9OA 2DVIA 3V81B 1S6PA 2WCXA 3P45B 4FVCA 4LRBA 5I3PA 5AE2A 2DXEA 3TR5A 2LQ9A 3NXZA 3X1LB 2NXCA 2B3TB 2DNMA 3PV8A 1NB7A 2VPYB 2FD2A 2HQ3A 5CCLA 4X64J 2WW8A 3MMCB 4ALZA 2M4MA 3KHHA 2DISA 2QA1A 4ZPCA 4MFBA 2DH9A 2F4VJ 2DHSA 3HSGA 3K5PA 1LWCA 1UVNA 2PIIA 2OPRB 4MK9A 2Q6CA 4J7CA 2CVIA 3MPUB 1NHUA 3AJDA 2MQLA 3NCPA 2MQQA 2VFSA 4NXMF 5EWFA 4R5PA 4DFJA 2V69A 2DHHA 4OJHA 1DAXA 4GC7A 2UUAF 4USJC 2JSXA 1KHWA 3D1HA 4ZPBA 1XBWA 3GIRA 2N82B 3VAGA 3DI6A 3BQ2A 4QJVA 4B3OA 3U1LA 1KQGB 4X66J 4I6AA 1VRUA 2B5JB 3D9BA 3G86A 3MAAA 4ZA1A 4C8LA 4K2XA 2HHWA 5L1LA 3G8TA 1RTZA 4DR1F 5BR8F 3I0SB 1N36F 1XTZA 4QYRA 4W90B 1F5CA 4YEAA 4RUAA 5FLXU 2M8HA 1TMJA 1TZ0A 2RF2B 3AB4B 3M05A 3KK1A 3NS6A 5D4NA 3R97A 4DV3F 3K58A 4ILRA 2RHSB 3EZOA 2EFGA 4ZVOB 2BQ3A 1NJWA 2FLNA 2BZ2A 1UJ5A 3BYPA 5FDLA 1UFLA 1MU2B 4NX9A 2DNOA 1MU2A 3KYLA 3HHKA 3DLKB 4WK3A 3TZWA 2MJNA 4JI1F 3KLEA 4PWDB 2GVZB 1IBMJ 5FIIA 4AL5A 2MZRA 2IIHA 2BV3A 4F67A 3V6DA 5KFRA 1SI9A 2HIYA 1TL5A 1N32F 2VBXA 2GV1A 2FVRA 2K8GA 3D6HB 3VAIA 3PW0A 3HVTB 4IFYA 3KLFB 5LSLA 3EGVA 4A8MP 3MEGB 4F4XA 3UDEA 4RBTA 2ASJA 3I6PA 3EGWB 5KFEA 4R25A 2UVRA 4WIIA 4WXWA 1N5VA 3RRKA 2ZZMA 5KFLA 2IBOA 2KFNA 3CMQA 4I7FA 1UP1A 5K14A 3BDPA 1PAEX 3FCHA 4JI0J 3PYGA 2XWXA 3MECA 3GV5B 1F1BB 1HHSA 3DGVA 1U1KA 1FHTA 4PQUA 1K1SA 2GHWA 2BOAA 4V1Ak 2W7AA 3S7RA 2UXBF 1WEZA 3MCNA 2HLTA 5KG6A 2ADBA 2O01C 1TELA 2RKIB 3DDNA 4IOBA 1IM4A 4RNNA 2B4UA 1SUQA 5KFDA 3CCQS 2HHHJ 2OTLS 1S6PB 2V8GA 4A8QA 3TQ1A 2JFKA 5L9XA 2YQ1A 2G9OA 4WXOA 5F8IA 1HNVB 4DMZA 4EZ6A 4KJIA 3LTOA 5HBMA 2FGCA 2P8IA 3PACA 3QT8A 4O44A 4WKRA 3LPYA 3GIJA 3MM5A 4B9NA 1B7FA 4FYWB 3R2DJ 2B4PA 2MMYA 2QLWA 2HNYA 2VB6A 1HBOA 2FHJA 4DPTA 2HNYB 1B64A 3RBDA 2YWHA 3HHLB 2DITA 4ZN3A 1T7PA 4RZRA 2RHQB 2CQ4A 2DR6A 2K7KA 3I4HX 5HI7A 1RT2B 2Y9HA 3W3SA 1SL2A 3VGTA 1M5SA 3GYNA 3KMSA 2HSEB 3G96A 5J2PB 5J2PA 2VFTA 5KFTA 1RYSA 1NCLA 3BEGB 5F0UA 2XS7A 2PI5A 1Y3KA 3TZYA 3CULA 3OL8A 1ITPA 3GFHA 4AYBD 3ICLA 3THTA 4DZ6A 4FBTA 1AZSA 1FTCA 1GMWD 1RWNB 3F41A 4PWWA 2DO4A 2F5GA 2OMOA 3BZQA 4XAKA 2Z2LA 3F73A 1XNQF 2IY5B 1BMQB 4OIXA 3KJVA 4EI2A 3MCOA 1ZZNA 1KS2A 2B9EA 3MD3A 5HMXA 3DLHA 3C15B 3MECB 3TX8A 4CRJA 2J0XA 1QM9A 3LH2S 3QPIA 5B09A 2EEYA 1LW2A 3W62A 1Z2LA 1YBTA 3W2VA 1WG1A 2ZEJA 5E7OB 4EGLA 1KEKA 2KO1A 1W26A 3SI8A 3J7AN 4QOTA 4O4GA 2OJ3A 3JXOA 3OL7A 1VGYA 2HYIB 1HR0J 2FTRA 3NWGA 2RKIA 2VDIA 2ZUGA 3KG0A 2HVDA 4OI0A 2Z2ZA 3G82A 3L7PA 3MEEA 3T3FA 3CEDA 2H5EA 4FZVA 3W61A 3DXSX 2HMIA 1DQ9A 4ECSA 3FVYA 4RW8B 2GCFA 1YWXA 3CDWA 2BE9B 4Z7YA 1D8ZA 1S1WB 4ZHRA 4MKYA 3RBZA 4DF8A 4NZ0A 3OTOJ 2VONA 2FYXA 3M9OB 1VQ5S 1CJKA 3PCOB 2P9GA 4FPRA 3EZ5A 3KLGB 3D5MA 5HQ8A 4MKAA 3KK1B 2E9ZA 2E1PA 1IKVB 1YBAA 1YX2A 5EWEA 1FJEB 2J9DA 3HZGA 3IR6B 3N4WA 2C3OA 4J9KA 3EPGA 4DSLA 3V6JA 1UEVA 1WEXA 4KHRA 4DR7F 3OFHA 3SCLE 1ZS6A 2HK3A 3SSQA 4BCAA 5LSRA 4DS4A 1GAOA 1W2IA 2O3DA 2U2FA 5GAGI 4K4UA 5D3GA 2ATLA 5IQQA 2GAHC 1TKTA 4WYWA 3SQOP 3I55S 4J9PA 3CCJS 1TKTB 1S10A 2CQ0A 1L3SA 1JX4A 1P9QC 3SFGA 4ZVGA 1JJ4A 2R8IA 3W65A 3NOCA 3KG1A 2CDRB 4IG3B 2CQBA 3B82A 2JRSA 1RK8A 4Q45A 1TK8A 2XNRA 3AQOA 4DV4J 1PIEA 2OD6A 1K9MT 2IJRA 4I0WA 3CCLS 4DV7J 2W4CA 1X5TA 2IC3A 1NJXA 3E8OA 3M2VA 1BQNB 4NCBA 1VQ9S 4M1KA 2AU0A 1HQEB 2LU1A 4LT6A 4ELTA 4JYAF 1X4AA 3K2YA 5LMUF 3BJYA 2FVCA 4LFBF 4W4MA 2K2PA 3HHEA 4Y2MA 1NAQA 4PEOA 1VQLS 1SCJB 3C46A 4DEZA 1IKYA 2ZKTA 4ANDA 2V94A 3V6KA 3CC7S 1WI8A 3EE3A 1UTAA 4LF9J 4DSFA 4XK8C 2CQPA 1XR6A 2CNNB 4KO0A 1XR5A 3A3NB 5H9EK 1FNOA 4ANEA 4ENOA 3OXGA 3ZZUA 2RDIA 3D6FB 2ERRA 2UXBJ 3MD1A 2GFFA 2XULA 4DQIA 3JB9k 3NBPB 3D4JA 3MM9B 2JEIA 3QNWB 3KMQA 3M8ZA 2QA2A 5I42B 5M2PA 4ES2A 4JV5J 3AQPA 5ETLA 2J5AA 4PYDA 5B0CA 3M8RA 4RUHA 2LECA 1WD6A 1EJ7L 1Q53A 3ETMA 1R43A 3QRPA 1MMLA 2XGPA 4OJ3A 5KG1A 4ED1A 4OHVA 3QAUA 3EGNA 4ZP8A 3KHRA 4O3RA 4WE1A 1F0XA 2UXCJ 1ZH5A 4HR2A 1OY6A 3FKBA 2LVWA 4P71A 4DN0A 2J6UA 1OPIA 3FBEA 1NK5A 1N8RT 1RBAA 3VALA 2PI4A 4QZVB 1FXRA 3DDIA 3KHGA 2OEJA 4RW7A 2W4DA 3IN5A 5F8NA 3Q8PB 3M1VA 3Q8VA 3VGSA 1HD1A 4BBYA 4KGZB 2ZFHA 4DV6J 2FZKB 3SFUA 2XZTB 5HO4A 2R2RA 3RZAA 4YUDA 4OLPA 1D3WA 1RWWB 4CI0B 2KTQA 2EFPA 3CDEA 4TQRA 1EB0A 2AEJA 2ATCB 3U1MA 2CWKA 3ZTRA 4HT5A 1X9WA 1KQSR 1HHTP 4F3OA 1QLNA 2KYZA 3AD7C 3I56S 2YKMA 4F7VA 4YR3A 4K50A 4CO1A 1Y11A 3NRBA 1NSKL 4RNOA 2AW0A 2DGVA 3QAEA 1HL6A 5KOWA 3BQ0A 1RKIA 2EWHA 2OI2A 3MPWA 5CXTA 1J27A 4UQTA 4J90A 4NOHA 4ER8A 5KT4A 5A6PA 3VAJA 2XGQA 3ET6A 1VC0A 1KRPA 2XS2A 3MEDB 4HTIA 1GXUA 1DRZA 2E5GA 2EC0A 1H7XA 2HQDA 4OI2A 3AH6A 2MHEA 4PG4A 3AJ2A 4DCPB 4QWCA 4LF1A 3UCGA 3H2VE 1HBUB 2CQCA 4PYAA 3G6YA 1JXEA 2R2UA 2PMHA 2Y0BB 4AL6A 1T9YA 3ADAC 2YX7A 2EI5A 2ASLA 2FVSA 3MM8A 3NLCA 3CW2C 1W25A 2PN6A 4ZN1A 3GJSB 1JXVA 2DD8S 1NJYA 4YY3F 3FDSA 4HH1A 4XPEA 1TUVA 2FHOB 2OKQA 1XMQJ 4QU7A 2RQKA 3RBXA 5LSOA 2YNIB 4JI3F 3JQMA 1OSCA 1RAFB 3VAMA 1LQ9A 4OJ1A 4NASA 3HXMA 4DV7F 3W8GA 4TKTA 2GC8A 1XIQA 2LQ5A 5AXLA 2ASDA 1NKBA 1T9WA 3FQKA 3DLGB 3CT9A 3QGPA 2E5LF 5KT2A 4DV0F 1LWCB 5L1IA 4JV2A 1SC1B 1LKZA 5IT9U 2KL8A 3GJRB 3TX0A 2VA3A 5HQLA 3CCUS 4K4VA 1ZPWX 3QQCD 1T03B 2B9WA 1JLGB 1SVDA 3EXCX 3FBFA 3UN5A 5DGBA 3I5AA 1NU4A 2PFDA 2QT7A 3J80U 3BQ1A 4OV6A 2RAQA 2H48B 2RQMA 4ZP7A 4RNMA 2C2DA 1RT3B 1D0EA 1NPRA 4OJGA 4F4AA 3BH6B 1FKAF 2X3DA 5KFIA 1ZYQA 2MY7A 2DHGA 4J9SA 3IFEA 2AJ2A 4GRSA 2MLZA 4PXDA 4ED0A 4IRDA 3GV7B 1UWBA 4M94A 1NK8A 2OUGA 3RYLA 2IC3B 4RO0A 2XY6A 3LOUA 1S1XB 3BSOA 2UXCF 4KKOA 2K3IA 3WC0A 1N5YA 2NZCA 4ECTA 5HVHA 1RA7A 2JEGA 1CQMA 2HRYA 4F0MA 4NLDA 3T5JA 3Q8UA 3R5AA 1HWIA 2X1GA 4YB5A 4GVBB 3BB5A 5U47A 4UOGA 2WSCC 3GV8B 4GVBA 1X8DA 1T11A 2A18A 2PEHA 2HWIA 1VQ6S 2LDIA 5HK4A 4G1QB 2FB0A 3S1TA 1TK0A 2V5HG 3VVTA 1EARA 3M2UB 3ZXWA 3LAMA 3LO3A 1F60B 2ZH3A 4ZLPA 2ZWPA 2WONA 3OQ2A 1QAJA 4WJBA 2ZKUA 1ZBTA 2IM1A 2XTJP 2PMZD 4FBUA 1KVJA 3ILLA 1CJKB 1U09A 2IJNA 2LDYA 3R5JB 4O3OA 2XC9A 1ZM2A 2CQ1A 4K0KJ 3JTOA 3AODA 2QGFB 2M9KA 3MMCA 5C42B 1HNIB 3HO1A 1FD2A 2OEKA 1IM6A 2DNPA 1M1GA 2CAJA 1YJUA 1EZZB 3HD1A 1H2TZ 4OI3A 1VHFA 5KFAA 3WC2A 3N79A 3B4DA 4ZPDA 3LP0A 2YVSA 3CDBA 2VODA 2MGZB 2ZZNA 2F7VA 2H65B 4D3HA 1HBNA 2GMHA 2HK2A 5D4OA 1KSPA 4C2MA 5KG0A 2PE8A 4F4KA 2IDLA 2RIJA 2VASA 1XK8A 4PABA 1TV6B 2UUTA 1KKHA 2H4YB 3GU0A 3R5CA 3D68A 4C0HA 5DDRC 1RTHA 4WP8A 2IRYA 2EFOA 2YWGA 4LR7A 3CCRS 2MQNA 4M5DA 4IFVB 1RT6A 2U1AA 2W1BA 3DGPB 2FLOA 4YN3B 4KGKA 9ATCB 1BD6A 2DHAA 3QYYA 4OQJA 4Q5VA 3HF5A 5D0EA 3WIVA 2VG5B 4GC6A 1UWBB 2PA3A 2RUGA 3OFGA 2FVQA 3R1LA 4LF8F 5T14A 1N5QA 3KFWX 4ID5B 4NLVA 4EUVA 5GMKa 2DT9A 1XMOF 2KZMA 3SV3A 4KRWA 5B0EA 3PYDA 1H7WA 1PC4A 4ZK7M 4X65J 3C8YA 2E5LJ 2A2DA 3OL9A 4IDKB 3IAS9 3X3UA 4CIOA 2QRRA 3QGGA 5SZTA 1FWPA 3UR0A 5KFPA 3CIMA 2GW8A 2BMBA 3M2RA 4K4YA 1JLGA 5CA5A 3GFYA 3VGUA 2JDJA 2FHMA 2QIFA 4FYVB 3MR2A 1UZHA 2MLXA 4ELVA 3BBCA 3J81Y 2F8MA 2HMIB 5F8GA 1S1TA 4DUYJ 1TVRA 5D4LA 2ZBRA 4RJVA 1UEUA 2RD5C 3ZTOA 3UD4P 4ANCA 2XEXA 2K1RA 2CDQA 5KFWA 1P8GA 1X7VA 1HBMB 2LA6A 3HSZA 1RISA 3S01A 4KAIA 4DR4F 2YNIA 3FCWA 2KI2A 1FRKA 2E1AA 2VL1A 2W2QP 4MKBA 4N7TA 3UDLA 1X9SA 4OX8A 4P10A 4BLGA 4M5HA 3C15A 3PG9A 1DQAA 3NMAA 1WF2A 2AWZA 1JJHA 1B4SA 1NJZA 3N5FA 2QL9B 2GVDB 3N6MA 3TJ8A 1N48A 1LV5A 1BWEA 2CPDA 2ALYB 3M30B 4ZP9A 3K57A 2DR7A 2XS5A 3ENVA 3A13A 1FK9A 2NYHA 3ENAA 1TL3A 3FCVA 2V0NA 4IH7A 3OLAA 2HQFA 2ALZA 1EIYB 4FXDA 3G9CA 4TQSA 5KFCA 2QLXA 1KHVA 1DTQA 2FJWA 4GVLA 1XNRJ 3QO9A 4JV0A 2Z57B 4RUCA 2VOOA 1WELA 4CO4A 5B7WA 1TP7A 2J0SD 1Q8LA 3DLLQ 1U47A 2NR0A 1A9NB 2NCKL 1UVKA 3U02A 4KGVB 3M32A 4OYOA 4UZBA 2JEJA 4F02A 3UR3C 5AJ3J 3G6VA 3POTA 5AT1B 4B3TJ 3HHNB 2AZ1A 2CPJA 4M5LA 3L95X 3MHYA 5C25B 5C24B 4URQU 3OLBA 2YX1A 5LXRA 2PDAA 1RYRA 1WF1A 4RNHA 4NLYA 2J0QD 3J7A1 2DNNA 3IM8A 2FJDB 4I6YA 1HQUB 1V3SA 3LA0A 2IVMA 1OPZA 2XSFA 3AXMA 1U0SA 5D6GA 4CYUA 1WOPA 1T0TV 5CYJA 3U27A 1RUSA 1Q7LB 5ETRA 4UW2A 5K8MA 1GTEA 3I4PA 1Q8IA 4KY3A 1V6HA 2R42A 2DJWA 2X7IA 4DUTA 3OHBA 3BKUA 4ZVRB 1R3NA 2WB4A 3KNAA 3DLJA 4G1PA 3OR2B 1CULA 2KYXA 2DTJA 2W7PA 4DR4J 1BXNA 2IYGA 2DXDA 2LYVA 2KRRA 4OHZA 2YWKA 1UL3A 4HTJA 2DH8A 4ID5A 3ZZOA 3OXFA 5J2NA 4J9UE 3BV8A 3D3CJ 4PQAA 4JI4F 5ETSA 2XY7A 3DLGA 1NEEA 1Q5YA 4DV2J 2R7TA 3P8BB 2NS1B 2A10A 3BH7B 1MW7A 2JC1A 2DR5A 3MTKA 1NM2A 1X5SA 3W64A 1UFWA 2VV5A 1OO0B 2C2ZB 4OL8A 1OYEA 3PEHA 4M5JA 4USIA 4CZCA 2VQFF 4KFBB 4ZP6A 3B6BA 5E2QA 1VQNS 3RB0A 1VRTA 3GE9A 4KHPF 3O1LA 4DUYF 4ERDA 5HROB 1RHQB 1PBUA 4OZ0A 3CXCR 2EKNA 2B8PA 1R8BA 2R8KA 4DSIA 5B0BA 1UW9A 1BGXT 3VTIA 1WJ9A 1RWPB 4NL5A 3T41A 4ZLLA 1GQEA 2C3MA 1H38A 2HAIA 3VHQA 3HD2A 5KAKA 2GX8A 4QCLA 1MG7A 4CLUA 2L08A 3MR6A 1G4CA 3HHDA 3AY0A 3R27A 5KFFA 4USVA 3Q8RB 1UEKA 4IQMA 4LQ9A 1Y3JA 3PY8A 2DIUA 3IA0A 5IC6B 3QRRA 2UV8G 4FS1A 1U0HA 1XMOJ 5J2QB 2FDNA 4CNYA 4F8RA 4G3IA 3THPA 4X62F 4DR2J 5DQIA 1LOUA 2KRBA 3NGTA 2Y8YA 4MIWA 5HSPA 2HZAA 1O0PA 1YBUA 3JS9A 1RTIB 4JI7J 1PC5A 3FNNA 5FJ4A 3N6NA 2DGTA 2GGPB 3WDOA 2EXUA 1VQOS 4ZPAA 3LUYA 2HZCA 4TYBA 4ED4A 1EKRA 3C2PA 1GX5A 1SQFA 3IRXA 3KK3A 2K3KA 4PCQA 1O6XA 1Z1ZA 3SQGB 3KLGA 1HFEL 5M2RA 5ETTA 4UZCA 1FDDA 3P49B 4C6AA 2V8HA 1L3VA 2KHDA 1YJ9S 2BM1A 1P1TA 2DNYA 2G4BA 3ET6B 2EFVA 2WVCA 4OHYA 2BKNA 2ZHBA 2CJAA 1NK7A 3UDVA 4BHQA 5C2CA 1KFDA 2GMLA 4PR6A 1RAEB 2F40A 4A8XA 3VAHA 4D3GA 1JLFB 1JLAA 1QDUB 2RU9A 1FVSA 1VQSA 3HKWA 4DQRA 4IFVA 3LP1A 2CJXB 3UN2A 2K1RB 4IRKA 2HHQA 5D0GA 1SJFA 1S6OA 1RDRA 4QIWD 2WOMA 3KJVB 1PYSB 4TU8A 4NCAA 2NUHA 1S6QB 1BWVA 3EPIA 1MN9A 1CJUB 5J1PA 1N6QB 5H9FK 3BO3A 4XPCA 4WYLA 2YX4A 1LWXA 1APSA 2G2YA 2EPIA 3HULA 3RUBL 1CS4A 4IDKA 2YWEA 1NDCA 3M9MB 3DLEB 3FEZA 1DY3A 2Z0GA 5A8RB 2OEMA 2ACYA 2OLWA 5EX3A 3TJ9A 1BQXA 1RAHB 1U2RA 1KQFB 2W8KA 5KFUA 4RW6B 2A6OA 2YQ3A 2AF6A 3VAKA 2XSJB 4RBUA 4QWEA 2HG4A 3C14B 4ZPWR 3TO8A 4NLRA 1TL1B 3NBPA 2E7VA 2AJFE 2DNKA 2ILYA 3CO0P 3MM9A 3SSSA 3JAMU 5KT3A 4B9VA 1WEYA 1HBMA 1BQMA 3I96A 3VCDA 2MHNA 2Q43A 2QZ8A 4B02A 3GIKA 5IT0A 8ATCB 1RA6A 3DRYA 4CQ1A 1X5PA 3AJ1A 5D78A 1VBZA 2IJFA 4Q2LA 2XMMA 4KV8A 1VOMA 1Y7PA 2ZBCA 3GTYX 3IR5B 4KH0B 4MIAA 4OZ5A 5ETMA 3PR4A 2BR0A 2CZVC 3QZ8A 1Y5LB 2R7OA 3UVJB 2MGZA 5B0FA 2HBRB 4AXJA 2KU7A 4K5RA 1OJ4A 2VDHA 2MQOA 3AT1B 1N56A 4KHMA 2X1FA 1XN9A 1ZM3A 2R3VA 4OYPA 5IWAF 2VH7A 4L6V3 3ZZYA 1N5TA 2CIMA 2V2ZA 3RBEA 3IWXA 3G87A 5H1SV 4J9OA 2CPHA 3I31A 5HANA 1S5ZA 4U7CA 3H4DA 4H4OA 4NA3A 1FDAA 3J80Y 4FNHA 2W9BB 2NSCA 1IN0A 3PVXA 1HNZF 5HROA 4TLQA 3NGDA 3AOCA 3B78A 3BN4A 3N01A 1MROB 1R0CB 2EK1A 3PRBA 1WSRA 5ETOA 3PW4A 1SKRA 3RR7A 4KHPJ 3DOMB 3QJLA 2Q3PA 4DV4F 4Z37A 1IR2A 1YQHA 4DN9A 3DHXA 1WHYA 3PM9A 1WC3A 4DV1F 1U4BA 2UV8A 1VQMS 2UXDF 2FLPA 1H2VZ 2D1CA 3AOAA 4JI1J 4PG8A 2JLGA 3MAQA 4UF4A 2ZWOA 2DEIA 2H5IB 2XHCA 4ZVFA 4FPIA 1Y0HA 5G0RA 5DDPC 4QU6A 4YB7A 1OWXA 4Q8FA 5T7LB 1TL7B 2OPQB 4L76A 1KVKA 5L9NA 3VQTA 3EGZA 1WC4A 4LBHA 3M6XA 1H73A 3S8SA 3BO4A 3EUNA 2DGUA 1X0PA 4IYQA 4CWBA 1DLOB 2J6TA 4YQWA 2W9BA 1HLWA 5I3QA 1SBRA 5D0RA 1HNXF 4JOUA 2Q6BA 2E1RA 3NAIA 2XMAA 3A3OB 3FJ2A 4XDDA 3OR2A 2P6SA 4ILLA 2AMCB 3LP2B 4ZVHA 1UKUA 4Y65A 1GT8A 2ZC4A 1AT1B 3CVKA 1E6VA 1I51B 5KTQA 5JVGQ 4DV5F 4XIUA 2LQ8A 3HSDA 4QR2A 4USKA 2CADA 4YB6A 3R6LB 4CO5A 2QFJA 3C16A 1XR7A 1U1QA 4RUBA 2LQJA 2A6MA 2V4JA 4DCOB 3A3PB 1HWUA 2FPHX 2WK4A 4JI2J 1FRJA 2OH2A 4CM0A 1SJRA 1C1CB 2UUCF 1VRQC 1IR1A 1VQ8S 1W7WA 4P7VA 1G7CB 2XYHB 2KM8B 3QGHA 4ZMMA 3DYAA 3DOKB 1S1TB 3SDEA 3KLIB 2J7UA 2DCLA 1UVJA 3T6BA 1WACA 1JLFA 2VC0A 3BGLA 2HGLA 2P6TA 3Q23A 1MROA 1N88A 2RRNA 4K8RA 4O0NA 2HKEA 3MZIA 4JI8J 2L48A 3M32B 3PX0A 4WFAQ 5KFJA 2ROGA 4ECQA 3M7VA 3HT3A 4WF9Q 2C3UA 1ULRA 4BC9A 2CNOB 3QT7A 2JX2A 3AHPA 5HJYA 3GILA 1IUJA 2EBEA 5L1KA 4F4ZA 1NDLA 2F65A 3NNCA 2HHXA 2J7KA 4DX6A 1EQMA 1FWLA 2CG4A 3G8SA 1V3ZA 2L9DA 3UVJA 2PD1A 1FK9B 2QL7B 1JNZB 4EK2A 3ILOA 2QC3A 1TKXA 2V67A 2QA4S 3UCUP 2CKWA 4YDXA 2YKOA 1P9YA 2MKIA 1WTBA 2ZM6J 2V68A 3BBFA 3OTBA 2F3JA 1D9FA 4BDPA 2FGOA 2XHWA 2CPIA 4OYIA 3I9ZA 1KQKA 2N3LA 1P6TA 5CH7B 3C14A 3MOJB 1WOOA 3QFWA 2YH1A 4CLKA 3MUVP 1TFYA 1C1BB 4P52A 2RMLA 1SJ1A 3GLJA 4LR8A 5K8PA 1JKHA 4JI3J 2LCWA 3GIIA 4V19J 2XCAA 3NNHA 1S9EB 3CCZA 2W2NP 3IBFB 2XB2D 1FJGJ 4OHXA 1S6UA 2HNZB 1KR4A 4DL6A 1JLQB 2BJ1A 1RHUB 2E29A 3C19A 3JQJA 4NPOA 3ISND 2KHCA 2PGCA 2MSSA 3DM2B 4R8UA 3THVA 1J5OA 3M2RB 3LF0A 4JP8A 2QSWA 2HRTA 3T5LA 1HPZA 2KT2A 1TL7A 3PO4A 1R8AA 1IXKA 4WWSA 1IQTA 2N7YA 4FKYA 4IR9A 2YPZA 1VFJA 4HHHA 1N36J 3OBIA 1NH8A 1VRUB 1A6LA 2JWNA 4ICLA 1AA1B 5DG7A 2YBVA 1R8PA 1AROP 2QV6A 3PFEA 3K0JA 3MTJA 4NLPA 4FF1A 5CYMB 2H1YA 3LQVA 3OL6A 2MDAA 5A8WB 1S1XA 2AV5A 3RB4A 2HHUA 5B0DA 1LFPA 3GONA 4C7QA 1X4CA 2FC8A 2Z30B 4BC7A 1C4CA 5KFBA 4ED7A 5HP1A 5DLFA 4E8UA 4FF4A 4DR7J 3DLKA 3P5BP 1J2VA 1FTRA 3J7Z5 4U9RA 4ZDNA 2J9DE 1QUPA 4X4SA 4DUZF 1YIJS 1I94J 4LF9F 2DGSA 3QATA 2VFRA 3PRVA 4LIRA 1T8EA 3V6DB 2VG7B 1RACB 5AXKA 6AT1B 1RTDB 4KE5A 3O3LA 4LSNA 1LFWA 4MKVA 4JI2F 4ECZA 1K0TA 3J7YU 2GJ2A 1VBXA 3CGIA 2MYFA 1PGZA 4MT1A 5MAOA 4NA1A 4IRCA 3RR8A 1JLEA 3LGHA 1JLBB 3PNIA 3AA9A 4AL7A 4JI0F 1NK6A 2BOPA 2RF2A 5HMWA 5E0OA 3TUJC 3M9NB 1YDLA 4K0KF 2R7XA 4E0DA 1BHNA 2ZE2A 2HVZA 3W7BA 3CIZA 5DG8A 3CMAS 1NK4A 2EC2A 5B0GA 1S0OA 1ZAXA 1NK9A 2CQIA 1S12A 2MZQA 4YDDB 2BJ3A 6FDRA 4DV5J 1RGVA 3GJQB 4M5NA 1WTFA 1X60A 2E1MC 1I6JA 3CJSA 5CAAA 4EWTA 4C97A 4CM2A 4X4QA 2W9CB 1B7YB 2D3ZA 3KDOA 4O23A 5SUHA 1HI1A 4F3MA 5JVHQ 1Q86T 2KT5A 2OD4A 3MM8B 2B0GA 4EO8A 1KLMB 1S49A 2B51A 2LEPA 4GO5X 1OMSA 2XZWA 3TOQA 4LSNB 7FD1A 3CPWR 1X4BA 2WAQD 3ELHA 1XMBA 4QW9A 4ED5A 3GWCA 3DXBA 5HATA 1VQYA 4ZHRB 2DNLA 1L3TA 1KN6A 1RCXB 3F0NA 7FDRA 4ED3A 5LXYA 1SV5A 3HKZD 3IS9A 4DX7A 4C8MA 4X4NA 1S6QA 3HVAA 1S9EA 2FJEB 3SZ2A 1C4AA 1O51A 1Y10A 2H54B 2P5VA 2J6SA 1KOOA 1FRXA 4B9UA 4NYPA 3W9HA 2V9WA 3H98A 4CLWA 2CZ9A 2XLKA 3UDCA 1NNDA 1N5SA 3BGUA 3O8WA 1GEHA 1KBRA 1RE1B 3DRSA 1SQEA 4ZIWA 2YKNA 5HMYA 5JJBA 1UA1A 4LF7F 4JI5J 4N41A 3EMTA 2VA2A 1Y00A 4Y6IA 2BJDA 3PIPQ 4I6WA 1AZSB 4GKJJ 1C0UB 1C0TA 1UJ6A 2RB7A 4IG0A 4HVZA 2X3GA 4Y2KA 2QN6B 1D9AA 3IGVA 4C0OC 2AGOA 1EAYC 1K8AT 2C3PA 1DHMA 2RRAA 2ROPA 3IBWA 3US5A 2VF3A 3W2WA 3NKYA 3UQSA 1X0FA 3WBZA 2RT3A 2LLZA 4OX9F 4DOZA 3K8WA 2V8DA 5HP1B 2CFXA 2D41A 3KUEA 2K7JA 2H51B 3AD8C 5F9NA 2Y8WA 1TTHB 1RAGB 4IQXA 1RKJA 1CS4B 2VBWA 4ES1A 4I2PB 4X4OA 3UW1A 3DOLA 3JAMY 1FD8A 4JBCA 2MQPA 2EKYA 3SDEB 2SXLA 1UW4A 2YTCA 4NA2A 4WPAA 4ZVUB 1LW0B 3HPOA 3PZPA 2DRDA 2DYAA 3GR1A 2HLUA 1U1LA 4LSLA 3ETOA 4DR3F 1TVRB 4LSLB 2X1BA 4C8NA 1YRUA 3QSYB 2M8DB 2Y3YA 2RRBA 3W9IA 2Z8QA 1F9FA 4FYDA 1SV5B 1PAUB 1MWQA 3O5TB 5K8OA 2GAGC 4DL4A 2L9WA 4KB7A 2B7BB 2HFSA 2MJUA 1LNQA 1EX8A 2GO8A 1FWKA 1JLQA 4J9VA 3GG0A 3IMQJ 5AXMA 4TU7A 1M5OC 2VD3A 5T41A 1L3UA 3DU5A 2GVDA 2A1BA 3KNGA 3VWSA 3ZTSA 3T5KA 1S0NA 1G2EA 2W8LA 1HBUA 2IDEA 1WWHA 3BF4A 3D67A 3SCKE 3D1QA 5L38A 2F63A 4DR1J 4LF2A 1G3OA 1S57A 2B4VA 1Q79A 1FFSB 1OYDA 3IAM9 4TY9A 1NKCA 1KLMA 3E51A 2XNQA 1WC5A 1HWKA 1ZAWA 2PEBA 2WRMA 4M5DB 3GG1A 5GMDA 4Z7CA 3O2IA 5KFHA 5IT9Y 5F8HA 1TU0B 3R1HA 1MWYA 1OIAA 1N34J 1C1BA 4DPOA 1M5KC 1QD1A 2QO3A 3QZ7A 3PXGa 4M63A 2BA9A 4Q2MA 3FEXB 1M0SA 4KH1B 2MKJA 2OFGX 2YNGA 5IS2A 2LEBA 3HMJG 1XMQF 1B3TA 1FRIA 1S7IA 2AD9A 1H98A 5LMNJ 2O67A 5BYQA 4Q8EA 2ZOGA 5GAEI 4U96A 2AT1B 3U7JA 3ZZ0A 1O8BA 4AQYF 1K73T 2IBKA 3G71S 2CG8A 2OPPB 2MY8A 2AJ0A 3ZTPA 5KOXA 4ZCMA 3W60A 4LF7J 3N6LA 2W9CA 3I5BA 2D74B 2GIFA 2MQ8A 4LVNP 4ED8A 4UQGA 2XBPA 1NPKA 4K4XA 4JI7F 3ZC4A 3W8PA 3I87A 5KT7A 1NB2A 2CQDA 2DGOA 4JUZA 4RR5A 3CDUA 3MI7X 3I0SA 1CEZA 1Q82T 1OSDA 4HHJA 4YFUA 3CJ2A 5CD4H 1VS3A 4DU8A 4DV3J 1OQ3A 4CCHA 4LQ3A 2E9TA 3DNCA 2HS4A 3ITHA 1V3RA 1YKWA 4DPYA 5J2NB 4OZ3A 4AXIA 3P4UB 2XWYA 4ITSA 1RWKB 3QSIA 4F4WA 4I1TA 3C6TA 2R7WA 3JSMA 2J8AA 4F0HA 2OPRA 3IP0A 2HHHF 4EZ9A 1FA0A 3CMES 2JOQA 1IQZA 2JEFA 4NXMJ 4KPYA 2XMKA 4HACB 3KK2B 3ULHA 2VG7A 3NG8A 3QRQA 5J2MB 2MXYA 1M5VC 4MK7A 2G1DA 2EFNA 1QVFR 1RI7A 3SSRA 4DPXA 1EP4A 4J9QA 8AT1B 4AE5A 3TA1A 3UI3A 2BJ7A 1Q7YT 2RSQA 3D66A 2COLA 4J9NA 1U02A 3K5MA 3LGNA 5A6WA 2KG1A 2NZ4A 2J9CA 4YP3A 4UUWA 4DBQA 4PG5A 3EXYA 3MR7A 1BY9A 4ZVPB 4K4WA 4NLXA 3TW0A 1RBLA 3CCSS 9RUBA 3OVAA 5E3RA 3S6EA 3HSJA 2KM8C 3MPYA 3JSMB 1U26A 3EYZA 1YTYA 4W92B 1L5UA 1PG5B 1TUWA 1JMTA 1FFWB 1T94A 2CPZA 2G0IA 3CWJA 1FFGB 3FZBA 4J91A 2HZVA 4A8OA 3C6UA 1HA1A 3ZZZA 5KFXA 2C3YA 1CQNA 4UY85 2UU9J 1SH0A 3CJ5A 4ETZA 4Z2XA 1RQ0A 2C2OB 2POKA 1R7IA 2W2OP 2WVFA 2XMUA 4N8OA 1GFWB 3SEOA 1ZZFA 2DIVA 3PDNA 4WFYA 5CQGA 4NEYA 4WKYA 1N6QA 4LF6J 3OHAA 3P6YC 4I7FB 4HHUA 5JXSA 3TUZC 2VKRA 3ISZA 1ZM4A 2BACA 4O3PA 2CJQA 4NLGA 4RBVA 2W7OA 1RT2A 2DY9A 4LF4J 5DZ7A 2IYIA 3Q89A 4QIEA 5GMEA 3Q2TC 1NUEA 2OELA 4H4MB 4ED6A 2M7SA 2MPUA 3KJNB 2GO9A 1FE0A 4A4JA 2AGPA 2ZJRQ 1YI2S 2FUG9 5RUBA 3HK2A 2O5DA 2KB2A 2IVFB 3TANA 3CJQA 4N8NA 2Z2MA 3V2UC 1YZ6A 1R0AA 2B9XA 2HVEA 3FRZA 3M4XA 3GCWP 2BKPA 5HBMB 4P73A 3RU0A 2ZH7A 4LF8J 3R7NB 1DFDA 4TN2A 2OTJS 1O5JA 2BYCA 2LEAA 4V19X 1WNEA 3HFKA 4OI1A 2UXDJ 1HQEA 1VQKS 3MWBA 5CYQA 5BYRA 1ZOTA 1ZPVA 4CLTA 2Y1IA 1R8HA 3HCXA 4WFZA 4RNFA 5DG9A 2FLLA 1S4EA 2VQFJ 3JTNA 4PAAA 4ECVA 2VG6A 1N54B 2QE5A 1H6KX 4G1QA 1T05B 1WF0A 3FMBA 3ZNUA 4JI6F 5LJ5Y 1RWUA 4CLSA 3UD3P 3DI6B 3IWLA 4Y2IA 5E3PA 2HFVA 4LFCJ 2JL9A 4WFNQ 2QYCA 3HFZB 2DK2A 2I6WA 3R9LA 1HWLA 2HWTA 4ZJOA 1XNRF 1FXLA 4A46A 4QR0A 1NSAA 3L7UA 3PIOQ 3RTVA 4H4KC 2RQ4A 3QIPB 2RVJA 2F8HA 3EICA 3G2XA 4OZJA 2CJKA 4OZNA 2UVWA 2QJ3A 3LAKA 3NY0A 4U67Q 3CJRA 4ZS6A 3JQKA 1F5BA 2Z58B 4PUOA 3CJKA 2ZH2A 1YJNS 2R7VA 2DNRA 2MQMA 3PTWA 1K47A 1CC7A 1I5OB 2I0XA 3K5NA 1UVIA 4ECRA 1YRTA 3V4IB 2QMXA 1SKSA 1NDKA 1HMVB 1QVGR 3FQLA 2WVEA 1CC8A 2PSZA 2AYBA 1BC6A 5J2MA 3DKDA 3C6UB 1RLCL 3NGUA 3CD5A 3TYTA 4P72A 3RAMA 3VQSA 1YJ7A 1RXOB 3AA8A 5MLCV 1PYOB 2R2TA 5IOLA 3MUMP 2CQGA 4K2JA 1AFIA 2VBZA 5KG7A 2AIRB 3TVYA 4QPTA 2N4DA 2DHXA 3NOGA 1FDBA 4KT0C 3EVWA 1S0MA 4NCGB 4B3SF 1VK8A 2JLFA 1SXLA 4CT8A 2E1CA 4DS5A 3FGVA 2ROEA 1HW8A 4L74A 5HLFA 2BJ9A 5DETA 1M1HA 1SKUB 4B9TA 1N0VC 1XWLA 3IC1A 4UUXA 5LL6d 3EWGA 2UUCJ 3V4IA 4BWMA 2MKYA 3Q8QB 5GVQA 1U8WA 5CABA 3OVBA 2BJEA 2F8EX 1GXTA 2I9SA 4B9SA 2V2QA 1V5VA 1RTJA 4RW9B 3GSIA 2JVRA 3P5TL 2MKHA 3TQEA 1URRA 4U7UK 3E2EA 2UVUA 1YVFA 1CVJA 5DZ6A 3MR5A 2HFUA 2ZJQQ 1R8CA 4C0BA 2C2NA 1SPBP 2HNDA 1FCAA 2NXNA 4LRDA 4YS2A 2AX0A 2WBMA 3MCSA 4WBFA 5HMZA 3OTDA 1JJ2R 3W66A 2ZH1A 1RHJB 3OPKA 4L3NA 3UNGC 3OV7A 4NXNF 3W2VB 4X64F 1EETB 2Y1LB 1RT7A 1Q4RA 1VR6A 4NYOA 2BE2A 3FRYA 3WIUA 4LF6F 2VG6B 3QJPA 1GH8A 2ZITA 4C8YA 1T05A 1TKXB 4R5PB 4O0IA 1HMVA 1IBLJ 1N32J 4KQZA 3AD9C 2P9CA 1JLCB 2O66A 3MF5A 2Z4PA 4C8ZA 2N7CA 2M3DA 4OYZA 4P6QA 4EEYA 2AEFA 3Q8SB 3U1NA 1FERA 2FZGB 2XSJA 3I82A 4F0KA 1S1WA 3FUYA 1FI4A 2I5JA 5A0YA 3SQGA 2HBZB 1RADB 3DC2A 2CJBA 4LFAJ 2W25A 2XZDB 4MYUA 1VBYA 4NZ6A 1LK5A 1MMDA 2CYYA 2EFQA 3OTEA 4LBIA 3CD7A 3K17A 4RWXA 5LJ3Y 2I2YA 2E9RX 3DMJB 1JQGA 4K7QA 4X4PA 5DGAA 1S1VA 3MEDA 4OZ1A 1N33J 1X4DA 3K5OA 1U1OA 3LGMA 4I2QB 3TAMB 1U6ZA 3PJXA 2UUWA 2C2KB 3BR8A 4RPFA 1MMNA 4Y00A 3WX4A 5F3ZA 1Q81T 4I67A 1IBCB 3NAHA 3ZTQA 2V63A 3FK4A 3DRPB 5AE3A 3L3CA 4TYAA 1UVLA 2A2CA 3BREA 2G0CA 1RP5A 1UFKA 2HEKA 3KLVA 1CG2A 3LP1B 1RTJB 4RW9A 1RJJA 3D6MB 4J37A 1PO6A 5F3TA 4F26A 1VI7A 3AXKA 4KGXB 1HIYA 3MGJA 4NLUA 1U6BA 2W4PA 4OI6A 3H8YA 2LU2A 1HNIA 2FIUA 2QYGA 3ONQA 5CCMA 5DDOC 3ZZPA 4NXNJ 3WZ0A 4OYBA 4P7TA 4B3RJ 1MNEA 4USUA 1YGYA 3OW2R 3HX9A 3RW7A 3TVZA 5IV4A 1T9TA 1L3KA 3D54A 3TWZA 5GADI 1RCOB 5B0AA 3PR5B 1HR0F 3KTQA 2AJQA 2KXNB 3SYZA 1NBEB 4AQYJ 4NRUA 3T1HF 4I64A 4I56A 1T9VA 2NXUA 4KO0B 1TV6A 2M2BA 3MAAB 4I68A 1GX6A 3VR1A 3MEGA 1OQ6A 4ZKAA 4EBCA 1HNZJ 4O3QA 1TKZA 1YJVA 2JFDA 5I4MA 1FDNA 2KVQE 2ZVSA 1UPMB 3AAWB 5I42A 1JLEB 1HNVA 2GZOA 3CJ3A 4KIAA 4OFZA 4DSEA 1SIZA 1B99A 2UUBF 2FJBB 2KKHA 1WOSA 5CHCB 5J1NA 3JSBA 4Y0FA 4AT1B 3KWMA 2ZE2B 3TI0A 1TK5A 1OY8A 4CH0S 3IR7B 3R2CJ 3I9V9 2QL5B 3UO0A 1BQNA 4WIQA 1SQGA 3A12A 1Q8BA 2ZOMA 1NZ8A 4PUOB 3CJKB 3KLEB 3G6XA 4OZLA 5HVFA 1RT1A 1HD0A 3SMZA 1WORA 2RE1A 1AXQA 2D3OR 3CDAA 4Y2AA 1LXJA 5KG4A 4E2FB 1VJQA 4HACA 4DG1B 2M70A 3W5ZA 4FF3A 2LP4A 2RNEA 2H9ZA 2B4OA 1JLCA 1F3FA 1ZA2B 2IRUA 3DOKA 3D0IE 2WONB 2V9KA 4R0JA 5KFNA 4C8OA 2B6AA 1TAUA 1YJTA 2QLBB 4RU9A 4IG3A 3H90A 4QBUA 1AB8A 3GYXB 1J5EJ 1S9GA 4I4BA 3Q0AA 4IKAA 2VG5A 1BLUA 3PW2A 3M8YA 1T02A 3TVKA 2K06A 2V50A 2CNKB 3WHIA 1IJEB 2ZZTA 5GAGU 4LRFA 4ECWA 3CC2S 2OPSA 3N28A 5LMUJ 3M6UA 3PRDA 4WU3A 1IBMF 1AW0A 2UVVA 1W2BR 4MH8A 3VZHA 2NREA 4OX7A 4P75A 3HVRA 4UY8T 2ZNYA 3DM2A 2HRUA 3FMWA 4R8UB 1FJCA 1JK9B 3A8JA 3SXLA 3QLHA 4HEA9 3TA2A 3VVUA 4CO0A 1FKOA 1HBNB 1NRKA 5E3CA 3H2LA 1UCNA 2HHPA 4M95A 3K89A 4CLLA 2CQHA 2LXUA 3UE2A 4HL9A 2VPXB 3V81A 3H42A 4DR3J 2HHTA 3M8QA 4U8VA 2IM2A 3MDFA 3CUNA 2DKOB 2JNJA 3B4MA 3BSAA 4F50A 2IPOB 3CNQP 4UT4A 1WUUA 1Y5NB 4MTPA 3MM5B 5F8LA 1F9EB 1KP6A 3NS7B 3HVWA 5CD4A 2KJWA 1VIXA 1RU1A 1WKLA 2NUUG 4DLGA 2OPSB 2YNGB 4N56A 3QJJA 4LMZA 5D8HB 3M8SA 3CF5Q 4LFBJ 4CLZA 2M0GB 1MN7A 4ZJLA 1FXDA 2EK6A 2OO4A 1S1VB 4P74A 4B08A 3RJMB 4DR6F 3H40A 3DOLB 5IV3A 1RT5B 2DO0A 3MXHP 4WFBQ 2XY5A 3AOBA 4L73A 4DV6F 5E3QA 5BXIA 2HS3A 4ECYA 4F04B 5KFQA 2GA7A 1Q1KA 3MUTP 3R8YA 2HVHA 2DRBA 4NLSA 3BS9A 4ZITA 5JUMA 2VUGA 3HT0A 2G13A 5EX0A 5KFSA 4DX8H 4FP9A 2BKOA 1YJRA 2MB0B 1MSWD 3HP6A 4YR2A 4GMKA 2ZH4A 1FRHA 2BBEA 2R7RA 3TARA 4H54A 1YZ7A 4ECUA 1ZETA 1EHWA 3OUYA 1HNWJ 2NQPA 3NP5A 3E01B 2HW3A 1EETA 1V5IB 1RSCA 2BUNA 4I2QA 3TAMA 3CJTA 4O4GB 3FEYB 4USWA 1K44A 1FRLA 5J1EB 1QUVA 5J1EA 5DDQC 1LXNA 1SC6A 4X4RA 3H2UB 2YQ0A 1G6BA 5E5NA 4A47A 5EHHA 1FX2A 2WTFA 3GQCA 4NMLA 3MFHA 3I0RA 2PT0A 4DL5A 2XMVA 5ETVA 3Q83A 1RTHB 3MM7A 1LW0A 1TR0A 4PG6A 4PG7A 1A7GE 2M88A 3LW5C 4ZVEA 2C2MB 3ZZRA 4YY3J 1URNA 2QFIA 2ADCA 1R89A 5DQHA 1RAOA 2CA9A 2BQRA 1QE1A 3SBMA 1U2CA 4DR5F 2DR8A 3J81j 2DNGA 3GR0A 3HHLD 3V4MA 1WI6A 1QSSA 3MR3A 4OHWA 2PMWA 5KT5A 2L3MA 3GP9A 2HS0A 2MKSA 4QIGA 3DU6A 4CDIA 5K8NA 1AUDA 4DSJA 2HQCA 4HI2A 2HNZA 1HQ2A 4A8YA 1TFWA 3MM6B 4WE1B 3W1YC 2RUSA 3NNAA 1DARA 1JB0C 4TXSA 1N0UA 4W98A 2CJ9A 1SC4B 3GFXA 2RS2A 4PQUB 2F9JA 2IM3A 3QLHB 1K0VA 3H5SA 5H9EJ 2WZ1A 5IM0A 2FVPA 2ZHAA 2YKNB 3K8VA 1CJVA 1WKKA 2HIQA 2FQQB 3J81U 4A48A 4A8WA 1U6FA 4DZDA 5GAHU 1S72S 1ZM9A 4OZ2A 5T7LA 5L1JA 4HI1A 2HFNA 3UD5A 4DFPA 1QAYA 1TL4A 1F5AA 2MZSA 4UOFA 2NPIA 3OFFA 2ZHOA 1QJHA 2LMIA 3FC9A 5FD1A 2R7SA 1DURA 1WG4A 3R6GB 2YKAA 2ZC3A 4ZIVA 1YJWS 2DPJA 4OV1A 2ZVIA 5A8KA 2AP6A 2YH0A 4DL7A 1SL1A 1FESA 4CTAB 3NEKA 5FDLB 4MJKA 1HNWF 4OYAA 2E5HA 3ENWA 1QAIA 4DCJB 4DV2F 1S4FA 4P2FA 2EBGA 2LA4A 4RU2A 2IA6A 4X66F 1UA0A 3HJFA 2FJVA 3D7SB 4N77A 1DBDA 1T3OA 3GB0A 1S76D 1X4GA 3JTPA 3W63A 3Q86A 3TZZA 3MEEB 3QGIA 1R31A 2AJ1A 4RL1A 1M90T 3OFEA 3C66A 1JWWA 2W2MP 3CC4S 1E6YB 4IUFA 5IFMA 2UU9F 1VC6A 1GNKA 2CUYA 4JB8B 1HI0P 1SH2A 1TL1A 4Q0BA 4KYZA 1X4EA 4NWBA 4RLEA 3J7YI 1S7HA 3DN9A 3L7OA 2A3JA 3ENQA 4U8YA 4B3MF 2AHOB 2HGMA 2XYGB 5KFKA 2V4RA 2B43A 4IH5A 3C3LA 1XNQJ 3PHTA 3BBBA 4ECXA 4DI6A 4DDFA 4I69A 3C16B 1PILA 3JYTB 3LP0B 5M2UA 2D9OA 4DV1J 1YG0A 1R6VA 3PX4A 1KTVA 2HBQB 5K5MA 3G8QA 4DG1A 4X62J 4ATNA 2HHVA 4J5OA 2MZ1A 1U8SA 1TL3B 1T03A 3G6ES 1FVQA 1PSDA 3QT5A 2AEMA 3RG6A 1P27B 3G82B 1UAWA 5BYSA 4A8SA 2ZH8A 1RT3A 4EBEA 1VBKA 4HT7A 3KJFB 2E5IA 4NI2B 2MZTA 1VMBA 3KDNA 4M5IA 2NPFA 3R7SB 8RUCA 3DLBA 4G1IA 1VYAA 2VPZB 2ZD1B 5A8KB 5C5JA 2YKMB 2P2CB 3NL0A 3FFIA 1NKEA 2QSFA 2KT3A 3POTB 2FJXA 3R5DA 2DBBA 4NCGA 1VLYA 2GJIA 4KV8B 1GTHA 2VJUA 4LRCA 4KR0B 4IOCQ 1YK9A 2BW2A 2NXJA 4CP5A 3CCMS 2IRXA 1N5YB 4DJBA 1B0PA 1H3DA 1TKDA 5D3GB 3T6JA 2JZ5A 5EGYA 4FS2A 2R2SA 2W24A 3PKYA 3QMQA 2VIHA 1DQ8A 1PJ6A 3FZ2A 4USTA 5C7PA 2Z2YB 3HZEA 1TQLA 1VC5A 1J5EF 2EW9A 2XG8A 4H4OB 3QT6A 4TU9A 3EX7B 2YNHB 2CVEA 3VGVA 4LFCF 2VQEF 3EDRB 1X4HA 1CULB 1FEHA 3NGRA 1RAIB 3CD6S 4U95A 1VCTA 1WC1A 5EDWA 5LM7E 3W9JA 3A8KA 4CTAA 1LWEA 3K59A 3LPEA 1VK3A 5LMNF 3G4SS 1CJUA 1VISA 4X65F 5B08A 1HBOB 2QMWA 3E01A 4CH7A 2HHSA 2VFUA 2IHR1 2CRLA 1HYSB 4BWJA 2IMOA 3BKTA 4QQBA 1FO1A 1HYSA 5KFMA 4OX9J 1IKYB 2BABA 1ZTWA 4O3NA 4WTOB 1UPPA 1UETA 2BXJA 3HVTA 3KLFA 5CZXA 1DTQB 4TLRA 4S0MA 4GKKF 1FKPB 4RW6A 1NZAA 1T9UA 5DO2A 2XI3A 3OR1B 4LR9A 5THWA 2QMUB 2ZH9A 2DEJA 2FJAB 2MSTA 3Q24A 2ABYA 4RW4B 1KVIA 4DFMA 1VHIA 5AJ3F 1RLDA 1Q5VA 4J9MA 5KFOA 1RHRB 3W2WB 1N4LA 4DV0J 3MPVA 1FNXH 3TUPA 3MPDA 4K5SA 4PPZA 4B3MJ 4USMA 4B3SJ 3M8PA 2YKPA 4QIVA 2HQGA 2KXHA 2DCUB 2V2KA 3BN7A 3M30A 1KLNA 3C6TB 4LF5J 3NGKA 2XMTA 4PKDB 4O4RA 2DNHA 2BE2B 2QX0A 3LALA 4PPDA 3DRPA 5DQGA 5IWAJ 2QA4G 2D69A 2FY8A 3I0RB 1BUXA 1RB0A 1S48A 2IFXA 1I1GA 2DNQA 4KFBA 2ZOFA 2KDOA 3CCVS 2IA0A 4YMEA 1KD1T 3O44A 3TA0A 1B0VA 2VC1A 3M8QB 2LXFA 2B6AB 3P96A 1CJTA 4FKXA 4CLYA 4CO3A 3RGIA 3QWUA 1S99A 2Q1LA 1EP4B 2B56A 3DOMA 4O44B 2HFOA 3QIDA 1FJ7A 1U48A 3BPSP 3D2WA 4F36A 3IS9B 1S9FA 4B9LA 1N33F 2CQ3A 2JC0A 2I38A 2DB1A 3DCAA 2YWWA 5BJRA 1XQIA 1X31C 2KH9A 2DR9A 2HGNA 3IXQA 4CT9A 3HM9A 3OSNA 3BKFA 1HQUA 1NHVA 4P2XA 1PJ7A 2W2PP 3WQPA 1FRMA 2JHEA 3CJ4A 4RX6A 2BX6A 2E7XA 1JJCB 5AE1A 2RS8A 6FD1A 4J9LA 2C2RA 1FKOB 4Q43A 4YHHJ 2JH3A 3OTCA 3UN3A 2BANB 1UMJA 1VRTB 3OD2A 3PYEA 4HDHA 1KONA 1DJ0A 4KGMA 3N5BA 4Y34A 1SC3B 2B5JA 1PBAA 5D0HA 1TKZB 1RTIA 1ZA1B 5LOQA 4ICLB 2AJ4A 2PC6A 5IZHA 2X1AA 4EYHB 4TY8A 2E66A 3EM1A 1DZ5A 3RRHA 2RJZA 5HVGA 1RT6B 3MFIA 1BQMB 1M5HA 1FT8A 1RHKB 1ZAVA 3BR9A 2ZJPQ 3KUHA 4NMXA 2RH3A 2HNDB 2WBRA 2YKQA 1WHVA 2V6AA 4AFFA 2WW4A 4WK1A 3A1YG 2VBYA 4QWBA 3WX8A 3L09A 2KG0A 2DXFA 4ZCKA 3UNYA 1SKWA 1WDDA 4CH1A 2OP5A 3TEGA 1JXLA 2IAJB 1IKWB 2V4JB 4ZLJA 1U1PA 3MMJA 4QPXA 2V8PA 2WHOA 3HFVA 5ETNA 2ZM6F 4DR2F 2XCPA 3D28A 4ZCIA 1NO8A 2CXEA 2G2OA 1Q95G 3H20A 3M6VA 4KBIA 1U7LA 4A8FA 4NE9C 3IRWP 1RTDA 4DR6J 2CJYB 4LREA 4C3MA 3LWLA 4JV5F 3GIMA 1Q78A 2F9DA 3KLHB 3V6HA 1FNMA 4RW8A 4DXLA 4KC5A 2E44A 3HI9A 2MTLA 3RB3A 1DLOA 2NXEA 1QTNB 3IO1A 2Z56B 1R0AB 1PYTA 3EDQB 4Q0BB 3LWMA 1M5PC 3L4BC 2C28A 1H72C 1FEEA 2Q66A 2BEFA 1F2GA 4RKUC 2IVYA 3KJQB 5C24A 1LEOA 3TAPA 1I3OB 1HI8A 4Y28C 4JYAJ 3DMJA 3A8EA 2GHVC 3PHEA 1KTQA 1LW2B 3D1OA 3HLUA 2C2EA 5DJBA 5A2QU 2C22A 3D0GE 2XI2A 3H4BA 1WSVA 2B7CB 3Q8YA 4YHHF 5CZVA 4JI6J 4O3SA 2GNKA 1WC0A 2CWXA 2XO6A 3GPAA 4HKQA 3QO9B 3T9ZA 3W5XA 5HL7Q 2OGUA 2M52A 2QLFB 2DY1A 1QE1B 4DL2A 3BGFA 1AUSL 2XMWA 5L46A 2FY1A 1Y4ZB 4GKKJ 4DPWA 2WOMB 2OFHX 3F44A 2QG9B 1IR0A 2YY3A 4OLOA 4NLWA 5F41A 1Z4UA 1SJ4P 4MYTA 4DL3A 4LSZB 1NMEB 2D3O1 3GYGA 4LIWA 2BM0A 2MLYA 4MAKA 4OYMA 5KG3A 4G65A 1AYEA 3OVSA 3B8HA 4C98A 4CNZA 2BRKA 4USHA 1FJGF 5C25A 2LQBA 3VAFA 1D1UA 4X4UA 4ED2A 2H4WB 3CE8A 2G0JA 4K4ZA 2EG1A 3BGRB 2J7WA 3MMAB 4WFXA 3PJWA 5IM0B 1NK0A 4C9DA 7AT1B 3DHWC 5J2QA 1RWXB 1RHMB 4XTTA 3MCMA 4OYWA 1QAXA 5HAOA 3SCIE 3TP2A 3ZO7A 3R3TA 2ZH5A 2VHGA 2V2VA 4YOEA 3UFCX 1RZMA 3MURP 4LF5F 1MWZA 1IWGA 2YNHA 2W9AA 1D9DA 1U2FA 1X5OA 3VV2B 2PA8D 4M5MA 4UOCA 4B3TF 1CPZA 1C0TB 1C0UA 1GMVA 5G4DA 5GAEU 1QSYA 3JSRA 3TZXA 2UUBJ 3LP2A 2GJFA 3T1AA 2BE7D 5ETPA 2M5YA 4URGA 2HPUA 3CD0A 1JKHB 3AFGA 4EYIB 3ILIA 3CB4A 4GO7X 1R27B 4FF2A 2B8QA 1X9MA 1REGX 3TRGA 2YNFB 2PO4A 4XO0A 2ZH6A 4DQPA 1YITS 5K9FA 2H5JB 2QEXS 3H5YA 4KPCA 2RQCA 3MOZA 2R9LA 2OMLA 2EG2A 2VQEJ 4Q44A 4B9MA 1Q0NA 2AKWB 4HH0A 2BDPA 1S77D 1GMUA 3J7ZT 2MZJA 3D0HE 1RAJA 4BS2A 2GIQA 1NDPA 2Y0SD 3UWTA 3CSKA 4PXEA 3TAQA 2WB1D 1IWAA 3IBCB 4CLFA 5F8MA 2YXLA 5KG5A 2ILZA 1QY7A 2EVZA 2FC9A 3NMRA 4G6VB 4MK8A 4RWWA 2C1EB 2ZNZA 1NJIT 3JYTA 5KT6A 1NSPA 2QLJB 1RT4B 1CBKA 5IC4B 2Y1JA 2IAJA 4C48A 1GMWA 2NLWA 3JSYA 4H4KA 2VOPA 3IWNC 1EQ0A 5AXNA 5DM6Q 2OIHA 3RAXA 3PEJA 4ZLNA 3EVOA 4IR1A 1T9XA 3D3BJ 1IBKF 1CLFA 3L9ZA 3SCJE 4GKJF 4UTGA 4JV1A 3LANA 2I1RA 2MKCA 5E33A 2VICA 2L41A 4DQQA 2PFFB 4OX6A 1LWFB 3M2UA 4PXCA 3HHLC 3FBCA 4HYKA 3GMGA 2ZDOA 4A8KA 2GMJA 1S9GB 4FXWA 1ACMB 2BJ8A 4LFAF 4C8KA 3FFIB 3QWPA 4ELUA 4F2SA 4WZQA 2ZD1A 5H9FJ 4LBPA 2RDJA 2DGQA 2YPYA 1F9HA 2QTWA 4LJMA 2E5JA 4E98A 1S79A 3R5GA 4AUKA 1XJWB 4AD6A 1RT4A 3KG4A 3K7RA 3OJSA 5F8JA 2OPPA 4QYZK 3IGNA 3IM9A 4K59A 2H3EB 4CYUB 1H0HB 4WCEQ 2R8HA 3ISNC 5L8RC 1QSLA 4N76A 4DFKA 3BGOP 1SIWB 2OPQA 3PO5A 4DU7A 5BR8J 2AYGA 2BVZA 4WTYA 4DL0C 1SJ3P 1HNXJ 2A0FB 2UP1A 4C3LA 1VQ4S 4TY8B 2WSFC 4DSKA 1F6TA 4IO9Q 4NZ7A 3H25A 2DGWA 2HFZA 4IO1A 4P2SA 5A8WA 1FF2A 2AX1A 4ID8A 4IOAQ 3D6TB 4B3RF 3M8PB 2ZBPA 5DM7Q 1H2UX 3BM7A 1U45A 1FE4A 1R6YA 1KDNA 1NPPA 4NRTA 2OHDA 3T9NA 2DPIA 3T1HJ 1Q8KA 2Y1RI 2D7SA 5A8RA 1G1XA 1S1UA 2AQ4A 3DLEA 1ZTTA 1DTTA 3IG1A 2CPEA 4C4WA 2BRLA 2CPXA 3CJ8A 1N34F 4ZPTR 1QTMA 3DDKA 1LK7A 3SIPB 3PFOA 2AYEA 3OR1A 1ROFA 3GFZA 2GGPA 3NGSA 1FKPA 1VQPS 1KFSA 1WG5A 4ES3A 1P1LA 1X4FA 2CPFA 2J8SA 1SB6A 4DWIA 1IJFB 4IG0B 5D4PA 3OT9A 4ZVTB 5F0WA 1Y5IB 2GS8A 2KVIA 1RAAB 4X84A 3I32A 3NCRA 3DRRB 3QIPA 2RILA 3BPDA 5IQ6A 2V4QA 1U1RA 1U1NA 2ZDPA 3CCWA 2ACMA 5KFVA 1M1KT 4EMDA 4FYYB 2O1PA 4FXVA 4QR1A 1RBOB 1SJQA 4F25A 3CJ0A 4N47A 3T1YF 2F4VF 2OSRA 1YHQS 2YNFA 5ADZA 5EUHA 5L39A 4I2PA 1CJVB 2HWHA 2OAUA 2DH7A 1OY9A 1IBKJ 2IMWP 1WC6A 1EKSA 3CTRA 1S97A 4MIBA 3N0VA 2GQCA 1NSQA 3R5BA 4J9RA 4ILMA 3H7HB 4ZCLA 3K5LA 2GIRA 1D8YA 1AFJA 3KOAA 3B54A 4R0EA 3V5RA 4U7UD 2KJVA 2R7QA 3O6QA 2XLIA 4NYZA 1KC8T 3I5CA 4PWUA 2LFVA 5K20B 2V34A 3BYRA 2G2ZA 3Q2SC 5F9LA
chains in the Genus database with same CATH topology
2KXFA 3M2VB 3BSCA 1ELOA 5DS7A 4WZMA 2DGXA 5KG2A 1REVB 3NCQA 4C3KA 1U1MA 5HLFB 4C11A 2D3UA 3OXLA 4LVOP 1RT5A 3HHLA 3BGRA 2X51A 3MMAA 2J0WA 2BANA 2AYMA 1Q16B 3DYAB 1C2PA 2ASYA 1Z2ZA 1T95A 4H4MA 2P6SA 3KLHA 2JLEA 3KKFA 4L72B 5I3UB 1SUQB 4ZPVR 4F2RA 1E6YA 4OMFG 2HVIA 3E3XA 3H5XA 2IM0A 4YR0A 4EFAC 5IT4A 4PXBA 3GZ7A 5A2QY 3N9UC 2KFZA 2P9EA 4JI5F 1XEZA 3BDEA 3HDSA 3FSIA 1E6VB 2AGQA 2F1FA 1WHWA 4Y3CA 4EO6A 3RB6A 3PW5A 1IKWA 1HWJA 2HQIA 2GHPA 3DFEA 3DRXA 4X4TA 1IBLF 5EWGA 2CQ2A 2WSEC 4NLOA 1LWFA 5EN1A 4QWAA 3KLIA 5I3UA 1OS5A 3FSXA 4ZOSA 5KFGA 5LT5A 5E41A 4WU2A 2D9PA 5GAHI 2RU3A 4NLTA 4DLEA 4F4YA 3CCTA 2KN4A 3DGPA 1UVMA 1JLBA 2X1FA 1SH3A 2FHKA 3EZUA 5E3AA 4B17A 3KHLA 5C42A 2XMJA 1S0VA 2MKKA 2GQQA 3VAGA 3MAHA 1IKVA 2J9EA 1REVA 1WHXA 2JJ4D 4HDGA 4IH6A 5FLXY 3BO2A 5KFYA 4QYZJ 5DRKA 2UZAA 4PRFA 2OSQA 2Q79A 5CYQB 3H5UA 1XERA 1J5OB 4PWDA 1U49A 3TUIC 3PKMA 1RT1B 4HLBA 3VF0B 2CPYA 4U6PA 3GSDA 2LXIA 4DHVA 2C42A 2N4CA 5DLGA 3KK2A 3OJUA 4B3OB 2BQUA 4JI8F 1I94F 1YSJA 3TNVA 1U25A 3MM7B 2XLJA 1HARA 1N52B 1JNRB 4F3QA 2VKZG 2I8EA 3SV4A 2B9YA 5IXUA 2DNZA 4OI4A 1LWEB 3ITHB 4MFBB 1CSJA 4KTQA 1Y9OA 4URSA 5HN0A 2XO7A 4DQSA 2N3OA 4N5SA 4C11B 3MM6A 4QW8A 4K4SA 1TAQA 2NSBA 4QIFA 4QWDA 4EU0A 1GXLA 1HPZB 4FVMA 1IKXA 3H59A 3M6WA 2NYIA 4Q7AA 2KFYA 1IKXB 1UJ4A 2R8GA 5ITHA 3CO9A 3NS5A 2VZ9A 4RW4A 4KSEB 1U24A 2VPWB 4K4TA 4X4VA 1NH7A 4LUBA 2CZ4A 4X2BA 3DRRA 3OTOF 5CYMA 3FSYA 3RRGA 3MMBB 3UPFA 1HW9A 2APOA 3MMBA 4Y2CA 3BSNA 3RAQA 1VIOA 3OUYB 2FHJD 2YWFA 3ZFVA 3CCES 3ZZTA 1JIHA 4TNOA 1KOHA 1C1CA 2VFVA 4XDCA 2E7WA 4EBDA 1VQ7S 3M1VB 4RW7B 4LF4F 1DTTB 3IG1B 1XC9A 1B0TA 1S1UB 1SL0A 3AB2B 3P3DA 1KNZA 4MMOA 5D77A 2JVOA 2DRAA 2R7UA 3PX6A 3VZIA 2V8VA 3IRXB 3KK3B 1T3NA 3F56A 4M8LA 2GQ2A 2I5JB 5A0YB 3RW6A 3PW7A 4DF4A 5K14B 2LKZA 3T5HA 4NLQA 1K1QA 2L9NA 2R4FA 4FNIA 4ETXA 2ZBIA 3Q22A 4CO2A 4KKOB 4YB1P