1BQQM

Crystal structure of the mt1-mmp--timp-2 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
174
structure length
174
Chain Sequence
IQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEMBRANE-TYPE MATRIX METALLOPROTEINASE
publication title Crystal structure of the complex formed by the membrane type 1-matrix metalloproteinase with the tissue inhibitor of metalloproteinases-2, the soluble progelatinase A receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 35
structure length 174
sequence length 174
ec nomenclature ec 3.4.24.80: Membrane-type matrix metalloproteinase-1.
pdb deposition date 1998-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1bqqM00
1XFUA 3ELMA 3P1VA 4XM8A 3F19A 2K9CA 2N8RA 3HBVP 3DSLA 1BKCE 4PKQA 4FVLA 4G9LA 4GQLA 3KECA 2OY2A 3WV3A 3N2UA 1JAOA 1ZP5A 1ZXVA 2X3CA 1XFZA 2XS4A 1UTTA 3SHIA 2FV5A 4WZVA 3LIKA 2OXZA 4H76A 3EWJA 2CLTA 4QKZA 4JQGA 1FM1A 1CK7A 2W14A 1UTZA 3ZVSA 1QJIA 5D2BA 1SRPA 4I35A 1S4BP 966CA 4DPEA 1KUIA 3TS4A 1R1IA 3LJZA 1G12A 2DW1A 4PKWA 1Z3JA 3LJTA 3EDIA 4H2EA 1H71P 1BQOA 3EDHA 4DF9A 2OY4A 2OW0A 2JNPA 1RM8A 4XCTA 1XFYA 1QUAA 2JIHA 1QICA 3KHIA 1IADA 2Y6CA 4IUWA 1EB6A 3CKIA 1USNA 3AYUA 1GE7A 3EDGA 1BUVM 3KEJA 3EHYA 3USNA 1IACA 3F17A 3LQ0A 1ATLA 2MZEA 5B5OA 1K7IA 3KWVC 3G42A 3P24A 1D8MA 1HY7A 4H30A 4H84A 3BA0A 2OXWA 1FBLA 5D7WA 5LABA 3RTSA 1D5JA 1FLSA 5L79A 1JK3A 1BM6A 1QJJA 1JJ9A 2D1NA 2DW0A 1ROSA 1CAQA 1GO8P 3B2ZA 3F16A 5CZMA 2OW2A 1MMPA 3L0TA 1HTDA 3ZXHA 1ASTA 1XUCA 4IN9A 2Y6DA 2OW1A 3KMCA 3KMEA 2OVZA 1YOUA 3WV2A 3EDZA 4JIJA 2W0DA 4XBHA 1BQQM 2OI0A 1BZSA 1EUBA 1PWWA 3LEAA 1GKCA 5I4OA 4A3WA 1XURA 2W15A 2X7MA 5BPAA 2TCLA 1KUHA 4DD8A 3LGPA 3Q2GA 1SATA 3VTGA 3AYKA 2D1OA 4J4MA 1JH1A 3I7GA 2W13A 5D1UA 5D3CA 3OHLA 4JP4A 2K2GA 3E8RA 2O3EA 1CXVA 1G49A 1D7XA 3VI1A 4CTHA 2X3AA 1KUKA 1BKCI 1A86A 4H3XA 1ZXCA 2YIGA 2CKIA 3WV1A 3N2VA 4WKIA 4JA1A 2OVXA 2EROA 1JIZA 4H82A 4DV8A 1R54A 1RMZA 3I7IA 5H8XA 1Y0VA 1OO9A 5I2ZA 1IAGA 4XM6A 2XS3A 2AIGP 1ZS0A 2E2DA 1AYKA 1SLMA 1G4KA 1OS9A 1MNCA 3GBOA 3LUMA 1B3DA 1DMTA 3HY9A 2DDYA 1O0QA 3O2XA 1O0TA 1MMBA 2HU6A 4FU4A 1C3IA 2ERPA 1HFSA 3L0VA 3DPFA 4A7BA 5D1TA 1GE6A 3HBUP 1IAAA 1BUDA 3ZUKA 3UVCA 3F18A 3K7NA 1CGFA 4I03A 1YQYA 1IAEA 4R3VA 1J7NA 3LUNA 1BSWA 4IJOA 1CIZA 1JANA 5I0LA 1DTHA 1K7QA 2MZIA 2JT5A 1A85A 4ILWD 3F1AA 1I76A 3V96B 1SLNA 1K7GA 1ZTQA 4PKUA 3HDBA 3EHXA 3O64A 1GXDA 1HFCA 2E3XA 1KAPP 1GE5A 3LJGA 4AIGA 1ZVXA 2V4BA 2DW2A 3B92A 1OM7A 4PKVA 2YB9A 3U1RA 4WKEA 4GR0A 1SU3A 1ND1A 4HMAA 1C7KA 4PKRA 2W12A 3G5CA 2MLRA 1PWQA 1YP1A 2A8HA 1B8YA 1JKYA 1OMJA 3AIGA 3OHOA 5I12A 1R1JA 1R55A 1AF0A 4WK7A 5JMYA 5I43A 1I1IP 2OW9A 5BOTA 1D8FA 2MZHA 1JIWP 1HOVA 4WF6A 2WO8A 1UMTA 1GO7P 4AUOA 1UMSA 1HV5A 2Z2DA 4GUYA 2FV9A 2DDFA 5CUHA 3HY7A 2USNA 1JAPA 1G05A 3TSKA 1JAQA 5B5PA 1XUDA 1CQRA 1XFWA 5D1SA 3TVCA 4GWNA 1OM8A 1Y8JA 5I3MA 1XFVA 1I73A 1QIAA 2RJQA 1L6JA 1MMRA 2PJTA 1PWPA 3DNGA 1CGEA 1PWUA 2ERQA 4EFSA 2AYKA 1G9KA 4ON1A 1Y93A 830CA 3LIRA 3DWBA 4PKTA 4G0DA 3B8ZA 1AKLA 1OS2A 1QIBA 1EAKA 4L63A 2JT6A 4HX3A 4FXYP 3LE9A 2WOAA 3KEKA 1KBCA 2JSDA 2RJPA 1MMQA 4GF1A 2QPJA 2L0RA 4FXQA 4XM7A 3LQBA 4AXQA 3TT4A 456CA 2X3BA 1UEAA 4AYKA 3KRYA 4H49A 2MLSA 3LILA 4JPAA 3LK8A 3F15A 3LMCA 1XFXA 5L7FA 1Q3AA 5BOYA 4GR3A 2KRJA 1BIWA 4L6TA 3NX7A 4H1QA 2POJA 2SRTA 3Q2HA 3DL1A 3K7LA 4ZR5A 1OM6A 1GKDA 1SMPA 2O36A 4L19A 1PWVA 1WNIA 3HB2P 4Q1LA 2WO9A 2J83A 3HYGA 1C8TA 1BKCA 4GWMA 3LKAA 2J0TA 1KUFA 4PKSA 1R1HA 1CGLA 4GR8A 5CXAA 1YCMA 3DPEA 1IABA 1KUGA 3MA2A 2OXUA 3HDAP 2I47A 3RTTA 2OZRA
chains in the Genus database with same CATH superfamily
1XFUA 3ELMA 3P1VA 4XM8A 3F19A 2K9CA 2N8RA 3HBVP 3DSLA 1BKCE 4PKQA 4FVLA 4G9LA 4GQLA 3KECA 2OY2A 3WV3A 3N2UA 1JAOA 1ZP5A 1ZXVA 2X3CA 1XFZA 2XS4A 1UTTA 3SHIA 2FV5A 4WZVA 3LIKA 2OXZA 4H76A 3EWJA 2CLTA 4QKZA 4JQGA 1FM1A 1CK7A 2W14A 1UTZA 3ZVSA 1QJIA 5D2BA 1SRPA 4I35A 1S4BP 966CA 4DPEA 1KUIA 3TS4A 1R1IA 3LJZA 1G12A 2DW1A 4PKWA 1Z3JA 3LJTA 3EDIA 4H2EA 1H71P 1BQOA 3EDHA 4DF9A 2OY4A 2OW0A 2JNPA 1RM8A 4XCTA 1XFYA 1QUAA 2JIHA 1QICA 3KHIA 1IADA 2Y6CA 4IUWA 1EB6A 3CKIA 1USNA 3AYUA 1GE7A 3EDGA 1BUVM 3DTEA 3KEJA 3EHYA 3USNA 1IACA 3F17A 3LQ0A 1ATLA 2MZEA 5B5OA 1K7IA 3KWVC 3G42A 3P24A 1D8MA 1HY7A 4H30A 4H84A 3BA0A 2OXWA 1XAXA 3DTIA 1FBLA 5D7WA 5LABA 3RTSA 1D5JA 1FLSA 5L79A 1JK3A 1BM6A 1QJJA 1JJ9A 2D1NA 2DW0A 1ROSA 1CAQA 1GO8P 3B2ZA 3F16A 5CZMA 2OW2A 1MMPA 3L0TA 1HTDA 3ZXHA 1ASTA 1XUCA 4IN9A 2Y6DA 2OW1A 3KMCA 3KMEA 2OVZA 1YOUA 3WV2A 3EDZA 4JIJA 2W0DA 4XBHA 1BQQM 2OI0A 1BZSA 1EUBA 1PWWA 3LEAA 1GKCA 5I4OA 4A3WA 1XM5A 1XURA 2W15A 2X7MA 5BPAA 2TCLA 1KUHA 4DD8A 3LGPA 3Q2GA 1SATA 3VTGA 3AYKA 2D1OA 4J4MA 1JH1A 3I7GA 2W13A 5D1UA 5D3CA 3OHLA 4JP4A 2K2GA 3E8RA 2O3EA 1CXVA 3DTKA 1G49A 1D7XA 3VI1A 4CTHA 2X3AA 1KUKA 1BKCI 1A86A 4H3XA 1ZXCA 2YIGA 2CKIA 3WV1A 3N2VA 4WKIA 4JA1A 2OVXA 2EROA 1JIZA 4H82A 4DV8A 1R54A 1RMZA 3I7IA 5H8XA 1Y0VA 1OO9A 5I2ZA 1IAGA 1OZ9A 4XM6A 2XS3A 2AIGP 1ZS0A 2E2DA 1TVIA 1AYKA 1SLMA 1G4KA 1OS9A 1MNCA 3GBOA 3LUMA 1B3DA 1DMTA 3HY9A 2DDYA 1O0QA 3O2XA 1O0TA 1MMBA 2HU6A 4FU4A 1C3IA 2ERPA 1HFSA 3L0VA 3DPFA 4A7BA 5D1TA 1GE6A 3HBUP 1IAAA 1BUDA 3ZUKA 3UVCA 3F18A 3K7NA 1CGFA 4I03A 1YQYA 1IAEA 4R3VA 1J7NA 3LUNA 1BSWA 4IJOA 1CIZA 1JANA 5I0LA 1DTHA 1K7QA 2MZIA 2JT5A 1A85A 4ILWD 3F1AA 1I76A 3V96B 1SLNA 1K7GA 1ZTQA 4PKUA 3HDBA 3EHXA 3O64A 1GXDA 1HFCA 2E3XA 1KAPP 1GE5A 3LJGA 4AIGA 1ZVXA 2V4BA 2DW2A 3B92A 1OM7A 4PKVA 2YB9A 3U1RA 4WKEA 4GR0A 1SU3A 1ND1A 4HMAA 1C7KA 4PKRA 2W12A 3G5CA 2MLRA 1PWQA 1YP1A 2A8HA 1B8YA 1JKYA 1OMJA 3AIGA 3OHOA 5I12A 1R1JA 1R55A 1AF0A 4WK7A 5JMYA 5I43A 1I1IP 2OW9A 5BOTA 1D8FA 2MZHA 1JIWP 1HOVA 4WF6A 4L7AA 2WO8A 1UMTA 1GO7P 4AUOA 1UMSA 1HV5A 2Z2DA 4GUYA 2FV9A 2DDFA 5CUHA 3HY7A 2USNA 1JAPA 1G05A 3TSKA 1JAQA 5B5PA 1XUDA 1CQRA 1XFWA 5D1SA 3TVCA 4GWNA 1OM8A 1Y8JA 5I3MA 1XFVA 1I73A 1QIAA 2RJQA 1L6JA 1MMRA 2PJTA 1PWPA 3DNGA 1CGEA 1PWUA 2ERQA 4EFSA 2AYKA 1G9KA 4ON1A 1Y93A 830CA 3LIRA 3DWBA 4PKTA 4G0DA 3B8ZA 1AKLA 1OS2A 1QIBA 1EAKA 4L63A 2JT6A 4HX3A 4FXYP 3LE9A 2WOAA 3KEKA 1KBCA 2JSDA 2RJPA 1MMQA 4GF1A 2QPJA 2L0RA 4FXQA 4XM7A 3LQBA 4AXQA 3TT4A 456CA 2X3BA 1UEAA 4AYKA 3KRYA 4H49A 2MLSA 3LILA 4JPAA 3LK8A 3F15A 3LMCA 1XFXA 5L7FA 1Q3AA 5BOYA 4GR3A 2KRJA 1BIWA 4L6TA 3NX7A 4H1QA 2POJA 2SRTA 3Q2HA 3DL1A 3K7LA 4ZR5A 1OM6A 1GKDA 1SMPA 2O36A 4L19A 1PWVA 1WNIA 3HB2P 4Q1LA 2WO9A 2J83A 3HYGA 2YUFA 1C8TA 1BKCA 4GWMA 3LKAA 2J0TA 1KUFA 4PKSA 1R1HA 1CGLA 4GR8A 5CXAA 1YCMA 3DPEA 1IABA 1KUGA 3MA2A 2OXUA 3HDAP 2I47A 3RTTA 2OZRA
chains in the Genus database with same CATH topology
1XFUA 3ELMA 3P1VA 4XM8A 3F19A 2K9CA 2N8RA 3HBVP 3DSLA 1BKCE 4PKQA 4FVLA 4G9LA 4GQLA 3KECA 2OY2A 3WV3A 3N2UA 1JAOA 1ZP5A 1ZXVA 2X3CA 1XFZA 2XS4A 1UTTA 3SHIA 2FV5A 4WZVA 3LIKA 2OXZA 4H76A 3EWJA 2CLTA 4QKZA 4JQGA 1FM1A 1CK7A 2W14A 1UTZA 3ZVSA 1QJIA 5D2BA 1SRPA 4I35A 1S4BP 966CA 4DPEA 1KUIA 3TS4A 1R1IA 3LJZA 1G12A 2DW1A 4PKWA 1Z3JA 3LJTA 3EDIA 4H2EA 1H71P 1BQOA 3EDHA 4DF9A 2OY4A 2OW0A 2JNPA 1RM8A 4XCTA 1XFYA 1QUAA 2JIHA 1QICA 3KHIA 1IADA 2Y6CA 4IUWA 1EB6A 3CKIA 1USNA 3AYUA 1GE7A 3EDGA 1BUVM 3DTEA 3KEJA 3EHYA 3USNA 1IACA 3F17A 3LQ0A 1ATLA 2MZEA 5B5OA 1K7IA 3KWVC 3G42A 3P24A 1D8MA 1HY7A 4H30A 4H84A 3BA0A 2OXWA 3DTIA 1FBLA 5D7WA 5LABA 3RTSA 1D5JA 1FLSA 5L79A 1JK3A 1BM6A 1QJJA 1JJ9A 2D1NA 2DW0A 1ROSA 1CAQA 1GO8P 3B2ZA 3F16A 5CZMA 2OW2A 1MMPA 3L0TA 1HTDA 3ZXHA 1ASTA 1XUCA 4IN9A 2Y6DA 2OW1A 3KMCA 3KMEA 2OVZA 1YOUA 3WV2A 3EDZA 4JIJA 2W0DA 4XBHA 1BQQM 2OI0A 1BZSA 1EUBA 1PWWA 3LEAA 1GKCA 5I4OA 4A3WA 1XURA 2W15A 2X7MA 5BPAA 2TCLA 1KUHA 4DD8A 3LGPA 3Q2GA 1SATA 3VTGA 3AYKA 2D1OA 4J4MA 1JH1A 3I7GA 2W13A 5D1UA 5D3CA 3OHLA 4JP4A 2K2GA 3E8RA 2O3EA 1CXVA 3DTKA 1G49A 1D7XA 3VI1A 4CTHA 2X3AA 1KUKA 1BKCI 1A86A 4H3XA 1ZXCA 2YIGA 2CKIA 3WV1A 3N2VA 4WKIA 4JA1A 2OVXA 2EROA 1JIZA 4H82A 4DV8A 1R54A 1RMZA 3I7IA 5H8XA 1Y0VA 1OO9A 5I2ZA 1IAGA 4XM6A 2XS3A 2AIGP 1ZS0A 2E2DA 1AYKA 1SLMA 1G4KA 1OS9A 1MNCA 3GBOA 3LUMA 1B3DA 1DMTA 3HY9A 2DDYA 1O0QA 3O2XA 1O0TA 1MMBA 2HU6A 4FU4A 1C3IA 2ERPA 1HFSA 3L0VA 3DPFA 4A7BA 5D1TA 1GE6A 3HBUP 1IAAA 1BUDA 3ZUKA 3UVCA 3F18A 3K7NA 1CGFA 4I03A 1YQYA 1IAEA 4R3VA 1J7NA 3LUNA 1BSWA 4IJOA 1CIZA 1JANA 5I0LA 1DTHA 1K7QA 2MZIA 2JT5A 1A85A 4ILWD 3F1AA 1I76A 3V96B 1SLNA 1K7GA 1ZTQA 4PKUA 3HDBA 3EHXA 3O64A 1GXDA 1HFCA 2E3XA 1KAPP 1GE5A 3LJGA 4AIGA 1ZVXA 2V4BA 2DW2A 3B92A 1OM7A 4PKVA 2YB9A 3U1RA 4WKEA 4GR0A 1SU3A 1ND1A 4HMAA 1C7KA 4PKRA 2W12A 3G5CA 2MLRA 1PWQA 1YP1A 2A8HA 1B8YA 1JKYA 1OMJA 3AIGA 3OHOA 5I12A 1R1JA 1R55A 1AF0A 4WK7A 5JMYA 5I43A 1I1IP 2OW9A 5BOTA 1D8FA 2MZHA 1JIWP 1HOVA 4WF6A 4L7AA 2WO8A 1UMTA 1GO7P 4AUOA 1UMSA 1HV5A 2Z2DA 4GUYA 2FV9A 2DDFA 5CUHA 3HY7A 2USNA 1JAPA 1G05A 3TSKA 1JAQA 5B5PA 1XUDA 1CQRA 1XFWA 5D1SA 3TVCA 4GWNA 1OM8A 1Y8JA 5I3MA 1XFVA 1I73A 1QIAA 2RJQA 1L6JA 1MMRA 2PJTA 1PWPA 3DNGA 1CGEA 1PWUA 2ERQA 4EFSA 2AYKA 1G9KA 4ON1A 1Y93A 830CA 3LIRA 3DWBA 4PKTA 4G0DA 3B8ZA 1AKLA 1OS2A 1QIBA 1EAKA 4L63A 2JT6A 4HX3A 4FXYP 3LE9A 2WOAA 3KEKA 1KBCA 2JSDA 2RJPA 1MMQA 4GF1A 2QPJA 2L0RA 4FXQA 4XM7A 3LQBA 4AXQA 3TT4A 456CA 2X3BA 1UEAA 4AYKA 3KRYA 4H49A 2MLSA 3LILA 4JPAA 3LK8A 3F15A 3LMCA 1XFXA 5L7FA 1Q3AA 5BOYA 4GR3A 2KRJA 1BIWA 4L6TA 3NX7A 4H1QA 2POJA 2SRTA 3Q2HA 3DL1A 3K7LA 4ZR5A 1OM6A 1GKDA 1SMPA 2O36A 4L19A 1PWVA 1WNIA 3HB2P 4Q1LA 2WO9A 2J83A 3HYGA 2YUFA 1C8TA 1BKCA 4GWMA 3LKAA 2J0TA 1KUFA 4PKSA 1R1HA 1CGLA 4GR8A 5CXAA 1YCMA 3DPEA 1IABA 1KUGA 3MA2A 2OXUA 3HDAP 2I47A 3RTTA 2OZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFU A;  3ELM A;  3P1V A;  4XM8 A;  3F19 A;  2K9C A;  2N8R A;  3HBV P;  3DSL A;  1BKC E;  4PKQ A;  4FVL A;  4G9L A;  4GQL A;  3KEC A;  2OY2 A;  3WV3 A;  3N2U A;  1JAO A;  1ZP5 A;  1ZXV A;  2X3C A;  1XFZ A;  2XS4 A;  1UTT A;  3SHI A;  2FV5 A;  4WZV A;  3LIK A;  2OXZ A;  4H76 A;  3EWJ A;  2CLT A;  4QKZ A;  4JQG A;  1FM1 A;  1CK7 A;  2W14 A;  1UTZ A;  3ZVS A;  1QJI A;  5D2B A;  1SRP A;  4I35 A;  1S4B P;  966C A;  4DPE A;  1KUI A;  3TS4 A;  1R1I A;  3LJZ A;  1G12 A;  2DW1 A;  4PKW A;  1Z3J A;  3LJT A;  3EDI A;  4H2E A;  1H71 P;  1BQO A;  3EDH A;  4DF9 A;  2OY4 A;  2OW0 A;  2JNP A;  1RM8 A;  4XCT A;  1XFY A;  1QUA A;  2JIH A;  1QIC A;  3KHI A;  1IAD A;  2Y6C A;  4IUW A;  1EB6 A;  3CKI A;  1USN A;  3AYU A;  1GE7 A;  3EDG A;  1BUV M;  3KEJ A;  3EHY A;  3USN A;  1IAC A;  3F17 A;  3LQ0 A;  1ATL A;  2MZE A;  5B5O A;  1K7I A;  3KWV C;  3G42 A;  3P24 A;  1D8M A;  1HY7 A;  4H30 A;  4H84 A;  3BA0 A;  2OXW A;  1FBL A;  5D7W A;  5LAB A;  3RTS A;  1D5J A;  1FLS A;  5L79 A;  1JK3 A;  1BM6 A;  1QJJ A;  1JJ9 A;  2D1N A;  2DW0 A;  1ROS A;  1CAQ A;  1GO8 P;  3B2Z A;  3F16 A;  5CZM A;  2OW2 A;  1MMP A;  3L0T A;  1HTD A;  3ZXH A;  1AST A;  1XUC A;  4IN9 A;  2Y6D A;  2OW1 A;  3KMC A;  3KME A;  2OVZ A;  1YOU A;  3WV2 A;  3EDZ A;  4JIJ A;  2W0D A;  4XBH A;  1BQQ M;  2OI0 A;  1BZS A;  1EUB A;  1PWW A;  3LEA A;  1GKC A;  5I4O A;  4A3W A;  1XUR A;  2W15 A;  2X7M A;  5BPA A;  2TCL A;  1KUH A;  4DD8 A;  3LGP A;  3Q2G A;  1SAT A;  3VTG A;  3AYK A;  2D1O A;  4J4M A;  1JH1 A;  3I7G A;  2W13 A;  5D1U A;  5D3C A;  3OHL A;  4JP4 A;  2K2G A;  3E8R A;  2O3E A;  1CXV A;  1G49 A;  1D7X A;  3VI1 A;  4CTH A;  2X3A A;  1KUK A;  1BKC I;  1A86 A;  4H3X A;  1ZXC A;  2YIG A;  2CKI A;  3WV1 A;  3N2V A;  4WKI A;  4JA1 A;  2OVX A;  2ERO A;  1JIZ A;  4H82 A;  4DV8 A;  1R54 A;  1RMZ A;  3I7I A;  5H8X A;  1Y0V A;  1OO9 A;  5I2Z A;  1IAG A;  4XM6 A;  2XS3 A;  2AIG P;  1ZS0 A;  2E2D A;  1AYK A;  1SLM A;  1G4K A;  1OS9 A;  1MNC A;  3GBO A;  3LUM A;  1B3D A;  1DMT A;  3HY9 A;  2DDY A;  1O0Q A;  3O2X A;  1O0T A;  1MMB A;  2HU6 A;  4FU4 A;  1C3I A;  2ERP A;  1HFS A;  3L0V A;  3DPF A;  4A7B A;  5D1T A;  1GE6 A;  3HBU P;  1IAA A;  1BUD A;  3ZUK A;  3UVC A;  3F18 A;  3K7N A;  1CGF A;  4I03 A;  1YQY A;  1IAE A;  4R3V A;  1J7N A;  3LUN A;  1BSW A;  4IJO A;  1CIZ A;  1JAN A;  5I0L A;  1DTH A;  1K7Q A;  2MZI A;  2JT5 A;  1A85 A;  4ILW D;  3F1A A;  1I76 A;  3V96 B;  1SLN A;  1K7G A;  1ZTQ A;  4PKU A;  3HDB A;  3EHX A;  3O64 A;  1GXD A;  1HFC A;  2E3X A;  1KAP P;  1GE5 A;  3LJG A;  4AIG A;  1ZVX A;  2V4B A;  2DW2 A;  3B92 A;  1OM7 A;  4PKV A;  2YB9 A;  3U1R A;  4WKE A;  4GR0 A;  1SU3 A;  1ND1 A;  4HMA A;  1C7K A;  4PKR A;  2W12 A;  3G5C A;  2MLR A;  1PWQ A;  1YP1 A;  2A8H A;  1B8Y A;  1JKY A;  1OMJ A;  3AIG A;  3OHO A;  5I12 A;  1R1J A;  1R55 A;  1AF0 A;  4WK7 A;  5JMY A;  5I43 A;  1I1I P;  2OW9 A;  5BOT A;  1D8F A;  2MZH A;  1JIW P;  1HOV A;  4WF6 A;  2WO8 A;  1UMT A;  1GO7 P;  4AUO A;  1UMS A;  1HV5 A;  2Z2D A;  4GUY A;  2FV9 A;  2DDF A;  5CUH A;  3HY7 A;  2USN A;  1JAP A;  1G05 A;  3TSK A;  1JAQ A;  5B5P A;  1XUD A;  1CQR A;  1XFW A;  5D1S A;  3TVC A;  4GWN A;  1OM8 A;  1Y8J A;  5I3M A;  1XFV A;  1I73 A;  1QIA A;  2RJQ A;  1L6J A;  1MMR A;  2PJT A;  1PWP A;  3DNG A;  1CGE A;  1PWU A;  2ERQ A;  4EFS A;  2AYK A;  1G9K A;  4ON1 A;  1Y93 A;  830C A;  3LIR A;  3DWB A;  4PKT A;  4G0D A;  3B8Z A;  1AKL A;  1OS2 A;  1QIB A;  1EAK A;  4L63 A;  2JT6 A;  4HX3 A;  4FXY P;  3LE9 A;  2WOA A;  3KEK A;  1KBC A;  2JSD A;  2RJP A;  1MMQ A;  4GF1 A;  2QPJ A;  2L0R A;  4FXQ A;  4XM7 A;  3LQB A;  4AXQ A;  3TT4 A;  456C A;  2X3B A;  1UEA A;  4AYK A;  3KRY A;  4H49 A;  2MLS A;  3LIL A;  4JPA A;  3LK8 A;  3F15 A;  3LMC A;  1XFX A;  5L7F A;  1Q3A A;  5BOY A;  4GR3 A;  2KRJ A;  1BIW A;  4L6T A;  3NX7 A;  4H1Q A;  2POJ A;  2SRT A;  3Q2H A;  3DL1 A;  3K7L A;  4ZR5 A;  1OM6 A;  1GKD A;  1SMP A;  2O36 A;  4L19 A;  1PWV A;  1WNI A;  3HB2 P;  4Q1L A;  2WO9 A;  2J83 A;  3HYG A;  1C8T A;  1BKC A;  4GWM A;  3LKA A;  2J0T A;  1KUF A;  4PKS A;  1R1H A;  1CGL A;  4GR8 A;  5CXA A;  1YCM A;  3DPE A;  1IAB A;  1KUG A;  3MA2 A;  2OXU A;  3HDA P;  2I47 A;  3RTT A;  2OZR A; 
#chains in the Genus database with same CATH topology
 1XFU A;  3ELM A;  3P1V A;  4XM8 A;  3F19 A;  2K9C A;  2N8R A;  3HBV P;  3DSL A;  1BKC E;  4PKQ A;  4FVL A;  4G9L A;  4GQL A;  3KEC A;  2OY2 A;  3WV3 A;  3N2U A;  1JAO A;  1ZP5 A;  1ZXV A;  2X3C A;  1XFZ A;  2XS4 A;  1UTT A;  3SHI A;  2FV5 A;  4WZV A;  3LIK A;  2OXZ A;  4H76 A;  3EWJ A;  2CLT A;  4QKZ A;  4JQG A;  1FM1 A;  1CK7 A;  2W14 A;  1UTZ A;  3ZVS A;  1QJI A;  5D2B A;  1SRP A;  4I35 A;  1S4B P;  966C A;  4DPE A;  1KUI A;  3TS4 A;  1R1I A;  3LJZ A;  1G12 A;  2DW1 A;  4PKW A;  1Z3J A;  3LJT A;  3EDI A;  4H2E A;  1H71 P;  1BQO A;  3EDH A;  4DF9 A;  2OY4 A;  2OW0 A;  2JNP A;  1RM8 A;  4XCT A;  1XFY A;  1QUA A;  2JIH A;  1QIC A;  3KHI A;  1IAD A;  2Y6C A;  4IUW A;  1EB6 A;  3CKI A;  1USN A;  3AYU A;  1GE7 A;  3EDG A;  1BUV M;  3DTE A;  3KEJ A;  3EHY A;  3USN A;  1IAC A;  3F17 A;  3LQ0 A;  1ATL A;  2MZE A;  5B5O A;  1K7I A;  3KWV C;  3G42 A;  3P24 A;  1D8M A;  1HY7 A;  4H30 A;  4H84 A;  3BA0 A;  2OXW A;  1XAX A;  3DTI A;  1FBL A;  5D7W A;  5LAB A;  3RTS A;  1D5J A;  1FLS A;  5L79 A;  1JK3 A;  1BM6 A;  1QJJ A;  1JJ9 A;  2D1N A;  2DW0 A;  1ROS A;  1CAQ A;  1GO8 P;  3B2Z A;  3F16 A;  5CZM A;  2OW2 A;  1MMP A;  3L0T A;  1HTD A;  3ZXH A;  1AST A;  1XUC A;  4IN9 A;  2Y6D A;  2OW1 A;  3KMC A;  3KME A;  2OVZ A;  1YOU A;  3WV2 A;  3EDZ A;  4JIJ A;  2W0D A;  4XBH A;  1BQQ M;  2OI0 A;  1BZS A;  1EUB A;  1PWW A;  3LEA A;  1GKC A;  5I4O A;  4A3W A;  1XM5 A;  1XUR A;  2W15 A;  2X7M A;  5BPA A;  2TCL A;  1KUH A;  4DD8 A;  3LGP A;  3Q2G A;  1SAT A;  3VTG A;  3AYK A;  2D1O A;  4J4M A;  1JH1 A;  3I7G A;  2W13 A;  5D1U A;  5D3C A;  3OHL A;  4JP4 A;  2K2G A;  3E8R A;  2O3E A;  1CXV A;  3DTK A;  1G49 A;  1D7X A;  3VI1 A;  4CTH A;  2X3A A;  1KUK A;  1BKC I;  1A86 A;  4H3X A;  1ZXC A;  2YIG A;  2CKI A;  3WV1 A;  3N2V A;  4WKI A;  4JA1 A;  2OVX A;  2ERO A;  1JIZ A;  4H82 A;  4DV8 A;  1R54 A;  1RMZ A;  3I7I A;  5H8X A;  1Y0V A;  1OO9 A;  5I2Z A;  1IAG A;  1OZ9 A;  4XM6 A;  2XS3 A;  2AIG P;  1ZS0 A;  2E2D A;  1TVI A;  1AYK A;  1SLM A;  1G4K A;  1OS9 A;  1MNC A;  3GBO A;  3LUM A;  1B3D A;  1DMT A;  3HY9 A;  2DDY A;  1O0Q A;  3O2X A;  1O0T A;  1MMB A;  2HU6 A;  4FU4 A;  1C3I A;  2ERP A;  1HFS A;  3L0V A;  3DPF A;  4A7B A;  5D1T A;  1GE6 A;  3HBU P;  1IAA A;  1BUD A;  3ZUK A;  3UVC A;  3F18 A;  3K7N A;  1CGF A;  4I03 A;  1YQY A;  1IAE A;  4R3V A;  1J7N A;  3LUN A;  1BSW A;  4IJO A;  1CIZ A;  1JAN A;  5I0L A;  1DTH A;  1K7Q A;  2MZI A;  2JT5 A;  1A85 A;  4ILW D;  3F1A A;  1I76 A;  3V96 B;  1SLN A;  1K7G A;  1ZTQ A;  4PKU A;  3HDB A;  3EHX A;  3O64 A;  1GXD A;  1HFC A;  2E3X A;  1KAP P;  1GE5 A;  3LJG A;  4AIG A;  1ZVX A;  2V4B A;  2DW2 A;  3B92 A;  1OM7 A;  4PKV A;  2YB9 A;  3U1R A;  4WKE A;  4GR0 A;  1SU3 A;  1ND1 A;  4HMA A;  1C7K A;  4PKR A;  2W12 A;  3G5C A;  2MLR A;  1PWQ A;  1YP1 A;  2A8H A;  1B8Y A;  1JKY A;  1OMJ A;  3AIG A;  3OHO A;  5I12 A;  1R1J A;  1R55 A;  1AF0 A;  4WK7 A;  5JMY A;  5I43 A;  1I1I P;  2OW9 A;  5BOT A;  1D8F A;  2MZH A;  1JIW P;  1HOV A;  4WF6 A;  4L7A A;  2WO8 A;  1UMT A;  1GO7 P;  4AUO A;  1UMS A;  1HV5 A;  2Z2D A;  4GUY A;  2FV9 A;  2DDF A;  5CUH A;  3HY7 A;  2USN A;  1JAP A;  1G05 A;  3TSK A;  1JAQ A;  5B5P A;  1XUD A;  1CQR A;  1XFW A;  5D1S A;  3TVC A;  4GWN A;  1OM8 A;  1Y8J A;  5I3M A;  1XFV A;  1I73 A;  1QIA A;  2RJQ A;  1L6J A;  1MMR A;  2PJT A;  1PWP A;  3DNG A;  1CGE A;  1PWU A;  2ERQ A;  4EFS A;  2AYK A;  1G9K A;  4ON1 A;  1Y93 A;  830C A;  3LIR A;  3DWB A;  4PKT A;  4G0D A;  3B8Z A;  1AKL A;  1OS2 A;  1QIB A;  1EAK A;  4L63 A;  2JT6 A;  4HX3 A;  4FXY P;  3LE9 A;  2WOA A;  3KEK A;  1KBC A;  2JSD A;  2RJP A;  1MMQ A;  4GF1 A;  2QPJ A;  2L0R A;  4FXQ A;  4XM7 A;  3LQB A;  4AXQ A;  3TT4 A;  456C A;  2X3B A;  1UEA A;  4AYK A;  3KRY A;  4H49 A;  2MLS A;  3LIL A;  4JPA A;  3LK8 A;  3F15 A;  3LMC A;  1XFX A;  5L7F A;  1Q3A A;  5BOY A;  4GR3 A;  2KRJ A;  1BIW A;  4L6T A;  3NX7 A;  4H1Q A;  2POJ A;  2SRT A;  3Q2H A;  3DL1 A;  3K7L A;  4ZR5 A;  1OM6 A;  1GKD A;  1SMP A;  2O36 A;  4L19 A;  1PWV A;  1WNI A;  3HB2 P;  4Q1L A;  2WO9 A;  2J83 A;  3HYG A;  2YUF A;  1C8T A;  1BKC A;  4GWM A;  3LKA A;  2J0T A;  1KUF A;  4PKS A;  1R1H A;  1CGL A;  4GR8 A;  5CXA A;  1YCM A;  3DPE A;  1IAB A;  1KUG A;  3MA2 A;  2OXU A;  3HDA P;  2I47 A;  3RTT A;  2OZR A; 
#chains in the Genus database with same CATH homology
 1XFU A;  3ELM A;  3P1V A;  4XM8 A;  3F19 A;  2K9C A;  2N8R A;  3HBV P;  3DSL A;  1BKC E;  4PKQ A;  4FVL A;  4G9L A;  4GQL A;  3KEC A;  2OY2 A;  3WV3 A;  3N2U A;  1JAO A;  1ZP5 A;  1ZXV A;  2X3C A;  1XFZ A;  2XS4 A;  1UTT A;  3SHI A;  2FV5 A;  4WZV A;  3LIK A;  2OXZ A;  4H76 A;  3EWJ A;  2CLT A;  4QKZ A;  4JQG A;  1FM1 A;  1CK7 A;  2W14 A;  1UTZ A;  3ZVS A;  1QJI A;  5D2B A;  1SRP A;  4I35 A;  1S4B P;  966C A;  4DPE A;  1KUI A;  3TS4 A;  1R1I A;  3LJZ A;  1G12 A;  2DW1 A;  4PKW A;  1Z3J A;  3LJT A;  3EDI A;  4H2E A;  1H71 P;  1BQO A;  3EDH A;  4DF9 A;  2OY4 A;  2OW0 A;  2JNP A;  1RM8 A;  4XCT A;  1XFY A;  1QUA A;  2JIH A;  1QIC A;  3KHI A;  1IAD A;  2Y6C A;  4IUW A;  1EB6 A;  3CKI A;  1USN A;  3AYU A;  1GE7 A;  3EDG A;  1BUV M;  3DTE A;  3KEJ A;  3EHY A;  3USN A;  1IAC A;  3F17 A;  3LQ0 A;  1ATL A;  2MZE A;  5B5O A;  1K7I A;  3KWV C;  3G42 A;  3P24 A;  1D8M A;  1HY7 A;  4H30 A;  4H84 A;  3BA0 A;  2OXW A;  3DTI A;  1FBL A;  5D7W A;  5LAB A;  3RTS A;  1D5J A;  1FLS A;  5L79 A;  1JK3 A;  1BM6 A;  1QJJ A;  1JJ9 A;  2D1N A;  2DW0 A;  1ROS A;  1CAQ A;  1GO8 P;  3B2Z A;  3F16 A;  5CZM A;  2OW2 A;  1MMP A;  3L0T A;  1HTD A;  3ZXH A;  1AST A;  1XUC A;  4IN9 A;  2Y6D A;  2OW1 A;  3KMC A;  3KME A;  2OVZ A;  1YOU A;  3WV2 A;  3EDZ A;  4JIJ A;  2W0D A;  4XBH A;  1BQQ M;  2OI0 A;  1BZS A;  1EUB A;  1PWW A;  3LEA A;  1GKC A;  5I4O A;  4A3W A;  1XUR A;  2W15 A;  2X7M A;  5BPA A;  2TCL A;  1KUH A;  4DD8 A;  3LGP A;  3Q2G A;  1SAT A;  3VTG A;  3AYK A;  2D1O A;  4J4M A;  1JH1 A;  3I7G A;  2W13 A;  5D1U A;  5D3C A;  3OHL A;  4JP4 A;  2K2G A;  3E8R A;  2O3E A;  1CXV A;  3DTK A;  1G49 A;  1D7X A;  3VI1 A;  4CTH A;  2X3A A;  1KUK A;  1BKC I;  1A86 A;  4H3X A;  1ZXC A;  2YIG A;  2CKI A;  3WV1 A;  3N2V A;  4WKI A;  4JA1 A;  2OVX A;  2ERO A;  1JIZ A;  4H82 A;  4DV8 A;  1R54 A;  1RMZ A;  3I7I A;  5H8X A;  1Y0V A;  1OO9 A;  5I2Z A;  1IAG A;  4XM6 A;  2XS3 A;  2AIG P;  1ZS0 A;  2E2D A;  1AYK A;  1SLM A;  1G4K A;  1OS9 A;  1MNC A;  3GBO A;  3LUM A;  1B3D A;  1DMT A;  3HY9 A;  2DDY A;  1O0Q A;  3O2X A;  1O0T A;  1MMB A;  2HU6 A;  4FU4 A;  1C3I A;  2ERP A;  1HFS A;  3L0V A;  3DPF A;  4A7B A;  5D1T A;  1GE6 A;  3HBU P;  1IAA A;  1BUD A;  3ZUK A;  3UVC A;  3F18 A;  3K7N A;  1CGF A;  4I03 A;  1YQY A;  1IAE A;  4R3V A;  1J7N A;  3LUN A;  1BSW A;  4IJO A;  1CIZ A;  1JAN A;  5I0L A;  1DTH A;  1K7Q A;  2MZI A;  2JT5 A;  1A85 A;  4ILW D;  3F1A A;  1I76 A;  3V96 B;  1SLN A;  1K7G A;  1ZTQ A;  4PKU A;  3HDB A;  3EHX A;  3O64 A;  1GXD A;  1HFC A;  2E3X A;  1KAP P;  1GE5 A;  3LJG A;  4AIG A;  1ZVX A;  2V4B A;  2DW2 A;  3B92 A;  1OM7 A;  4PKV A;  2YB9 A;  3U1R A;  4WKE A;  4GR0 A;  1SU3 A;  1ND1 A;  4HMA A;  1C7K A;  4PKR A;  2W12 A;  3G5C A;  2MLR A;  1PWQ A;  1YP1 A;  2A8H A;  1B8Y A;  1JKY A;  1OMJ A;  3AIG A;  3OHO A;  5I12 A;  1R1J A;  1R55 A;  1AF0 A;  4WK7 A;  5JMY A;  5I43 A;  1I1I P;  2OW9 A;  5BOT A;  1D8F A;  2MZH A;  1JIW P;  1HOV A;  4WF6 A;  4L7A A;  2WO8 A;  1UMT A;  1GO7 P;  4AUO A;  1UMS A;  1HV5 A;  2Z2D A;  4GUY A;  2FV9 A;  2DDF A;  5CUH A;  3HY7 A;  2USN A;  1JAP A;  1G05 A;  3TSK A;  1JAQ A;  5B5P A;  1XUD A;  1CQR A;  1XFW A;  5D1S A;  3TVC A;  4GWN A;  1OM8 A;  1Y8J A;  5I3M A;  1XFV A;  1I73 A;  1QIA A;  2RJQ A;  1L6J A;  1MMR A;  2PJT A;  1PWP A;  3DNG A;  1CGE A;  1PWU A;  2ERQ A;  4EFS A;  2AYK A;  1G9K A;  4ON1 A;  1Y93 A;  830C A;  3LIR A;  3DWB A;  4PKT A;  4G0D A;  3B8Z A;  1AKL A;  1OS2 A;  1QIB A;  1EAK A;  4L63 A;  2JT6 A;  4HX3 A;  4FXY P;  3LE9 A;  2WOA A;  3KEK A;  1KBC A;  2JSD A;  2RJP A;  1MMQ A;  4GF1 A;  2QPJ A;  2L0R A;  4FXQ A;  4XM7 A;  3LQB A;  4AXQ A;  3TT4 A;  456C A;  2X3B A;  1UEA A;  4AYK A;  3KRY A;  4H49 A;  2MLS A;  3LIL A;  4JPA A;  3LK8 A;  3F15 A;  3LMC A;  1XFX A;  5L7F A;  1Q3A A;  5BOY A;  4GR3 A;  2KRJ A;  1BIW A;  4L6T A;  3NX7 A;  4H1Q A;  2POJ A;  2SRT A;  3Q2H A;  3DL1 A;  3K7L A;  4ZR5 A;  1OM6 A;  1GKD A;  1SMP A;  2O36 A;  4L19 A;  1PWV A;  1WNI A;  3HB2 P;  4Q1L A;  2WO9 A;  2J83 A;  3HYG A;  2YUF A;  1C8T A;  1BKC A;  4GWM A;  3LKA A;  2J0T A;  1KUF A;  4PKS A;  1R1H A;  1CGL A;  4GR8 A;  5CXA A;  1YCM A;  3DPE A;  1IAB A;  1KUG A;  3MA2 A;  2OXU A;  3HDA P;  2I47 A;  3RTT A;  2OZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...