1BR0A

Three dimensional structure of the n-terminal domain of syntaxin 1a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
DRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SYNTAXIN 1-A)
publication title Three-dimensional structure of an evolutionarily conserved N-terminal domain of syntaxin 1A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1998-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1br0A00
4TX5A 1EZ3A 1FIOA 4JEUB 3C98B 5LG4A 5M4YA 1FEWA 1S94A 2DNXA 3LG7A 2XHEB 1HS7A 1G73A 1BR0A 4JEHB
chains in the Genus database with same CATH superfamily
3GN5A 1KF6A 3A8YC 3E0ZA 2VASA 5F5WA 2BG9A 3V5UA 2MBGA 3M65A 1HG2A 1XMQT 4ASKA 4IREA 4O4LE 2LM2A 4DUZT 2WMOA 1E7PA 4BAYB 1N36T 3ZCJA 2EHOD 5L3GB 4U2YA 1KK7A 5IYZE 2XPKA 3AECA 3KV5A 4TX5A 4TWDA 5L2LA 1GQEA 2FUPA 4HFCA 4TWFA 4AQFA 5ETWA 2YOEA 5LG3A 4B3MT 1HNWT 2CXFA 3QK6A 3PUGA 3G06A 2BVLA 3BQIA 4IE6A 2VL8A 2XSAA 2LKGA 4PJMA 4DBRA 3VU7H 4H9PC 5L3CB 2D5UA 1T7SA 4NXMT 5HXRA 2LE8A 5KXJA 4HWHA 3ZLIA 2JQQA 4E7SA 3HA4A 2L8KA 1J5ET 2KMFA 2KSRA 4LF4T 5LNKA 1S94A 5EK4A 1ZV4X 5AQTB 5M4YA 3KV6A 3MXZA 4DBQA 3ZCIA 1N34T 4QH5A 3JADA 1Z8UA 4ILUA 4DR4T 4K0KT 4U2ZA 2K5BB 2V26A 3HKDE 3N9QA 2WWUA 4JUYA 3RPUA 2BS2A 3R84B 2WU2A 3I9YA 3ZEFB 1HR0T 3NZQA 4JI8T 1UX4A 2W0GA 5JDLA 3T8OA 3JAFA 3SFEA 5JDFA 2DCFA 4PAGA 1KEYA 1YQ4A 4N78D 4ZOLE 4DV7T 2BS3A 4YTPA 3N5LA 4U74A 4UEMA 2RP4A 3VKHA 4X65T 3FB2A 5AQSB 5LCYA 2BBJA 1ZHCA 4YXDA 3F2EA 5JVDE 4X1IE 2BZBA 2XM2A 1NEKA 5HEJA 5ABFB 4YSXA 4TV9E 3LJCA 2NW8A 4A56A 4ZZCA 4O8SA 2C5IT 3CX7B 5AQPB 5EZYE 2W00A 4ZZBA 3AB3B 2W63A 4U7IA 5AQGB 1X9BA 2WP9A 3AEAA 3JC6C 2YDRA 3RQUA 3HL6A 4I4TE 5IWAT 3UU6A 3ZSSA 4MBQA 2VQET 3ZJ1A 4EZHA 3LDQB 4EIWA 1NWMX 2XQ3A 4I55E 2ES0A 4HFHA 2LEHA 5H6RB 5ABGA 2JQKA 2YK0A 3SWHA 2CBIA 5FKYA 1AJ3A 1BR0A 5HWXA 1XMOT 1OEDC 5JTGA 5IHYA 3UU5A 3UQ4A 3RIUA 4DIDB 4ZHQE 3E08A 4JI6T 5HEHA 4PK6A 4LF9T 3RIFA 3I1AA 3EDUA 2BKPA 2KLQA 4Z91A 4ZEYA 4KHZF 4EB6E 1HF8A 4JBWF 3B57A 4C91A 4L5GA 3P4RA 4U72A 3EI0A 1YXRA 2UXNB 2JQHA 4AISA 2LSKA 2V5CA 3RLFF 2I6HA 2UXDT 2DLRA 5JDQA 2FJBA 2XQ4A 2V6YB 3PUSA 4LFAT 2E9XA 5LHGB 4UF0B 2CLYC 3Q5XA 4FI5A 5EK2A 2IDOB 3OYZA 2UXXB 1I6ZA 4EV6A 3B13A 1ZOYA 2YKSA 2W4XA 3M3ZB 2VKOA 2OA5A 3N2GE 3CVRA 1MIVA 5JDHA 3MZKB 4H9RC 4L9IA 2HHHT 2NW9A 5HEOA 4LMKA 3ANWA 2HPLA 3AVRA 5JR9C 5L3BB 5FL1A 4WZXA 2X9HA 4LF5T 2WSSV 2KINB 4GK5E 3ZSTA 4ADZA 1M62A 3LK3B 3ZYMA 4NIQA 3ZT7A 4HN9A 3K8PC 2J62A 2W67A 3VR8A 1SUMB 2Q9QD 3ZKRA 4CN1A 3H3MA 4P09A 4CN4A 3KINB 2WDVA 5F3JA 4JYAT 1HS7A 4O4JE 1MMNA 1IBMT 4UV9B 3AAAB 4QWNB 2NW7A 4TUYE 1FMWA 2H7OA 2V7MA 2XQ8A 2ACZA 2CCQA 2IC9A 2WDQA 4PK5A 4G63A 2A72A 4UELA 3BQLA 5L3DB 4IDZA 4P0BA 2K3WA 3AE4A 3FHNA 4JI2T 2LM9A 1YQ3A 2D2SA 1IJ6A 1WCRA 3CX8B 3TLVA 5LBQB 2PBIA 4ERRA 4DR1T 2VURA 5ABFA 2FBWA 2XY8B 2F4VT 3S4UA 2E2AA 4A97A 4AIUA 5FXWA 4DR7T 2BS4A 3BQKA 3FBLA 4U3CA 4LFBT 2CLYB 4ILCA 1VCSA 3LFMA 2WZIA 3PU8A 3RIAA 1UUSA 1M7KA 3AAEB 2N9DA 3AXJB 2FJAA 3UFGA 3EHZA 4HTEA 2E9XD 2IC6A 5FVKA 3P50A 4HFBA 3I0OA 2CHNA 2NOXA 3AE9A 5JR9B 3RC8A 3MKDA 1U5PA 3MACA 4TWHA 4XAXB 3O4XE 2IMLA 2M6BA 3E22E 5EK3A 5DQVA 5LHIB 3UU4A 3UUBA 1W9RA 1US7B 3PUZF 1MMDA 2HN2A 4JI3T 3ZYLA 3RRWA 1WR0A 2Y6XA 3H3AA 3OTOT 3SRZA 1UX5A 2IIUA 2G0UA 1MNDA 3CWZB 5HXEA 4H9QC 1NAFA 3AA7B 1HCIA 3ONXA 4AQGA 1HTJF 4YSYA 2NP9A 5HXSA 2V6YA 4UVAB 4ZS2A 2VQFT 2D9DA 4Q25A 4ZS3A 2E5VA 2W61A 4ZI3D 1YW0A 3DTOA 4U31A 1W0BA 2C0SA 2Y8DA 3CK6A 3AE2A 3UUNA 3QC9A 5E0OA 2ZM2A 3RX6A 4F6RC 4LF8T 2DHRA 3AE8A 4WW0A 4TN7B 5LJMA 3RKGA 5CA1E 1OWAA 4OX9T 4WNKA 3P8CD 1EZ3A 2DL1A 3ZN1B 3ZT5A 5HXHA 2LLYA 2D0UA 4BA9A 3AEDA 5AQVB 1HX1B 3LSVA 3MK7C 4PFPA 2LHRA 5BR8T 3FZHB 4WYVA 4IL9A 3PJAA 2MAWA 5FY1A 2J1DG 2XAHB 4F8HA 2CM0A 4B6XA 4ANJA 2GK9A 2K48A 1WYCA 2XAGB 4PK4A 2ACXA 3QUJA 2CBJA 2LSYA 2W66A 4LFCT 4V1Av 2OLTA 3O1IA 4BJMA 3VRBA 3OPCA 4U7YA 4JI5T 2YDSA 2MPKA 5F8PA 1OEDA 1BR1A 2RA1A 3GA8A 3N9LA 4GOUA 2PJQA 1V9DA 2JPFA 2EHOB 1MMAA 1LVKA 3N9MA 3RRCA 1WLXA 5FP3A 2UUCT 3VKGA 4I43B 4XBFB 2WS3A 4DMVA 3ZC0A 1MNEA 2W2UA 2JQ9A 4AKIA 5LB7B 3H37A 2YU2A 4GKKT 4ZI2C 3L09A 4HKAA 3T1HT 5JDGA 2V6XA 1JNZA 3VR9A 2P9BA 3UUXB 1G73A 3UULA 2VK9A 1N33T 2BKOA 5AQKB 1D0ZA 3C4ZA 2UXCT 4MALA 1DU2A 5HCJA 3UFEA 2KZ7B 3L8RA 2IW5B 2QA7A 5J2UE 4GKJT 3N9NA 2K24A 2N1GA 5AFUL 3AA6B 2LSGA 4H63H 1MIWA 3N9OA 2BG9E 3U78A 5AQQB 4QHOA 2WDRA 1XZYA 4LMLA 1D1BA 1J5WA 3CQXC 2HN1A 2X66A 4DV6T 4GIWA 2V7LA 3PUAA 5KMGP 3ONJA 4QKNA 3UU3A 2D0TA 5JR9A 3CMLA 1YKHB 2NR4A 3IBPA 3WAJA 4ZXLA 3J9X1 5FXZA 3ZJ2A 4K0UA 1WYBA 3IEEA 1FJGT 3AEGA 4DR6T 3MA9A 2M6IA 4YY3T 3AE6A 3P4WA 3CX6B 1W0AA 2VWAA 4O2AE 3LK2B 2QGSA 5JRCA 2E8IA 3JC6D 3UU8A 2XASB 1KNPA 3I0QA 3LBXB 3Q2MA 4CXYA 2L3LA 3F31A 3HKCE 1Y01A 5ADXL 4YLHA 2WQYA 3AEFA 4O2BE 3NKZA 5LYJE 2WAUA 1H7CA 4OK0A 2JIWA 5JQGE 3GN5B 2Q9QC 2V5DA 4DV1T 1T72A 2KNDA 5JH7E 4GK0E 2BG9B 3U3IA 2LJLA 1MMGA 3FZFB 2CA5A 4FJOA 4IDNA 3OYXA 4Z90A 4KUMB 4DUYT 4DR3T 5JREA 5J0ZA 1R8IA 2V7IA 3I9WA 4ISTA 3SS1A 4EAHA 3OJAA 2DWKA 3NWIA 4CXXA 3ZMSB 1BR4A 4CN6A 4JI0T 3BK9A 4AI6A 1XNQT 4DV0T 2LRKA 3DJBA 2I59A 3KFWX 1D0XA 3RC3A 4AKLA 3AVSA 4GYSA 4EGWA 4HFVA 3ZN0B 4Z8XA 2X67A 4LF7T 5L4HA 1IZNB 3RIUC 2WZHA 3NVOA 3JCFA 2CWOA 3X1DA 4H9SE 5AQUB 2FJDA 4AQYT 2XQ5A 1VRBA 4JI7T 2XQ9A 5FXXA 3O1JA 3N2OA 2VVNA 5C2TA 3C4WA 3KVAA 5DABA 2ZM6T 4KHPT 4CQIA 2NWBA 3KV9A 2XAQB 4YT0A 5LGUB 4ZI7E 2JRKA 3SFDA 5CGMA 1IBLT 3HKEE 2VVSA 3V5SA 3RYCE 5AQRB 3CPZA 3EDVA 2KWHA 2A2FX 3O1HA 2PG8A 3VRAA 4ILAA 3FXDB 3RQWA 4IE0A 4UVBB 3Q9DA 5GONE 3W15B 3PE0A 4HWCA 3TLSA 2IAKA 4U33A 5LMNT 3CKDA 4X62T 2WMNA 3K3NA 2Q9QB 2BBHA 2FJEA 2WB5A 5IUXA 5CA0E 2XAJB 3ABVA 5FNVE 4AKHA 3PURA 2X0LB 1MIYA 5LXTE 3KBTA 2CXLA 2VB6A 1UCUA 5HAXA 5HYAA 2XTLA 1UK5A 1IAPA 3PTRB 2QRXA 2PFVA 5JDMA 3RH3A 3C4XA 3EABA 3SOLA 5L3FB 4OFZA 4HWIB 2ZM0A 2V1DB 1HFAA 2PTFA 4KI0F 5FY7A 2YINA 1E2AA 5LHHB 4JEUB 2EHOC 3UQ7A 4IDQA 2DI4A 3CIRA 2LHNA 1SE7A 4DR5T 4TNVA 2H88A 1D1CA 1QUUA 3AEEA 3PV0F 4HWDA 1OXZA 4HFEA 4EEDA 1WRDA 3CQCB 4AXPA 4CI3B 1N32T 2XQ6A 5AQIB 4YJ3E 4O4IE 3TLWA 1ZKEA 4HE8A 3PDYA 5AQOB 2A9UA 5FYMA 3RYFE 1HNZT 2J4GA 1CUNA 1YKEB 2XQ7A 3ESLA 1QLBA 4M1PA 1Z0PA 3KBUA 4DV3T 4UF0A 5CJ5A 4I0UA 5LBMA 1S35A 4BJNA 2IUBA 4X1KE 5LP6E 4HGAA 2XM1A 2MTQA 2B1EA 5JDNA 5C8YE 4H9OC 4QH4A 4E7ZA 2UUBT 2E9XB 3LK42 1W09A 1ZP0A 3PUWF 1U4QA 2VKDA 2LT3A 5AQNB 3UT5E 5ABEA 3A7MA 2N2NA 2VL0A 4GYRA 4WBNE 3AE5A 3C64A 4IL4A 2CPTA 1QSDA 3HI2A 1VCTA 3FXEB 4IT4A 2Z6EA 3A5XA 3NBXX 3ANWB 3FZKB 3P7IA 4HWFA 2YU1A 3ZMUB 3Q5EA 3AAIA 4JEHB 1BR2A 2QYWA 5FXVA 5HEUA 5KX5E 1D0YA 3TLTA 2BKNA 3PUVF 4NUUA 4EYYR 2C5KT 4YJ2E 4OHFA 5AQHB 5L47A 2LOSA 3AA1B 3IHRA 3TKLB 3RHWA 1FMVA 3AE3A 4H63V 4X5TA 4P0AA 2M67A 4DNDA 3N2KE 4KX6A 3KDSE 4DO0A 3UUMA 4L0RA 1KNZA 5ABHA 3QB5K 1CHUA 3OVUA 2UU9T 3DP7A 1KNRA 4EYUA 2H7VC 2ODVA 3FZLB 2BG9C 4QXCB 5L3EB 2SPCA 2H3RA 5LG4A 4CZZB 4DR2T 4YSZA 3NZPA 2XZEA 3QOFA 2YEVC 1X79A 2CWYA 5FMNA 2JJ9A 3RF1A 2XHEB 4H9NC 3PU3A 4JLEA 3KVBA 4AQFC 3ZT6A 2WU5A 3RGLA 4IGUA 1I94T 2LSJA 2CE7A 2BVMA 2Q9QA 2VKJA 2C5JA 5AQLB 1Y64B 2YDQA 2CHOA 3OBVE 4B3RT 5BMVE 3RYIE 4X64T 2ODUA 2YN6A 4ILBA 3NRYA 3ZMTB 4COFA 1E1HB 3AXJA 4IE5A 3N9PA 4YFSA 2I0MA 4AKRB 2CXDA 2AXDS 3L39A 1WR6A 5FY0A 4YTMA 2LRLA 2HH7A 2AE9A 4ZI2D 3ZMZB 4NXNT 2IHR1 5TAOA 4TZ4C 1UURA 3ZYKA 5LOVE 5DJQC 4YTNA 4UIGA 2B76A 2HPJA 2XAFB 3VHLA 4MHCA 2X9WA 3Q5DA 3PUXF 2XQAA 2Y48B 4IDPA 4PNIA 5AQJB 2WCAA 1LRZA 5HEGA 3F57A 2UXBT 1WFDA 1T98A 3JAEA 1IBKT 4EXTA 4IDOA 1IJ5A 5LJNA 2UUAT 3EAMA 1SHZC 3O9XA 5LA6E 3EUHA 2X51A 2X9YA 4CI1B 4TNWA 1FEWA 4HFIA 2X9XA 4IE4A 4B3ST 1YD8G 5A1LA 3PUQA 1OEDE 3PJAJ 1ZEEA 3R6NA 3C51A 2X68A 2QVAA 2J47A 3NRXA 4ISSA 1O3XA 2WBLA 4I50E 3OKQA 3L3PA 4PJLA 3K3OA 3UTKA 3FBZA 4HEAA 3GWHA 2R6GF 3IA3A 1LVFA 4LMJA 2WWVA 1HNXT 5AQFB 4OYJA 2OV9A 3ETUA 4YHHT 1HG5A 2LSIA 3QB5A 4IIJE 2JMHA 3B5MA 2WM9A 4KMCA 3ZC1A 4NUVA 2LOPA 4PJNA 3K3QC 4A98A 2KT9A 4HFDA 5HWYA 2ZLYA 2K9AA 1D1AA 3QNUA 4MLKA 5AQMB 1VOMA 1XDOA 4AKGA 1XDPA 2LKHA 4QX7B 3WI3A 3D0TA 2XJ7A 2VKHA 3C98B 4EOZB 3ZMVB 2XQYA 1XWMA 4QX8B 4C90A 2EHOA 4OYKA 2RPAA 4JI4T 4X20E 2E5LT 3IF8B 1HX8A 5H6QB 3AA0B 3ZPOA 1SA0E 4G2AA 4JV5T 4UXNB 5LGTB 1OEDB 4QXBB 3MJXA 2DNXA 3P4PA 3HKBE 1UGOA 1JNRA 2E9XC 3HR0A 3K1SA 5HXCA 4DV5T 4DVDA 3GMIA 3RYHE 3CQGB 4X66T 2KWIB 5CB4E 2CMRA 4EZ4A 2JMKA 2V8SV 3AE7A 1L0VA 3ETVA 1J1JA 5L4EA 2X0HA 1NENA 3J7Yq 5C3JA 2MOZA 4NPPA 4IHJE 2W62A 4O4HE 1G8XA 3WAKA 4JI1T 4B3TT 3P4SA 2WY2A 4CXWA 2BDEA 5HCMA 5KDMC 4UR9A 2DWGA 2A3DA 2NTXA 3TLUA 2V7KA 3PUYF 4DMWA 1XNRT 5J2TE 5CFBA 4DV2T 3LG7A 4QH1A 4X1YE 3KV4A 2CRBA 5LGNB 2V7JA 4QXHB 4A5XA 4PJJA 5FVLA 4PFOA 2KXPB 2L9QA 4KP3C 3T1YT 3RI5A 4IE7A 4YHJA 2XUEA 4UV8B 4ZI3C 4J2CA 2MYSA 3P4QA 4WBOA 5DQWA 4EEBA 5FL0A 3Q5WA 2X0YA 1KFYA 4LF6T 3ONLC 2ZMAA 4UVCB 3RKOA 4TV8E 5J1GA 3EVYA 1B7TA 3C50A 4KBMB 4CI2B 1T8BA 3LBXA 5LMUT 1FIOA 4XZCA 2H89A 2XSBA 2CEAA 4DV4T 4P1NA 3AE1A 4PW8A 2NTYA 3AEBA 3FZMB 1LKXA 2ZM8A 4MFRA 5JRCB
chains in the Genus database with same CATH topology
3GN5A 3HKCE 5ADXL 3FHNA 4YLHA 2LM9A 2YEVC 1X79A 3E0ZA 2VASA 4O2BE 2CWYA 2D2SA 5LYJE 3V5UA 1IJ6A 2WAUA 2MBGA 1H7CA 3M65A 1HG2A 4OK0A 3CX8B 5FMNA 5JQGE 3GN5B 2JJ9A 2Q9QC 5LBQB 2PBIA 4ASKA 2XHEB 4H9NC 2KNDA 4ERRA 5JH7E 4GK0E 4O4LE 3PU3A 2WMOA 4JLEA 4BAYB 3KVBA 3ZCJA 4AQFC 2EHOD 4IGUA 5L3GB 3U3IA 2LSJA 2LJLA 1MMGA 2CE7A 1KK7A 2BVMA 2CA5A 5IYZE 2Q9QA 4FJOA 3OYXA 3S4UA 2VKJA 2C5JA 5FXWA 3KV5A 4TX5A 4KUMB 5L2LA 1Y64B 3BQKA 4AQFA 3FBLA 5ETWA 2CXFA 3OBVE 5BMVE 3RYIE 3QK6A 3PUGA 5JREA 2BVLA 2ODUA 3BQIA 2CLYB 4IE6A 2VL8A 3NRYA 3ZMTB 2V7IA 1E1HB 3I9WA 4PJMA 3LFMA 4ISTA 4IE5A 3SS1A 3PU8A 3VU7H 4DBRA 4H9PC 4EAHA 5L3CB 3OJAA 2DWKA 3N9PA 2D5UA 4YFSA 4CXXA 5HXRA 3ZMSB 3AAEB 1BR4A 2N9DA 4AKRB 3BK9A 4AI6A 2CXDA 2LE8A 4HTEA 3DJBA 2I59A 3KFWX 1D0XA 2E9XD 3ZLIA 3RC3A 2IC6A 1WR6A 5FY0A 2JQQA 4AKLA 3AVSA 2HH7A 4GYSA 4E7SA 4HFVA 3ZN0B 3HA4A 2L8KA 2KMFA 4Z8XA 3ZMZB 4ZI2D 3I0OA 2NOXA 5LNKA 1S94A 5EK4A 5JR9B 3RC8A 2X67A 3MKDA 1U5PA 1ZV4X 5TAOA 4TZ4C 3MACA 1IZNB 4XAXB 3ZYKA 5LOVE 5M4YA 5DJQC 3O4XE 3KV6A 3MXZA 4DBQA 3ZCIA 3E22E 4UIGA 5EK3A 5DQVA 2HPJA 5LHIB 4ILUA 2CWOA 2XAFB 1US7B 4H9SE 1MMDA 3VHLA 4MHCA 2K5BB 2V26A 3HKDE 2X9WA 3ZYLA 3N9QA 2Y48B 4PNIA 3RRWA 2WWUA 4JUYA 3RPUA 1VRBA 2Y6XA 3R84B 1LRZA 3H3AA 3I9YA 3F57A 3ZEFB 5FXXA 3O1JA 3NZQA 3SRZA 1UX4A 3N2OA 1UX5A 2G0UA 3C4WA 1MNDA 1T98A 3CWZB 3KVAA 5DABA 2W0GA 5JDLA 4CQIA 5HXEA 2NWBA 4H9QC 3T8OA 3KV9A 2XAQB 4EXTA 1NAFA 5LGUB 1IJ5A 5LJNA 4ZI7E 5JDFA 2DCFA 3AA7B 4PAGA 1SHZC 2JRKA 1HCIA 3O9XA 3ONXA 5LA6E 3EUHA 2X51A 4AQGA 2X9YA 1HTJF 4N78D 4ZOLE 2NP9A 4CI1B 5HXSA 1FEWA 3HKEE 3N5LA 4U74A 4UEMA 4UVAB 2X9XA 4ZS2A 3V5SA 2RP4A 3VKHA 3RYCE 4IE4A 3CPZA 3EDVA 2KWHA 1YD8G 2A2FX 4ZS3A 3FB2A 5A1LA 3O1HA 2PG8A 2W61A 3PUQA 5LCYA 3FXDB 4IE0A 1ZEEA 4ZI3D 1ZHCA 3F2EA 5JVDE 4UVBB 3Q9DA 3C51A 4X1IE 2BZBA 1YW0A 2X68A 3DTOA 3R6NA 5GONE 3W15B 3PE0A 3NRXA 4ISSA 2C0SA 2IAKA 2Y8DA 4TV9E 3LJCA 1O3XA 2NW8A 4A56A 2WBLA 3UUNA 4I50E 4O8SA 2C5IT 3OKQA 3QC9A 3CKDA 3L3PA 2WMNA 3CX7B 5E0OA 4PJLA 2ZM2A 3K3NA 2Q9QB 3K3OA 3RX6A 5EZYE 4F6RC 3UTKA 2DHRA 3FBZA 4HEAA 5CA0E 2XAJB 2W00A 4WW0A 4TN7B 3AB3B 5LJMA 2W63A 3GWHA 1OWAA 5CA1E 1LVFA 4WNKA 5FNVE 3P8CD 1EZ3A 4AKHA 4OYJA 3PURA 3ZN1B 2X0LB 3JC6C 3ETUA 5HXHA 1MIYA 2D0UA 4BA9A 5LXTE 3KBTA 1HG5A 2CXLA 3HL6A 2VB6A 4I4TE 1UCUA 2LSIA 4IIJE 3MK7C 5HAXA 5HYAA 4PFPA 2XTLA 2LHRA 4MBQA 3ZJ1A 1IAPA 2JMHA 3PTRB 2WM9A 4KMCA 4EZHA 3ZC1A 5FY1A 2PFVA 2J1DG 4NUVA 5JDMA 3RH3A 4EIWA 3C4XA 2LOPA 2XAHB 3SOLA 1NWMX 4I55E 2ES0A 3K3QC 4PJNA 2CM0A 5L3FB 4B6XA 2LEHA 2KT9A 4OFZA 5HWYA 2ZLYA 2ZM0A 5H6RB 2K9AA 1D1AA 4MLKA 2V1DB 1HFAA 4ANJA 3SWHA 2YK0A 2GK9A 2K48A 1WYCA 2XAGB 1VOMA 2YINA 4PK4A 2ACXA 5FY7A 1AJ3A 1BR0A 5HWXA 3QUJA 5LHHB 4JEUB 2EHOC 2DI4A 4AKGA 2LSYA 5IHYA 2LHNA 4QX7B 3WI3A 4V1Av 3D0TA 1D1CA 2VKHA 3O1IA 4BJMA 1QUUA 3C98B 3ZMVB 4EOZB 4ZHQE 2XQYA 4QX8B 1OXZA 4C90A 2EHOA 4OYKA 3E08A 4X20E 1WRDA 3CQCB 5F8PA 1BR1A 3IF8B 4AXPA 2RA1A 4PK6A 1HX8A 4CI3B 5H6QB 3I1AA 3AA0B 3EDUA 3GA8A 3N9LA 4YJ3E 4GOUA 2KLQA 3ZPOA 2PJQA 1V9DA 4O4IE 2JPFA 1SA0E 4G2AA 4EB6E 2EHOB 1HF8A 1MMAA 1LVKA 3N9MA 4UXNB 3B57A 3RRCA 5LGTB 1ZKEA 4HE8A 4C91A 3PDYA 1WLXA 4L5GA 5FP3A 4QXBB 5FYMA 3MJXA 2DNXA 4U72A 3RYFE 3VKGA 4I43B 4XBFB 1CUNA 3HKBE 4DMVA 1YKEB 3ZC0A 1MNEA 2E9XC 2UXNB 4AKIA 3ESLA 4M1PA 1Z0PA 2LSKA 3HR0A 3H37A 3KBUA 2DLRA 2YU2A 5HXCA 4ZI2C 5JDQA 4UF0A 3L09A 4HKAA 3PUSA 4DVDA 5LBMA 3GMIA 5JDGA 1S35A 4BJNA 3RYHE 3CQGB 2E9XA 4X1KE 5LP6E 2KWIB 5CB4E 4HGAA 2CMRA 2P9BA 4EZ4A 2JMKA 5LHGB 2MTQA 2B1EA 5JDNA 3ETVA 3UUXB 4UF0B 5C8YE 1G73A 2CLYC 4H9OC 3UULA 3Q5XA 2VK9A 4FI5A 5EK2A 4E7ZA 3OYZA 1D0ZA 2UXXB 3C4ZA 2E9XB 3B13A 3LK42 3J7Yq 2VKOA 4MALA 2OA5A 2MOZA 3N2GE 4IHJE 2W62A 1U4QA 2VKDA 4O4HE 3CVRA 1G8XA 3UFEA 2KZ7B 2IW5B 3WAKA 1MIVA 2QA7A 2LT3A 5JDHA 3UT5E 5J2UE 4CXWA 3N9NA 3MZKB 2BDEA 2K24A 2N2NA 4H9RC 2N1GA 4GYRA 5KDMC 2DWGA 5AFUL 3AA6B 4WBNE 2A3DA 4L9IA 2LSGA 4H63H 3C64A 1MIWA 3N9OA 3U78A 2NW9A 2NTXA 3ANWA 4QHOA 1QSDA 2HPLA 3AVRA 2V7KA 4DMWA 5JR9C 3HI2A 5J2TE 5L3BB 2X9HA 3LG7A 2WSSV 3FXEB 1D1BA 3CQXC 2KINB 4GK5E 4X1YE 2Z6EA 3KV4A 4ADZA 2X66A 3LK3B 3A5XA 4GIWA 3NBXX 2V7LA 3ZYMA 5LGNB 3PUAA 5KMGP 2V7JA 3ANWB 4QKNA 4QXHB 4PJJA 3P7IA 4HN9A 3K8PC 2YU1A 2D0TA 2KXPB 4PFOA 2L9QA 3ZMUB 3AAIA 4JEHB 1BR2A 5JR9A 3CMLA 4KP3C 1YKHB 2Q9QD 5FXVA 5KX5E 4IE7A 1D0YA 4P09A 4YHJA 2XUEA 3IBPA 4NUUA 3KINB 4EYYR 2C5KT 4UV8B 4ZI3C 4YJ2E 3WAJA 4J2CA 4OHFA 2MYSA 3J9X1 2LOSA 3AA1B 4WBOA 5DQWA 5F3JA 5FXZA 3ZJ2A 3IHRA 1HS7A 3Q5WA 3TKLB 4O4JE 4K0UA 1WYBA 1FMVA 3IEEA 1MMNA 2ZMAA 4UVCB 3RKOA 4TV8E 4UV9B 4H63V 5J1GA 3MA9A 3AAAB 3EVYA 4QWNB 2NW7A 4TUYE 1FMWA 4P0AA 3CX6B 1B7TA 3C50A 2M67A 4DNDA 3N2KE 4KBMB 4CI2B 2VWAA 2H7OA 3KDSE 4DO0A 2V7MA 3LBXA 3UUMA 1FIOA 4L0RA 4O2AE 3LK2B 4XZCA 2CCQA 1KNZA 2CEAA 2IC9A 2QGSA 3DP7A 5JRCA 2E8IA 4EYUA 4PW8A 2H7VC 2NTYA 2ODVA 3JC6D 4PK5A 4G63A 2A72A 4UELA 4QXCB 3BQLA 2XASB 5L3EB 2SPCA 3I0QA 5L3DB 4IDZA 2H3RA 1LKXA 4P0BA 2ZM8A 3LBXB 3Q2MA 4MFRA 4CZZB 5LG4A 2L3LA 4CXYA 3F31A 3NZPA 5JRCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX5 A;  1EZ3 A;  1FIO A;  4JEU B;  3C98 B;  5LG4 A;  5M4Y A;  1FEW A;  1S94 A;  2DNX A;  3LG7 A;  2XHE B;  1HS7 A;  1G73 A;  1BR0 A;  4JEH B; 
#chains in the Genus database with same CATH topology
 3GN5 A;  1KF6 A;  3A8Y C;  3E0Z A;  2VAS A;  5F5W A;  2BG9 A;  3V5U A;  2MBG A;  3M65 A;  1HG2 A;  1XMQ T;  4ASK A;  4IRE A;  4O4L E;  2LM2 A;  4DUZ T;  2WMO A;  1E7P A;  4BAY B;  1N36 T;  3ZCJ A;  2EHO D;  5L3G B;  4U2Y A;  1KK7 A;  5IYZ E;  2XPK A;  3AEC A;  3KV5 A;  4TX5 A;  4TWD A;  5L2L A;  1GQE A;  2FUP A;  4HFC A;  4TWF A;  4AQF A;  5ETW A;  2YOE A;  5LG3 A;  4B3M T;  1HNW T;  2CXF A;  3QK6 A;  3PUG A;  3G06 A;  2BVL A;  3BQI A;  4IE6 A;  2VL8 A;  2XSA A;  2LKG A;  4PJM A;  4DBR A;  3VU7 H;  4H9P C;  5L3C B;  2D5U A;  1T7S A;  4NXM T;  5HXR A;  2LE8 A;  5KXJ A;  4HWH A;  3ZLI A;  2JQQ A;  4E7S A;  3HA4 A;  2L8K A;  1J5E T;  2KMF A;  2KSR A;  4LF4 T;  5LNK A;  1S94 A;  5EK4 A;  1ZV4 X;  5AQT B;  5M4Y A;  3KV6 A;  3MXZ A;  4DBQ A;  3ZCI A;  1N34 T;  4QH5 A;  3JAD A;  1Z8U A;  4ILU A;  4DR4 T;  4K0K T;  4U2Z A;  2K5B B;  2V26 A;  3HKD E;  3N9Q A;  2WWU A;  4JUY A;  3RPU A;  2BS2 A;  3R84 B;  2WU2 A;  3I9Y A;  3ZEF B;  1HR0 T;  3NZQ A;  4JI8 T;  1UX4 A;  2W0G A;  5JDL A;  3T8O A;  3JAF A;  3SFE A;  5JDF A;  2DCF A;  4PAG A;  1KEY A;  1YQ4 A;  4N78 D;  4ZOL E;  4DV7 T;  2BS3 A;  4YTP A;  3N5L A;  4U74 A;  4UEM A;  2RP4 A;  3VKH A;  4X65 T;  3FB2 A;  5AQS B;  5LCY A;  2BBJ A;  1ZHC A;  4YXD A;  3F2E A;  5JVD E;  4X1I E;  2BZB A;  2XM2 A;  1NEK A;  5HEJ A;  5ABF B;  4YSX A;  4TV9 E;  3LJC A;  2NW8 A;  4A56 A;  4ZZC A;  4O8S A;  2C5I T;  3CX7 B;  5AQP B;  5EZY E;  2W00 A;  4ZZB A;  3AB3 B;  2W63 A;  4U7I A;  5AQG B;  1X9B A;  2WP9 A;  3AEA A;  3JC6 C;  2YDR A;  3RQU A;  3HL6 A;  4I4T E;  5IWA T;  3UU6 A;  3ZSS A;  4MBQ A;  2VQE T;  3ZJ1 A;  4EZH A;  3LDQ B;  4EIW A;  1NWM X;  2XQ3 A;  4I55 E;  2ES0 A;  4HFH A;  2LEH A;  5H6R B;  5ABG A;  2JQK A;  2YK0 A;  3SWH A;  2CBI A;  5FKY A;  1AJ3 A;  1BR0 A;  5HWX A;  1XMO T;  1OED C;  5JTG A;  5IHY A;  3UU5 A;  3UQ4 A;  3RIU A;  4DID B;  4ZHQ E;  3E08 A;  4JI6 T;  5HEH A;  4PK6 A;  4LF9 T;  3RIF A;  3I1A A;  3EDU A;  2BKP A;  2KLQ A;  4Z91 A;  4ZEY A;  4KHZ F;  4EB6 E;  1HF8 A;  4JBW F;  3B57 A;  4C91 A;  4L5G A;  3P4R A;  4U72 A;  3EI0 A;  1YXR A;  2UXN B;  2JQH A;  4AIS A;  2LSK A;  2V5C A;  3RLF F;  2I6H A;  2UXD T;  2DLR A;  5JDQ A;  2FJB A;  2XQ4 A;  2V6Y B;  3PUS A;  4LFA T;  2E9X A;  5LHG B;  4UF0 B;  2CLY C;  3Q5X A;  4FI5 A;  5EK2 A;  2IDO B;  3OYZ A;  2UXX B;  1I6Z A;  4EV6 A;  3B13 A;  1ZOY A;  2YKS A;  2W4X A;  3M3Z B;  2VKO A;  2OA5 A;  3N2G E;  3CVR A;  1MIV A;  5JDH A;  3MZK B;  4H9R C;  4L9I A;  2HHH T;  2NW9 A;  5HEO A;  4LMK A;  3ANW A;  2HPL A;  3AVR A;  5JR9 C;  5L3B B;  5FL1 A;  4WZX A;  2X9H A;  4LF5 T;  2WSS V;  2KIN B;  4GK5 E;  3ZST A;  4ADZ A;  1M62 A;  3LK3 B;  3ZYM A;  4NIQ A;  3ZT7 A;  4HN9 A;  3K8P C;  2J62 A;  2W67 A;  3VR8 A;  1SUM B;  2Q9Q D;  3ZKR A;  4CN1 A;  3H3M A;  4P09 A;  4CN4 A;  3KIN B;  2WDV A;  5F3J A;  4JYA T;  1HS7 A;  4O4J E;  1MMN A;  1IBM T;  4UV9 B;  3AAA B;  4QWN B;  2NW7 A;  4TUY E;  1FMW A;  2H7O A;  2V7M A;  2XQ8 A;  2ACZ A;  2CCQ A;  2IC9 A;  2WDQ A;  4PK5 A;  4G63 A;  2A72 A;  4UEL A;  3BQL A;  5L3D B;  4IDZ A;  4P0B A;  2K3W A;  3AE4 A;  3FHN A;  4JI2 T;  2LM9 A;  1YQ3 A;  2D2S A;  1IJ6 A;  1WCR A;  3CX8 B;  3TLV A;  5LBQ B;  2PBI A;  4ERR A;  4DR1 T;  2VUR A;  5ABF A;  2FBW A;  2XY8 B;  2F4V T;  3S4U A;  2E2A A;  4A97 A;  4AIU A;  5FXW A;  4DR7 T;  2BS4 A;  3BQK A;  3FBL A;  4U3C A;  4LFB T;  2CLY B;  4ILC A;  1VCS A;  3LFM A;  2WZI A;  3PU8 A;  3RIA A;  1UUS A;  1M7K A;  3AAE B;  2N9D A;  3AXJ B;  2FJA A;  3UFG A;  3EHZ A;  4HTE A;  2E9X D;  2IC6 A;  5FVK A;  3P50 A;  4HFB A;  3I0O A;  2CHN A;  2NOX A;  3AE9 A;  5JR9 B;  3RC8 A;  3MKD A;  1U5P A;  3MAC A;  4TWH A;  4XAX B;  3O4X E;  2IML A;  2M6B A;  3E22 E;  5EK3 A;  5DQV A;  5LHI B;  3UU4 A;  3UUB A;  1W9R A;  1US7 B;  3PUZ F;  1MMD A;  2HN2 A;  4JI3 T;  3ZYL A;  3RRW A;  1WR0 A;  2Y6X A;  3H3A A;  3OTO T;  3SRZ A;  1UX5 A;  2IIU A;  2G0U A;  1MND A;  3CWZ B;  5HXE A;  4H9Q C;  1NAF A;  3AA7 B;  1HCI A;  3ONX A;  4AQG A;  1HTJ F;  4YSY A;  2NP9 A;  5HXS A;  2V6Y A;  4UVA B;  4ZS2 A;  2VQF T;  2D9D A;  4Q25 A;  4ZS3 A;  2E5V A;  2W61 A;  4ZI3 D;  1YW0 A;  3DTO A;  4U31 A;  1W0B A;  2C0S A;  2Y8D A;  3CK6 A;  3AE2 A;  3UUN A;  3QC9 A;  5E0O A;  2ZM2 A;  3RX6 A;  4F6R C;  4LF8 T;  2DHR A;  3AE8 A;  4WW0 A;  4TN7 B;  5LJM A;  3RKG A;  5CA1 E;  1OWA A;  4OX9 T;  4WNK A;  3P8C D;  1EZ3 A;  2DL1 A;  3ZN1 B;  3ZT5 A;  5HXH A;  2LLY A;  2D0U A;  4BA9 A;  3AED A;  5AQV B;  1HX1 B;  3LSV A;  3MK7 C;  4PFP A;  2LHR A;  5BR8 T;  3FZH B;  4WYV A;  4IL9 A;  3PJA A;  2MAW A;  5FY1 A;  2J1D G;  2XAH B;  4F8H A;  2CM0 A;  4B6X A;  4ANJ A;  2GK9 A;  2K48 A;  1WYC A;  2XAG B;  4PK4 A;  2ACX A;  3QUJ A;  2CBJ A;  2LSY A;  2W66 A;  4LFC T;  4V1A v;  2OLT A;  3O1I A;  4BJM A;  3VRB A;  3OPC A;  4U7Y A;  4JI5 T;  2YDS A;  2MPK A;  5F8P A;  1OED A;  1BR1 A;  2RA1 A;  3GA8 A;  3N9L A;  4GOU A;  2PJQ A;  1V9D A;  2JPF A;  2EHO B;  1MMA A;  1LVK A;  3N9M A;  3RRC A;  1WLX A;  5FP3 A;  2UUC T;  3VKG A;  4I43 B;  4XBF B;  2WS3 A;  4DMV A;  3ZC0 A;  1MNE A;  2W2U A;  2JQ9 A;  4AKI A;  5LB7 B;  3H37 A;  2YU2 A;  4GKK T;  4ZI2 C;  3L09 A;  4HKA A;  3T1H T;  5JDG A;  2V6X A;  1JNZ A;  3VR9 A;  2P9B A;  3UUX B;  1G73 A;  3UUL A;  2VK9 A;  1N33 T;  2BKO A;  5AQK B;  1D0Z A;  3C4Z A;  2UXC T;  4MAL A;  1DU2 A;  5HCJ A;  3UFE A;  2KZ7 B;  3L8R A;  2IW5 B;  2QA7 A;  5J2U E;  4GKJ T;  3N9N A;  2K24 A;  2N1G A;  5AFU L;  3AA6 B;  2LSG A;  4H63 H;  1MIW A;  3N9O A;  2BG9 E;  3U78 A;  5AQQ B;  4QHO A;  2WDR A;  1XZY A;  4LML A;  1D1B A;  1J5W A;  3CQX C;  2HN1 A;  2X66 A;  4DV6 T;  4GIW A;  2V7L A;  3PUA A;  5KMG P;  3ONJ A;  4QKN A;  3UU3 A;  2D0T A;  5JR9 A;  3CML A;  1YKH B;  2NR4 A;  3IBP A;  3WAJ A;  4ZXL A;  3J9X 1;  5FXZ A;  3ZJ2 A;  4K0U A;  1WYB A;  3IEE A;  1FJG T;  3AEG A;  4DR6 T;  3MA9 A;  2M6I A;  4YY3 T;  3AE6 A;  3P4W A;  3CX6 B;  1W0A A;  2VWA A;  4O2A E;  3LK2 B;  2QGS A;  5JRC A;  2E8I A;  3JC6 D;  3UU8 A;  2XAS B;  1KNP A;  3I0Q A;  3LBX B;  3Q2M A;  4CXY A;  2L3L A;  3F31 A;  3HKC E;  1Y01 A;  5ADX L;  4YLH A;  2WQY A;  3AEF A;  4O2B E;  3NKZ A;  5LYJ E;  2WAU A;  1H7C A;  4OK0 A;  2JIW A;  5JQG E;  3GN5 B;  2Q9Q C;  2V5D A;  4DV1 T;  1T72 A;  2KND A;  5JH7 E;  4GK0 E;  2BG9 B;  3U3I A;  2LJL A;  1MMG A;  3FZF B;  2CA5 A;  4FJO A;  4IDN A;  3OYX A;  4Z90 A;  4KUM B;  4DUY T;  4DR3 T;  5JRE A;  5J0Z A;  1R8I A;  2V7I A;  3I9W A;  4IST A;  3SS1 A;  4EAH A;  3OJA A;  2DWK A;  3NWI A;  4CXX A;  3ZMS B;  1BR4 A;  4CN6 A;  4JI0 T;  3BK9 A;  4AI6 A;  1XNQ T;  4DV0 T;  2LRK A;  3DJB A;  2I59 A;  3KFW X;  1D0X A;  3RC3 A;  4AKL A;  3AVS A;  4GYS A;  4EGW A;  4HFV A;  3ZN0 B;  4Z8X A;  2X67 A;  4LF7 T;  5L4H A;  1IZN B;  3RIU C;  2WZH A;  3NVO A;  3JCF A;  2CWO A;  3X1D A;  4H9S E;  5AQU B;  2FJD A;  4AQY T;  2XQ5 A;  1VRB A;  4JI7 T;  2XQ9 A;  5FXX A;  3O1J A;  3N2O A;  2VVN A;  5C2T A;  3C4W A;  3KVA A;  5DAB A;  2ZM6 T;  4KHP T;  4CQI A;  2NWB A;  3KV9 A;  2XAQ B;  4YT0 A;  5LGU B;  4ZI7 E;  2JRK A;  3SFD A;  5CGM A;  1IBL T;  3HKE E;  2VVS A;  3V5S A;  3RYC E;  5AQR B;  3CPZ A;  3EDV A;  2KWH A;  2A2F X;  3O1H A;  2PG8 A;  3VRA A;  4ILA A;  3FXD B;  3RQW A;  4IE0 A;  4UVB B;  3Q9D A;  5GON E;  3W15 B;  3PE0 A;  4HWC A;  3TLS A;  2IAK A;  4U33 A;  5LMN T;  3CKD A;  4X62 T;  2WMN A;  3K3N A;  2Q9Q B;  2BBH A;  2FJE A;  2WB5 A;  5IUX A;  5CA0 E;  2XAJ B;  3ABV A;  5FNV E;  4AKH A;  3PUR A;  2X0L B;  1MIY A;  5LXT E;  3KBT A;  2CXL A;  2VB6 A;  1UCU A;  5HAX A;  5HYA A;  2XTL A;  1UK5 A;  1IAP A;  3PTR B;  2QRX A;  2PFV A;  5JDM A;  3RH3 A;  3C4X A;  3EAB A;  3SOL A;  5L3F B;  4OFZ A;  4HWI B;  2ZM0 A;  2V1D B;  1HFA A;  2PTF A;  4KI0 F;  5FY7 A;  2YIN A;  1E2A A;  5LHH B;  4JEU B;  2EHO C;  3UQ7 A;  4IDQ A;  2DI4 A;  3CIR A;  2LHN A;  1SE7 A;  4DR5 T;  4TNV A;  2H88 A;  1D1C A;  1QUU A;  3AEE A;  3PV0 F;  4HWD A;  1OXZ A;  4HFE A;  4EED A;  1WRD A;  3CQC B;  4AXP A;  4CI3 B;  1N32 T;  2XQ6 A;  5AQI B;  4YJ3 E;  4O4I E;  3TLW A;  1ZKE A;  4HE8 A;  3PDY A;  5AQO B;  2A9U A;  5FYM A;  3RYF E;  1HNZ T;  2J4G A;  1CUN A;  1YKE B;  2XQ7 A;  3ESL A;  1QLB A;  4M1P A;  1Z0P A;  3KBU A;  4DV3 T;  4UF0 A;  5CJ5 A;  4I0U A;  5LBM A;  1S35 A;  4BJN A;  2IUB A;  4X1K E;  5LP6 E;  4HGA A;  2XM1 A;  2MTQ A;  2B1E A;  5JDN A;  5C8Y E;  4H9O C;  4QH4 A;  4E7Z A;  2UUB T;  2E9X B;  3LK4 2;  1W09 A;  1ZP0 A;  3PUW F;  1U4Q A;  2VKD A;  2LT3 A;  5AQN B;  3UT5 E;  5ABE A;  3A7M A;  2N2N A;  2VL0 A;  4GYR A;  4WBN E;  3AE5 A;  3C64 A;  4IL4 A;  2CPT A;  1QSD A;  3HI2 A;  1VCT A;  3FXE B;  4IT4 A;  2Z6E A;  3A5X A;  3NBX X;  3ANW B;  3FZK B;  3P7I A;  4HWF A;  2YU1 A;  3ZMU B;  3Q5E A;  3AAI A;  4JEH B;  1BR2 A;  2QYW A;  5FXV A;  5HEU A;  5KX5 E;  1D0Y A;  3TLT A;  2BKN A;  3PUV F;  4NUU A;  4EYY R;  2C5K T;  4YJ2 E;  4OHF A;  5AQH B;  5L47 A;  2LOS A;  3AA1 B;  3IHR A;  3TKL B;  3RHW A;  1FMV A;  3AE3 A;  4H63 V;  4X5T A;  4P0A A;  2M67 A;  4DND A;  3N2K E;  4KX6 A;  3KDS E;  4DO0 A;  3UUM A;  4L0R A;  1KNZ A;  5ABH A;  3QB5 K;  1CHU A;  3OVU A;  2UU9 T;  3DP7 A;  1KNR A;  4EYU A;  2H7V C;  2ODV A;  3FZL B;  2BG9 C;  4QXC B;  5L3E B;  2SPC A;  2H3R A;  5LG4 A;  4CZZ B;  4DR2 T;  4YSZ A;  3NZP A;  2XZE A;  3QOF A;  2YEV C;  1X79 A;  2CWY A;  5FMN A;  2JJ9 A;  3RF1 A;  2XHE B;  4H9N C;  3PU3 A;  4JLE A;  3KVB A;  4AQF C;  3ZT6 A;  2WU5 A;  3RGL A;  4IGU A;  1I94 T;  2LSJ A;  2CE7 A;  2BVM A;  2Q9Q A;  2VKJ A;  2C5J A;  5AQL B;  1Y64 B;  2YDQ A;  2CHO A;  3OBV E;  4B3R T;  5BMV E;  3RYI E;  4X64 T;  2ODU A;  2YN6 A;  4ILB A;  3NRY A;  3ZMT B;  4COF A;  1E1H B;  3AXJ A;  4IE5 A;  3N9P A;  4YFS A;  2I0M A;  4AKR B;  2CXD A;  2AXD S;  3L39 A;  1WR6 A;  5FY0 A;  4YTM A;  2LRL A;  2HH7 A;  2AE9 A;  4ZI2 D;  3ZMZ B;  4NXN T;  2IHR 1;  5TAO A;  4TZ4 C;  1UUR A;  3ZYK A;  5LOV E;  5DJQ C;  4YTN A;  4UIG A;  2B76 A;  2HPJ A;  2XAF B;  3VHL A;  4MHC A;  2X9W A;  3Q5D A;  3PUX F;  2XQA A;  2Y48 B;  4IDP A;  4PNI A;  5AQJ B;  2WCA A;  1LRZ A;  5HEG A;  3F57 A;  2UXB T;  1WFD A;  1T98 A;  3JAE A;  1IBK T;  4EXT A;  4IDO A;  1IJ5 A;  5LJN A;  2UUA T;  3EAM A;  1SHZ C;  3O9X A;  5LA6 E;  3EUH A;  2X51 A;  2X9Y A;  4CI1 B;  4TNW A;  1FEW A;  4HFI A;  2X9X A;  4IE4 A;  4B3S T;  1YD8 G;  5A1L A;  3PUQ A;  1OED E;  3PJA J;  1ZEE A;  3R6N A;  3C51 A;  2X68 A;  2QVA A;  2J47 A;  3NRX A;  4ISS A;  1O3X A;  2WBL A;  4I50 E;  3OKQ A;  3L3P A;  4PJL A;  3K3O A;  3UTK A;  3FBZ A;  4HEA A;  3GWH A;  2R6G F;  3IA3 A;  1LVF A;  4LMJ A;  2WWV A;  1HNX T;  5AQF B;  4OYJ A;  2OV9 A;  3ETU A;  4YHH T;  1HG5 A;  2LSI A;  3QB5 A;  4IIJ E;  2JMH A;  3B5M A;  2WM9 A;  4KMC A;  3ZC1 A;  4NUV A;  2LOP A;  4PJN A;  3K3Q C;  4A98 A;  2KT9 A;  4HFD A;  5HWY A;  2ZLY A;  2K9A A;  1D1A A;  3QNU A;  4MLK A;  5AQM B;  1VOM A;  1XDO A;  4AKG A;  1XDP A;  2LKH A;  4QX7 B;  3WI3 A;  3D0T A;  2XJ7 A;  2VKH A;  3C98 B;  4EOZ B;  3ZMV B;  2XQY A;  1XWM A;  4QX8 B;  4C90 A;  2EHO A;  4OYK A;  2RPA A;  4JI4 T;  4X20 E;  2E5L T;  3IF8 B;  1HX8 A;  5H6Q B;  3AA0 B;  3ZPO A;  1SA0 E;  4G2A A;  4JV5 T;  4UXN B;  5LGT B;  1OED B;  4QXB B;  3MJX A;  2DNX A;  3P4P A;  3HKB E;  1UGO A;  1JNR A;  2E9X C;  3HR0 A;  3K1S A;  5HXC A;  4DV5 T;  4DVD A;  3GMI A;  3RYH E;  3CQG B;  4X66 T;  2KWI B;  5CB4 E;  2CMR A;  4EZ4 A;  2JMK A;  2V8S V;  3AE7 A;  1L0V A;  3ETV A;  1J1J A;  5L4E A;  2X0H A;  1NEN A;  3J7Y q;  5C3J A;  2MOZ A;  4NPP A;  4IHJ E;  2W62 A;  4O4H E;  1G8X A;  3WAK A;  4JI1 T;  4B3T T;  3P4S A;  2WY2 A;  4CXW A;  2BDE A;  5HCM A;  5KDM C;  4UR9 A;  2DWG A;  2A3D A;  2NTX A;  3TLU A;  2V7K A;  3PUY F;  4DMW A;  1XNR T;  5J2T E;  5CFB A;  4DV2 T;  3LG7 A;  4QH1 A;  4X1Y E;  3KV4 A;  2CRB A;  5LGN B;  2V7J A;  4QXH B;  4A5X A;  4PJJ A;  5FVL A;  4PFO A;  2KXP B;  2L9Q A;  4KP3 C;  3T1Y T;  3RI5 A;  4IE7 A;  4YHJ A;  2XUE A;  4UV8 B;  4ZI3 C;  4J2C A;  2MYS A;  3P4Q A;  4WBO A;  5DQW A;  4EEB A;  5FL0 A;  3Q5W A;  2X0Y A;  1KFY A;  4LF6 T;  3ONL C;  2ZMA A;  4UVC B;  3RKO A;  4TV8 E;  5J1G A;  3EVY A;  1B7T A;  3C50 A;  4KBM B;  4CI2 B;  1T8B A;  3LBX A;  5LMU T;  1FIO A;  4XZC A;  2H89 A;  2XSB A;  2CEA A;  4DV4 T;  4P1N A;  3AE1 A;  4PW8 A;  2NTY A;  3AEB A;  3FZM B;  1LKX A;  2ZM8 A;  4MFR A;  5JRC B; 
#chains in the Genus database with same CATH homology
 3GN5 A;  3HKC E;  5ADX L;  3FHN A;  4YLH A;  2LM9 A;  2YEV C;  1X79 A;  3E0Z A;  2VAS A;  4O2B E;  2CWY A;  2D2S A;  5LYJ E;  3V5U A;  1IJ6 A;  2WAU A;  2MBG A;  1H7C A;  3M65 A;  1HG2 A;  4OK0 A;  3CX8 B;  5FMN A;  5JQG E;  3GN5 B;  2JJ9 A;  2Q9Q C;  5LBQ B;  2PBI A;  4ASK A;  2XHE B;  4H9N C;  2KND A;  4ERR A;  5JH7 E;  4GK0 E;  4O4L E;  3PU3 A;  2WMO A;  4JLE A;  4BAY B;  3KVB A;  3ZCJ A;  4AQF C;  2EHO D;  4IGU A;  5L3G B;  3U3I A;  2LSJ A;  2LJL A;  1MMG A;  2CE7 A;  1KK7 A;  2BVM A;  2CA5 A;  5IYZ E;  2Q9Q A;  4FJO A;  3OYX A;  3S4U A;  2VKJ A;  2C5J A;  5FXW A;  3KV5 A;  4TX5 A;  4KUM B;  5L2L A;  1Y64 B;  3BQK A;  4AQF A;  3FBL A;  5ETW A;  2CXF A;  3OBV E;  5BMV E;  3RYI E;  3QK6 A;  3PUG A;  5JRE A;  2BVL A;  2ODU A;  3BQI A;  2CLY B;  4IE6 A;  2VL8 A;  3NRY A;  3ZMT B;  2V7I A;  1E1H B;  3I9W A;  4PJM A;  3LFM A;  4IST A;  4IE5 A;  3SS1 A;  3PU8 A;  3VU7 H;  4DBR A;  4H9P C;  4EAH A;  5L3C B;  3OJA A;  2DWK A;  3N9P A;  2D5U A;  4YFS A;  4CXX A;  5HXR A;  3ZMS B;  3AAE B;  1BR4 A;  2N9D A;  4AKR B;  3BK9 A;  4AI6 A;  2CXD A;  2LE8 A;  4HTE A;  3DJB A;  2I59 A;  3KFW X;  1D0X A;  2E9X D;  3ZLI A;  3RC3 A;  2IC6 A;  1WR6 A;  5FY0 A;  2JQQ A;  4AKL A;  3AVS A;  2HH7 A;  4GYS A;  4E7S A;  4HFV A;  3ZN0 B;  3HA4 A;  2L8K A;  2KMF A;  4Z8X A;  3ZMZ B;  4ZI2 D;  3I0O A;  2NOX A;  5LNK A;  1S94 A;  5EK4 A;  5JR9 B;  3RC8 A;  2X67 A;  3MKD A;  1U5P A;  1ZV4 X;  5TAO A;  4TZ4 C;  3MAC A;  1IZN B;  4XAX B;  3ZYK A;  5LOV E;  5M4Y A;  5DJQ C;  3O4X E;  3KV6 A;  3MXZ A;  4DBQ A;  3ZCI A;  3E22 E;  4UIG A;  5EK3 A;  5DQV A;  2HPJ A;  5LHI B;  4ILU A;  2CWO A;  2XAF B;  1US7 B;  4H9S E;  1MMD A;  3VHL A;  4MHC A;  2K5B B;  2V26 A;  3HKD E;  2X9W A;  3ZYL A;  3N9Q A;  2Y48 B;  4PNI A;  3RRW A;  2WWU A;  4JUY A;  3RPU A;  1VRB A;  2Y6X A;  3R84 B;  1LRZ A;  3H3A A;  3I9Y A;  3F57 A;  3ZEF B;  5FXX A;  3O1J A;  3NZQ A;  3SRZ A;  1UX4 A;  3N2O A;  1UX5 A;  2G0U A;  3C4W A;  1MND A;  1T98 A;  3CWZ B;  3KVA A;  5DAB A;  2W0G A;  5JDL A;  4CQI A;  5HXE A;  2NWB A;  4H9Q C;  3T8O A;  3KV9 A;  2XAQ B;  4EXT A;  1NAF A;  5LGU B;  1IJ5 A;  5LJN A;  4ZI7 E;  5JDF A;  2DCF A;  3AA7 B;  4PAG A;  1SHZ C;  2JRK A;  1HCI A;  3O9X A;  3ONX A;  5LA6 E;  3EUH A;  2X51 A;  4AQG A;  2X9Y A;  1HTJ F;  4N78 D;  4ZOL E;  2NP9 A;  4CI1 B;  5HXS A;  1FEW A;  3HKE E;  3N5L A;  4U74 A;  4UEM A;  4UVA B;  2X9X A;  4ZS2 A;  3V5S A;  2RP4 A;  3VKH A;  3RYC E;  4IE4 A;  3CPZ A;  3EDV A;  2KWH A;  1YD8 G;  2A2F X;  4ZS3 A;  3FB2 A;  5A1L A;  3O1H A;  2PG8 A;  2W61 A;  3PUQ A;  5LCY A;  3FXD B;  4IE0 A;  1ZEE A;  4ZI3 D;  1ZHC A;  3F2E A;  5JVD E;  4UVB B;  3Q9D A;  3C51 A;  4X1I E;  2BZB A;  1YW0 A;  2X68 A;  3DTO A;  3R6N A;  5GON E;  3W15 B;  3PE0 A;  3NRX A;  4ISS A;  2C0S A;  2IAK A;  2Y8D A;  4TV9 E;  3LJC A;  1O3X A;  2NW8 A;  4A56 A;  2WBL A;  3UUN A;  4I50 E;  4O8S A;  2C5I T;  3OKQ A;  3QC9 A;  3CKD A;  3L3P A;  2WMN A;  3CX7 B;  5E0O A;  4PJL A;  2ZM2 A;  3K3N A;  2Q9Q B;  3K3O A;  3RX6 A;  5EZY E;  4F6R C;  3UTK A;  2DHR A;  3FBZ A;  4HEA A;  5CA0 E;  2XAJ B;  2W00 A;  4WW0 A;  4TN7 B;  3AB3 B;  5LJM A;  2W63 A;  3GWH A;  1OWA A;  5CA1 E;  1LVF A;  4WNK A;  5FNV E;  3P8C D;  1EZ3 A;  4AKH A;  4OYJ A;  3PUR A;  3ZN1 B;  2X0L B;  3JC6 C;  3ETU A;  5HXH A;  1MIY A;  2D0U A;  4BA9 A;  5LXT E;  3KBT A;  1HG5 A;  2CXL A;  3HL6 A;  2VB6 A;  4I4T E;  1UCU A;  2LSI A;  4IIJ E;  3MK7 C;  5HAX A;  5HYA A;  4PFP A;  2XTL A;  2LHR A;  4MBQ A;  3ZJ1 A;  1IAP A;  2JMH A;  3PTR B;  2WM9 A;  4KMC A;  4EZH A;  3ZC1 A;  5FY1 A;  2PFV A;  2J1D G;  4NUV A;  5JDM A;  3RH3 A;  4EIW A;  3C4X A;  2LOP A;  2XAH B;  3SOL A;  1NWM X;  4I55 E;  2ES0 A;  3K3Q C;  4PJN A;  2CM0 A;  5L3F B;  4B6X A;  2LEH A;  2KT9 A;  4OFZ A;  5HWY A;  2ZLY A;  2ZM0 A;  5H6R B;  2K9A A;  1D1A A;  4MLK A;  2V1D B;  1HFA A;  4ANJ A;  3SWH A;  2YK0 A;  2GK9 A;  2K48 A;  1WYC A;  2XAG B;  1VOM A;  2YIN A;  4PK4 A;  2ACX A;  5FY7 A;  1AJ3 A;  1BR0 A;  5HWX A;  3QUJ A;  5LHH B;  4JEU B;  2EHO C;  2DI4 A;  4AKG A;  2LSY A;  5IHY A;  2LHN A;  4QX7 B;  3WI3 A;  4V1A v;  3D0T A;  1D1C A;  2VKH A;  3O1I A;  4BJM A;  1QUU A;  3C98 B;  3ZMV B;  4EOZ B;  4ZHQ E;  2XQY A;  4QX8 B;  1OXZ A;  4C90 A;  2EHO A;  4OYK A;  3E08 A;  4X20 E;  1WRD A;  3CQC B;  5F8P A;  1BR1 A;  3IF8 B;  4AXP A;  2RA1 A;  4PK6 A;  1HX8 A;  4CI3 B;  5H6Q B;  3I1A A;  3AA0 B;  3EDU A;  3GA8 A;  3N9L A;  4YJ3 E;  4GOU A;  2KLQ A;  3ZPO A;  2PJQ A;  1V9D A;  4O4I E;  2JPF A;  1SA0 E;  4G2A A;  4EB6 E;  2EHO B;  1HF8 A;  1MMA A;  1LVK A;  3N9M A;  4UXN B;  3B57 A;  3RRC A;  5LGT B;  1ZKE A;  4HE8 A;  4C91 A;  3PDY A;  1WLX A;  4L5G A;  5FP3 A;  4QXB B;  5FYM A;  3MJX A;  2DNX A;  4U72 A;  3RYF E;  3VKG A;  4I43 B;  4XBF B;  1CUN A;  3HKB E;  4DMV A;  1YKE B;  3ZC0 A;  1MNE A;  2E9X C;  2UXN B;  4AKI A;  3ESL A;  4M1P A;  1Z0P A;  2LSK A;  3HR0 A;  3H37 A;  3KBU A;  2DLR A;  2YU2 A;  5HXC A;  4ZI2 C;  5JDQ A;  4UF0 A;  3L09 A;  4HKA A;  3PUS A;  4DVD A;  5LBM A;  3GMI A;  5JDG A;  1S35 A;  4BJN A;  3RYH E;  3CQG B;  2E9X A;  4X1K E;  5LP6 E;  2KWI B;  5CB4 E;  4HGA A;  2CMR A;  2P9B A;  4EZ4 A;  2JMK A;  5LHG B;  2MTQ A;  2B1E A;  5JDN A;  3ETV A;  3UUX B;  4UF0 B;  5C8Y E;  1G73 A;  2CLY C;  4H9O C;  3UUL A;  3Q5X A;  2VK9 A;  4FI5 A;  5EK2 A;  4E7Z A;  3OYZ A;  1D0Z A;  2UXX B;  3C4Z A;  2E9X B;  3B13 A;  3LK4 2;  3J7Y q;  2VKO A;  4MAL A;  2OA5 A;  2MOZ A;  3N2G E;  4IHJ E;  2W62 A;  1U4Q A;  2VKD A;  4O4H E;  3CVR A;  1G8X A;  3UFE A;  2KZ7 B;  2IW5 B;  3WAK A;  1MIV A;  2QA7 A;  2LT3 A;  5JDH A;  3UT5 E;  5J2U E;  4CXW A;  3N9N A;  3MZK B;  2BDE A;  2K24 A;  2N2N A;  4H9R C;  2N1G A;  4GYR A;  5KDM C;  2DWG A;  5AFU L;  3AA6 B;  4WBN E;  2A3D A;  4L9I A;  2LSG A;  4H63 H;  3C64 A;  1MIW A;  3N9O A;  3U78 A;  2NW9 A;  2NTX A;  3ANW A;  4QHO A;  1QSD A;  2HPL A;  3AVR A;  2V7K A;  4DMW A;  5JR9 C;  3HI2 A;  5J2T E;  5L3B B;  2X9H A;  3LG7 A;  2WSS V;  3FXE B;  1D1B A;  3CQX C;  2KIN B;  4GK5 E;  4X1Y E;  2Z6E A;  3KV4 A;  4ADZ A;  2X66 A;  3LK3 B;  3A5X A;  4GIW A;  3NBX X;  2V7L A;  3ZYM A;  5LGN B;  3PUA A;  5KMG P;  2V7J A;  3ANW B;  4QKN A;  4QXH B;  4PJJ A;  3P7I A;  4HN9 A;  3K8P C;  2YU1 A;  2D0T A;  2KXP B;  4PFO A;  2L9Q A;  3ZMU B;  3AAI A;  4JEH B;  1BR2 A;  5JR9 A;  3CML A;  4KP3 C;  1YKH B;  2Q9Q D;  5FXV A;  5KX5 E;  4IE7 A;  1D0Y A;  4P09 A;  4YHJ A;  2XUE A;  3IBP A;  4NUU A;  3KIN B;  4EYY R;  2C5K T;  4UV8 B;  4ZI3 C;  4YJ2 E;  3WAJ A;  4J2C A;  4OHF A;  2MYS A;  3J9X 1;  2LOS A;  3AA1 B;  4WBO A;  5DQW A;  5F3J A;  5FXZ A;  3ZJ2 A;  3IHR A;  1HS7 A;  3Q5W A;  3TKL B;  4O4J E;  4K0U A;  1WYB A;  1FMV A;  3IEE A;  1MMN A;  2ZMA A;  4UVC B;  3RKO A;  4TV8 E;  4UV9 B;  4H63 V;  5J1G A;  3MA9 A;  3AAA B;  3EVY A;  4QWN B;  2NW7 A;  4TUY E;  1FMW A;  4P0A A;  3CX6 B;  1B7T A;  3C50 A;  2M67 A;  4DND A;  3N2K E;  4KBM B;  4CI2 B;  2VWA A;  2H7O A;  3KDS E;  4DO0 A;  2V7M A;  3LBX A;  3UUM A;  1FIO A;  4L0R A;  4O2A E;  3LK2 B;  4XZC A;  2CCQ A;  1KNZ A;  2CEA A;  2IC9 A;  2QGS A;  3DP7 A;  5JRC A;  2E8I A;  4EYU A;  4PW8 A;  2H7V C;  2NTY A;  2ODV A;  3JC6 D;  4PK5 A;  4G63 A;  2A72 A;  4UEL A;  4QXC B;  3BQL A;  2XAS B;  5L3E B;  2SPC A;  3I0Q A;  5L3D B;  4IDZ A;  2H3R A;  1LKX A;  4P0B A;  2ZM8 A;  3LBX B;  3Q2M A;  4MFR A;  4CZZ B;  5LG4 A;  2L3L A;  4CXY A;  3F31 A;  3NZP A;  5JRC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...