1BR0A

Three dimensional structure of the n-terminal domain of syntaxin 1a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
b'DRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SYNTAXIN 1-A)
molecule tags Membrane protein
source organism Rattus norvegicus
publication title Three-dimensional structure of an evolutionarily conserved N-terminal domain of syntaxin 1A.
pubmed doi rcsb
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1998-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1br0A00
1FEWA 2XHEB 1BR0A 5M4YA 3C98B 4JEHB 3LG7A 1HS7A 1FIOA 4TX5A 5LG4A 1EZ3A 2DNXA 1G73A 4JEUB 1S94A
chains in the Genus database with same CATH superfamily
3WAKA 1MNEA 3ONXA 5JRCA 3GWHA 2LRLA 5LOVE 3ZEFB 1YD8G 2CHNA 3O4XE 3CX8B 3DP7A 4I55E 2WMOA 4HFCA 1W9RA 2WY2A 3MK7C 4F8HA 3B5MA 2F4VT 4HFIA 4JI6T 4JYAT 3ANWB 3O1JA 4WW0A 4HFHA 3LBXA 4L5GA 3SFDA 2YDSA 4AQYT 1XDPA 4UF0B 3T8OA 2IIUA 2M6BA 1B7TA 2CLYB 2YDQA 2Q9QC 2QGSA 2R6GF 2ZLYA 3E22E 4IGUA 5AQUB 2VVNA 5DQWA 4YJ2E 2WP9A 1XDOA 5CA0E 2VQET 1N33T 5HWYA 1G73A 1KK7A 4YY3T 2NWBA 2ZM0A 1YKEB 2VK9A 4IT4A 4AQFA 5JDFA 2AXDS 5LMUT 4ILAA 2D5UA 2K24A 5JR9C 2NTYA 4CXYA 3FHNA 1CHUA 2WMNA 4GKKT 4NPPA 1D0YA 3AVSA 4EB6E 2RP4A 3B13A 4NUUA 4BAYB 4IHJE 5AQKB 4KI0F 1ZP0A 5EZYE 1KF6A 2DL1A 4CN4A 4P0AA 5A1LA 1NAFA 2IAKA 2X0LB 1HF8A 4MLKA 2NW9A 2BZBA 4YT0A 1XNRT 2G0UA 3HA4A 2MYSA 4O4JE 5BMVE 2W62A 5GONE 1DU2A 3RHWA 3VU7H 3ZSSA 1I6ZA 2XASB 5F5WA 4AKIA 3VKGA 1N32T 2DI4A 3UQ7A 2K9AA 5FP3A 5J1GA 4ZOLE 3VRBA 4I50E 4IE7A 1FMWA 2XSBA 1QSDA 2J1DG 2LE8A 3EDUA 1FMVA 2H7VC 3ZT6A 2JPFA 2BDEA 2YOEA 5KXJA 3NRXA 3AXJA 3IHRA 2K5BB 3CX7B 2MPKA 3P4RA 3RRCA 2WBLA 2E2AA 4N78D 1OEDA 4UV9B 5L3FB 2UUAT 4U7IA 1UX4A 5AQSB 4KUMB 3R6NA 3P7IA 5EK4A 3UU8A 1H7CA 1HNWT 4O8SA 2CPTA 3CK6A 3LJCA 2ACZA 4LFCT 3VRAA 2LOPA 3PJAA 2FJBA 2X9HA 4OX9T 3CPZA 4DR1T 3LG7A 3RF1A 4LFBT 4TWFA 2ZM8A 5KDMC 3AE4A 3J7Yq 3RC8A 4I0UA 1AJ3A 3RRWA 1KNRA 4AI6A 4WNKA 5FY0A 3PU8A 3ZJ1A 5ABFB 1IBKT 4JV5T 1KEYA 1KNPA 1MIVA 2ODVA 3BQIA 4FJOA 2HN2A 2MAWA 4X1KE 2FJDA 3TLSA 4A97A 2V6YA 2V6XA 2X0HA 3HKDE 5LB7B 2BG9C 3RKGA 3H37A 2IDOB 3RX6A 3ZN0B 5BR8T 3AE2A 2HN1A 5HXHA 4DBRA 4UELA 2NOXA 2HPJA 2X9WA 2IW5B 1I94T 3C4ZA 3KV9A 2ZM6T 3RKOA 4LFAT 2WWUA 1HX1B 3CQXC 5HCMA 5LGNB 3PUYF 3MZKB 4F6RC 3C98B 2CXLA 2YINA 4PK5A 2KWHA 2ZM2A 4YHJA 5LGTB 4ZI3D 3QNUA 3HKCE 2N1GA 3LDQB 4U31A 1YQ3A 3UTKA 4X64T 5LMNT 1ZKEA 3NWIA 2YEVC 5ABGA 3MJXA 3O9XA 3NZQA 1E2AA 1UGOA 4UVCB 5AQQB 4TN7B 3SS1A 2BG9E 4DVDA 2XQ8A 5L3BB 4UIGA 5LYJE 2KINB 3RQWA 4O4IE 3J9X1 3DTOA 2MTQA 1NEKA 5AQPB 5AQGB 4X62T 5FKYA 4IL4A 5JQGE 3ZMSB 4EGWA 1U5PA 3GN5B 2UU9T 4ADZA 1Y01A 2L8KA 1SA0E 2JQHA 2CBJA 2WM9A 2VKJA 5AQMB 2UXDT 3Q9DA 4Z90A 2DLRA 4PJNA 3K1SA 2A2FX 5JDQA 4KHPT 5LHIB 2Y48B 3JADA 2C5KT 4DV6T 1YXRA 2SPCA 4JUYA 2XQ6A 4JI2T 2XUEA 1WLXA 2CXFA 3U3IA 4ZHQE 2XAJB 2WS3A 4HTEA 2W67A 3BQLA 2WZHA 2XQYA 4X66T 1BR2A 3ZT7A 3FZFB 2UUBT 1D1AA 5LGUB 3I1AA 4AIUA 5CFBA 4AQGA 3H3AA 3NZPA 4TV8E 3KVBA 4QHOA 2WU5A 4I43B 4WZXA 1IBMT 2BVLA 1SHZC 2X0YA 2LHRA 3UT5E 2FJEA 3KBTA 1XWMA 3PDYA 5LNKA 4DNDA 4IDZA 3AE3A 4O4LE 2UXXB 3AECA 3N2OA 1M7KA 5AQHB 4OYKA 1J5ET 2Y8DA 3UFEA 3QC9A 4YJ3E 2W0GA 2V7LA 3EABA 2NP9A 5EK2A 4HWCA 3MXZA 5LBMA 5E0OA 2UUCT 1NWMX 2KZ7B 3N5LA 4UXNB 4DR5T 2VL0A 2CEAA 3PUAA 1VOMA 4PJMA 1ZV4X 2VKDA 4WBOA 2V26A 1MNDA 2W2UA 1E1HB 2CCQA 3I9WA 1BR0A 5DQVA 2PTFA 5L3GB 3DJBA 3H3MA 4O2AE 2E9XA 4TV9E 4TWHA 4V1Av 4YTMA 3PUVF 3VHLA 2CXDA 1U4QA 4ISTA 1LVKA 4IDQA 4TX5A 5JVDE 4ANJA 5HEJA 5JREA 3ZCJA 3A7MA 3QUJA 3RYHE 2N9DA 5LG3A 4X5TA 3PV0F 4LMKA 2XHEB 4MFRA 4CI2B 2IHR1 2LSIA 1YW0A 3HI2A 4YSZA 2LHNA 3O1HA 3HKBE 2VKHA 4ZEYA 3WAJA 5JDMA 4DV0T 1WCRA 4DV2T 1Z8UA 2XAGB 4ZS3A 4CXXA 4ZI2D 3AEBA 4B3MT 2XJ7A 2ZMAA 2X66A 2C5JA 4GK0E 2KT9A 2IUBA 3OBVE 3KBUA 2XM2A 1LVFA 2H3RA 1M62A 4HWIB 1T98A 4HKAA 2XAFB 2IC9A 2W61A 2WAUA 2XPKA 3AE5A 4DR4T 4EXTA 4XZCA 3CKDA 3CWZB 4Z91A 3ZT5A 5FL1A 1US7B 4JI5T 3RYFE 4DV1T 1QLBA 2LRKA 5H6RB 4CI3B 1OEDC 3NRYA 3P4WA 2J62A 3OKQA 2Q9QB 4EYUA 2V7JA 4PJLA 2WB5A 4X20E 4CN1A 3KFWX 3L39A 3QK6A 4E7ZA 2FJAA 2E8IA 2CM0A 4ZS2A 3E08A 3P50A 4CI1B 2X9XA 1HCIA 2JQKA 2WDRA 4J2CA 4C91A 3LSVA 5L3CB 4H9SE 5FY7A 3FZLB 5HXCA 3GN5A 4PFPA 4TNVA 5L4EA 3P4SA 3FZKB 1XNQT 3C4XA 4HFEA 4DUZT 4H9RC 2PBIA 3VR8A 2EHOA 3ZMVB 1SE7A 1SUMB 2BBJA 5FXWA 4AKRB 3UU6A 5AQFB 3AEEA 3JAEA 3LFMA 4G2AA 1O3XA 5FL0A 5J2UE 1UX5A 5HXRA 2LM9A 2LOSA 2N2NA 3KV5A 5FXXA 4YXDA 3ZN1B 1E7PA 1D0XA 1MMNA 5L3DB 1HG2A 1UK5A 1T8BA 4CXWA 4QXBB 1WRDA 4JI3T 3RPUA 3PUXF 4AISA 1IZNB 3E0ZA 4NXNT 3V5SA 2JQ9A 3ONJA 3VR9A 5AQLB 2LSKA 5M4YA 2PJQA 3K3OA 1HNZT 2VL8A 3RH3A 4PW8A 2D2SA 2KWIB 4GYRA 4KX6A 3AE1A 2V5DA 5HEHA 4EEBA 2P9BA 3CQCB 2AE9A 2BKOA 1YKHB 2QYWA 4ASKA 1XZYA 3JC6C 2X9YA 1HFAA 1HNXT 5HXSA 5IHYA 2CMRA 3QB5K 5JH7E 4DUYT 2HH7A 1G8XA 2V8SV 4JI1T 1OEDB 3QB5A 5KX5E 3KINB 3M3ZB 2BVMA 4LMLA 2BKPA 2CA5A 2V7IA 2V7KA 3N9MA 1D1CA 3IEEA 4TWDA 3AEDA 3N9PA 3MACA 3PTRB 4U33A 4LF8T 3RC3A 4CN6A 5ABHA 4TZ4C 4DV4T 3ESLA 2QA7A 2NR4A 3K8PC 1KFYA 5HEOA 3EVYA 3SWHA 5JDNA 4GIWA 2MOZA 4YFSA 3CMLA 4AXPA 2C5IT 3ZCIA 4PK4A 1FEWA 5IYZE 5IWAT 3N2GE 4TUYE 4DMVA 2BG9A 4MBQA 1FIOA 2WU2A 3KDSE 2KLQA 4G63A 5LXTE 4PFOA 2VQFT 2A9UA 4ZI3C 3N9LA 4QX8B 4HFDA 3C50A 2Z6EA 3O1IA 4IDOA 2B76A 2A3DA 2V5CA 5HAXA 2HPLA 2IC6A 1JNZA 5JR9B 4AKHA 1ZHCA 2XTLA 2Q9QD 4M1PA 3Q2MA 4U3CA 3AEAA 4H9OC 3AEFA 3P4QA 4I4TE 4U2ZA 3I0QA 3N9NA 5F8PA 2DWGA 3BK9A 4YTPA 2CWOA 3EDVA 2DNXA 3QOFA 2YDRA 4JEUB 5ADXL 5J2TE 4YHHT 4WYVA 4BJMA 3G06A 1HX8A 3PUZF 3NBXX 3RYIE 5L3EB 4NXMT 4QKNA 1Y64B 1XMOT 2C0SA 3UUXB 2VB6A 1NENA 1UURA 1ZOYA 2WQYA 3M65A 2M6IA 1S94A 3UULA 2UXCT 4DV7T 4KMCA 3KVAA 4JI8T 3X1DA 4ILCA 4QH5A 4KBMB 3CIRA 2E5LT 5LBQB 5CA1E 3JC6D 2BS4A 3AEGA 5EK3A 3PURA 4X1IE 4B6XA 4H9QC 4BA9A 2YN6A 4QXHB 4JBWF 1VRBA 2HHHT 4ILBA 4YTNA 3L09A 3B57A 4OK0A 2XQ4A 3N2KE 2X68A 3N9OA 2V7MA 2VASA 2Y6XA 1J5WA 2LT3A 2LKHA 2XSAA 2RPAA 3C4WA 3PUGA 4IE6A 2H88A 4JEHB 5AQRB 4EOZB 2W4XA 2BBHA 2EHOC 4LF4T 1OEDE 2QVAA 3RI5A 2FBWA 1OXZA 5FY1A 2UXNB 2M67A 3EAMA 3UU5A 5LJMA 2LEHA 2XQ7A 2NW7A 4DO0A 1HG5A 2JIWA 1HTJF 2K48A 1LKXA 4XAXB 1WYBA 3RLFF 2RA1A 3TKLB 4E7SA 5AFUL 3ONLC 4P0BA 4DV5T 4IE0A 3AE8A 1S35A 5JDLA 5FVKA 2CHOA 3SFEA 3LBXB 1MMDA 2JQQA 4KP3C 4UF0A 3ETVA 2UXBT 5ETWA 3K3QC 2LSGA 4XBFB 1W0AA 2PG8A 2H89A 1BR1A 1KNZA 2IMLA 4C90A 3OYZA 3HKEE 3AA6B 4OHFA 4A98A 2A72A 4IDPA 2WSSV 3CQGB 2K3WA 1HR0T 2XQ3A 4EZHA 5J0ZA 1R8IA 2CLYC 3PUQA 3GA8A 4UV8B 3F57A 2BS2A 4U74A 5JDGA 1FJGT 3I9YA 4ISSA 1GQEA 2YKSA 3AAAB 5AQVB 1XMQT 3OVUA 4YSYA 3MA9A 1IBLT 1V9DA 3ZMZB 4HWFA 2YU1A 4B3RT 3TLVA 1T72A 3ZKRA 5HCJA 4Z8XA 3LK3B 4L0RA 4X65T 5HXEA 4K0KT 3FXEB 4UVBB 1WFDA 4EYYR 3C51A 5LHGB 3SRZA 2CBIA 1LRZA 5AQJB 2L9QA 1WR0A 1VCTA 3AA0B 4EZ4A 5C3JA 4UVAB 2W00A 4GK5E 4ZI2C 3ETUA 4DV3T 4ILUA 4O4HE 5AQNB 2JRKA 2JMKA 2WDQA 2XAQB 4ZZBA 2WDVA 4GOUA 3AXJB 2CWYA 3Q5WA 4EAHA 3AE9A 2BG9B 4AKLA 3ZYLA 2XM1A 2WZIA 2D0UA 2I0MA 2I6HA 2X51A 4JLEA 5HEUA 3U78A 4DMWA 3PUWF 2KNDA 4LF9T 4UR9A 2EHOB 4PK6A 2E9XD 1D0ZA 3JCFA 2J4GA 4HFVA 4QH1A 4HE8A 1Z0PA 1ZEEA 3CVRA 3HL6A 3L3PA 4L9IA 3BQKA 1UCUA 1WYCA 4IDNA 3NVOA 4QX7B 4ZXLA 3RIAA 3ZYMA 4COFA 1N34T 2ODUA 3WI3A 2LJLA 3OTOT 3UUNA 5DABA 4X1YE 1UUSA 3IA3A 3PUSA 5CJ5A 4KHZF 1W09A 2DWKA 2NTXA 1IJ6A 5ABFA 1EZ3A 3AA7B 1CUNA 4PAGA 5AQIB 4EEDA 5LJNA 1MIWA 4H63V 4DR6T 2WCAA 2V6YB 3GMIA 5FXVA 2Q9QA 5LP6E 4A5XA 4OYJA 4ERRA 4HN9A 1QUUA 4GKJT 2XAHB 5H6QB 4U72A 4P1NA 3FB2A 2PFVA 3PE0A 5AQTB 5LCYA 3UUBA 3ZPOA 3I0OA 3K3NA 5HEGA 4WBNE 2XQ5A 3C64A 5HWXA 1N36T 5LG4A 2KSRA 3AE7A 1W0BA 5LA6E 3RIUC 3CX6B 4JI7T 2D0TA 3KV6A 4CZZB 3RIFA 3V5UA 3UFGA 5C2TA 2X67A 3AAIA 3A5XA 3FBLA 3HR0A 3KV4A 1MMGA 3OJAA 2GK9A 4AKGA 3AB3B 4Q25A 4ZZCA 1T7SA 3TLWA 2YK0A 5IUXA 2OV9A 3S4UA 3ZMTB 2JMHA 2ACXA 2VURA 4HGAA 3Q5EA 4U2YA 3MKDA 5ABEA 2WWVA 5L2LA 4DR2T 3T1HT 3ZC0A 3UU4A 4HEAA 2I59A 1MMAA 2KMFA 3FBZA 5TAOA 2XY8B 4DBQA 3P8CD 4MHCA 4GYSA 3ABVA 2V1DB 4CQIA 4IREA 4IIJE 2BKNA 4YSXA 3RYCE 4O2BE 5KMGP 1HS7A 2LLYA 3RGLA 3TLUA 5FYMA 2KXPB 4H63H 3OYXA 2OA5A 3IF8B 3W15B 4DIDB 4LF5T 2BS3A 4NUVA 3ZSTA 2LSYA 3AAEB 3D0TA 4AQFC 3F2EA 4IE5A 1JNRA 4HWHA 5L4HA 5HYAA 4LF7T 1WR6A 2YU2A 3AE6A 2LM2A 1IJ5A 3Q5XA 4H9PC 4BJNA 3ZYKA 4B3TT 2VKOA 5FXZA 5F3JA 5FVLA 2XQ9A 3ZJ2A 4DR7T 2ES0A 3JAFA 4K0UA 3EUHA 4PNIA 3R84B 2NW8A 3NKZA 2LKGA 4A56A 3IBPA 2XZEA 4EIWA 3ZMUB 4B3ST 4U7YA 3OPCA 3RQUA 3UQ4A 2QRXA 4LF6T 3ZLIA 4LMJA 4QH4A 4FI5A 1L0VA 5CGMA 2D9DA 4OFZA 1D1BA 3AVRA 2VWAA 3TLTA 1J1JA 4IE4A 4TNWA 3VKHA 3N9QA 5FNVE 4YLHA 4NIQA 4EV6A 2EHOD 5JTGA 2XQAA 3LK42 4UEMA 2LSJA 5FMNA 2JJ9A 2CE7A 5LHHB 5AQOB 3P4PA 1BR4A 3FZMB 1IAPA 2FUPA 3EHZA 5CB4E 3PJAJ 4HWDA 3ZC1A 1X9BA 2B1EA 4JI4T 2E9XC 5JRCB 2DCFA 3EI0A 4QWNB 2MBGA 3L8RA 1VCSA 3FZHB 4JI0T 3LK2B 3A8YC 3PU3A 4P09A 4QXCB 2H7OA 2CRBA 3ANWA 4MALA 2OLTA 2L3LA 4PJJA 3UUMA 1X79A 3AA1B 3RIUA 3FXDB 5DJQC 5JR9A 2J47A 5C8YE 4DR3T 2VVSA 4ZI7E 2DHRA 2E9XB 3UU3A 2E5VA 2W63A 3Q5DA 4IL9A 3T1YT 1YQ4A 5JDHA 1OWAA 2W66A 3F31A 4HFBA 5L47A 1MIYA 3SOLA 4H9NC
chains in the Genus database with same CATH topology
3WAKA 1MNEA 3ONXA 5JRCA 3GWHA 3ZEFB 5LOVE 1YD8G 3O4XE 3CX8B 3DP7A 4I55E 2WMOA 3MK7C 3ANWB 3O1JA 4WW0A 3LBXA 4L5GA 3T8OA 4UF0B 1B7TA 2CLYB 4AKIA 2Q9QC 2QGSA 2ZLYA 3E22E 4YJ2E 4IGUA 5CA0E 5DQWA 5HWYA 1G73A 1KK7A 2NWBA 2ZM0A 1YKEB 2VK9A 4AQFA 5JDFA 2D5UA 2K24A 5JR9C 2NTYA 4CXYA 3FHNA 2WMNA 1D0YA 3AVSA 4EB6E 2RP4A 3B13A 4NUUA 4BAYB 4IHJE 5EZYE 5A1LA 1NAFA 2IAKA 2X0LB 1HF8A 4MLKA 2NW9A 2BZBA 2G0UA 3HA4A 2MYSA 4O4JE 5BMVE 2W62A 5GONE 3VKGA 3VU7H 2XASB 2DI4A 2K9AA 5FP3A 5J1GA 4ZOLE 4I50E 4IE7A 1FMWA 1QSDA 2J1DG 2LE8A 3EDUA 1FMVA 2H7VC 2JPFA 2BDEA 3NRXA 3IHRA 2K5BB 3CX7B 3RRCA 2WBLA 4N78D 4UV9B 5L3FB 1UX4A 4KUMB 3R6NA 3P7IA 5EK4A 1H7CA 4O8SA 3LJCA 2LOPA 2X9HA 3CPZA 3LG7A 2ZM8A 5KDMC 3J7Yq 3RC8A 1AJ3A 4AI6A 3RRWA 4WNKA 5FY0A 3PU8A 3ZJ1A 4FJOA 1MIVA 2ODVA 3BQIA 4X1KE 4ZHQE 3HKDE 3RX6A 4AKHA 3H37A 3ZN0B 5HXHA 4DBRA 4UELA 2NOXA 2HPJA 2X9WA 2IW5B 3C4ZA 3KV9A 3RKOA 2WWUA 3CQXC 5LGNB 3MZKB 4F6RC 3C98B 2CXLA 2YINA 4PK5A 2KWHA 2ZM2A 4YHJA 5LGTB 4ZI3D 3HKCE 2N1GA 3UTKA 1ZKEA 3O9XA 2YEVC 3MJXA 3NZQA 4UVCB 4TN7B 3SS1A 4DVDA 5LYJE 5L3BB 4UIGA 2KINB 4O4IE 3J9X1 3DTOA 2MTQA 5JQGE 3ZMSB 1U5PA 3GN5B 4ADZA 2L8KA 1SA0E 2WM9A 2VKJA 3Q9DA 2DLRA 4PJNA 2A2FX 5LHIB 2Y48B 2C5KT 2SPCA 4JUYA 2XUEA 1WLXA 2CXFA 3U3IA 2XAJB 4HTEA 3BQLA 2XQYA 1BR2A 1D1AA 5LGUB 3I1AA 4AQGA 3H3AA 3NZPA 4TV8E 3KVBA 4QHOA 4I43B 2BVLA 1SHZC 2LHRA 3UT5E 3KBTA 3PDYA 5LNKA 4DNDA 4IDZA 4O4LE 2UXXB 3N2OA 4OYKA 2Y8DA 3UFEA 3QC9A 4YJ3E 2W0GA 2V7LA 2NP9A 5EK2A 3MXZA 5LBMA 5E0OA 1NWMX 2KZ7B 3N5LA 4UXNB 2CEAA 3PUAA 1VOMA 4PJMA 1ZV4X 2VKDA 4WBOA 2V26A 1MNDA 1BR0A 1E1HB 2CCQA 3I9WA 5DQVA 5L3GB 3DJBA 4O2AE 2E9XA 4TV9E 4V1Av 3VHLA 2CXDA 1U4QA 4ISTA 1LVKA 4TX5A 5JVDE 5JREA 4ANJA 3ZCJA 3QUJA 3RYHE 2N9DA 2XHEB 4MFRA 4CI2B 2LSIA 1YW0A 3HI2A 2LHNA 3O1HA 3HKBE 2VKHA 3WAJA 5JDMA 2XAGB 4ZS3A 4CXXA 4ZI2D 2ZMAA 2X66A 2C5JA 4GK0E 2KT9A 3OBVE 3KBUA 1LVFA 2H3RA 1T98A 4HKAA 2XAFB 2IC9A 2W61A 2WAUA 4EXTA 4XZCA 3CKDA 3CWZB 1US7B 3RYFE 4CI3B 5H6RB 3NRYA 3OKQA 2Q9QB 4EYUA 2V7JA 4PJLA 4X20E 3KFWX 3QK6A 4E7ZA 2E8IA 2CM0A 4ZS2A 3E08A 4CI1B 2X9XA 1HCIA 4J2CA 4C91A 5L3CB 4H9SE 5FY7A 5HXCA 3GN5A 4PFPA 3C4XA 4H9RC 2PBIA 2EHOA 3ZMVB 4AKRB 5FXWA 3LFMA 4G2AA 1O3XA 5J2UE 1UX5A 5HXRA 2LM9A 2LOSA 2N2NA 3KV5A 5FXXA 3ZN1B 1MMNA 1D0XA 5L3DB 1HG2A 4CXWA 4QXBB 1WRDA 3RPUA 1IZNB 3E0ZA 3V5SA 2LSKA 5M4YA 2PJQA 3K3OA 2VL8A 3RH3A 4PW8A 2D2SA 2KWIB 4GYRA 2P9BA 3CQCB 1YKHB 4ASKA 3JC6C 2X9YA 1HFAA 5HXSA 5IHYA 2CMRA 5JH7E 2HH7A 1G8XA 5KX5E 3KINB 2BVMA 2CA5A 2V7IA 3N9MA 2V7KA 1D1CA 3IEEA 3N9PA 3MACA 3PTRB 3RC3A 4TZ4C 3ESLA 2QA7A 3SWHA 3K8PC 3EVYA 5JDNA 4GIWA 2MOZA 4YFSA 3CMLA 4AXPA 2C5IT 3ZCIA 4PK4A 1FEWA 5IYZE 3N2GE 4TUYE 4DMVA 4MBQA 1FIOA 4G63A 3KDSE 2KLQA 5LXTE 4PFOA 4ZI3C 3N9LA 4QX8B 3C50A 2Z6EA 3O1IA 2A3DA 5HAXA 2HPLA 2IC6A 5JR9B 1ZHCA 2XTLA 2Q9QD 4M1PA 3Q2MA 4H9OC 4I4TE 5F8PA 3I0QA 3N9NA 2DWGA 3BK9A 2CWOA 3EDVA 2DNXA 5ADXL 5J2TE 4BJMA 1HX8A 5L3EB 3NBXX 3RYIE 4QKNA 1Y64B 2C0SA 3UUXB 2VB6A 3M65A 3UULA 1S94A 4KMCA 3KVAA 4KBMB 5LBQB 5CA1E 3JC6D 5EK3A 4B6XA 3PURA 4X1IE 4H9QC 4BA9A 4QXHB 1VRBA 3L09A 3B57A 4OK0A 3N2KE 2X68A 3N9OA 2V7MA 2VASA 2Y6XA 2LT3A 4IE6A 3C4WA 4JEUB 3PUGA 4EOZB 5JDQA 4JEHB 2EHOC 1OXZA 5FY1A 2UXNB 2M67A 5LJMA 2LEHA 2NW7A 4DO0A 1HG5A 1HTJF 2K48A 1LKXA 4XAXB 1WYBA 3TKLB 2RA1A 5AFUL 4E7SA 4P0BA 4IE0A 1S35A 5JDLA 3LBXB 1MMDA 2JQQA 4KP3C 4UF0A 3ETVA 5ETWA 3K3QC 2LSGA 4XBFB 2PG8A 1KNZA 1BR1A 4C90A 3OYZA 3HKEE 3AA6B 4OHFA 2A72A 2WSSV 3CQGB 4EZHA 2CLYC 3PUQA 4UV8B 3GA8A 3F57A 4U74A 5JDGA 3I9YA 4ISSA 3AAAB 3MA9A 1V9DA 3ZMZB 2YU1A 4Z8XA 3LK3B 4L0RA 5HXEA 3FXEB 4UVBB 4EYYR 3C51A 5LHGB 3SRZA 1LRZA 2L9QA 4EZ4A 3AA0B 4UVAB 2W00A 4GK5E 4ZI2C 3ETUA 4ILUA 4O4HE 2JRKA 2JMKA 2XAQB 4GOUA 2CWYA 3Q5WA 4EAHA 4AKLA 3ZYLA 4JLEA 2X51A 2D0UA 3U78A 4DMWA 2KNDA 2EHOB 4PK6A 2E9XD 1D0ZA 4HFVA 4HE8A 1Z0PA 1ZEEA 3CVRA 3HL6A 3L3PA 4L9IA 3BQKA 1UCUA 1WYCA 3ZYMA 4DBQA 4QX7B 4P0AA 2ODUA 3WI3A 2LJLA 3UUNA 5DABA 4X1YE 3PUSA 2DWKA 2NTXA 1IJ6A 1EZ3A 3AA7B 1CUNA 4PAGA 5LJNA 1MIWA 4H63V 5LP6E 3GMIA 5FXVA 2Q9QA 4OYJA 4ERRA 4HN9A 1QUUA 2XAHB 5H6QB 4U72A 5LCYA 3FB2A 2PFVA 3PE0A 3ZPOA 3I0OA 3K3NA 4WBNE 5HWXA 3C64A 5LG4A 5LA6E 3CX6B 2D0TA 3KV6A 4CZZB 3V5UA 2X67A 3AAIA 3A5XA 3FBLA 3HR0A 3KV4A 1MMGA 3OJAA 2GK9A 4AKGA 3AB3B 2YK0A 3S4UA 3ZMTB 2JMHA 2ACXA 4HGAA 3MKDA 3ZC0A 5L2LA 4HEAA 2I59A 1MMAA 2KMFA 3FBZA 5TAOA 3P8CD 4MHCA 4GYSA 4CQIA 2V1DB 4IIJE 5KMGP 3RYCE 4O2BE 1HS7A 5FYMA 2KXPB 4H63H 3OYXA 2OA5A 3IF8B 3W15B 4NUVA 2LSYA 3AAEB 3D0TA 4AQFC 3F2EA 4IE5A 5HYAA 1WR6A 2YU2A 4H9PC 3Q5XA 1IJ5A 4BJNA 3ZYKA 2VKOA 5FXZA 5F3JA 3ZJ2A 2ES0A 4K0UA 3EUHA 4PNIA 3R84B 2NW8A 4A56A 3IBPA 4EIWA 3ZMUB 3ZLIA 4FI5A 4OFZA 1D1BA 3AVRA 2VWAA 4IE4A 3VKHA 3N9QA 5FNVE 4YLHA 2EHOD 3LK42 4UEMA 2LSJA 5FMNA 2JJ9A 2CE7A 5LHHB 1BR4A 5CB4E 1IAPA 5JRCB 3ZC1A 2B1EA 2E9XC 2DCFA 4QWNB 2MBGA 3LK2B 3PU3A 4P09A 4QXCB 4ZI7E 2H7OA 3UUMA 3ANWA 4MALA 4PJJA 2L3LA 1X79A 3AA1B 3FXDB 5DJQC 5JR9A 5C8YE 2DHRA 2E9XB 2W63A 5JDHA 1OWAA 3F31A 1MIYA 3SOLA 4H9NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEW A;  2XHE B;  1BR0 A;  5M4Y A;  3C98 B;  4JEH B;  3LG7 A;  1HS7 A;  1FIO A;  4TX5 A;  5LG4 A;  1EZ3 A;  2DNX A;  1G73 A;  4JEU B;  1S94 A; 
#chains in the Genus database with same CATH topology
 3WAK A;  1MNE A;  3ONX A;  5JRC A;  3GWH A;  2LRL A;  5LOV E;  3ZEF B;  1YD8 G;  2CHN A;  3O4X E;  3CX8 B;  3DP7 A;  4I55 E;  2WMO A;  4HFC A;  1W9R A;  2WY2 A;  3MK7 C;  4F8H A;  3B5M A;  2F4V T;  4HFI A;  4JI6 T;  4JYA T;  3ANW B;  3O1J A;  4WW0 A;  4HFH A;  3LBX A;  4L5G A;  3SFD A;  2YDS A;  4AQY T;  1XDP A;  4UF0 B;  3T8O A;  2IIU A;  2M6B A;  1B7T A;  2CLY B;  2YDQ A;  2Q9Q C;  2QGS A;  2R6G F;  2ZLY A;  3E22 E;  4IGU A;  5AQU B;  2VVN A;  5DQW A;  4YJ2 E;  2WP9 A;  1XDO A;  5CA0 E;  2VQE T;  1N33 T;  5HWY A;  1G73 A;  1KK7 A;  4YY3 T;  2NWB A;  2ZM0 A;  1YKE B;  2VK9 A;  4IT4 A;  4AQF A;  5JDF A;  2AXD S;  5LMU T;  4ILA A;  2D5U A;  2K24 A;  5JR9 C;  2NTY A;  4CXY A;  3FHN A;  1CHU A;  2WMN A;  4GKK T;  4NPP A;  1D0Y A;  3AVS A;  4EB6 E;  2RP4 A;  3B13 A;  4NUU A;  4BAY B;  4IHJ E;  5AQK B;  4KI0 F;  1ZP0 A;  5EZY E;  1KF6 A;  2DL1 A;  4CN4 A;  4P0A A;  5A1L A;  1NAF A;  2IAK A;  2X0L B;  1HF8 A;  4MLK A;  2NW9 A;  2BZB A;  4YT0 A;  1XNR T;  2G0U A;  3HA4 A;  2MYS A;  4O4J E;  5BMV E;  2W62 A;  5GON E;  1DU2 A;  3RHW A;  3VU7 H;  3ZSS A;  1I6Z A;  2XAS B;  5F5W A;  4AKI A;  3VKG A;  1N32 T;  2DI4 A;  3UQ7 A;  2K9A A;  5FP3 A;  5J1G A;  4ZOL E;  3VRB A;  4I50 E;  4IE7 A;  1FMW A;  2XSB A;  1QSD A;  2J1D G;  2LE8 A;  3EDU A;  1FMV A;  2H7V C;  3ZT6 A;  2JPF A;  2BDE A;  2YOE A;  5KXJ A;  3NRX A;  3AXJ A;  3IHR A;  2K5B B;  3CX7 B;  2MPK A;  3P4R A;  3RRC A;  2WBL A;  2E2A A;  4N78 D;  1OED A;  4UV9 B;  5L3F B;  2UUA T;  4U7I A;  1UX4 A;  5AQS B;  4KUM B;  3R6N A;  3P7I A;  5EK4 A;  3UU8 A;  1H7C A;  1HNW T;  4O8S A;  2CPT A;  3CK6 A;  3LJC A;  2ACZ A;  4LFC T;  3VRA A;  2LOP A;  3PJA A;  2FJB A;  2X9H A;  4OX9 T;  3CPZ A;  4DR1 T;  3LG7 A;  3RF1 A;  4LFB T;  4TWF A;  2ZM8 A;  5KDM C;  3AE4 A;  3J7Y q;  3RC8 A;  4I0U A;  1AJ3 A;  3RRW A;  1KNR A;  4AI6 A;  4WNK A;  5FY0 A;  3PU8 A;  3ZJ1 A;  5ABF B;  1IBK T;  4JV5 T;  1KEY A;  1KNP A;  1MIV A;  2ODV A;  3BQI A;  4FJO A;  2HN2 A;  2MAW A;  4X1K E;  2FJD A;  3TLS A;  4A97 A;  2V6Y A;  2V6X A;  2X0H A;  3HKD E;  5LB7 B;  2BG9 C;  3RKG A;  3H37 A;  2IDO B;  3RX6 A;  3ZN0 B;  5BR8 T;  3AE2 A;  2HN1 A;  5HXH A;  4DBR A;  4UEL A;  2NOX A;  2HPJ A;  2X9W A;  2IW5 B;  1I94 T;  3C4Z A;  3KV9 A;  2ZM6 T;  3RKO A;  4LFA T;  2WWU A;  1HX1 B;  3CQX C;  5HCM A;  5LGN B;  3PUY F;  3MZK B;  4F6R C;  3C98 B;  2CXL A;  2YIN A;  4PK5 A;  2KWH A;  2ZM2 A;  4YHJ A;  5LGT B;  4ZI3 D;  3QNU A;  3HKC E;  2N1G A;  3LDQ B;  4U31 A;  1YQ3 A;  3UTK A;  4X64 T;  5LMN T;  1ZKE A;  3NWI A;  2YEV C;  5ABG A;  3MJX A;  3O9X A;  3NZQ A;  1E2A A;  1UGO A;  4UVC B;  5AQQ B;  4TN7 B;  3SS1 A;  2BG9 E;  4DVD A;  2XQ8 A;  5L3B B;  4UIG A;  5LYJ E;  2KIN B;  3RQW A;  4O4I E;  3J9X 1;  3DTO A;  2MTQ A;  1NEK A;  5AQP B;  5AQG B;  4X62 T;  5FKY A;  4IL4 A;  5JQG E;  3ZMS B;  4EGW A;  1U5P A;  3GN5 B;  2UU9 T;  4ADZ A;  1Y01 A;  2L8K A;  1SA0 E;  2JQH A;  2CBJ A;  2WM9 A;  2VKJ A;  5AQM B;  2UXD T;  3Q9D A;  4Z90 A;  2DLR A;  4PJN A;  3K1S A;  2A2F X;  5JDQ A;  4KHP T;  5LHI B;  2Y48 B;  3JAD A;  2C5K T;  4DV6 T;  1YXR A;  2SPC A;  4JUY A;  2XQ6 A;  4JI2 T;  2XUE A;  1WLX A;  2CXF A;  3U3I A;  4ZHQ E;  2XAJ B;  2WS3 A;  4HTE A;  2W67 A;  3BQL A;  2WZH A;  2XQY A;  4X66 T;  1BR2 A;  3ZT7 A;  3FZF B;  2UUB T;  1D1A A;  5LGU B;  3I1A A;  4AIU A;  5CFB A;  4AQG A;  3H3A A;  3NZP A;  4TV8 E;  3KVB A;  4QHO A;  2WU5 A;  4I43 B;  4WZX A;  1IBM T;  2BVL A;  1SHZ C;  2X0Y A;  2LHR A;  3UT5 E;  2FJE A;  3KBT A;  1XWM A;  3PDY A;  5LNK A;  4DND A;  4IDZ A;  3AE3 A;  4O4L E;  2UXX B;  3AEC A;  3N2O A;  1M7K A;  5AQH B;  4OYK A;  1J5E T;  2Y8D A;  3UFE A;  3QC9 A;  4YJ3 E;  2W0G A;  2V7L A;  3EAB A;  2NP9 A;  5EK2 A;  4HWC A;  3MXZ A;  5LBM A;  5E0O A;  2UUC T;  1NWM X;  2KZ7 B;  3N5L A;  4UXN B;  4DR5 T;  2VL0 A;  2CEA A;  3PUA A;  1VOM A;  4PJM A;  1ZV4 X;  2VKD A;  4WBO A;  2V26 A;  1MND A;  2W2U A;  1E1H B;  2CCQ A;  3I9W A;  1BR0 A;  5DQV A;  2PTF A;  5L3G B;  3DJB A;  3H3M A;  4O2A E;  2E9X A;  4TV9 E;  4TWH A;  4V1A v;  4YTM A;  3PUV F;  3VHL A;  2CXD A;  1U4Q A;  4IST A;  1LVK A;  4IDQ A;  4TX5 A;  5JVD E;  4ANJ A;  5HEJ A;  5JRE A;  3ZCJ A;  3A7M A;  3QUJ A;  3RYH E;  2N9D A;  5LG3 A;  4X5T A;  3PV0 F;  4LMK A;  2XHE B;  4MFR A;  4CI2 B;  2IHR 1;  2LSI A;  1YW0 A;  3HI2 A;  4YSZ A;  2LHN A;  3O1H A;  3HKB E;  2VKH A;  4ZEY A;  3WAJ A;  5JDM A;  4DV0 T;  1WCR A;  4DV2 T;  1Z8U A;  2XAG B;  4ZS3 A;  4CXX A;  4ZI2 D;  3AEB A;  4B3M T;  2XJ7 A;  2ZMA A;  2X66 A;  2C5J A;  4GK0 E;  2KT9 A;  2IUB A;  3OBV E;  3KBU A;  2XM2 A;  1LVF A;  2H3R A;  1M62 A;  4HWI B;  1T98 A;  4HKA A;  2XAF B;  2IC9 A;  2W61 A;  2WAU A;  2XPK A;  3AE5 A;  4DR4 T;  4EXT A;  4XZC A;  3CKD A;  3CWZ B;  4Z91 A;  3ZT5 A;  5FL1 A;  1US7 B;  4JI5 T;  3RYF E;  4DV1 T;  1QLB A;  2LRK A;  5H6R B;  4CI3 B;  1OED C;  3NRY A;  3P4W A;  2J62 A;  3OKQ A;  2Q9Q B;  4EYU A;  2V7J A;  4PJL A;  2WB5 A;  4X20 E;  4CN1 A;  3KFW X;  3L39 A;  3QK6 A;  4E7Z A;  2FJA A;  2E8I A;  2CM0 A;  4ZS2 A;  3E08 A;  3P50 A;  4CI1 B;  2X9X A;  1HCI A;  2JQK A;  2WDR A;  4J2C A;  4C91 A;  3LSV A;  5L3C B;  4H9S E;  5FY7 A;  3FZL B;  5HXC A;  3GN5 A;  4PFP A;  4TNV A;  5L4E A;  3P4S A;  3FZK B;  1XNQ T;  3C4X A;  4HFE A;  4DUZ T;  4H9R C;  2PBI A;  3VR8 A;  2EHO A;  3ZMV B;  1SE7 A;  1SUM B;  2BBJ A;  5FXW A;  4AKR B;  3UU6 A;  5AQF B;  3AEE A;  3JAE A;  3LFM A;  4G2A A;  1O3X A;  5FL0 A;  5J2U E;  1UX5 A;  5HXR A;  2LM9 A;  2LOS A;  2N2N A;  3KV5 A;  5FXX A;  4YXD A;  3ZN1 B;  1E7P A;  1D0X A;  1MMN A;  5L3D B;  1HG2 A;  1UK5 A;  1T8B A;  4CXW A;  4QXB B;  1WRD A;  4JI3 T;  3RPU A;  3PUX F;  4AIS A;  1IZN B;  3E0Z A;  4NXN T;  3V5S A;  2JQ9 A;  3ONJ A;  3VR9 A;  5AQL B;  2LSK A;  5M4Y A;  2PJQ A;  3K3O A;  1HNZ T;  2VL8 A;  3RH3 A;  4PW8 A;  2D2S A;  2KWI B;  4GYR A;  4KX6 A;  3AE1 A;  2V5D A;  5HEH A;  4EEB A;  2P9B A;  3CQC B;  2AE9 A;  2BKO A;  1YKH B;  2QYW A;  4ASK A;  1XZY A;  3JC6 C;  2X9Y A;  1HFA A;  1HNX T;  5HXS A;  5IHY A;  2CMR A;  3QB5 K;  5JH7 E;  4DUY T;  2HH7 A;  1G8X A;  2V8S V;  4JI1 T;  1OED B;  3QB5 A;  5KX5 E;  3KIN B;  3M3Z B;  2BVM A;  4LML A;  2BKP A;  2CA5 A;  2V7I A;  2V7K A;  3N9M A;  1D1C A;  3IEE A;  4TWD A;  3AED A;  3N9P A;  3MAC A;  3PTR B;  4U33 A;  4LF8 T;  3RC3 A;  4CN6 A;  5ABH A;  4TZ4 C;  4DV4 T;  3ESL A;  2QA7 A;  2NR4 A;  3K8P C;  1KFY A;  5HEO A;  3EVY A;  3SWH A;  5JDN A;  4GIW A;  2MOZ A;  4YFS A;  3CML A;  4AXP A;  2C5I T;  3ZCI A;  4PK4 A;  1FEW A;  5IYZ E;  5IWA T;  3N2G E;  4TUY E;  4DMV A;  2BG9 A;  4MBQ A;  1FIO A;  2WU2 A;  3KDS E;  2KLQ A;  4G63 A;  5LXT E;  4PFO A;  2VQF T;  2A9U A;  4ZI3 C;  3N9L A;  4QX8 B;  4HFD A;  3C50 A;  2Z6E A;  3O1I A;  4IDO A;  2B76 A;  2A3D A;  2V5C A;  5HAX A;  2HPL A;  2IC6 A;  1JNZ A;  5JR9 B;  4AKH A;  1ZHC A;  2XTL A;  2Q9Q D;  4M1P A;  3Q2M A;  4U3C A;  3AEA A;  4H9O C;  3AEF A;  3P4Q A;  4I4T E;  4U2Z A;  3I0Q A;  3N9N A;  5F8P A;  2DWG A;  3BK9 A;  4YTP A;  2CWO A;  3EDV A;  2DNX A;  3QOF A;  2YDR A;  4JEU B;  5ADX L;  5J2T E;  4YHH T;  4WYV A;  4BJM A;  3G06 A;  1HX8 A;  3PUZ F;  3NBX X;  3RYI E;  5L3E B;  4NXM T;  4QKN A;  1Y64 B;  1XMO T;  2C0S A;  3UUX B;  2VB6 A;  1NEN A;  1UUR A;  1ZOY A;  2WQY A;  3M65 A;  2M6I A;  1S94 A;  3UUL A;  2UXC T;  4DV7 T;  4KMC A;  3KVA A;  4JI8 T;  3X1D A;  4ILC A;  4QH5 A;  4KBM B;  3CIR A;  2E5L T;  5LBQ B;  5CA1 E;  3JC6 D;  2BS4 A;  3AEG A;  5EK3 A;  3PUR A;  4X1I E;  4B6X A;  4H9Q C;  4BA9 A;  2YN6 A;  4QXH B;  4JBW F;  1VRB A;  2HHH T;  4ILB A;  4YTN A;  3L09 A;  3B57 A;  4OK0 A;  2XQ4 A;  3N2K E;  2X68 A;  3N9O A;  2V7M A;  2VAS A;  2Y6X A;  1J5W A;  2LT3 A;  2LKH A;  2XSA A;  2RPA A;  3C4W A;  3PUG A;  4IE6 A;  2H88 A;  4JEH B;  5AQR B;  4EOZ B;  2W4X A;  2BBH A;  2EHO C;  4LF4 T;  1OED E;  2QVA A;  3RI5 A;  2FBW A;  1OXZ A;  5FY1 A;  2UXN B;  2M67 A;  3EAM A;  3UU5 A;  5LJM A;  2LEH A;  2XQ7 A;  2NW7 A;  4DO0 A;  1HG5 A;  2JIW A;  1HTJ F;  2K48 A;  1LKX A;  4XAX B;  1WYB A;  3RLF F;  2RA1 A;  3TKL B;  4E7S A;  5AFU L;  3ONL C;  4P0B A;  4DV5 T;  4IE0 A;  3AE8 A;  1S35 A;  5JDL A;  5FVK A;  2CHO A;  3SFE A;  3LBX B;  1MMD A;  2JQQ A;  4KP3 C;  4UF0 A;  3ETV A;  2UXB T;  5ETW A;  3K3Q C;  2LSG A;  4XBF B;  1W0A A;  2PG8 A;  2H89 A;  1BR1 A;  1KNZ A;  2IML A;  4C90 A;  3OYZ A;  3HKE E;  3AA6 B;  4OHF A;  4A98 A;  2A72 A;  4IDP A;  2WSS V;  3CQG B;  2K3W A;  1HR0 T;  2XQ3 A;  4EZH A;  5J0Z A;  1R8I A;  2CLY C;  3PUQ A;  3GA8 A;  4UV8 B;  3F57 A;  2BS2 A;  4U74 A;  5JDG A;  1FJG T;  3I9Y A;  4ISS A;  1GQE A;  2YKS A;  3AAA B;  5AQV B;  1XMQ T;  3OVU A;  4YSY A;  3MA9 A;  1IBL T;  1V9D A;  3ZMZ B;  4HWF A;  2YU1 A;  4B3R T;  3TLV A;  1T72 A;  3ZKR A;  5HCJ A;  4Z8X A;  3LK3 B;  4L0R A;  4X65 T;  5HXE A;  4K0K T;  3FXE B;  4UVB B;  1WFD A;  4EYY R;  3C51 A;  5LHG B;  3SRZ A;  2CBI A;  1LRZ A;  5AQJ B;  2L9Q A;  1WR0 A;  1VCT A;  3AA0 B;  4EZ4 A;  5C3J A;  4UVA B;  2W00 A;  4GK5 E;  4ZI2 C;  3ETU A;  4DV3 T;  4ILU A;  4O4H E;  5AQN B;  2JRK A;  2JMK A;  2WDQ A;  2XAQ B;  4ZZB A;  2WDV A;  4GOU A;  3AXJ B;  2CWY A;  3Q5W A;  4EAH A;  3AE9 A;  2BG9 B;  4AKL A;  3ZYL A;  2XM1 A;  2WZI A;  2D0U A;  2I0M A;  2I6H A;  2X51 A;  4JLE A;  5HEU A;  3U78 A;  4DMW A;  3PUW F;  2KND A;  4LF9 T;  4UR9 A;  2EHO B;  4PK6 A;  2E9X D;  1D0Z A;  3JCF A;  2J4G A;  4HFV A;  4QH1 A;  4HE8 A;  1Z0P A;  1ZEE A;  3CVR A;  3HL6 A;  3L3P A;  4L9I A;  3BQK A;  1UCU A;  1WYC A;  4IDN A;  3NVO A;  4QX7 B;  4ZXL A;  3RIA A;  3ZYM A;  4COF A;  1N34 T;  2ODU A;  3WI3 A;  2LJL A;  3OTO T;  3UUN A;  5DAB A;  4X1Y E;  1UUS A;  3IA3 A;  3PUS A;  5CJ5 A;  4KHZ F;  1W09 A;  2DWK A;  2NTX A;  1IJ6 A;  5ABF A;  1EZ3 A;  3AA7 B;  1CUN A;  4PAG A;  5AQI B;  4EED A;  5LJN A;  1MIW A;  4H63 V;  4DR6 T;  2WCA A;  2V6Y B;  3GMI A;  5FXV A;  2Q9Q A;  5LP6 E;  4A5X A;  4OYJ A;  4ERR A;  4HN9 A;  1QUU A;  4GKJ T;  2XAH B;  5H6Q B;  4U72 A;  4P1N A;  3FB2 A;  2PFV A;  3PE0 A;  5AQT B;  5LCY A;  3UUB A;  3ZPO A;  3I0O A;  3K3N A;  5HEG A;  4WBN E;  2XQ5 A;  3C64 A;  5HWX A;  1N36 T;  5LG4 A;  2KSR A;  3AE7 A;  1W0B A;  5LA6 E;  3RIU C;  3CX6 B;  4JI7 T;  2D0T A;  3KV6 A;  4CZZ B;  3RIF A;  3V5U A;  3UFG A;  5C2T A;  2X67 A;  3AAI A;  3A5X A;  3FBL A;  3HR0 A;  3KV4 A;  1MMG A;  3OJA A;  2GK9 A;  4AKG A;  3AB3 B;  4Q25 A;  4ZZC A;  1T7S A;  3TLW A;  2YK0 A;  5IUX A;  2OV9 A;  3S4U A;  3ZMT B;  2JMH A;  2ACX A;  2VUR A;  4HGA A;  3Q5E A;  4U2Y A;  3MKD A;  5ABE A;  2WWV A;  5L2L A;  4DR2 T;  3T1H T;  3ZC0 A;  3UU4 A;  4HEA A;  2I59 A;  1MMA A;  2KMF A;  3FBZ A;  5TAO A;  2XY8 B;  4DBQ A;  3P8C D;  4MHC A;  4GYS A;  3ABV A;  2V1D B;  4CQI A;  4IRE A;  4IIJ E;  2BKN A;  4YSX A;  3RYC E;  4O2B E;  5KMG P;  1HS7 A;  2LLY A;  3RGL A;  3TLU A;  5FYM A;  2KXP B;  4H63 H;  3OYX A;  2OA5 A;  3IF8 B;  3W15 B;  4DID B;  4LF5 T;  2BS3 A;  4NUV A;  3ZST A;  2LSY A;  3AAE B;  3D0T A;  4AQF C;  3F2E A;  4IE5 A;  1JNR A;  4HWH A;  5L4H A;  5HYA A;  4LF7 T;  1WR6 A;  2YU2 A;  3AE6 A;  2LM2 A;  1IJ5 A;  3Q5X A;  4H9P C;  4BJN A;  3ZYK A;  4B3T T;  2VKO A;  5FXZ A;  5F3J A;  5FVL A;  2XQ9 A;  3ZJ2 A;  4DR7 T;  2ES0 A;  3JAF A;  4K0U A;  3EUH A;  4PNI A;  3R84 B;  2NW8 A;  3NKZ A;  2LKG A;  4A56 A;  3IBP A;  2XZE A;  4EIW A;  3ZMU B;  4B3S T;  4U7Y A;  3OPC A;  3RQU A;  3UQ4 A;  2QRX A;  4LF6 T;  3ZLI A;  4LMJ A;  4QH4 A;  4FI5 A;  1L0V A;  5CGM A;  2D9D A;  4OFZ A;  1D1B A;  3AVR A;  2VWA A;  3TLT A;  1J1J A;  4IE4 A;  4TNW A;  3VKH A;  3N9Q A;  5FNV E;  4YLH A;  4NIQ A;  4EV6 A;  2EHO D;  5JTG A;  2XQA A;  3LK4 2;  4UEM A;  2LSJ A;  5FMN A;  2JJ9 A;  2CE7 A;  5LHH B;  5AQO B;  3P4P A;  1BR4 A;  3FZM B;  1IAP A;  2FUP A;  3EHZ A;  5CB4 E;  3PJA J;  4HWD A;  3ZC1 A;  1X9B A;  2B1E A;  4JI4 T;  2E9X C;  5JRC B;  2DCF A;  3EI0 A;  4QWN B;  2MBG A;  3L8R A;  1VCS A;  3FZH B;  4JI0 T;  3LK2 B;  3A8Y C;  3PU3 A;  4P09 A;  4QXC B;  2H7O A;  2CRB A;  3ANW A;  4MAL A;  2OLT A;  2L3L A;  4PJJ A;  3UUM A;  1X79 A;  3AA1 B;  3RIU A;  3FXD B;  5DJQ C;  5JR9 A;  2J47 A;  5C8Y E;  4DR3 T;  2VVS A;  4ZI7 E;  2DHR A;  2E9X B;  3UU3 A;  2E5V A;  2W63 A;  3Q5D A;  4IL9 A;  3T1Y T;  1YQ4 A;  5JDH A;  1OWA A;  2W66 A;  3F31 A;  4HFB A;  5L47 A;  1MIY A;  3SOL A;  4H9N C; 
#chains in the Genus database with same CATH homology
 3WAK A;  1MNE A;  3ONX A;  5JRC A;  3GWH A;  3ZEF B;  5LOV E;  1YD8 G;  3O4X E;  3CX8 B;  3DP7 A;  4I55 E;  2WMO A;  3MK7 C;  3ANW B;  3O1J A;  4WW0 A;  3LBX A;  4L5G A;  3T8O A;  4UF0 B;  1B7T A;  2CLY B;  4AKI A;  2Q9Q C;  2QGS A;  2ZLY A;  3E22 E;  4YJ2 E;  4IGU A;  5CA0 E;  5DQW A;  5HWY A;  1G73 A;  1KK7 A;  2NWB A;  2ZM0 A;  1YKE B;  2VK9 A;  4AQF A;  5JDF A;  2D5U A;  2K24 A;  5JR9 C;  2NTY A;  4CXY A;  3FHN A;  2WMN A;  1D0Y A;  3AVS A;  4EB6 E;  2RP4 A;  3B13 A;  4NUU A;  4BAY B;  4IHJ E;  5EZY E;  5A1L A;  1NAF A;  2IAK A;  2X0L B;  1HF8 A;  4MLK A;  2NW9 A;  2BZB A;  2G0U A;  3HA4 A;  2MYS A;  4O4J E;  5BMV E;  2W62 A;  5GON E;  3VKG A;  3VU7 H;  2XAS B;  2DI4 A;  2K9A A;  5FP3 A;  5J1G A;  4ZOL E;  4I50 E;  4IE7 A;  1FMW A;  1QSD A;  2J1D G;  2LE8 A;  3EDU A;  1FMV A;  2H7V C;  2JPF A;  2BDE A;  3NRX A;  3IHR A;  2K5B B;  3CX7 B;  3RRC A;  2WBL A;  4N78 D;  4UV9 B;  5L3F B;  1UX4 A;  4KUM B;  3R6N A;  3P7I A;  5EK4 A;  1H7C A;  4O8S A;  3LJC A;  2LOP A;  2X9H A;  3CPZ A;  3LG7 A;  2ZM8 A;  5KDM C;  3J7Y q;  3RC8 A;  1AJ3 A;  4AI6 A;  3RRW A;  4WNK A;  5FY0 A;  3PU8 A;  3ZJ1 A;  4FJO A;  1MIV A;  2ODV A;  3BQI A;  4X1K E;  4ZHQ E;  3HKD E;  3RX6 A;  4AKH A;  3H37 A;  3ZN0 B;  5HXH A;  4DBR A;  4UEL A;  2NOX A;  2HPJ A;  2X9W A;  2IW5 B;  3C4Z A;  3KV9 A;  3RKO A;  2WWU A;  3CQX C;  5LGN B;  3MZK B;  4F6R C;  3C98 B;  2CXL A;  2YIN A;  4PK5 A;  2KWH A;  2ZM2 A;  4YHJ A;  5LGT B;  4ZI3 D;  3HKC E;  2N1G A;  3UTK A;  1ZKE A;  3O9X A;  2YEV C;  3MJX A;  3NZQ A;  4UVC B;  4TN7 B;  3SS1 A;  4DVD A;  5LYJ E;  5L3B B;  4UIG A;  2KIN B;  4O4I E;  3J9X 1;  3DTO A;  2MTQ A;  5JQG E;  3ZMS B;  1U5P A;  3GN5 B;  4ADZ A;  2L8K A;  1SA0 E;  2WM9 A;  2VKJ A;  3Q9D A;  2DLR A;  4PJN A;  2A2F X;  5LHI B;  2Y48 B;  2C5K T;  2SPC A;  4JUY A;  2XUE A;  1WLX A;  2CXF A;  3U3I A;  2XAJ B;  4HTE A;  3BQL A;  2XQY A;  1BR2 A;  1D1A A;  5LGU B;  3I1A A;  4AQG A;  3H3A A;  3NZP A;  4TV8 E;  3KVB A;  4QHO A;  4I43 B;  2BVL A;  1SHZ C;  2LHR A;  3UT5 E;  3KBT A;  3PDY A;  5LNK A;  4DND A;  4IDZ A;  4O4L E;  2UXX B;  3N2O A;  4OYK A;  2Y8D A;  3UFE A;  3QC9 A;  4YJ3 E;  2W0G A;  2V7L A;  2NP9 A;  5EK2 A;  3MXZ A;  5LBM A;  5E0O A;  1NWM X;  2KZ7 B;  3N5L A;  4UXN B;  2CEA A;  3PUA A;  1VOM A;  4PJM A;  1ZV4 X;  2VKD A;  4WBO A;  2V26 A;  1MND A;  1BR0 A;  1E1H B;  2CCQ A;  3I9W A;  5DQV A;  5L3G B;  3DJB A;  4O2A E;  2E9X A;  4TV9 E;  4V1A v;  3VHL A;  2CXD A;  1U4Q A;  4IST A;  1LVK A;  4TX5 A;  5JVD E;  5JRE A;  4ANJ A;  3ZCJ A;  3QUJ A;  3RYH E;  2N9D A;  2XHE B;  4MFR A;  4CI2 B;  2LSI A;  1YW0 A;  3HI2 A;  2LHN A;  3O1H A;  3HKB E;  2VKH A;  3WAJ A;  5JDM A;  2XAG B;  4ZS3 A;  4CXX A;  4ZI2 D;  2ZMA A;  2X66 A;  2C5J A;  4GK0 E;  2KT9 A;  3OBV E;  3KBU A;  1LVF A;  2H3R A;  1T98 A;  4HKA A;  2XAF B;  2IC9 A;  2W61 A;  2WAU A;  4EXT A;  4XZC A;  3CKD A;  3CWZ B;  1US7 B;  3RYF E;  4CI3 B;  5H6R B;  3NRY A;  3OKQ A;  2Q9Q B;  4EYU A;  2V7J A;  4PJL A;  4X20 E;  3KFW X;  3QK6 A;  4E7Z A;  2E8I A;  2CM0 A;  4ZS2 A;  3E08 A;  4CI1 B;  2X9X A;  1HCI A;  4J2C A;  4C91 A;  5L3C B;  4H9S E;  5FY7 A;  5HXC A;  3GN5 A;  4PFP A;  3C4X A;  4H9R C;  2PBI A;  2EHO A;  3ZMV B;  4AKR B;  5FXW A;  3LFM A;  4G2A A;  1O3X A;  5J2U E;  1UX5 A;  5HXR A;  2LM9 A;  2LOS A;  2N2N A;  3KV5 A;  5FXX A;  3ZN1 B;  1MMN A;  1D0X A;  5L3D B;  1HG2 A;  4CXW A;  4QXB B;  1WRD A;  3RPU A;  1IZN B;  3E0Z A;  3V5S A;  2LSK A;  5M4Y A;  2PJQ A;  3K3O A;  2VL8 A;  3RH3 A;  4PW8 A;  2D2S A;  2KWI B;  4GYR A;  2P9B A;  3CQC B;  1YKH B;  4ASK A;  3JC6 C;  2X9Y A;  1HFA A;  5HXS A;  5IHY A;  2CMR A;  5JH7 E;  2HH7 A;  1G8X A;  5KX5 E;  3KIN B;  2BVM A;  2CA5 A;  2V7I A;  3N9M A;  2V7K A;  1D1C A;  3IEE A;  3N9P A;  3MAC A;  3PTR B;  3RC3 A;  4TZ4 C;  3ESL A;  2QA7 A;  3SWH A;  3K8P C;  3EVY A;  5JDN A;  4GIW A;  2MOZ A;  4YFS A;  3CML A;  4AXP A;  2C5I T;  3ZCI A;  4PK4 A;  1FEW A;  5IYZ E;  3N2G E;  4TUY E;  4DMV A;  4MBQ A;  1FIO A;  4G63 A;  3KDS E;  2KLQ A;  5LXT E;  4PFO A;  4ZI3 C;  3N9L A;  4QX8 B;  3C50 A;  2Z6E A;  3O1I A;  2A3D A;  5HAX A;  2HPL A;  2IC6 A;  5JR9 B;  1ZHC A;  2XTL A;  2Q9Q D;  4M1P A;  3Q2M A;  4H9O C;  4I4T E;  5F8P A;  3I0Q A;  3N9N A;  2DWG A;  3BK9 A;  2CWO A;  3EDV A;  2DNX A;  5ADX L;  5J2T E;  4BJM A;  1HX8 A;  5L3E B;  3NBX X;  3RYI E;  4QKN A;  1Y64 B;  2C0S A;  3UUX B;  2VB6 A;  3M65 A;  3UUL A;  1S94 A;  4KMC A;  3KVA A;  4KBM B;  5LBQ B;  5CA1 E;  3JC6 D;  5EK3 A;  4B6X A;  3PUR A;  4X1I E;  4H9Q C;  4BA9 A;  4QXH B;  1VRB A;  3L09 A;  3B57 A;  4OK0 A;  3N2K E;  2X68 A;  3N9O A;  2V7M A;  2VAS A;  2Y6X A;  2LT3 A;  4IE6 A;  3C4W A;  4JEU B;  3PUG A;  4EOZ B;  5JDQ A;  4JEH B;  2EHO C;  1OXZ A;  5FY1 A;  2UXN B;  2M67 A;  5LJM A;  2LEH A;  2NW7 A;  4DO0 A;  1HG5 A;  1HTJ F;  2K48 A;  1LKX A;  4XAX B;  1WYB A;  3TKL B;  2RA1 A;  5AFU L;  4E7S A;  4P0B A;  4IE0 A;  1S35 A;  5JDL A;  3LBX B;  1MMD A;  2JQQ A;  4KP3 C;  4UF0 A;  3ETV A;  5ETW A;  3K3Q C;  2LSG A;  4XBF B;  2PG8 A;  1KNZ A;  1BR1 A;  4C90 A;  3OYZ A;  3HKE E;  3AA6 B;  4OHF A;  2A72 A;  2WSS V;  3CQG B;  4EZH A;  2CLY C;  3PUQ A;  4UV8 B;  3GA8 A;  3F57 A;  4U74 A;  5JDG A;  3I9Y A;  4ISS A;  3AAA B;  3MA9 A;  1V9D A;  3ZMZ B;  2YU1 A;  4Z8X A;  3LK3 B;  4L0R A;  5HXE A;  3FXE B;  4UVB B;  4EYY R;  3C51 A;  5LHG B;  3SRZ A;  1LRZ A;  2L9Q A;  4EZ4 A;  3AA0 B;  4UVA B;  2W00 A;  4GK5 E;  4ZI2 C;  3ETU A;  4ILU A;  4O4H E;  2JRK A;  2JMK A;  2XAQ B;  4GOU A;  2CWY A;  3Q5W A;  4EAH A;  4AKL A;  3ZYL A;  4JLE A;  2X51 A;  2D0U A;  3U78 A;  4DMW A;  2KND A;  2EHO B;  4PK6 A;  2E9X D;  1D0Z A;  4HFV A;  4HE8 A;  1Z0P A;  1ZEE A;  3CVR A;  3HL6 A;  3L3P A;  4L9I A;  3BQK A;  1UCU A;  1WYC A;  3ZYM A;  4DBQ A;  4QX7 B;  4P0A A;  2ODU A;  3WI3 A;  2LJL A;  3UUN A;  5DAB A;  4X1Y E;  3PUS A;  2DWK A;  2NTX A;  1IJ6 A;  1EZ3 A;  3AA7 B;  1CUN A;  4PAG A;  5LJN A;  1MIW A;  4H63 V;  5LP6 E;  3GMI A;  5FXV A;  2Q9Q A;  4OYJ A;  4ERR A;  4HN9 A;  1QUU A;  2XAH B;  5H6Q B;  4U72 A;  5LCY A;  3FB2 A;  2PFV A;  3PE0 A;  3ZPO A;  3I0O A;  3K3N A;  4WBN E;  5HWX A;  3C64 A;  5LG4 A;  5LA6 E;  3CX6 B;  2D0T A;  3KV6 A;  4CZZ B;  3V5U A;  2X67 A;  3AAI A;  3A5X A;  3FBL A;  3HR0 A;  3KV4 A;  1MMG A;  3OJA A;  2GK9 A;  4AKG A;  3AB3 B;  2YK0 A;  3S4U A;  3ZMT B;  2JMH A;  2ACX A;  4HGA A;  3MKD A;  3ZC0 A;  5L2L A;  4HEA A;  2I59 A;  1MMA A;  2KMF A;  3FBZ A;  5TAO A;  3P8C D;  4MHC A;  4GYS A;  4CQI A;  2V1D B;  4IIJ E;  5KMG P;  3RYC E;  4O2B E;  1HS7 A;  5FYM A;  2KXP B;  4H63 H;  3OYX A;  2OA5 A;  3IF8 B;  3W15 B;  4NUV A;  2LSY A;  3AAE B;  3D0T A;  4AQF C;  3F2E A;  4IE5 A;  5HYA A;  1WR6 A;  2YU2 A;  4H9P C;  3Q5X A;  1IJ5 A;  4BJN A;  3ZYK A;  2VKO A;  5FXZ A;  5F3J A;  3ZJ2 A;  2ES0 A;  4K0U A;  3EUH A;  4PNI A;  3R84 B;  2NW8 A;  4A56 A;  3IBP A;  4EIW A;  3ZMU B;  3ZLI A;  4FI5 A;  4OFZ A;  1D1B A;  3AVR A;  2VWA A;  4IE4 A;  3VKH A;  3N9Q A;  5FNV E;  4YLH A;  2EHO D;  3LK4 2;  4UEM A;  2LSJ A;  5FMN A;  2JJ9 A;  2CE7 A;  5LHH B;  1BR4 A;  5CB4 E;  1IAP A;  5JRC B;  3ZC1 A;  2B1E A;  2E9X C;  2DCF A;  4QWN B;  2MBG A;  3LK2 B;  3PU3 A;  4P09 A;  4QXC B;  4ZI7 E;  2H7O A;  3UUM A;  3ANW A;  4MAL A;  4PJJ A;  2L3L A;  1X79 A;  3AA1 B;  3FXD B;  5DJQ C;  5JR9 A;  5C8Y E;  2DHR A;  2E9X B;  2W63 A;  5JDH A;  1OWA A;  3F31 A;  1MIY A;  3SOL A;  4H9N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...