1BR0A

Three dimensional structure of the n-terminal domain of syntaxin 1a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
b'DRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SYNTAXIN 1-A)
publication title Three-dimensional structure of an evolutionarily conserved N-terminal domain of syntaxin 1A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1998-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1br0A00
4JEHB 1S94A 1EZ3A 4TX5A 1FIOA 2DNXA 3C98B 1BR0A 5LG4A 1HS7A 1G73A 2XHEB 3LG7A 5M4YA 4JEUB 1FEWA
chains in the Genus database with same CATH superfamily
1ZKEA 5FY1A 4X64T 3PDYA 2WBLA 4DV2T 3FZLB 3GA8A 2XSAA 4U7YA 4GK0E 4KMCA 2CPTA 4ILBA 4YHJA 4GKKT 3H3AA 1Z0PA 5ABGA 2LT3A 2LOPA 2VL8A 4KP3C 4WBNE 2H89A 3O9XA 4K0KT 3ZKRA 1UK5A 1YXRA 4KBMB 4GYSA 2LOSA 3ANWA 2NW7A 2BG9B 2YN6A 2OA5A 3A5XA 2K9AA 3T1YT 4OX9T 5FY7A 3AA1B 2NW8A 1MMGA 4JUYA 4KUMB 3AA6B 3PURA 4U2ZA 2V5DA 2JPFA 3AB3B 4HWCA 4A56A 3AE4A 1X79A 5HXSA 3P7IA 4Z90A 5FXXA 4OYKA 1OEDB 3ZC0A 3MZKB 3N2OA 4GIWA 1XZYA 3LK3B 4C90A 1LVKA 5FMNA 1M7KA 3LK42 2V7KA 5F3JA 3N9OA 3AEAA 4IE7A 4YTNA 2BG9E 3M65A 4JI6T 4ZOLE 3N2GE 3AAEB 4U7IA 2BG9C 2VQFT 4JV5T 4CXXA 4ANJA 4ZHQE 1HX1B 4NIQA 5A1LA 1N34T 3NZPA 1T7SA 2QRXA 5JDGA 3OYZA 5FKYA 3ESLA 2WWUA 5ADXL 1D1AA 3I1AA 4OFZA 4MHCA 2MAWA 2XAJB 2CHOA 1M62A 3NKZA 5H6QB 4LF9T 1OEDC 3ABVA 1WR6A 1WRDA 4ZS2A 3UTKA 1KEYA 5LJNA 3B5MA 1MIVA 3AE9A 5LHHB 3ZMSB 3S4UA 4EYUA 2YINA 4DBRA 1NEKA 3MXZA 5AQGB 1FIOA 2WB5A 2LEHA 4UV9B 4I0UA 3HR0A 2BG9A 3N9NA 3PUWF 3QUJA 2UXXB 3RI5A 5F8PA 2W63A 1FEWA 2E5VA 5LB7B 2E8IA 3I9YA 3RIAA 1UX5A 3AE3A 5HEHA 2LJLA 1G8XA 4DR7T 3RYIE 5LBQB 3X1DA 5LJMA 4G2AA 2WQYA 4DV0T 3ZT6A 3ZMTB 5HEUA 4H63V 3DJBA 2LE8A 3J9X1 2Z6EA 3MKDA 4JBWF 1OEDA 2FBWA 2YU2A 4U72A 4PK6A 4CI2B 2BDEA 3ZMUB 1HR0T 2IC9A 5H6RB 4H9OC 3C51A 2W00A 2YDQA 2H3RA 2VL0A 3HI2A 4PNIA 4ASKA 2PFVA 1B7TA 1H7CA 3PV0F 3RHWA 3KBUA 3NWIA 5JDNA 5HEOA 4WNKA 3FZHB 2JQQA 2C0SA 3ZMZB 4X62T 2I0MA 2BVLA 3ZN1B 3C64A 5L3DB 3Q5XA 2YKSA 2Y48B 3UU5A 3LG7A 3RC8A 5CA1E 4NXNT 3L09A 4ILCA 2XHEB 3QOFA 3ZMVB 4DR1T 5KX5E 3P8CD 1KNZA 2BKPA 2KXPB 2WDQA 3PUVF 2F4VT 4Z91A 3AE8A 1WFDA 2X0LB 5AQMB 3ZYMA 3RKOA 5L47A 5HYAA 2C5KT 3PJAJ 4X1YE 3PUYF 4HTEA 3AEEA 3ZT5A 5LCYA 4HWDA 2CCQA 4H9SE 1J1JA 5J0ZA 5JQGE 1ZP0A 3I0QA 3ZLIA 5LNKA 2FJDA 3ZPOA 2R6GF 4LFBT 5JDLA 4HN9A 4HWIB 1T72A 2DWKA 1D0ZA 4ZI3C 2VK9A 2YEVC 4CN4A 1VOMA 2KZ7B 4NPPA 2ZMAA 4L5GA 4MFRA 2XJ7A 4TWFA 4YXDA 5C3JA 2CRBA 2LKGA 4QH5A 2N9DA 2VKHA 4UV8B 4X1IE 4J2CA 1KNRA 3F57A 2J1DG 4O2AE 5LP6E 4TX5A 3LSVA 5JDMA 2ZM2A 4WW0A 3SRZA 5C2TA 3VKGA 3AXJB 2XY8B 4YTMA 2V5CA 4AXPA 4IDOA 2OV9A 3CX6B 4ZI7E 2RA1A 2IW5B 4QX7B 1KF6A 1YD8G 4PAGA 2XQ4A 2IUBA 4AQFC 1S35A 2K48A 5DQWA 3W15B 3UFEA 5AQVB 3AVRA 4TV8E 3RIUC 3UUBA 2KT9A 4MLKA 1VRBA 3E22E 4DR5T 1LRZA 2D5UA 4H63H 3RYFE 3AE7A 3WAJA 2CMRA 5FP3A 1YKEB 1IBMT 5L4HA 3ZCIA 1LVFA 1CHUA 3ONJA 3OVUA 2W61A 3P4SA 1FMVA 3C4ZA 4B3RT 2VVSA 3C50A 4OK0A 2PBIA 2WDVA 4X1KE 2LHRA 4IE6A 5AQKB 5L3CB 4HKAA 3ZSTA 4EB6E 2NTYA 3C98B 5JDHA 3GWHA 3AEBA 3AEDA 4AQFA 5JR9B 3EHZA 2N2NA 2UXBT 2E9XD 5HXEA 5IUXA 2D0TA 4AKGA 3NZQA 3KVAA 3AE6A 4YJ2E 3FBLA 2WP9A 3PUGA 1ZV4X 4KX6A 3EUHA 3VR9A 2M6BA 2V1DB 3KV9A 4QH4A 3PUZF 2HH7A 4DBQA 5L3FB 1X9BA 4AKHA 3FXEB 4O4JE 3TLTA 4WBOA 5KDMC 4EZ4A 3LBXB 5AQTB 4QKNA 5AQIB 3R84B 3K3NA 2D2SA 3P50A 3UT5E 2L8KA 2Q9QD 5AQFB 1T98A 2H7OA 2J47A 2DWGA 4H9PC 4YTPA 3QC9A 1O3XA 3AXJA 3PUQA 4P0BA 2WSSV 4DVDA 3AVSA 3Q9DA 4H9QC 4B6XA 4BJNA 5HXRA 4TZ4C 3RYHE 5JR9C 4EEDA 3N5LA 4DR4T 4COFA 3CQGB 4HFBA 2YOEA 3O1IA 1MMNA 3SFDA 4JLEA 4JEUB 1NWMX 3JC6D 2BS3A 1IZNB 2DI4A 2XQ8A 4FJOA 1T8BA 1KK7A 3ZN0B 4PFPA 5AQRB 3AEFA 4QX8B 4LMLA 4AQYT 3Q5EA 4DMVA 1UUSA 2XAQB 2OLTA 5LG4A 1XDOA 3CPZA 1EZ3A 3AAAB 2VKDA 3Q2MA 3C4WA 4ADZA 2LM2A 5JH7E 3HKEE 3CQCB 3JCFA 2IHR1 2XM2A 2NTXA 2VURA 5LXTE 4JI1T 4PFOA 3RQUA 4DMWA 3VKHA 5JR9A 4IREA 3HKCE 4EGWA 4QXBB 2X0HA 2E9XC 3K3OA 4YHHT 2JQ9A 3KV6A 4H9RC 2FUPA 3ONLC 2B1EA 2JMHA 1FJGT 3EAMA 4F8HA 2D0UA 2XQAA 4EOZB 3H3MA 2CM0A 5ABEA 2XQ5A 2PG8A 3LBXA 3PJAA 4EIWA 2IIUA 4IL4A 5AQSB 2CBJA 5HEJA 2V6YB 2NOXA 3L39A 3AE5A 4ILUA 3UQ7A 1Z8UA 3FBZA 2V7MA 1AJ3A 4TNWA 2CA5A 4TNVA 1W09A 1SUMB 4JI8T 2QA7A 4I4TE 4L9IA 3EVYA 4DV6T 4JEHB 3AE2A 2V8SV 4X66T 4U3CA 4UXNB 1WLXA 2CXLA 2GK9A 4CI3B 1LKXA 1KFYA 2IMLA 2LM9A 2WCAA 3JC6C 3HL6A 3AA7B 5AFUL 4A97A 4TUYE 5FNVE 4HFVA 2V7IA 5LMNT 2KWHA 1D1BA 3ZYKA 4P0AA 4K0UA 5CB4E 2XUEA 3BQKA 1SHZC 2W0GA 3RC3A 1J5WA 2XTLA 2A2FX 2WY2A 1WR0A 3TLUA 2UXCT 2FJBA 4U33A 3UU4A 4EXTA 5IHYA 2WDRA 3VHLA 3O1HA 5JDFA 5FXZA 4DR3T 4O4IE 1G73A 2BS2A 2MTQA 2KSRA 1I94T 4HFIA 4YT0A 2P9BA 3N9QA 2KINB 5FXVA 3PUXF 5KXJA 3U78A 1ZHCA 2LRKA 4LF8T 4UR9A 4O2BE 2KMFA 3K3QC 3SWHA 3TKLB 3H37A 3RRCA 5DQVA 4E7SA 4WZXA 2CLYB 1XWMA 4EZHA 3EDVA 2XQ3A 2KLQA 3LDQB 3PU3A 4HGAA 2X9XA 1NAFA 3HKBE 2HN2A 3B57A 3RQWA 4DV3T 5FVKA 3RX6A 2V6YA 3P4RA 4DNDA 1IBLT 3KVBA 5CFBA 2CHNA 2ACXA 4U74A 4B3TT 4LFCT 5F5WA 5L3GB 3TLWA 1DU2A 3A8YC 2IDOB 2YDSA 1BR1A 4JI7T 3PTRB 3F31A 5LHGB 4AI6A 2RP4A 3IBPA 2UUBT 5AQUB 3CVRA 2E2AA 4QHOA 4TV9E 3VRBA 3VR8A 3NRYA 2V7JA 2K24A 4YSZA 3O1JA 3PU8A 1US7B 3QK6A 4L0RA 4HWFA 2X51A 5HAXA 3ZSSA 3MACA 4U31A 1HCIA 2JQKA 1WYCA 2CLYC 1ZOYA 4KI0F 2VASA 4CQIA 2LRLA 3ETUA 4MBQA 4NUUA 3BK9A 4JI2T 1XMOT 2NR4A 2V7LA 2WU5A 2FJAA 3V5UA 5HCMA 2EHOD 4DO0A 5M4YA 1MIWA 1IAPA 5KMGP 2M6IA 3MA9A 3BQIA 1IJ6A 3HA4A 2AXDS 3GN5B 3ZEFB 1OWAA 3M3ZB 1HG5A 4P1NA 2A9UA 3NVOA 2VWAA 3RF1A 3N9LA 4DUZT 5L2LA 3SS1A 3E0ZA 4IIJE 3PE0A 1VCTA 4HFHA 2QYWA 2ZM0A 1BR0A 4ZEYA 2UXDT 1WYBA 4IE4A 2I6HA 2I59A 3AECA 4ISSA 5LHIB 2XAFB 3FZMB 4NXMT 2DLRA 1IBKT 3KFWX 3SOLA 5GONE 3EI0A 2BS4A 2Y6XA 4ZZBA 3VU7H 4FI5A 3UULA 5LGNB 2DNXA 2XQ6A 3KV5A 2BBHA 2CEAA 5JRCB 5IWAT 4IDNA 2A3DA 4OHFA 5L3EB 5DJQC 3RYCE 4TN7B 5FL1A 4H9NC 4UVAB 2VQET 4QWNB 1JNRA 2J4GA 5AQLB 3K1SA 3I9WA 4LF5T 4DR2T 1MMDA 3ZT7A 5TAOA 3RIUA 4XZCA 3DP7A 4AQGA 1VCSA 3FXDB 2J62A 2JIWA 1SA0E 2B76A 3CQXC 3PUAA 4HFEA 3DTOA 4N78D 3QB5A 4KHPT 3LK2B 3Q5DA 3CIRA 2XQ9A 4CXWA 2KWIB 2ZM8A 4UVBB 3TLVA 3UFGA 1IJ5A 4V1Av 2LSJA 3P4WA 2XAHB 5E0OA 3JAEA 2UUAT 2EHOC 5J1GA 2LLYA 3RPUA 4EAHA 2VB6A 3GN5A 4ISTA 3ZCJA 4QXHB 1UX4A 3ETVA 2K5BB 3D0TA 2E9XB 1KNPA 5LOVE 4HEAA 4MALA 1BR4A 3T1HT 5JTGA 2X66A 4DV4T 4JI0T 1MMAA 4JI3T 5AQJB 4EEBA 4ILAA 5HWXA 4E7ZA 2BBJA 3CK6A 4IE5A 3N9PA 4X65T 1HX8A 4OYJA 3FHNA 3ONXA 2VKJA 2WS3A 5AQOB 3AA0B 4DUYT 4PK5A 2XAGB 4YY3T 4I43B 1GQEA 5IYZE 3RIFA 3RH3A 2C5JA 4ZZCA 4IE0A 2CWYA 5AQHB 1XNQT 2Q9QB 2C5IT 2X9HA 2WZHA 4CZZB 2EHOA 2HHHT 2V6XA 4GOUA 2LSKA 5JRCA 5CA0E 3WAKA 4HE8A 3E08A 3KDSE 5L4EA 2FJEA 5HCJA 2N1GA 3U3IA 4UELA 2XZEA 2ACZA 2JRKA 4B3ST 1S94A 2A72A 3UU3A 2H88A 3PUSA 2W67A 5FVLA 4O4HE 1SE7A 2WZIA 1J5ET 2KNDA 2DHRA 2VVNA 3T8OA 4AKLA 5C8YE 4TWDA 1HTJF 5ABHA 3ZC1A 4GKJT 1NENA 1N33T 2MPKA 3I0OA 5LYJE 2UU9T 2PTFA 4CN6A 1R8IA 1JNZA 4IT4A 2X67A 4JI4T 3NRXA 1MNEA 2W62A 3K8PC 4F6RC 2Q9QC 4LF7T 4LMJA 5JREA 1YW0A 5LGTB 4YJ3E 2X0YA 3EABA 5HWYA 1UURA 4EYYR 3Q5WA 1OEDE 4I50E 4IDQA 3OPCA 3KINB 2DCFA 1QUUA 2BZBA 1V9DA 5EK2A 2SPCA 2E9XA 3RGLA 5HXCA 4ZI2D 3RLFF 2CWOA 2WMNA 2CXFA 4X5TA 3AAIA 1HNXT 4O8SA 2WAUA 2RPAA 1HNWT 2DL1A 2XQYA 3CX7B 4XAXB 4ZI3D 5DABA 2XPKA 5ABFB 1CUNA 5FL0A 3IF8B 4IDPA 2YDRA 4PW8A 4X20E 2Q9QA 1N36T 5BR8T 4PK4A 3UUNA 4AKRB 4KHZF 2IAKA 3IHRA 4Q25A 1W9RA 4PJJA 2K3WA 2XSBA 3AE1A 5AQPB 4HFCA 2MYSA 5AQQB 2E5LT 2UXNB 4ZS3A 2HPLA 1HFAA 1HG2A 4U2YA 1U5PA 2L3LA 4YSYA 2IC6A 5J2UE 1BR2A 3ZJ2A 4AISA 1MNDA 3B13A 4DV1T 4UIGA 2WWVA 3C4XA 3O4XE 2XM1A 2JQHA 2NWBA 4ERRA 3MJXA 3UUXB 2ES0A 3J7Yq 4LFAT 3QNUA 3R6NA 4PJLA 2W4XA 2BKOA 1WCRA 1N32T 2Y8DA 1ZEEA 2H7VC 2ZLYA 1HNZT 2PJQA 2HN1A 1QSDA 3RKGA 3CWZB 2ZM6T 2ODUA 2G0UA 2MOZA 1Y01A 3N9MA 2MBGA 3G06A 4LF4T 2CE7A 1E7PA 4P09A 3FB2A 4YLHA 4JI5T 4CXYA 5ETWA 1Y64B 3OBVE 2W66A 5L3BB 4PJMA 5JVDE 3P4PA 2WM9A 2BKNA 4LF6T 5LG3A 4HFDA 3UQ4A 3A7MA 4GK5E 4ZI2C 4DV7T 4UEMA 3BQLA 4PJNA 1UCUA 3KBTA 5LGUB 4O4LE 1XNRT 5EK4A 3N2KE 2D9DA 3JADA 4UF0B 2NP9A 4QH1A 3FZFB 2XQ7A 4EV6A 1OXZA 5ABFA 2QVAA 2LHNA 3CKDA 2X68A 1W0BA 4A98A 5HXHA 3OTOT 3GMIA 5EZYE 2V26A 2NW9A 2JJ9A 2HPJA 2X9YA 4LMKA 1U4QA 4CN1A 5BMVE 1XDPA 2YU1A 3IA3A 2CBIA 2YK0A 4BJMA 4YSXA 4NUVA 1UGOA 4IHJE 2VKOA 2LSYA 3EDUA 2X9WA 4B3MT 5JDQA 2QGSA 4DIDB 4UVCB 3OJAA 3UUMA 1E1HB 1D1CA 5LMUT 4HWHA 5FXWA 1W0AA 3L8RA 3V5SA 4G63A 3OYXA 4BAYB 2L9QA 3NBXX 1HF8A 3ANWB 4I55E 3IEEA 3RRWA 4A5XA 2WU2A 3QB5K 3HKDE 2JMKA 5EK3A 4BA9A 2UUCT 1YQ3A 4AIUA 4M1PA 4GYRA 3WI3A 5FYMA 2ODVA 1D0XA 3FZKB 4IL9A 3ZYLA 2EHOB 4DR6T 3KV4A 1XMQT 4C91A 2XASB 2CXDA 3P4QA 1L0VA 2BVMA 4Z8XA 4CI1B 5AQNB 1E2AA 4JYAT 4ZXLA 2WMOA 1MIYA 2LSIA 4IGUA 5LA6E 4WYVA 3CMLA 4DV5T 1HS7A 1FMWA 1YKHB 5J2TE 3UU8A 1D0YA 4AKIA 4YFSA 4XBFB 2M67A 3F2EA 3JAFA 5HEGA 3TLSA 3CX8B 1I6ZA 3UU6A 3AEGA 3L3PA 4QXCB 4TWHA 5LBMA 4UF0A 3OKQA 2LSGA 3VRAA 3ZJ1A 5CJ5A 3LFMA 4IDZA 5FY0A 5CGMA 3MK7C 2AE9A 2W2UA 1QLBA 1YQ4A 3SFEA 2LKHA 3LJCA
chains in the Genus database with same CATH topology
1ZKEA 5FY1A 5FXVA 3CX6B 3U78A 3PDYA 4ZI7E 2X67A 1ZHCA 2WBLA 3NRXA 2RA1A 3GA8A 2IW5B 4O2BE 4QX7B 2KMFA 1MNEA 1YD8G 3K3QC 3SWHA 3TKLB 3H37A 4GK0E 4PAGA 2W62A 3K8PC 4AQFC 4F6RC 3RRCA 1S35A 2K48A 5DQVA 5DQWA 4E7SA 3W15B 2CLYB 3UFEA 2Q9QC 4KMCA 4YHJA 3H3AA 5JREA 3AVRA 1Z0PA 1YW0A 3EDVA 4EZHA 2KLQA 2LT3A 2LOPA 2VL8A 3PU3A 4KP3C 5LGTB 4HGAA 2X9XA 4WBNE 4YJ3E 5HWYA 1NAFA 3HKBE 3B57A 4EYYR 4TV8E 3O9XA 3Q5WA 2KT9A 3RX6A 4MLKA 4I50E 4KBMB 1VRBA 4GYSA 3KINB 2LOSA 2DCFA 4DNDA 3ANWA 1QUUA 3E22E 2BZBA 1V9DA 2NW7A 3KVBA 1LRZA 5EK2A 2SPCA 2OA5A 2E9XA 2D5UA 4H63H 3A5XA 3RYFE 5HXCA 3WAJA 2K9AA 2CMRA 2ACXA 4U74A 5FP3A 1YKEB 3ZCIA 4ZI2D 1LVFA 2CWOA 5FY7A 3AA1B 2NW8A 5L3GB 2WMNA 1MMGA 4JUYA 4KUMB 2CXFA 3AA6B 3PURA 2W61A 3AAIA 2JPFA 4O8SA 1BR1A 2WAUA 1FMVA 3C4ZA 3PTRB 3C50A 4OK0A 3AB3B 3F31A 2PBIA 5LHGB 4A56A 2XQYA 4X1KE 2LHRA 4IE6A 3CX7B 4AI6A 2RP4A 3IBPA 4XAXB 1X79A 4ZI3D 5DABA 5L3CB 4HKAA 3CVRA 1CUNA 5HXSA 4QHOA 4TV9E 3IF8B 3P7IA 3NRYA 2V7JA 2K24A 2NTYA 4EB6E 3O1JA 3C98B 3PU8A 1US7B 5JDHA 3GWHA 4PW8A 3QK6A 4L0RA 2X51A 5HAXA 4AQFA 5JR9B 4X20E 3MACA 1HCIA 5FXXA 2N2NA 2Q9QA 2E9XD 4PK4A 4OYKA 3ZC0A 1WYCA 2CLYC 3UUNA 4AKRB 5HXEA 2IAKA 2VASA 3MZKB 2D0TA 3IHRA 3N2OA 4GIWA 4AKGA 4PJJA 3LK3B 4C90A 4CQIA 1LVKA 3ETUA 3NZQA 3KVAA 4MBQA 4NUUA 5FMNA 3BK9A 4YJ2E 3LK42 3FBLA 2V7KA 5F3JA 2MYSA 3N9OA 3PUGA 2UXNB 1ZV4X 2V7LA 3EUHA 4IE7A 4ZS3A 2HPLA 1HFAA 1HG2A 3V5UA 1U5PA 2L3LA 2V1DB 3KV9A 3M65A 4ZOLE 2EHOD 3N2GE 2IC6A 3AAEB 4DO0A 5J2UE 2HH7A 4DBQA 1MIWA 3N9QA 5L3FB 1BR2A 1IAPA 5M4YA 3ZJ2A 4AKHA 1MNDA 5KMGP 3FXEB 4O4JE 3B13A 3MA9A 3BQIA 4UIGA 1IJ6A 3HA4A 3C4XA 3GN5B 3O4XE 4WBOA 5KDMC 4EZ4A 3ZEFB 3LBXB 1OWAA 4CXXA 4QKNA 2NWBA 4ANJA 3R84B 4ZHQE 4ERRA 1HG5A 3K3NA 3MJXA 2D2SA 3UUXB 2ES0A 3J7Yq 3UT5E 2L8KA 2Q9QD 5A1LA 1T98A 3NZPA 3R6NA 2VWAA 3N9LA 2H7OA 4PJLA 5L2LA 2DWGA 4H9PC 5JDGA 3OYZA 3SS1A 3E0ZA 3QC9A 1O3XA 3PUQA 4IIJE 4P0BA 2WSSV 2Y8DA 3ESLA 4DVDA 1ZEEA 3PE0A 2WWUA 2H7VC 5ADXL 2ZM0A 1BR0A 1D1AA 3I1AA 2ZLYA 3AVSA 4OFZA 2PJQA 4MHCA 2XAJB 3Q9DA 4H9QC 4B6XA 1WYBA 4IE4A 2I59A 4BJNA 1QSDA 5HXRA 4ISSA 5LHIB 4TZ4C 3CWZB 2XAFB 3RYHE 5JR9C 2ODUA 2G0UA 2MOZA 2DLRA 3KFWX 3SOLA 5H6QB 3N9MA 2MBGA 3N5LA 5GONE 1WR6A 1WRDA 4ZS2A 3CQGB 2Y6XA 3UTKA 2CE7A 4P09A 3O1IA 3FB2A 5LJNA 1MMNA 3VU7H 1MIVA 4FI5A 3UULA 4JLEA 4JEUB 1NWMX 5LGNB 4YLHA 5LHHB 3JC6D 3ZMSB 1IZNB 2DNXA 4CXYA 5ETWA 3S4UA 4EYUA 2YINA 2DI4A 4DBRA 3MXZA 1Y64B 4FJOA 3OBVE 3KV5A 1FIOA 1KK7A 2LEHA 4UV9B 3ZN0B 2CEAA 3HR0A 3N9NA 4PFPA 5L3BB 4PJMA 4QX8B 5JRCB 5JVDE 3QUJA 2WM9A 2UXXB 4DMVA 5F8PA 2XAQB 5LG4A 2W63A 4GK5E 3CPZA 1FEWA 4ZI2C 2A3DA 4OHFA 5L3EB 4UEMA 5DJQC 1EZ3A 3BQLA 4PJNA 3RYCE 4TN7B 3AAAB 2VKDA 1UCUA 2E8IA 3I9YA 3KBTA 5LGUB 4O4LE 4H9NC 4UVAB 5EK4A 3N2KE 3Q2MA 4QWNB 1UX5A 3C4WA 4ADZA 3I9WA 5JH7E 3HKEE 2LJLA 1G8XA 3CQCB 3RYIE 5LBQB 4UF0B 2NP9A 2NTXA 1MMDA 1OXZA 5LXTE 4PFOA 5TAOA 5LJMA 2LHNA 4XZCA 4DMWA 3DP7A 3CKDA 2X68A 4G2AA 5HXHA 3GMIA 3VKHA 4AQGA 5EZYE 2V26A 3ZMTB 2NW9A 2JJ9A 4H63V 3FXDB 3DJBA 2HPJA 2X9YA 5JR9A 2LE8A 3J9X1 2Z6EA 1SA0E 3CQXC 3PUAA 3MKDA 3HKCE 1U4QA 4QXBB 3DTOA 4N78D 5BMVE 2E9XC 3K3OA 2YU2A 2YU1A 4U72A 3LK2B 3KV6A 4PK6A 2YK0A 4BJMA 4CI2B 2BDEA 3ZMUB 4H9RC 4CXWA 2KWIB 2ZM8A 4NUVA 4UVBB 2B1EA 2JMHA 4IHJE 2IC9A 5H6RB 4H9OC 1IJ5A 2VKOA 2LSYA 3C51A 3EDUA 4V1Av 2W00A 2LSJA 2H3RA 2X9WA 3HI2A 4PNIA 2D0UA 2XAHB 5E0OA 4ASKA 5JDQA 2PFVA 2QGSA 2EHOC 3OJAA 4UVCB 3UUMA 1E1HB 4EOZB 1B7TA 5J1GA 1D1CA 1H7CA 3RPUA 2CM0A 5FXWA 3KBUA 5JDNA 4EAHA 2VB6A 2PG8A 3GN5A 4WNKA 3LBXA 4ISTA 3ZCJA 4EIWA 2JQQA 4QXHB 2C0SA 1UX4A 3ETVA 3V5SA 4G63A 2NOXA 3OYXA 3ZMZB 4BAYB 2L9QA 2K5BB 3D0TA 3NBXX 4ILUA 1HF8A 3ANWB 2BVLA 4I55E 3ZN1B 3C64A 3FBZA 3IEEA 5L3DB 2V7MA 3Q5XA 1AJ3A 2E9XB 5LOVE 3RRWA 4HEAA 2Y48B 2CA5A 3LG7A 4MALA 1BR4A 5CA1E 3RC8A 3L09A 2X66A 1MMAA 2QA7A 4I4TE 5HWXA 2XHEB 3HKDE 2JMKA 4L9IA 5EK3A 4BA9A 4E7ZA 3EVYA 3ZMVB 4JEHB 5KX5E 3P8CD 4M1PA 1KNZA 4GYRA 3WI3A 4IE5A 3N9PA 5FYMA 2KXPB 2ODVA 1D0XA 1HX8A 4OYJA 3FHNA 3ONXA 2VKJA 3ZYLA 2EHOB 4UXNB 1WLXA 2CXLA 3AA0B 2GK9A 4PK5A 3KV4A 2XAGB 4CI3B 2X0LB 3ZYMA 2XASB 4I43B 4C91A 2CXDA 3RKOA 5HYAA 2C5KT 5IYZE 2BVMA 1LKXA 4X1YE 3RH3A 4HTEA 4Z8XA 4CI1B 2C5JA 5LCYA 2LM9A 4IE0A 2CWYA 2WMOA 3JC6C 1MIYA 3HL6A 2LSIA 3AA7B 2Q9QB 2CCQA 2C5IT 4H9SE 2X9HA 4IGUA 5LA6E 5AFUL 4TUYE 5FNVE 4HFVA 4CZZB 2EHOA 5JQGE 3CMLA 3I0QA 3ZLIA 5LNKA 2V7IA 4GOUA 2LSKA 5JRCA 2KWHA 3ZPOA 1D1BA 3WAKA 5CA0E 1FMWA 3ZYKA 1HS7A 4HE8A 3E08A 3KDSE 4HN9A 5JDLA 4P0AA 1YKHB 5J2TE 4K0UA 2DWKA 5CB4E 1D0ZA 2N1GA 2XUEA 3BQKA 1SHZC 4ZI3C 2VK9A 3U3IA 2W0GA 1D0YA 3RC3A 4AKIA 4UELA 2YEVC 4YFSA 2XTLA 4XBFB 1VOMA 2A2FX 2M67A 2JRKA 2KZ7B 3F2EA 1S94A 2A72A 2ZMAA 3PUSA 4L5GA 4MFRA 4O4HE 3CX8B 4EXTA 5IHYA 3L3PA 2KNDA 4QXCB 5LBMA 4UF0A 3OKQA 3VHLA 2N9DA 2VKHA 3O1HA 4UV8B 5JDFA 4X1IE 4J2CA 5FXZA 2DHRA 2LSGA 3F57A 2J1DG 4O2AE 5LP6E 4TX5A 3T8OA 4O4IE 3ZJ1A 4AKLA 5C8YE 1HTJF 1G73A 5JDMA 2MTQA 3LFMA 2ZM2A 4IDZA 3ZC1A 5FY0A 4WW0A 3SRZA 3I0OA 5LYJE 3VKGA 3MK7C 2P9BA 4AXPA 3LJCA 2KINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEH B;  1S94 A;  1EZ3 A;  4TX5 A;  1FIO A;  2DNX A;  3C98 B;  1BR0 A;  5LG4 A;  1HS7 A;  1G73 A;  2XHE B;  3LG7 A;  5M4Y A;  4JEU B;  1FEW A; 
#chains in the Genus database with same CATH topology
 1ZKE A;  5FY1 A;  4X64 T;  3PDY A;  2WBL A;  4DV2 T;  3FZL B;  3GA8 A;  2XSA A;  4U7Y A;  4GK0 E;  4KMC A;  2CPT A;  4ILB A;  4YHJ A;  4GKK T;  3H3A A;  1Z0P A;  5ABG A;  2LT3 A;  2LOP A;  2VL8 A;  4KP3 C;  4WBN E;  2H89 A;  3O9X A;  4K0K T;  3ZKR A;  1UK5 A;  1YXR A;  4KBM B;  4GYS A;  2LOS A;  3ANW A;  2NW7 A;  2BG9 B;  2YN6 A;  2OA5 A;  3A5X A;  2K9A A;  3T1Y T;  4OX9 T;  5FY7 A;  3AA1 B;  2NW8 A;  1MMG A;  4JUY A;  4KUM B;  3AA6 B;  3PUR A;  4U2Z A;  2V5D A;  2JPF A;  3AB3 B;  4HWC A;  4A56 A;  3AE4 A;  1X79 A;  5HXS A;  3P7I A;  4Z90 A;  5FXX A;  4OYK A;  1OED B;  3ZC0 A;  3MZK B;  3N2O A;  4GIW A;  1XZY A;  3LK3 B;  4C90 A;  1LVK A;  5FMN A;  1M7K A;  3LK4 2;  2V7K A;  5F3J A;  3N9O A;  3AEA A;  4IE7 A;  4YTN A;  2BG9 E;  3M65 A;  4JI6 T;  4ZOL E;  3N2G E;  3AAE B;  4U7I A;  2BG9 C;  2VQF T;  4JV5 T;  4CXX A;  4ANJ A;  4ZHQ E;  1HX1 B;  4NIQ A;  5A1L A;  1N34 T;  3NZP A;  1T7S A;  2QRX A;  5JDG A;  3OYZ A;  5FKY A;  3ESL A;  2WWU A;  5ADX L;  1D1A A;  3I1A A;  4OFZ A;  4MHC A;  2MAW A;  2XAJ B;  2CHO A;  1M62 A;  3NKZ A;  5H6Q B;  4LF9 T;  1OED C;  3ABV A;  1WR6 A;  1WRD A;  4ZS2 A;  3UTK A;  1KEY A;  5LJN A;  3B5M A;  1MIV A;  3AE9 A;  5LHH B;  3ZMS B;  3S4U A;  4EYU A;  2YIN A;  4DBR A;  1NEK A;  3MXZ A;  5AQG B;  1FIO A;  2WB5 A;  2LEH A;  4UV9 B;  4I0U A;  3HR0 A;  2BG9 A;  3N9N A;  3PUW F;  3QUJ A;  2UXX B;  3RI5 A;  5F8P A;  2W63 A;  1FEW A;  2E5V A;  5LB7 B;  2E8I A;  3I9Y A;  3RIA A;  1UX5 A;  3AE3 A;  5HEH A;  2LJL A;  1G8X A;  4DR7 T;  3RYI E;  5LBQ B;  3X1D A;  5LJM A;  4G2A A;  2WQY A;  4DV0 T;  3ZT6 A;  3ZMT B;  5HEU A;  4H63 V;  3DJB A;  2LE8 A;  3J9X 1;  2Z6E A;  3MKD A;  4JBW F;  1OED A;  2FBW A;  2YU2 A;  4U72 A;  4PK6 A;  4CI2 B;  2BDE A;  3ZMU B;  1HR0 T;  2IC9 A;  5H6R B;  4H9O C;  3C51 A;  2W00 A;  2YDQ A;  2H3R A;  2VL0 A;  3HI2 A;  4PNI A;  4ASK A;  2PFV A;  1B7T A;  1H7C A;  3PV0 F;  3RHW A;  3KBU A;  3NWI A;  5JDN A;  5HEO A;  4WNK A;  3FZH B;  2JQQ A;  2C0S A;  3ZMZ B;  4X62 T;  2I0M A;  2BVL A;  3ZN1 B;  3C64 A;  5L3D B;  3Q5X A;  2YKS A;  2Y48 B;  3UU5 A;  3LG7 A;  3RC8 A;  5CA1 E;  4NXN T;  3L09 A;  4ILC A;  2XHE B;  3QOF A;  3ZMV B;  4DR1 T;  5KX5 E;  3P8C D;  1KNZ A;  2BKP A;  2KXP B;  2WDQ A;  3PUV F;  2F4V T;  4Z91 A;  3AE8 A;  1WFD A;  2X0L B;  5AQM B;  3ZYM A;  3RKO A;  5L47 A;  5HYA A;  2C5K T;  3PJA J;  4X1Y E;  3PUY F;  4HTE A;  3AEE A;  3ZT5 A;  5LCY A;  4HWD A;  2CCQ A;  4H9S E;  1J1J A;  5J0Z A;  5JQG E;  1ZP0 A;  3I0Q A;  3ZLI A;  5LNK A;  2FJD A;  3ZPO A;  2R6G F;  4LFB T;  5JDL A;  4HN9 A;  4HWI B;  1T72 A;  2DWK A;  1D0Z A;  4ZI3 C;  2VK9 A;  2YEV C;  4CN4 A;  1VOM A;  2KZ7 B;  4NPP A;  2ZMA A;  4L5G A;  4MFR A;  2XJ7 A;  4TWF A;  4YXD A;  5C3J A;  2CRB A;  2LKG A;  4QH5 A;  2N9D A;  2VKH A;  4UV8 B;  4X1I E;  4J2C A;  1KNR A;  3F57 A;  2J1D G;  4O2A E;  5LP6 E;  4TX5 A;  3LSV A;  5JDM A;  2ZM2 A;  4WW0 A;  3SRZ A;  5C2T A;  3VKG A;  3AXJ B;  2XY8 B;  4YTM A;  2V5C A;  4AXP A;  4IDO A;  2OV9 A;  3CX6 B;  4ZI7 E;  2RA1 A;  2IW5 B;  4QX7 B;  1KF6 A;  1YD8 G;  4PAG A;  2XQ4 A;  2IUB A;  4AQF C;  1S35 A;  2K48 A;  5DQW A;  3W15 B;  3UFE A;  5AQV B;  3AVR A;  4TV8 E;  3RIU C;  3UUB A;  2KT9 A;  4MLK A;  1VRB A;  3E22 E;  4DR5 T;  1LRZ A;  2D5U A;  4H63 H;  3RYF E;  3AE7 A;  3WAJ A;  2CMR A;  5FP3 A;  1YKE B;  1IBM T;  5L4H A;  3ZCI A;  1LVF A;  1CHU A;  3ONJ A;  3OVU A;  2W61 A;  3P4S A;  1FMV A;  3C4Z A;  4B3R T;  2VVS A;  3C50 A;  4OK0 A;  2PBI A;  2WDV A;  4X1K E;  2LHR A;  4IE6 A;  5AQK B;  5L3C B;  4HKA A;  3ZST A;  4EB6 E;  2NTY A;  3C98 B;  5JDH A;  3GWH A;  3AEB A;  3AED A;  4AQF A;  5JR9 B;  3EHZ A;  2N2N A;  2UXB T;  2E9X D;  5HXE A;  5IUX A;  2D0T A;  4AKG A;  3NZQ A;  3KVA A;  3AE6 A;  4YJ2 E;  3FBL A;  2WP9 A;  3PUG A;  1ZV4 X;  4KX6 A;  3EUH A;  3VR9 A;  2M6B A;  2V1D B;  3KV9 A;  4QH4 A;  3PUZ F;  2HH7 A;  4DBQ A;  5L3F B;  1X9B A;  4AKH A;  3FXE B;  4O4J E;  3TLT A;  4WBO A;  5KDM C;  4EZ4 A;  3LBX B;  5AQT B;  4QKN A;  5AQI B;  3R84 B;  3K3N A;  2D2S A;  3P50 A;  3UT5 E;  2L8K A;  2Q9Q D;  5AQF B;  1T98 A;  2H7O A;  2J47 A;  2DWG A;  4H9P C;  4YTP A;  3QC9 A;  1O3X A;  3AXJ A;  3PUQ A;  4P0B A;  2WSS V;  4DVD A;  3AVS A;  3Q9D A;  4H9Q C;  4B6X A;  4BJN A;  5HXR A;  4TZ4 C;  3RYH E;  5JR9 C;  4EED A;  3N5L A;  4DR4 T;  4COF A;  3CQG B;  4HFB A;  2YOE A;  3O1I A;  1MMN A;  3SFD A;  4JLE A;  4JEU B;  1NWM X;  3JC6 D;  2BS3 A;  1IZN B;  2DI4 A;  2XQ8 A;  4FJO A;  1T8B A;  1KK7 A;  3ZN0 B;  4PFP A;  5AQR B;  3AEF A;  4QX8 B;  4LML A;  4AQY T;  3Q5E A;  4DMV A;  1UUS A;  2XAQ B;  2OLT A;  5LG4 A;  1XDO A;  3CPZ A;  1EZ3 A;  3AAA B;  2VKD A;  3Q2M A;  3C4W A;  4ADZ A;  2LM2 A;  5JH7 E;  3HKE E;  3CQC B;  3JCF A;  2IHR 1;  2XM2 A;  2NTX A;  2VUR A;  5LXT E;  4JI1 T;  4PFO A;  3RQU A;  4DMW A;  3VKH A;  5JR9 A;  4IRE A;  3HKC E;  4EGW A;  4QXB B;  2X0H A;  2E9X C;  3K3O A;  4YHH T;  2JQ9 A;  3KV6 A;  4H9R C;  2FUP A;  3ONL C;  2B1E A;  2JMH A;  1FJG T;  3EAM A;  4F8H A;  2D0U A;  2XQA A;  4EOZ B;  3H3M A;  2CM0 A;  5ABE A;  2XQ5 A;  2PG8 A;  3LBX A;  3PJA A;  4EIW A;  2IIU A;  4IL4 A;  5AQS B;  2CBJ A;  5HEJ A;  2V6Y B;  2NOX A;  3L39 A;  3AE5 A;  4ILU A;  3UQ7 A;  1Z8U A;  3FBZ A;  2V7M A;  1AJ3 A;  4TNW A;  2CA5 A;  4TNV A;  1W09 A;  1SUM B;  4JI8 T;  2QA7 A;  4I4T E;  4L9I A;  3EVY A;  4DV6 T;  4JEH B;  3AE2 A;  2V8S V;  4X66 T;  4U3C A;  4UXN B;  1WLX A;  2CXL A;  2GK9 A;  4CI3 B;  1LKX A;  1KFY A;  2IML A;  2LM9 A;  2WCA A;  3JC6 C;  3HL6 A;  3AA7 B;  5AFU L;  4A97 A;  4TUY E;  5FNV E;  4HFV A;  2V7I A;  5LMN T;  2KWH A;  1D1B A;  3ZYK A;  4P0A A;  4K0U A;  5CB4 E;  2XUE A;  3BQK A;  1SHZ C;  2W0G A;  3RC3 A;  1J5W A;  2XTL A;  2A2F X;  2WY2 A;  1WR0 A;  3TLU A;  2UXC T;  2FJB A;  4U33 A;  3UU4 A;  4EXT A;  5IHY A;  2WDR A;  3VHL A;  3O1H A;  5JDF A;  5FXZ A;  4DR3 T;  4O4I E;  1G73 A;  2BS2 A;  2MTQ A;  2KSR A;  1I94 T;  4HFI A;  4YT0 A;  2P9B A;  3N9Q A;  2KIN B;  5FXV A;  3PUX F;  5KXJ A;  3U78 A;  1ZHC A;  2LRK A;  4LF8 T;  4UR9 A;  4O2B E;  2KMF A;  3K3Q C;  3SWH A;  3TKL B;  3H37 A;  3RRC A;  5DQV A;  4E7S A;  4WZX A;  2CLY B;  1XWM A;  4EZH A;  3EDV A;  2XQ3 A;  2KLQ A;  3LDQ B;  3PU3 A;  4HGA A;  2X9X A;  1NAF A;  3HKB E;  2HN2 A;  3B57 A;  3RQW A;  4DV3 T;  5FVK A;  3RX6 A;  2V6Y A;  3P4R A;  4DND A;  1IBL T;  3KVB A;  5CFB A;  2CHN A;  2ACX A;  4U74 A;  4B3T T;  4LFC T;  5F5W A;  5L3G B;  3TLW A;  1DU2 A;  3A8Y C;  2IDO B;  2YDS A;  1BR1 A;  4JI7 T;  3PTR B;  3F31 A;  5LHG B;  4AI6 A;  2RP4 A;  3IBP A;  2UUB T;  5AQU B;  3CVR A;  2E2A A;  4QHO A;  4TV9 E;  3VRB A;  3VR8 A;  3NRY A;  2V7J A;  2K24 A;  4YSZ A;  3O1J A;  3PU8 A;  1US7 B;  3QK6 A;  4L0R A;  4HWF A;  2X51 A;  5HAX A;  3ZSS A;  3MAC A;  4U31 A;  1HCI A;  2JQK A;  1WYC A;  2CLY C;  1ZOY A;  4KI0 F;  2VAS A;  4CQI A;  2LRL A;  3ETU A;  4MBQ A;  4NUU A;  3BK9 A;  4JI2 T;  1XMO T;  2NR4 A;  2V7L A;  2WU5 A;  2FJA A;  3V5U A;  5HCM A;  2EHO D;  4DO0 A;  5M4Y A;  1MIW A;  1IAP A;  5KMG P;  2M6I A;  3MA9 A;  3BQI A;  1IJ6 A;  3HA4 A;  2AXD S;  3GN5 B;  3ZEF B;  1OWA A;  3M3Z B;  1HG5 A;  4P1N A;  2A9U A;  3NVO A;  2VWA A;  3RF1 A;  3N9L A;  4DUZ T;  5L2L A;  3SS1 A;  3E0Z A;  4IIJ E;  3PE0 A;  1VCT A;  4HFH A;  2QYW A;  2ZM0 A;  1BR0 A;  4ZEY A;  2UXD T;  1WYB A;  4IE4 A;  2I6H A;  2I59 A;  3AEC A;  4ISS A;  5LHI B;  2XAF B;  3FZM B;  4NXM T;  2DLR A;  1IBK T;  3KFW X;  3SOL A;  5GON E;  3EI0 A;  2BS4 A;  2Y6X A;  4ZZB A;  3VU7 H;  4FI5 A;  3UUL A;  5LGN B;  2DNX A;  2XQ6 A;  3KV5 A;  2BBH A;  2CEA A;  5JRC B;  5IWA T;  4IDN A;  2A3D A;  4OHF A;  5L3E B;  5DJQ C;  3RYC E;  4TN7 B;  5FL1 A;  4H9N C;  4UVA B;  2VQE T;  4QWN B;  1JNR A;  2J4G A;  5AQL B;  3K1S A;  3I9W A;  4LF5 T;  4DR2 T;  1MMD A;  3ZT7 A;  5TAO A;  3RIU A;  4XZC A;  3DP7 A;  4AQG A;  1VCS A;  3FXD B;  2J62 A;  2JIW A;  1SA0 E;  2B76 A;  3CQX C;  3PUA A;  4HFE A;  3DTO A;  4N78 D;  3QB5 A;  4KHP T;  3LK2 B;  3Q5D A;  3CIR A;  2XQ9 A;  4CXW A;  2KWI B;  2ZM8 A;  4UVB B;  3TLV A;  3UFG A;  1IJ5 A;  4V1A v;  2LSJ A;  3P4W A;  2XAH B;  5E0O A;  3JAE A;  2UUA T;  2EHO C;  5J1G A;  2LLY A;  3RPU A;  4EAH A;  2VB6 A;  3GN5 A;  4IST A;  3ZCJ A;  4QXH B;  1UX4 A;  3ETV A;  2K5B B;  3D0T A;  2E9X B;  1KNP A;  5LOV E;  4HEA A;  4MAL A;  1BR4 A;  3T1H T;  5JTG A;  2X66 A;  4DV4 T;  4JI0 T;  1MMA A;  4JI3 T;  5AQJ B;  4EEB A;  4ILA A;  5HWX A;  4E7Z A;  2BBJ A;  3CK6 A;  4IE5 A;  3N9P A;  4X65 T;  1HX8 A;  4OYJ A;  3FHN A;  3ONX A;  2VKJ A;  2WS3 A;  5AQO B;  3AA0 B;  4DUY T;  4PK5 A;  2XAG B;  4YY3 T;  4I43 B;  1GQE A;  5IYZ E;  3RIF A;  3RH3 A;  2C5J A;  4ZZC A;  4IE0 A;  2CWY A;  5AQH B;  1XNQ T;  2Q9Q B;  2C5I T;  2X9H A;  2WZH A;  4CZZ B;  2EHO A;  2HHH T;  2V6X A;  4GOU A;  2LSK A;  5JRC A;  5CA0 E;  3WAK A;  4HE8 A;  3E08 A;  3KDS E;  5L4E A;  2FJE A;  5HCJ A;  2N1G A;  3U3I A;  4UEL A;  2XZE A;  2ACZ A;  2JRK A;  4B3S T;  1S94 A;  2A72 A;  3UU3 A;  2H88 A;  3PUS A;  2W67 A;  5FVL A;  4O4H E;  1SE7 A;  2WZI A;  1J5E T;  2KND A;  2DHR A;  2VVN A;  3T8O A;  4AKL A;  5C8Y E;  4TWD A;  1HTJ F;  5ABH A;  3ZC1 A;  4GKJ T;  1NEN A;  1N33 T;  2MPK A;  3I0O A;  5LYJ E;  2UU9 T;  2PTF A;  4CN6 A;  1R8I A;  1JNZ A;  4IT4 A;  2X67 A;  4JI4 T;  3NRX A;  1MNE A;  2W62 A;  3K8P C;  4F6R C;  2Q9Q C;  4LF7 T;  4LMJ A;  5JRE A;  1YW0 A;  5LGT B;  4YJ3 E;  2X0Y A;  3EAB A;  5HWY A;  1UUR A;  4EYY R;  3Q5W A;  1OED E;  4I50 E;  4IDQ A;  3OPC A;  3KIN B;  2DCF A;  1QUU A;  2BZB A;  1V9D A;  5EK2 A;  2SPC A;  2E9X A;  3RGL A;  5HXC A;  4ZI2 D;  3RLF F;  2CWO A;  2WMN A;  2CXF A;  4X5T A;  3AAI A;  1HNX T;  4O8S A;  2WAU A;  2RPA A;  1HNW T;  2DL1 A;  2XQY A;  3CX7 B;  4XAX B;  4ZI3 D;  5DAB A;  2XPK A;  5ABF B;  1CUN A;  5FL0 A;  3IF8 B;  4IDP A;  2YDR A;  4PW8 A;  4X20 E;  2Q9Q A;  1N36 T;  5BR8 T;  4PK4 A;  3UUN A;  4AKR B;  4KHZ F;  2IAK A;  3IHR A;  4Q25 A;  1W9R A;  4PJJ A;  2K3W A;  2XSB A;  3AE1 A;  5AQP B;  4HFC A;  2MYS A;  5AQQ B;  2E5L T;  2UXN B;  4ZS3 A;  2HPL A;  1HFA A;  1HG2 A;  4U2Y A;  1U5P A;  2L3L A;  4YSY A;  2IC6 A;  5J2U E;  1BR2 A;  3ZJ2 A;  4AIS A;  1MND A;  3B13 A;  4DV1 T;  4UIG A;  2WWV A;  3C4X A;  3O4X E;  2XM1 A;  2JQH A;  2NWB A;  4ERR A;  3MJX A;  3UUX B;  2ES0 A;  3J7Y q;  4LFA T;  3QNU A;  3R6N A;  4PJL A;  2W4X A;  2BKO A;  1WCR A;  1N32 T;  2Y8D A;  1ZEE A;  2H7V C;  2ZLY A;  1HNZ T;  2PJQ A;  2HN1 A;  1QSD A;  3RKG A;  3CWZ B;  2ZM6 T;  2ODU A;  2G0U A;  2MOZ A;  1Y01 A;  3N9M A;  2MBG A;  3G06 A;  4LF4 T;  2CE7 A;  1E7P A;  4P09 A;  3FB2 A;  4YLH A;  4JI5 T;  4CXY A;  5ETW A;  1Y64 B;  3OBV E;  2W66 A;  5L3B B;  4PJM A;  5JVD E;  3P4P A;  2WM9 A;  2BKN A;  4LF6 T;  5LG3 A;  4HFD A;  3UQ4 A;  3A7M A;  4GK5 E;  4ZI2 C;  4DV7 T;  4UEM A;  3BQL A;  4PJN A;  1UCU A;  3KBT A;  5LGU B;  4O4L E;  1XNR T;  5EK4 A;  3N2K E;  2D9D A;  3JAD A;  4UF0 B;  2NP9 A;  4QH1 A;  3FZF B;  2XQ7 A;  4EV6 A;  1OXZ A;  5ABF A;  2QVA A;  2LHN A;  3CKD A;  2X68 A;  1W0B A;  4A98 A;  5HXH A;  3OTO T;  3GMI A;  5EZY E;  2V26 A;  2NW9 A;  2JJ9 A;  2HPJ A;  2X9Y A;  4LMK A;  1U4Q A;  4CN1 A;  5BMV E;  1XDP A;  2YU1 A;  3IA3 A;  2CBI A;  2YK0 A;  4BJM A;  4YSX A;  4NUV A;  1UGO A;  4IHJ E;  2VKO A;  2LSY A;  3EDU A;  2X9W A;  4B3M T;  5JDQ A;  2QGS A;  4DID B;  4UVC B;  3OJA A;  3UUM A;  1E1H B;  1D1C A;  5LMU T;  4HWH A;  5FXW A;  1W0A A;  3L8R A;  3V5S A;  4G63 A;  3OYX A;  4BAY B;  2L9Q A;  3NBX X;  1HF8 A;  3ANW B;  4I55 E;  3IEE A;  3RRW A;  4A5X A;  2WU2 A;  3QB5 K;  3HKD E;  2JMK A;  5EK3 A;  4BA9 A;  2UUC T;  1YQ3 A;  4AIU A;  4M1P A;  4GYR A;  3WI3 A;  5FYM A;  2ODV A;  1D0X A;  3FZK B;  4IL9 A;  3ZYL A;  2EHO B;  4DR6 T;  3KV4 A;  1XMQ T;  4C91 A;  2XAS B;  2CXD A;  3P4Q A;  1L0V A;  2BVM A;  4Z8X A;  4CI1 B;  5AQN B;  1E2A A;  4JYA T;  4ZXL A;  2WMO A;  1MIY A;  2LSI A;  4IGU A;  5LA6 E;  4WYV A;  3CML A;  4DV5 T;  1HS7 A;  1FMW A;  1YKH B;  5J2T E;  3UU8 A;  1D0Y A;  4AKI A;  4YFS A;  4XBF B;  2M67 A;  3F2E A;  3JAF A;  5HEG A;  3TLS A;  3CX8 B;  1I6Z A;  3UU6 A;  3AEG A;  3L3P A;  4QXC B;  4TWH A;  5LBM A;  4UF0 A;  3OKQ A;  2LSG A;  3VRA A;  3ZJ1 A;  5CJ5 A;  3LFM A;  4IDZ A;  5FY0 A;  5CGM A;  3MK7 C;  2AE9 A;  2W2U A;  1QLB A;  1YQ4 A;  3SFE A;  2LKH A;  3LJC A; 
#chains in the Genus database with same CATH homology
 1ZKE A;  5FY1 A;  5FXV A;  3CX6 B;  3U78 A;  3PDY A;  4ZI7 E;  2X67 A;  1ZHC A;  2WBL A;  3NRX A;  2RA1 A;  3GA8 A;  2IW5 B;  4O2B E;  4QX7 B;  2KMF A;  1MNE A;  1YD8 G;  3K3Q C;  3SWH A;  3TKL B;  3H37 A;  4GK0 E;  4PAG A;  2W62 A;  3K8P C;  4AQF C;  4F6R C;  3RRC A;  1S35 A;  2K48 A;  5DQV A;  5DQW A;  4E7S A;  3W15 B;  2CLY B;  3UFE A;  2Q9Q C;  4KMC A;  4YHJ A;  3H3A A;  5JRE A;  3AVR A;  1Z0P A;  1YW0 A;  3EDV A;  4EZH A;  2KLQ A;  2LT3 A;  2LOP A;  2VL8 A;  3PU3 A;  4KP3 C;  5LGT B;  4HGA A;  2X9X A;  4WBN E;  4YJ3 E;  5HWY A;  1NAF A;  3HKB E;  3B57 A;  4EYY R;  4TV8 E;  3O9X A;  3Q5W A;  2KT9 A;  3RX6 A;  4MLK A;  4I50 E;  4KBM B;  1VRB A;  4GYS A;  3KIN B;  2LOS A;  2DCF A;  4DND A;  3ANW A;  1QUU A;  3E22 E;  2BZB A;  1V9D A;  2NW7 A;  3KVB A;  1LRZ A;  5EK2 A;  2SPC A;  2OA5 A;  2E9X A;  2D5U A;  4H63 H;  3A5X A;  3RYF E;  5HXC A;  3WAJ A;  2K9A A;  2CMR A;  2ACX A;  4U74 A;  5FP3 A;  1YKE B;  3ZCI A;  4ZI2 D;  1LVF A;  2CWO A;  5FY7 A;  3AA1 B;  2NW8 A;  5L3G B;  2WMN A;  1MMG A;  4JUY A;  4KUM B;  2CXF A;  3AA6 B;  3PUR A;  2W61 A;  3AAI A;  2JPF A;  4O8S A;  1BR1 A;  2WAU A;  1FMV A;  3C4Z A;  3PTR B;  3C50 A;  4OK0 A;  3AB3 B;  3F31 A;  2PBI A;  5LHG B;  4A56 A;  2XQY A;  4X1K E;  2LHR A;  4IE6 A;  3CX7 B;  4AI6 A;  2RP4 A;  3IBP A;  4XAX B;  1X79 A;  4ZI3 D;  5DAB A;  5L3C B;  4HKA A;  3CVR A;  1CUN A;  5HXS A;  4QHO A;  4TV9 E;  3IF8 B;  3P7I A;  3NRY A;  2V7J A;  2K24 A;  2NTY A;  4EB6 E;  3O1J A;  3C98 B;  3PU8 A;  1US7 B;  5JDH A;  3GWH A;  4PW8 A;  3QK6 A;  4L0R A;  2X51 A;  5HAX A;  4AQF A;  5JR9 B;  4X20 E;  3MAC A;  1HCI A;  5FXX A;  2N2N A;  2Q9Q A;  2E9X D;  4PK4 A;  4OYK A;  3ZC0 A;  1WYC A;  2CLY C;  3UUN A;  4AKR B;  5HXE A;  2IAK A;  2VAS A;  3MZK B;  2D0T A;  3IHR A;  3N2O A;  4GIW A;  4AKG A;  4PJJ A;  3LK3 B;  4C90 A;  4CQI A;  1LVK A;  3ETU A;  3NZQ A;  3KVA A;  4MBQ A;  4NUU A;  5FMN A;  3BK9 A;  4YJ2 E;  3LK4 2;  3FBL A;  2V7K A;  5F3J A;  2MYS A;  3N9O A;  3PUG A;  2UXN B;  1ZV4 X;  2V7L A;  3EUH A;  4IE7 A;  4ZS3 A;  2HPL A;  1HFA A;  1HG2 A;  3V5U A;  1U5P A;  2L3L A;  2V1D B;  3KV9 A;  3M65 A;  4ZOL E;  2EHO D;  3N2G E;  2IC6 A;  3AAE B;  4DO0 A;  5J2U E;  2HH7 A;  4DBQ A;  1MIW A;  3N9Q A;  5L3F B;  1BR2 A;  1IAP A;  5M4Y A;  3ZJ2 A;  4AKH A;  1MND A;  5KMG P;  3FXE B;  4O4J E;  3B13 A;  3MA9 A;  3BQI A;  4UIG A;  1IJ6 A;  3HA4 A;  3C4X A;  3GN5 B;  3O4X E;  4WBO A;  5KDM C;  4EZ4 A;  3ZEF B;  3LBX B;  1OWA A;  4CXX A;  4QKN A;  2NWB A;  4ANJ A;  3R84 B;  4ZHQ E;  4ERR A;  1HG5 A;  3K3N A;  3MJX A;  2D2S A;  3UUX B;  2ES0 A;  3J7Y q;  3UT5 E;  2L8K A;  2Q9Q D;  5A1L A;  1T98 A;  3NZP A;  3R6N A;  2VWA A;  3N9L A;  2H7O A;  4PJL A;  5L2L A;  2DWG A;  4H9P C;  5JDG A;  3OYZ A;  3SS1 A;  3E0Z A;  3QC9 A;  1O3X A;  3PUQ A;  4IIJ E;  4P0B A;  2WSS V;  2Y8D A;  3ESL A;  4DVD A;  1ZEE A;  3PE0 A;  2WWU A;  2H7V C;  5ADX L;  2ZM0 A;  1BR0 A;  1D1A A;  3I1A A;  2ZLY A;  3AVS A;  4OFZ A;  2PJQ A;  4MHC A;  2XAJ B;  3Q9D A;  4H9Q C;  4B6X A;  1WYB A;  4IE4 A;  2I59 A;  4BJN A;  1QSD A;  5HXR A;  4ISS A;  5LHI B;  4TZ4 C;  3CWZ B;  2XAF B;  3RYH E;  5JR9 C;  2ODU A;  2G0U A;  2MOZ A;  2DLR A;  3KFW X;  3SOL A;  5H6Q B;  3N9M A;  2MBG A;  3N5L A;  5GON E;  1WR6 A;  1WRD A;  4ZS2 A;  3CQG B;  2Y6X A;  3UTK A;  2CE7 A;  4P09 A;  3O1I A;  3FB2 A;  5LJN A;  1MMN A;  3VU7 H;  1MIV A;  4FI5 A;  3UUL A;  4JLE A;  4JEU B;  1NWM X;  5LGN B;  4YLH A;  5LHH B;  3JC6 D;  3ZMS B;  1IZN B;  2DNX A;  4CXY A;  5ETW A;  3S4U A;  4EYU A;  2YIN A;  2DI4 A;  4DBR A;  3MXZ A;  1Y64 B;  4FJO A;  3OBV E;  3KV5 A;  1FIO A;  1KK7 A;  2LEH A;  4UV9 B;  3ZN0 B;  2CEA A;  3HR0 A;  3N9N A;  4PFP A;  5L3B B;  4PJM A;  4QX8 B;  5JRC B;  5JVD E;  3QUJ A;  2WM9 A;  2UXX B;  4DMV A;  5F8P A;  2XAQ B;  5LG4 A;  2W63 A;  4GK5 E;  3CPZ A;  1FEW A;  4ZI2 C;  2A3D A;  4OHF A;  5L3E B;  4UEM A;  5DJQ C;  1EZ3 A;  3BQL A;  4PJN A;  3RYC E;  4TN7 B;  3AAA B;  2VKD A;  1UCU A;  2E8I A;  3I9Y A;  3KBT A;  5LGU B;  4O4L E;  4H9N C;  4UVA B;  5EK4 A;  3N2K E;  3Q2M A;  4QWN B;  1UX5 A;  3C4W A;  4ADZ A;  3I9W A;  5JH7 E;  3HKE E;  2LJL A;  1G8X A;  3CQC B;  3RYI E;  5LBQ B;  4UF0 B;  2NP9 A;  2NTX A;  1MMD A;  1OXZ A;  5LXT E;  4PFO A;  5TAO A;  5LJM A;  2LHN A;  4XZC A;  4DMW A;  3DP7 A;  3CKD A;  2X68 A;  4G2A A;  5HXH A;  3GMI A;  3VKH A;  4AQG A;  5EZY E;  2V26 A;  3ZMT B;  2NW9 A;  2JJ9 A;  4H63 V;  3FXD B;  3DJB A;  2HPJ A;  2X9Y A;  5JR9 A;  2LE8 A;  3J9X 1;  2Z6E A;  1SA0 E;  3CQX C;  3PUA A;  3MKD A;  3HKC E;  1U4Q A;  4QXB B;  3DTO A;  4N78 D;  5BMV E;  2E9X C;  3K3O A;  2YU2 A;  2YU1 A;  4U72 A;  3LK2 B;  3KV6 A;  4PK6 A;  2YK0 A;  4BJM A;  4CI2 B;  2BDE A;  3ZMU B;  4H9R C;  4CXW A;  2KWI B;  2ZM8 A;  4NUV A;  4UVB B;  2B1E A;  2JMH A;  4IHJ E;  2IC9 A;  5H6R B;  4H9O C;  1IJ5 A;  2VKO A;  2LSY A;  3C51 A;  3EDU A;  4V1A v;  2W00 A;  2LSJ A;  2H3R A;  2X9W A;  3HI2 A;  4PNI A;  2D0U A;  2XAH B;  5E0O A;  4ASK A;  5JDQ A;  2PFV A;  2QGS A;  2EHO C;  3OJA A;  4UVC B;  3UUM A;  1E1H B;  4EOZ B;  1B7T A;  5J1G A;  1D1C A;  1H7C A;  3RPU A;  2CM0 A;  5FXW A;  3KBU A;  5JDN A;  4EAH A;  2VB6 A;  2PG8 A;  3GN5 A;  4WNK A;  3LBX A;  4IST A;  3ZCJ A;  4EIW A;  2JQQ A;  4QXH B;  2C0S A;  1UX4 A;  3ETV A;  3V5S A;  4G63 A;  2NOX A;  3OYX A;  3ZMZ B;  4BAY B;  2L9Q A;  2K5B B;  3D0T A;  3NBX X;  4ILU A;  1HF8 A;  3ANW B;  2BVL A;  4I55 E;  3ZN1 B;  3C64 A;  3FBZ A;  3IEE A;  5L3D B;  2V7M A;  3Q5X A;  1AJ3 A;  2E9X B;  5LOV E;  3RRW A;  4HEA A;  2Y48 B;  2CA5 A;  3LG7 A;  4MAL A;  1BR4 A;  5CA1 E;  3RC8 A;  3L09 A;  2X66 A;  1MMA A;  2QA7 A;  4I4T E;  5HWX A;  2XHE B;  3HKD E;  2JMK A;  4L9I A;  5EK3 A;  4BA9 A;  4E7Z A;  3EVY A;  3ZMV B;  4JEH B;  5KX5 E;  3P8C D;  4M1P A;  1KNZ A;  4GYR A;  3WI3 A;  4IE5 A;  3N9P A;  5FYM A;  2KXP B;  2ODV A;  1D0X A;  1HX8 A;  4OYJ A;  3FHN A;  3ONX A;  2VKJ A;  3ZYL A;  2EHO B;  4UXN B;  1WLX A;  2CXL A;  3AA0 B;  2GK9 A;  4PK5 A;  3KV4 A;  2XAG B;  4CI3 B;  2X0L B;  3ZYM A;  2XAS B;  4I43 B;  4C91 A;  2CXD A;  3RKO A;  5HYA A;  2C5K T;  5IYZ E;  2BVM A;  1LKX A;  4X1Y E;  3RH3 A;  4HTE A;  4Z8X A;  4CI1 B;  2C5J A;  5LCY A;  2LM9 A;  4IE0 A;  2CWY A;  2WMO A;  3JC6 C;  1MIY A;  3HL6 A;  2LSI A;  3AA7 B;  2Q9Q B;  2CCQ A;  2C5I T;  4H9S E;  2X9H A;  4IGU A;  5LA6 E;  5AFU L;  4TUY E;  5FNV E;  4HFV A;  4CZZ B;  2EHO A;  5JQG E;  3CML A;  3I0Q A;  3ZLI A;  5LNK A;  2V7I A;  4GOU A;  2LSK A;  5JRC A;  2KWH A;  3ZPO A;  1D1B A;  3WAK A;  5CA0 E;  1FMW A;  3ZYK A;  1HS7 A;  4HE8 A;  3E08 A;  3KDS E;  4HN9 A;  5JDL A;  4P0A A;  1YKH B;  5J2T E;  4K0U A;  2DWK A;  5CB4 E;  1D0Z A;  2N1G A;  2XUE A;  3BQK A;  1SHZ C;  4ZI3 C;  2VK9 A;  3U3I A;  2W0G A;  1D0Y A;  3RC3 A;  4AKI A;  4UEL A;  2YEV C;  4YFS A;  2XTL A;  4XBF B;  1VOM A;  2A2F X;  2M67 A;  2JRK A;  2KZ7 B;  3F2E A;  1S94 A;  2A72 A;  2ZMA A;  3PUS A;  4L5G A;  4MFR A;  4O4H E;  3CX8 B;  4EXT A;  5IHY A;  3L3P A;  2KND A;  4QXC B;  5LBM A;  4UF0 A;  3OKQ A;  3VHL A;  2N9D A;  2VKH A;  3O1H A;  4UV8 B;  5JDF A;  4X1I E;  4J2C A;  5FXZ A;  2DHR A;  2LSG A;  3F57 A;  2J1D G;  4O2A E;  5LP6 E;  4TX5 A;  3T8O A;  4O4I E;  3ZJ1 A;  4AKL A;  5C8Y E;  1HTJ F;  1G73 A;  5JDM A;  2MTQ A;  3LFM A;  2ZM2 A;  4IDZ A;  3ZC1 A;  5FY0 A;  4WW0 A;  3SRZ A;  3I0O A;  5LYJ E;  3VKG A;  3MK7 C;  2P9B A;  4AXP A;  3LJC A;  2KIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...