1BR0A

Three dimensional structure of the n-terminal domain of syntaxin 1a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
DRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of an evolutionarily conserved N-terminal domain of syntaxin 1A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords PROTEIN (SYNTAXIN 1-A)
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1998-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1br0A00
1S94A 4JEUB 1HS7A 1FEWA 3LG7A 3C98B 2DNXA 1EZ3A 4TX5A 5M4YA 4JEHB 1BR0A 2XHEB 1FIOA 5LG4A 1G73A
chains in the Genus database with same CATH superfamily
4U2YA 2QGSA 4CN4A 3N9NA 4B3TT 4JYAT 4HFDA 2YKSA 4WW0A 3RGLA 3VRAA 5H6RB 1YQ3A 4DMVA 5FXZA 4NXNT 1XZYA 2UUAT 1BR1A 2D0TA 5FXXA 3AE3A 3ANWA 4TNVA 2UXBT 4WNKA 1N33T 2JRKA 1YKEB 3ZC1A 2DCFA 1UUSA 2V7IA 4PK4A 4YLHA 3ONXA 5AQGB 3IA3A 2XJ7A 5JREA 1NENA 3MZKB 5JDFA 4LFCT 4L5GA 5HXEA 3AEGA 3KVAA 4HWHA 3MA9A 3SS1A 3PV0F 4JI4T 1QLBA 4C90A 5LJMA 3KFWX 3AEEA 4Z90A 4A5XA 2JQKA 4LF4T 3NZPA 2K3WA 4P0BA 4IDZA 4JV5T 4B3MT 3SOLA 4ILAA 2LSKA 3RQUA 1N34T 3W15B 3M3ZB 4IDNA 3VRBA 3N9LA 2ODUA 2CM0A 2CHNA 2WZIA 1HFAA 3NZQA 2Y6XA 3P8CD 4O4LE 5HAXA 5DQVA 3OYXA 3C98B 4DV7T 1XMOT 4YSYA 2VWAA 3AE1A 4JEHB 4IDQA 4BA9A 2KWIB 2Q9QA 5AQFB 3FZLB 5ABFB 2N1GA 2XZEA 1E7PA 2ZM0A 3UUXB 3N2OA 3AA1B 4DR3T 3H3AA 2BBHA 4WZXA 1OEDE 2MAWA 2XAQB 4QXHB 5HXCA 5L2LA 1D0YA 3JCFA 1IJ5A 3AXJB 4NUUA 2CEAA 4DIDB 5LGTB 2CRBA 4TWHA 3ZYMA 3ZSTA 3KDSE 3PE0A 5FP3A 2KMFA 1NWMX 3SRZA 5L3EB 2EHOA 2C5KT 3PUXF 5AQMB 3FBLA 5AQUB 2WAUA 2XAFB 2D0UA 3IBPA 4YTNA 5F8PA 2W63A 3RHWA 4N78D 1V9DA 1MMGA 2CCQA 4H9RC 1ZKEA 4WBOA 3CQCB 1EZ3A 2A2FX 4TNWA 4TV9E 1W9RA 2CBJA 4YSZA 3ZMZB 5FL1A 3FZHB 2X68A 1IBMT 1JNRA 4QHOA 1VCTA 2BVMA 2J4GA 4LF5T 1HX8A 5IHYA 2MPKA 4GIWA 4Z8XA 5J2UE 4GKKT 2R6GF 4J2CA 4KI0F 5IWAT 1IZNB 1W09A 4TZ4C 4HWFA 3HKEE 4QH4A 3VKGA 3UQ7A 3L39A 2VB6A 3C4XA 3LDQB 4X20E 1KNPA 3L3PA 5LYJE 3RIUA 2IHR1 4DV2T 2CLYC 2ZM6T 3VR9A 2D2SA 1FIOA 3UUBA 4COFA 1HF8A 5FVLA 4LF9T 2J1DG 1MMNA 3H37A 3ONLC 4CN1A 3RF1A 2VKJA 2YDSA 4YFSA 2NWBA 4EV6A 3DTOA 1QSDA 4MFRA 2V1DB 5FKYA 3P4PA 4UVBB 2ODVA 4U2ZA 3WAJA 4ZEYA 3AECA 3C4ZA 3L09A 4DV6T 4JI8T 4HTEA 3VHLA 5ABEA 1FMWA 2LE8A 4ILBA 5HEGA 1N36T 2BS3A 2EHOB 4IE0A 2FUPA 4LMJA 4PJJA 3N9PA 4HWCA 5FNVE 3KV6A 3SFDA 4AQGA 3WI3A 1FEWA 5HEOA 4CI1B 3NKZA 4JI6T 1ZEEA 2V7MA 2LRKA 5AQLB 1BR4A 4MALA 1XNQT 1WR6A 3CMLA 4KX6A 2XSAA 1IBKT 1H7CA 5DJQC 3ESLA 4HFBA 2LSYA 3HI2A 4PW8A 1XDOA 3OBVE 4HFEA 4BAYB 4NXMT 4EEBA 4ZZBA 4X62T 5GONE 1SE7A 2HPLA 4BJMA 1J1JA 1SUMB 3GWHA 3N9MA 5LGNB 4OFZA 4AQFA 2V8SV 2XHEB 4HWIB 5LXTE 3RIFA 1WRDA 1HNZT 1UX4A 4AKGA 5LP6E 2IIUA 2VL8A 2LSIA 5ABGA 3KV5A 1UGOA 3MK7C 1S35A 2I59A 3OKQA 3P7IA 3V5SA 3TLVA 3UT5E 3C4WA 4H63V 4NIQA 2C5JA 4HFHA 3I0QA 4PJLA 3RYCE 2K5BB 3RRCA 4UF0A 5AQKB 4DV1T 4HKAA 3AAEB 4IL4A 3RX6A 2V7LA 4DO0A 4CQIA 3ZT6A 4PK6A 3A5XA 5FY7A 2W4XA 3F31A 3ZSSA 2ZMAA 4UR9A 4E7ZA 3OVUA 5JDQA 3PUGA 2BKOA 3K3QC 4IDPA 4YTMA 4CXXA 5JDNA 3AAIA 5LJNA 2LT3A 3CX6B 2L8KA 4GYSA 4ISTA 2MYSA 2C0SA 1T98A 3Q5DA 2M6IA 5H6QB 3BQKA 3MKDA 3K3OA 3EUHA 3FXEB 2LRLA 2A9UA 3UU8A 2H7VC 1MMDA 5AQSB 3AA7B 3AEBA 5LMNT 2D9DA 1T72A 1XMQT 2YDQA 1J5ET 3AE7A 5EK2A 5JDLA 1KNZA 2X67A 1HTJF 2XSBA 2ZM8A 2PJQA 2LEHA 2DHRA 5LNKA 1MNEA 3ZEFB 3GA8A 4IIJE 4IL9A 2K48A 3BQIA 3ZLIA 4LFAT 3CPZA 3F57A 2W61A 2YINA 2PTFA 2NR4A 3B57A 3PUZF 2V5CA 1Z0PA 4HWDA 4ISSA 4U33A 4Z91A 4YXDA 4PFPA 3ZMTB 3UUNA 4PJNA 4CN6A 2MTQA 2PFVA 4YY3T 3A7MA 2VQFT 2E5VA 2LM2A 4O4HE 5DQWA 2WQYA 3ONJA 5IUXA 4OX9T 3FBZA 3LBXB 4P1NA 2XQ3A 5AQVB 1WCRA 2CWOA 3TKLB 5JDGA 5JH7E 2W62A 4I43B 1J5WA 4UIGA 4JI2T 2UXNB 2W67A 3DP7A 3E0ZA 4ZHQE 3JC6C 1XWMA 1R8IA 2XASB 2V7JA 2XPKA 3CQXC 3GMIA 2BDEA 3D0TA 3PUSA 4OHFA 2NW7A 3ZMVB 3H3MA 4GK5E 3AA0B 1Y01A 3TLSA 4JI0T 2B76A 4ZI7E 3ZT7A 3AVRA 3JC6D 5J1GA 4GK0E 4BJNA 1G73A 3RKGA 5CA0E 2UXDT 5JRCB 2YN6A 3KVBA 4NPPA 4U7IA 2ZLYA 4LFBT 1OEDC 2WMOA 2WU5A 4DVDA 3SWHA 3ZCJA 5LMUT 4DR5T 5JDMA 2W0GA 5HCJA 3CIRA 1KFYA 3JAEA 2X0HA 3HL6A 4A97A 4EYYR 4DR7T 4AKRB 2K24A 5FXVA 2FJEA 4E7SA 4QWNB 5J0ZA 3O9XA 2QA7A 1VRBA 3ZC0A 1D0XA 2VVSA 3RYIE 3CX8B 3ZCIA 2B1EA 4ANJA 4YJ2E 2ES0A 2KT9A 3P4RA 2ACZA 1OXZA 3O1HA 4AI6A 2IMLA 4DR1T 2I6HA 1JNZA 2H7OA 2J47A 2V7KA 2X51A 2RA1A 1D0ZA 5CGMA 3ZMSB 2VVNA 4NUVA 3EDUA 4PJMA 2Q9QB 5F3JA 2BG9A 5L3GB 4H63H 4YSXA 3HA4A 2XQ7A 3P4WA 2XAJB 2NOXA 2KNDA 4OK0A 1KEYA 3U3IA 2VK9A 3O1IA 1KK7A 3TLTA 3FB2A 1D1AA 2BG9B 2D5UA 4JUYA 5JRCA 3A8YC 3IF8B 3RKOA 1GQEA 3LG7A 3UQ4A 1OEDA 4EYUA 2XQ8A 1E1HB 2X9YA 3G06A 3GN5B 2XQ6A 4IE7A 5JVDE 5HWYA 4UV8B 1HR0T 2X0LB 5LB7B 2WB5A 5LGUB 2F4VT 2VASA 2LSJA 3AE4A 5CJ5A 3KV4A 5A1LA 4YJ3E 5LHGB 3NBXX 2J62A 1OWAA 1ZOYA 3PDYA 3RI5A 4A98A 4DR4T 2LOSA 2L9QA 3N5LA 5JTGA 2W66A 2BKNA 1MIYA 2XY8B 3EAMA 4AQFC 4EB6E 4IE5A 4JBWF 5HXRA 2NW9A 4TWFA 1HNXT 3FHNA 1HX1B 1O3XA 3ZT5A 5HWXA 4XAXB 3K3NA 2ACXA 3ABVA 1U5PA 3C64A 2JQQA 2MBGA 3LK42 1UX5A 3UFEA 2WZHA 2FJDA 5CA1E 4DUYT 2BG9C 1D1CA 2CXDA 2E8IA 2HN2A 2WP9A 4DBQA 2XQAA 3CQGB 4HFVA 3KV9A 1ZV4X 3QUJA 2XAGB 3LFMA 4H9NC 3PUYF 5JR9A 3J9X1 3EDVA 4ZXLA 3PU8A 2NTXA 3PUAA 4O8SA 1LRZA 4JLEA 3ETVA 5FMNA 4LF8T 4C91A 5C8YE 2HN1A 4EEDA 4O4JE 3GN5A 3CVRA 5LG4A 2HPJA 5JR9B 3OTOT 5EZYE 3PTRB 2OV9A 5HXSA 3EVYA 3QB5K 4AXPA 3JADA 4AISA 2UUCT 1XDPA 5LBQB 1ZHCA 3VR8A 5FY0A 1G8XA 2LJLA 3O1JA 4IE6A 4K0KT 1MMAA 1HG2A 3AE8A 2JMKA 4QXCB 1E2AA 2QVAA 1UURA 3RQWA 4ADZA 2W00A 1VOMA 5LG3A 2K9AA 4HFIA 3R84B 2CE7A 2HH7A 4I55E 4TV8E 4KMCA 4ILCA 1YW0A 3UU5A 2YEVC 3M65A 2QRXA 4I0UA 3QB5A 5AQOB 4O4IE 2CLYB 1L0VA 2Y8DA 3PJAJ 3VU7H 2XQ9A 1T8BA 4K0UA 5AQIB 4Q25A 3RPUA 2X9XA 1WR0A 3AEDA 3PURA 3ZYKA 1I94T 4DV0T 5LHHB 3QK6A 1YD8G 3OJAA 3UUMA 5FYMA 2EHOD 3NRYA 2VKHA 3L8RA 3MACA 5JR9C 5KX5E 2IUBA 3LJCA 3TLWA 5L4EA 2YU2A 4DNDA 5CFBA 2VURA 2UUBT 3K8PC 2IDOB 4XBFB 3E08A 3EABA 4H9OC 5AFUL 3J7Yq 3TLUA 2UU9T 3T8OA 4MBQA 2XM2A 4OYJA 1WYBA 3QOFA 3Q5WA 5LCYA 4QXBB 3Q5XA 3KBTA 3AE9A 4IREA 5L47A 4DR2T 3AXJA 2BZBA 2Q9QD 3PUQA 2L3LA 4I50E 4DV4T 3Q5EA 1D1BA 2LHRA 2OA5A 3QNUA 2FJAA 1MIVA 3ANWB 4DV3T 1T7SA 2VL0A 2RPAA 3ZN0B 2E9XB 4QKNA 1XNRT 5AQTB 4V1Av 1IAPA 3RH3A 3AE2A 4L9IA 5M4YA 3V5UA 3CX7B 5ADXL 4JI3T 3MXZA 1NAFA 3I9WA 4ZI2C 2XTLA 1NEKA 3ETUA 2H88A 4F8HA 4HEAA 3FZFB 4EIWA 3AVSA 2V6YA 2PBIA 1IBLT 3WAKA 2H89A 2CA5A 2IC9A 4X1KE 1S94A 4AKLA 4JEUB 4P0AA 4LF7T 5AQRB 1SHZC 4FJOA 2QYWA 3C50A 2LKHA 4X1YE 2Y48B 5FL0A 4EZ4A 5JQGE 3RIAA 4DR6T 2X0YA 2CPTA 5HEHA 4H9QC 1WLXA 4CI2B 2LM9A 3FZKB 2DWKA 4ASKA 4JI5T 1BR2A 4DV5T 5FXWA 1KF6A 5F5WA 2AE9A 1AJ3A 4ERRA 4KHZF 4P09A 2W2UA 4EGWA 3O4XE 1YQ4A 1YKHB 4O2AE 1ZP0A 3AB3B 4IDOA 4AQYT 2E9XC 4U7YA 1FMVA 1M62A 2M6BA 3B5MA 4H9PC 5JDHA 2DI4A 4EXTA 3P4QA 5L3BB 3BQLA 3T1YT 4JI7T 2BG9E 4UV9B 3KINB 4EOZB 1FJGT 2BS2A 1X9BA 2E9XA 5IYZE 2YU1A 4U72A 4AKIA 4AKHA 3C51A 3CKDA 3JAFA 5HXHA 4U74A 5L3FB 2BBJA 3QC9A 5BMVE 2DWGA 2WMNA 5AQQB 5ABFA 3EHZA 4LMLA 4CXYA 2CHOA 2WBLA 3UU6A 4G2AA 2FBWA 1Z8UA 3P4SA 5HEJA 4X1IE 3I0OA 1HS7A 2CWYA 3AEAA 5HCMA 4ZZCA 3FZMB 2CXLA 4YHJA 2A72A 4X64T 2NW8A 4F6RC 3EI0A 2LHNA 4DBRA 2LSGA 2N2NA 4UVCB 4ZI3C 4B6XA 2E5LT 2VKDA 2A3DA 2IC6A 2XQYA 1CHUA 2DL1A 4M1PA 3ZN1B 2PG8A 2WDQA 3RYHE 5HYAA 3UTKA 1QUUA 2FJBA 4KUMB 4UXNB 4XZCA 3R6NA 4MLKA 4PNIA 5EK4A 3OYZA 5KDMC 2UXXB 4GKJT 2IAKA 2WM9A 3PUVF 1IJ6A 5LBMA 3LK3B 4YHHT 1WYCA 5FVKA 5C3JA 4EZHA 1HNWT 2MOZA 3PUWF 2KSRA 1W0BA 1YXRA 2AXDS 2Q9QC 3I9YA 5ETWA 5KXJA 3PU3A 4DUZT 1LVKA 4GYRA 4MHCA 5L4HA 4JI1T 3LK2B 2LKGA 3BK9A 1I6ZA 1LKXA 4DMWA 1OEDB 2CXFA 1UCUA 2P9BA 3N2KE 3UFGA 5ABHA 4ZI3D 4HGAA 1X79A 2KLQA 2VQET 2XQ4A 2XUEA 3E22E 4X66T 3ZKRA 2WU2A 4O2BE 3Q9DA 3NRXA 4TWDA 4KP3C 5AQNB 2SPCA 3AA6B 2IW5B 4KHPT 2G0UA 2JIWA 4EAHA 2H3RA 2UXCT 3N9OA 3X1DA 2RP4A 1Y64B 5LHIB 1HG5A 3LSVA 4WBNE 3HKBE 3RC8A 3AEFA 2NP9A 1N32T 4L0RA 3AE6A 4OYKA 2JPFA 2WS3A 4UF0B 3IHRA 5TAOA 4YT0A 1M7KA 3HKCE 3RRWA 2KXPB 3B13A 4PAGA 1W0AA 5FY1A 1CUNA 2KINB 4QH1A 2CMRA 2XM1A 3KBUA 4YTPA 4UEMA 5L3DB 1DU2A 4IHJE 4TX5A 2E9XD 4ZS3A 4PK5A 1B7TA 2JMHA 3RIUC 3ZJ2A 1WFDA 2BS4A 4IT4A 3S4UA 3LBXA 3ZMUB 2M67A 3I1AA 3RC3A 3IEEA 1US7B 4WYVA 4ZS2A 2HHHT 2X9HA 3T1HT 4QH5A 4H9SE 3DJBA 2E2AA 3CK6A 3SFEA 3P50A 4KBMB 2WSSV 5E0OA 3ZYLA 2V26A 4GOUA 3NVOA 5AQHB 4CI3B 3OPCA 3Q2MA 1MNDA 2WCAA 1BR0A 2BKPA 2NTYA 2V6YB 4ILUA 5BR8T 4LF6T 2V6XA 3HR0A 2WWUA 2X66A 3AE5A 2KWHA 3MJXA 4LMKA 2CBIA 2DNXA 5AQJB 2EHOC 2I0MA 2LOPA 4I4TE 3UULA 2JQ9A 2LLYA 4HN9A 5AQPB 5LOVE 4ZI2D 2VKOA 4UELA 5L3CB 3RLFF 4HFCA 3RYFE 3ZJ1A 2YOEA 3HKDE 2ZM2A 2YDRA 4U3CA 4UVAB 1MIWA 3UU4A 1UK5A 2V5DA 2XQ5A 4IGUA 2DLRA 1SA0E 2JJ9A 3PJAA 3U78A 3VKHA 3NWIA 4B3ST 1KNRA 2WY2A 4X65T 3F2EA 4B3RT 5KMGP 1VCSA 3FXDB 3N2GE 5EK3A 3UU3A 5J2TE 4HE8A 2C5IT 2XAHB 4QX7B 2GK9A 3CWZB 5CB4E 4X5TA 3ZPOA 4TUYE 4AIUA 4U31A 1LVFA 1U4QA 2YK0A 4QX8B 4ZOLE 2WDRA 2Z6EA 2OLTA 2JQHA 3N9QA 4A56A 1HCIA 4IE4A 2N9DA 5DABA 5HEUA 2KZ7B 3AAAB 4FI5A 4CZZB 2BVLA 2X9WA 4PFOA 2WWVA 2WDVA 3K1SA 4G63A 4CXWA 5LA6E 5C2TA 4TN7B
chains in the Genus database with same CATH topology
2QGSA 3N9NA 4WW0A 4DMVA 5H6RB 5FXZA 1BR1A 2D0TA 5FXXA 3ANWA 4WNKA 2JRKA 1YKEB 3ZC1A 2DCFA 2V7IA 4PK4A 4YLHA 3ONXA 5JREA 3MZKB 5JDFA 4L5GA 5HXEA 3KVAA 3MA9A 3SS1A 5LJMA 4C90A 3KFWX 3NZPA 4P0BA 4IDZA 3SOLA 2LSKA 3W15B 3N9LA 2CM0A 2ODUA 3NZQA 3UUXB 1HFAA 2Y6XA 3P8CD 4O4LE 5HAXA 5DQVA 3OYXA 3C98B 2VWAA 4JEHB 4BA9A 2KWIB 2Q9QA 2N1GA 2ZM0A 3N2OA 3AA1B 3H3AA 5HXCA 5L2LA 2XAQB 4QXHB 1D0YA 1IJ5A 4NUUA 2CEAA 5LGTB 3ZYMA 3KDSE 3PE0A 5FP3A 2KMFA 1NWMX 3SRZA 5L3EB 2EHOA 2C5KT 3FBLA 2WAUA 2XAFB 2D0UA 3IBPA 5F8PA 2W63A 4N78D 1V9DA 1MMGA 2CCQA 4H9RC 1ZKEA 4WBOA 3CQCB 1EZ3A 2A2FX 4TV9E 3ZMZB 2X68A 4QHOA 2BVMA 1HX8A 5IHYA 4GIWA 4Z8XA 5J2UE 4J2CA 1IZNB 4TZ4C 3HKEE 3VKGA 2VB6A 3C4XA 4X20E 3L3PA 5LYJE 2CLYC 2D2SA 1FIOA 1HF8A 2J1DG 1MMNA 3H37A 2VKJA 4YFSA 2NWBA 3DTOA 1QSDA 4MFRA 2V1DB 4UVBB 2ODVA 3C4ZA 3L09A 4HTEA 3VHLA 1FMWA 2LE8A 2EHOB 4IE0A 4PJJA 5FNVE 3N9PA 4AQGA 3KV6A 3WI3A 1FEWA 4CI1B 1ZEEA 2V7MA 1BR4A 4MALA 1WR6A 3CMLA 1H7CA 5DJQC 3ESLA 2LSYA 3HI2A 4PW8A 4BAYB 3OBVE 5GONE 2HPLA 4BJMA 3GWHA 3N9MA 5LGNB 4OFZA 4AQFA 2XHEB 5LXTE 1WRDA 1UX4A 4AKGA 5LP6E 2VL8A 2LSIA 3KV5A 3MK7C 3V5SA 1S35A 2I59A 3OKQA 3P7IA 3UT5E 3C4WA 4H63V 2C5JA 3I0QA 4PJLA 3RYCE 2K5BB 3RRCA 4UF0A 4HKAA 3AAEB 3RX6A 2V7LA 4DO0A 4CQIA 4PK6A 3A5XA 5FY7A 3F31A 2ZMAA 4E7ZA 5JDQA 3PUGA 3K3QC 5JDNA 3AAIA 2LT3A 3CX6B 2L8KA 4GYSA 4ISTA 2MYSA 2C0SA 1T98A 5H6QB 3BQKA 3MKDA 3K3OA 3EUHA 3FXEB 2H7VC 1MMDA 3AA7B 1KNZA 5EK2A 5JDLA 2X67A 1HTJF 2ZM8A 2PJQA 2LEHA 2DHRA 5LNKA 1MNEA 3ZEFB 3GA8A 4IIJE 3ZLIA 2K48A 3BQIA 3CPZA 3F57A 2W61A 2YINA 3B57A 1Z0PA 4ISSA 4PFPA 3ZMTB 3UUNA 4PJNA 2MTQA 2PFVA 4O4HE 5DQWA 3FBZA 3LBXB 3TKLB 2CWOA 5JDGA 5JH7E 2W62A 4I43B 4UIGA 2UXNB 3DP7A 4ZHQE 3E0ZA 3JC6C 2XASB 3CQXC 3GMIA 2V7JA 4OHFA 3ZYKA 3RC8A 2BDEA 3D0TA 3PUSA 2NW7A 3ZMVB 4GK5E 3AA0B 4ZI7E 5CA0E 3AVRA 3JC6D 5J1GA 4GK0E 4BJNA 1G73A 5JRCB 3KVBA 2ZLYA 2WMOA 4DVDA 3SWHA 3ZCJA 5JDMA 2W0GA 3HL6A 4EYYR 4AKRB 2K24A 5FXVA 4E7SA 3O9XA 4QWNB 2QA7A 1VRBA 3ZC0A 1D0XA 3RYIE 3CX8B 3ZCIA 2B1EA 4ANJA 4YJ2E 2ES0A 2KT9A 1OXZA 3O1HA 4AI6A 2H7OA 2V7KA 2X51A 2RA1A 1D0ZA 3ZMSB 4NUVA 3EDUA 4PJMA 2Q9QB 5F3JA 5L3GB 4H63H 3HA4A 2XAJB 2KNDA 2NOXA 4OK0A 3U3IA 2VK9A 3O1IA 1KK7A 3FB2A 1D1AA 4JUYA 2D5UA 5JRCA 3IF8B 3RKOA 3LG7A 4EYUA 1E1HB 2X9YA 3GN5B 4IE7A 5JVDE 5HWYA 4UV8B 2X0LB 5LGUB 2VASA 2LSJA 3KV4A 5A1LA 4YJ3E 5LHGB 3NBXX 1OWAA 3PDYA 2LOSA 2L9QA 3N5LA 4AQFC 1MIYA 4EB6E 4IE5A 2NW9A 5HXRA 3FHNA 1O3XA 5HWXA 4XAXB 3K3NA 2ACXA 1U5PA 3C64A 2JQQA 2MBGA 3LK42 1UX5A 3UFEA 5CA1E 2E8IA 1D1CA 2CXDA 4DBQA 3CQGB 4HFVA 3KV9A 1ZV4X 3QUJA 2XAGB 3LFMA 4H9NC 5L3FB 5JR9A 3J9X1 3EDVA 3PU8A 2NTXA 3PUAA 4O8SA 1LRZA 4JLEA 3ETVA 5FMNA 4C91A 5C8YE 4O4JE 3GN5A 3CVRA 5LG4A 2HPJA 5JR9B 5EZYE 3PTRB 5HXSA 3EVYA 4AXPA 5LBQB 1ZHCA 5FY0A 1G8XA 2LJLA 3O1JA 4IE6A 1MMAA 1HG2A 2JMKA 4QXCB 4ADZA 2W00A 1VOMA 2K9AA 3R84B 2CE7A 2HH7A 4I55E 4TV8E 4KMCA 1YW0A 2YEVC 3M65A 4O4IE 2CLYB 2Y8DA 4K0UA 3RPUA 2X9XA 3PURA 5LHHB 3QK6A 1YD8G 3OJAA 3UUMA 5FYMA 2EHOD 3NRYA 2VKHA 5JR9C 3MACA 5KX5E 3LJCA 2YU2A 4DNDA 3K8PC 4XBFB 3E08A 4H9OC 5AFUL 3J7Yq 3T8OA 4MBQA 4OYJA 5LCYA 1WYBA 4CXXA 3Q5WA 5BMVE 4QXBB 3Q5XA 3KBTA 5LJNA 2BZBA 2Q9QD 3PUQA 2L3LA 4I50E 1D1BA 2LHRA 2OA5A 1MIVA 3ANWB 3ZN0B 2E9XB 4QKNA 4V1Av 1IAPA 3RH3A 5M4YA 4L9IA 3V5UA 3CX7B 5ADXL 3MXZA 1NAFA 3I9WA 4ZI2C 2XTLA 3ETUA 4HEAA 4EIWA 3AVSA 2PBIA 3WAKA 2CA5A 2IC9A 4X1KE 1S94A 4AKLA 4JEUB 4P0AA 1SHZC 4FJOA 3C50A 4EZ4A 5JQGE 4X1YE 2Y48B 4H9QC 1WLXA 4CI2B 2LM9A 2DWKA 4ASKA 1BR2A 5FXWA 1AJ3A 4ERRA 4P09A 3O4XE 4O2AE 1YKHB 3AB3B 2E9XC 1FMVA 4H9PC 5JDHA 5L3BB 2DI4A 3BQLA 4UV9B 3KINB 4EOZB 2E9XA 5IYZE 2YU1A 4U72A 4AKIA 4AKHA 3C51A 3CKDA 5HXHA 4U74A 3QC9A 2DWGA 2WMNA 4CXYA 2WBLA 4G2AA 4X1IE 3I0OA 2CWYA 2CXLA 4YHJA 2A72A 2NW8A 4F6RC 4DBRA 2LHNA 2LSGA 2N2NA 4UVCB 4ZI3C 4B6XA 2VKDA 2A3DA 2IC6A 2XQYA 4M1PA 3ZN1B 2PG8A 3RYHE 5HYAA 3UTKA 1QUUA 4UXNB 4KUMB 4XZCA 3R6NA 4EXTA 4MLKA 4PNIA 5EK4A 3OYZA 5KDMC 2UXXB 2IAKA 2WM9A 5LBMA 1IJ6A 3LK3B 1WYCA 4EZHA 2MOZA 2Q9QC 3I9YA 5ETWA 3PU3A 1LVKA 4GYRA 4MHCA 3LK2B 3BK9A 1LKXA 4DMWA 3N2KE 2CXFA 1UCUA 2P9BA 4ZI3D 4HGAA 1X79A 2KLQA 2XUEA 3E22E 4O2BE 3Q9DA 3NRXA 4KP3C 2SPCA 3AA6B 2IW5B 2G0UA 4EAHA 2H3RA 3N9OA 2RP4A 1Y64B 5LHIB 1HG5A 4WBNE 3HKBE 2NP9A 4L0RA 4OYKA 2JPFA 4UF0B 3IHRA 5TAOA 3HKCE 3RRWA 2KXPB 3B13A 4PAGA 5FY1A 1CUNA 2KINB 2CMRA 3KBUA 1HS7A 4UEMA 5L3DB 4IHJE 4TX5A 2E9XD 4ZS3A 4PK5A 1B7TA 2JMHA 3ZJ2A 3S4UA 3LBXA 3ZMUB 2M67A 3I1AA 3RC3A 3IEEA 1US7B 4ZS2A 2X9HA 4H9SE 3DJBA 4KBMB 2WSSV 5E0OA 3ZYLA 2V26A 4GOUA 4CI3B 3Q2MA 1BR0A 1MNDA 2NTYA 4ILUA 3HR0A 2WWUA 2X66A 2KWHA 3MJXA 2DNXA 2EHOC 2LOPA 4I4TE 3UULA 3VU7H 4HN9A 4ZI2D 5L3CB 5LOVE 3WAJA 2VKOA 4UELA 3ZJ1A 3RYFE 3HKDE 2ZM2A 4UVAB 1MIWA 4IGUA 2DLRA 1SA0E 2JJ9A 3U78A 3VKHA 3F2EA 5KMGP 3FXDB 3N2GE 5EK3A 5J2TE 4HE8A 2C5IT 2XAHB 4QX7B 2GK9A 3CWZB 5CB4E 3ZPOA 4TUYE 1LVFA 1U4QA 2YK0A 4QX8B 4ZOLE 2Z6EA 3N9QA 4A56A 1HCIA 4IE4A 2N9DA 5DABA 2KZ7B 3AAAB 4FI5A 4CZZB 2BVLA 2X9WA 4PFOA 4G63A 4CXWA 5LA6E 4TN7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S94 A;  4JEU B;  1HS7 A;  1FEW A;  3LG7 A;  3C98 B;  2DNX A;  1EZ3 A;  4TX5 A;  5M4Y A;  4JEH B;  1BR0 A;  2XHE B;  1FIO A;  5LG4 A;  1G73 A; 
#chains in the Genus database with same CATH topology
 4U2Y A;  2QGS A;  4CN4 A;  3N9N A;  4B3T T;  4JYA T;  4HFD A;  2YKS A;  4WW0 A;  3RGL A;  3VRA A;  5H6R B;  1YQ3 A;  4DMV A;  5FXZ A;  4NXN T;  1XZY A;  2UUA T;  1BR1 A;  2D0T A;  5FXX A;  3AE3 A;  3ANW A;  4TNV A;  2UXB T;  4WNK A;  1N33 T;  2JRK A;  1YKE B;  3ZC1 A;  2DCF A;  1UUS A;  2V7I A;  4PK4 A;  4YLH A;  3ONX A;  5AQG B;  3IA3 A;  2XJ7 A;  5JRE A;  1NEN A;  3MZK B;  5JDF A;  4LFC T;  4L5G A;  5HXE A;  3AEG A;  3KVA A;  4HWH A;  3MA9 A;  3SS1 A;  3PV0 F;  4JI4 T;  1QLB A;  4C90 A;  5LJM A;  3KFW X;  3AEE A;  4Z90 A;  4A5X A;  2JQK A;  4LF4 T;  3NZP A;  2K3W A;  4P0B A;  4IDZ A;  4JV5 T;  4B3M T;  3SOL A;  4ILA A;  2LSK A;  3RQU A;  1N34 T;  3W15 B;  3M3Z B;  4IDN A;  3VRB A;  3N9L A;  2ODU A;  2CM0 A;  2CHN A;  2WZI A;  1HFA A;  3NZQ A;  2Y6X A;  3P8C D;  4O4L E;  5HAX A;  5DQV A;  3OYX A;  3C98 B;  4DV7 T;  1XMO T;  4YSY A;  2VWA A;  3AE1 A;  4JEH B;  4IDQ A;  4BA9 A;  2KWI B;  2Q9Q A;  5AQF B;  3FZL B;  5ABF B;  2N1G A;  2XZE A;  1E7P A;  2ZM0 A;  3UUX B;  3N2O A;  3AA1 B;  4DR3 T;  3H3A A;  2BBH A;  4WZX A;  1OED E;  2MAW A;  2XAQ B;  4QXH B;  5HXC A;  5L2L A;  1D0Y A;  3JCF A;  1IJ5 A;  3AXJ B;  4NUU A;  2CEA A;  4DID B;  5LGT B;  2CRB A;  4TWH A;  3ZYM A;  3ZST A;  3KDS E;  3PE0 A;  5FP3 A;  2KMF A;  1NWM X;  3SRZ A;  5L3E B;  2EHO A;  2C5K T;  3PUX F;  5AQM B;  3FBL A;  5AQU B;  2WAU A;  2XAF B;  2D0U A;  3IBP A;  4YTN A;  5F8P A;  2W63 A;  3RHW A;  4N78 D;  1V9D A;  1MMG A;  2CCQ A;  4H9R C;  1ZKE A;  4WBO A;  3CQC B;  1EZ3 A;  2A2F X;  4TNW A;  4TV9 E;  1W9R A;  2CBJ A;  4YSZ A;  3ZMZ B;  5FL1 A;  3FZH B;  2X68 A;  1IBM T;  1JNR A;  4QHO A;  1VCT A;  2BVM A;  2J4G A;  4LF5 T;  1HX8 A;  5IHY A;  2MPK A;  4GIW A;  4Z8X A;  5J2U E;  4GKK T;  2R6G F;  4J2C A;  4KI0 F;  5IWA T;  1IZN B;  1W09 A;  4TZ4 C;  4HWF A;  3HKE E;  4QH4 A;  3VKG A;  3UQ7 A;  3L39 A;  2VB6 A;  3C4X A;  3LDQ B;  4X20 E;  1KNP A;  3L3P A;  5LYJ E;  3RIU A;  2IHR 1;  4DV2 T;  2CLY C;  2ZM6 T;  3VR9 A;  2D2S A;  1FIO A;  3UUB A;  4COF A;  1HF8 A;  5FVL A;  4LF9 T;  2J1D G;  1MMN A;  3H37 A;  3ONL C;  4CN1 A;  3RF1 A;  2VKJ A;  2YDS A;  4YFS A;  2NWB A;  4EV6 A;  3DTO A;  1QSD A;  4MFR A;  2V1D B;  5FKY A;  3P4P A;  4UVB B;  2ODV A;  4U2Z A;  3WAJ A;  4ZEY A;  3AEC A;  3C4Z A;  3L09 A;  4DV6 T;  4JI8 T;  4HTE A;  3VHL A;  5ABE A;  1FMW A;  2LE8 A;  4ILB A;  5HEG A;  1N36 T;  2BS3 A;  2EHO B;  4IE0 A;  2FUP A;  4LMJ A;  4PJJ A;  3N9P A;  4HWC A;  5FNV E;  3KV6 A;  3SFD A;  4AQG A;  3WI3 A;  1FEW A;  5HEO A;  4CI1 B;  3NKZ A;  4JI6 T;  1ZEE A;  2V7M A;  2LRK A;  5AQL B;  1BR4 A;  4MAL A;  1XNQ T;  1WR6 A;  3CML A;  4KX6 A;  2XSA A;  1IBK T;  1H7C A;  5DJQ C;  3ESL A;  4HFB A;  2LSY A;  3HI2 A;  4PW8 A;  1XDO A;  3OBV E;  4HFE A;  4BAY B;  4NXM T;  4EEB A;  4ZZB A;  4X62 T;  5GON E;  1SE7 A;  2HPL A;  4BJM A;  1J1J A;  1SUM B;  3GWH A;  3N9M A;  5LGN B;  4OFZ A;  4AQF A;  2V8S V;  2XHE B;  4HWI B;  5LXT E;  3RIF A;  1WRD A;  1HNZ T;  1UX4 A;  4AKG A;  5LP6 E;  2IIU A;  2VL8 A;  2LSI A;  5ABG A;  3KV5 A;  1UGO A;  3MK7 C;  1S35 A;  2I59 A;  3OKQ A;  3P7I A;  3V5S A;  3TLV A;  3UT5 E;  3C4W A;  4H63 V;  4NIQ A;  2C5J A;  4HFH A;  3I0Q A;  4PJL A;  3RYC E;  2K5B B;  3RRC A;  4UF0 A;  5AQK B;  4DV1 T;  4HKA A;  3AAE B;  4IL4 A;  3RX6 A;  2V7L A;  4DO0 A;  4CQI A;  3ZT6 A;  4PK6 A;  3A5X A;  5FY7 A;  2W4X A;  3F31 A;  3ZSS A;  2ZMA A;  4UR9 A;  4E7Z A;  3OVU A;  5JDQ A;  3PUG A;  2BKO A;  3K3Q C;  4IDP A;  4YTM A;  4CXX A;  5JDN A;  3AAI A;  5LJN A;  2LT3 A;  3CX6 B;  2L8K A;  4GYS A;  4IST A;  2MYS A;  2C0S A;  1T98 A;  3Q5D A;  2M6I A;  5H6Q B;  3BQK A;  3MKD A;  3K3O A;  3EUH A;  3FXE B;  2LRL A;  2A9U A;  3UU8 A;  2H7V C;  1MMD A;  5AQS B;  3AA7 B;  3AEB A;  5LMN T;  2D9D A;  1T72 A;  1XMQ T;  2YDQ A;  1J5E T;  3AE7 A;  5EK2 A;  5JDL A;  1KNZ A;  2X67 A;  1HTJ F;  2XSB A;  2ZM8 A;  2PJQ A;  2LEH A;  2DHR A;  5LNK A;  1MNE A;  3ZEF B;  3GA8 A;  4IIJ E;  4IL9 A;  2K48 A;  3BQI A;  3ZLI A;  4LFA T;  3CPZ A;  3F57 A;  2W61 A;  2YIN A;  2PTF A;  2NR4 A;  3B57 A;  3PUZ F;  2V5C A;  1Z0P A;  4HWD A;  4ISS A;  4U33 A;  4Z91 A;  4YXD A;  4PFP A;  3ZMT B;  3UUN A;  4PJN A;  4CN6 A;  2MTQ A;  2PFV A;  4YY3 T;  3A7M A;  2VQF T;  2E5V A;  2LM2 A;  4O4H E;  5DQW A;  2WQY A;  3ONJ A;  5IUX A;  4OX9 T;  3FBZ A;  3LBX B;  4P1N A;  2XQ3 A;  5AQV B;  1WCR A;  2CWO A;  3TKL B;  5JDG A;  5JH7 E;  2W62 A;  4I43 B;  1J5W A;  4UIG A;  4JI2 T;  2UXN B;  2W67 A;  3DP7 A;  3E0Z A;  4ZHQ E;  3JC6 C;  1XWM A;  1R8I A;  2XAS B;  2V7J A;  2XPK A;  3CQX C;  3GMI A;  2BDE A;  3D0T A;  3PUS A;  4OHF A;  2NW7 A;  3ZMV B;  3H3M A;  4GK5 E;  3AA0 B;  1Y01 A;  3TLS A;  4JI0 T;  2B76 A;  4ZI7 E;  3ZT7 A;  3AVR A;  3JC6 D;  5J1G A;  4GK0 E;  4BJN A;  1G73 A;  3RKG A;  5CA0 E;  2UXD T;  5JRC B;  2YN6 A;  3KVB A;  4NPP A;  4U7I A;  2ZLY A;  4LFB T;  1OED C;  2WMO A;  2WU5 A;  4DVD A;  3SWH A;  3ZCJ A;  5LMU T;  4DR5 T;  5JDM A;  2W0G A;  5HCJ A;  3CIR A;  1KFY A;  3JAE A;  2X0H A;  3HL6 A;  4A97 A;  4EYY R;  4DR7 T;  4AKR B;  2K24 A;  5FXV A;  2FJE A;  4E7S A;  4QWN B;  5J0Z A;  3O9X A;  2QA7 A;  1VRB A;  3ZC0 A;  1D0X A;  2VVS A;  3RYI E;  3CX8 B;  3ZCI A;  2B1E A;  4ANJ A;  4YJ2 E;  2ES0 A;  2KT9 A;  3P4R A;  2ACZ A;  1OXZ A;  3O1H A;  4AI6 A;  2IML A;  4DR1 T;  2I6H A;  1JNZ A;  2H7O A;  2J47 A;  2V7K A;  2X51 A;  2RA1 A;  1D0Z A;  5CGM A;  3ZMS B;  2VVN A;  4NUV A;  3EDU A;  4PJM A;  2Q9Q B;  5F3J A;  2BG9 A;  5L3G B;  4H63 H;  4YSX A;  3HA4 A;  2XQ7 A;  3P4W A;  2XAJ B;  2NOX A;  2KND A;  4OK0 A;  1KEY A;  3U3I A;  2VK9 A;  3O1I A;  1KK7 A;  3TLT A;  3FB2 A;  1D1A A;  2BG9 B;  2D5U A;  4JUY A;  5JRC A;  3A8Y C;  3IF8 B;  3RKO A;  1GQE A;  3LG7 A;  3UQ4 A;  1OED A;  4EYU A;  2XQ8 A;  1E1H B;  2X9Y A;  3G06 A;  3GN5 B;  2XQ6 A;  4IE7 A;  5JVD E;  5HWY A;  4UV8 B;  1HR0 T;  2X0L B;  5LB7 B;  2WB5 A;  5LGU B;  2F4V T;  2VAS A;  2LSJ A;  3AE4 A;  5CJ5 A;  3KV4 A;  5A1L A;  4YJ3 E;  5LHG B;  3NBX X;  2J62 A;  1OWA A;  1ZOY A;  3PDY A;  3RI5 A;  4A98 A;  4DR4 T;  2LOS A;  2L9Q A;  3N5L A;  5JTG A;  2W66 A;  2BKN A;  1MIY A;  2XY8 B;  3EAM A;  4AQF C;  4EB6 E;  4IE5 A;  4JBW F;  5HXR A;  2NW9 A;  4TWF A;  1HNX T;  3FHN A;  1HX1 B;  1O3X A;  3ZT5 A;  5HWX A;  4XAX B;  3K3N A;  2ACX A;  3ABV A;  1U5P A;  3C64 A;  2JQQ A;  2MBG A;  3LK4 2;  1UX5 A;  3UFE A;  2WZH A;  2FJD A;  5CA1 E;  4DUY T;  2BG9 C;  1D1C A;  2CXD A;  2E8I A;  2HN2 A;  2WP9 A;  4DBQ A;  2XQA A;  3CQG B;  4HFV A;  3KV9 A;  1ZV4 X;  3QUJ A;  2XAG B;  3LFM A;  4H9N C;  3PUY F;  5JR9 A;  3J9X 1;  3EDV A;  4ZXL A;  3PU8 A;  2NTX A;  3PUA A;  4O8S A;  1LRZ A;  4JLE A;  3ETV A;  5FMN A;  4LF8 T;  4C91 A;  5C8Y E;  2HN1 A;  4EED A;  4O4J E;  3GN5 A;  3CVR A;  5LG4 A;  2HPJ A;  5JR9 B;  3OTO T;  5EZY E;  3PTR B;  2OV9 A;  5HXS A;  3EVY A;  3QB5 K;  4AXP A;  3JAD A;  4AIS A;  2UUC T;  1XDP A;  5LBQ B;  1ZHC A;  3VR8 A;  5FY0 A;  1G8X A;  2LJL A;  3O1J A;  4IE6 A;  4K0K T;  1MMA A;  1HG2 A;  3AE8 A;  2JMK A;  4QXC B;  1E2A A;  2QVA A;  1UUR A;  3RQW A;  4ADZ A;  2W00 A;  1VOM A;  5LG3 A;  2K9A A;  4HFI A;  3R84 B;  2CE7 A;  2HH7 A;  4I55 E;  4TV8 E;  4KMC A;  4ILC A;  1YW0 A;  3UU5 A;  2YEV C;  3M65 A;  2QRX A;  4I0U A;  3QB5 A;  5AQO B;  4O4I E;  2CLY B;  1L0V A;  2Y8D A;  3PJA J;  3VU7 H;  2XQ9 A;  1T8B A;  4K0U A;  5AQI B;  4Q25 A;  3RPU A;  2X9X A;  1WR0 A;  3AED A;  3PUR A;  3ZYK A;  1I94 T;  4DV0 T;  5LHH B;  3QK6 A;  1YD8 G;  3OJA A;  3UUM A;  5FYM A;  2EHO D;  3NRY A;  2VKH A;  3L8R A;  3MAC A;  5JR9 C;  5KX5 E;  2IUB A;  3LJC A;  3TLW A;  5L4E A;  2YU2 A;  4DND A;  5CFB A;  2VUR A;  2UUB T;  3K8P C;  2IDO B;  4XBF B;  3E08 A;  3EAB A;  4H9O C;  5AFU L;  3J7Y q;  3TLU A;  2UU9 T;  3T8O A;  4MBQ A;  2XM2 A;  4OYJ A;  1WYB A;  3QOF A;  3Q5W A;  5LCY A;  4QXB B;  3Q5X A;  3KBT A;  3AE9 A;  4IRE A;  5L47 A;  4DR2 T;  3AXJ A;  2BZB A;  2Q9Q D;  3PUQ A;  2L3L A;  4I50 E;  4DV4 T;  3Q5E A;  1D1B A;  2LHR A;  2OA5 A;  3QNU A;  2FJA A;  1MIV A;  3ANW B;  4DV3 T;  1T7S A;  2VL0 A;  2RPA A;  3ZN0 B;  2E9X B;  4QKN A;  1XNR T;  5AQT B;  4V1A v;  1IAP A;  3RH3 A;  3AE2 A;  4L9I A;  5M4Y A;  3V5U A;  3CX7 B;  5ADX L;  4JI3 T;  3MXZ A;  1NAF A;  3I9W A;  4ZI2 C;  2XTL A;  1NEK A;  3ETU A;  2H88 A;  4F8H A;  4HEA A;  3FZF B;  4EIW A;  3AVS A;  2V6Y A;  2PBI A;  1IBL T;  3WAK A;  2H89 A;  2CA5 A;  2IC9 A;  4X1K E;  1S94 A;  4AKL A;  4JEU B;  4P0A A;  4LF7 T;  5AQR B;  1SHZ C;  4FJO A;  2QYW A;  3C50 A;  2LKH A;  4X1Y E;  2Y48 B;  5FL0 A;  4EZ4 A;  5JQG E;  3RIA A;  4DR6 T;  2X0Y A;  2CPT A;  5HEH A;  4H9Q C;  1WLX A;  4CI2 B;  2LM9 A;  3FZK B;  2DWK A;  4ASK A;  4JI5 T;  1BR2 A;  4DV5 T;  5FXW A;  1KF6 A;  5F5W A;  2AE9 A;  1AJ3 A;  4ERR A;  4KHZ F;  4P09 A;  2W2U A;  4EGW A;  3O4X E;  1YQ4 A;  1YKH B;  4O2A E;  1ZP0 A;  3AB3 B;  4IDO A;  4AQY T;  2E9X C;  4U7Y A;  1FMV A;  1M62 A;  2M6B A;  3B5M A;  4H9P C;  5JDH A;  2DI4 A;  4EXT A;  3P4Q A;  5L3B B;  3BQL A;  3T1Y T;  4JI7 T;  2BG9 E;  4UV9 B;  3KIN B;  4EOZ B;  1FJG T;  2BS2 A;  1X9B A;  2E9X A;  5IYZ E;  2YU1 A;  4U72 A;  4AKI A;  4AKH A;  3C51 A;  3CKD A;  3JAF A;  5HXH A;  4U74 A;  5L3F B;  2BBJ A;  3QC9 A;  5BMV E;  2DWG A;  2WMN A;  5AQQ B;  5ABF A;  3EHZ A;  4LML A;  4CXY A;  2CHO A;  2WBL A;  3UU6 A;  4G2A A;  2FBW A;  1Z8U A;  3P4S A;  5HEJ A;  4X1I E;  3I0O A;  1HS7 A;  2CWY A;  3AEA A;  5HCM A;  4ZZC A;  3FZM B;  2CXL A;  4YHJ A;  2A72 A;  4X64 T;  2NW8 A;  4F6R C;  3EI0 A;  2LHN A;  4DBR A;  2LSG A;  2N2N A;  4UVC B;  4ZI3 C;  4B6X A;  2E5L T;  2VKD A;  2A3D A;  2IC6 A;  2XQY A;  1CHU A;  2DL1 A;  4M1P A;  3ZN1 B;  2PG8 A;  2WDQ A;  3RYH E;  5HYA A;  3UTK A;  1QUU A;  2FJB A;  4KUM B;  4UXN B;  4XZC A;  3R6N A;  4MLK A;  4PNI A;  5EK4 A;  3OYZ A;  5KDM C;  2UXX B;  4GKJ T;  2IAK A;  2WM9 A;  3PUV F;  1IJ6 A;  5LBM A;  3LK3 B;  4YHH T;  1WYC A;  5FVK A;  5C3J A;  4EZH A;  1HNW T;  2MOZ A;  3PUW F;  2KSR A;  1W0B A;  1YXR A;  2AXD S;  2Q9Q C;  3I9Y A;  5ETW A;  5KXJ A;  3PU3 A;  4DUZ T;  1LVK A;  4GYR A;  4MHC A;  5L4H A;  4JI1 T;  3LK2 B;  2LKG A;  3BK9 A;  1I6Z A;  1LKX A;  4DMW A;  1OED B;  2CXF A;  1UCU A;  2P9B A;  3N2K E;  3UFG A;  5ABH A;  4ZI3 D;  4HGA A;  1X79 A;  2KLQ A;  2VQE T;  2XQ4 A;  2XUE A;  3E22 E;  4X66 T;  3ZKR A;  2WU2 A;  4O2B E;  3Q9D A;  3NRX A;  4TWD A;  4KP3 C;  5AQN B;  2SPC A;  3AA6 B;  2IW5 B;  4KHP T;  2G0U A;  2JIW A;  4EAH A;  2H3R A;  2UXC T;  3N9O A;  3X1D A;  2RP4 A;  1Y64 B;  5LHI B;  1HG5 A;  3LSV A;  4WBN E;  3HKB E;  3RC8 A;  3AEF A;  2NP9 A;  1N32 T;  4L0R A;  3AE6 A;  4OYK A;  2JPF A;  2WS3 A;  4UF0 B;  3IHR A;  5TAO A;  4YT0 A;  1M7K A;  3HKC E;  3RRW A;  2KXP B;  3B13 A;  4PAG A;  1W0A A;  5FY1 A;  1CUN A;  2KIN B;  4QH1 A;  2CMR A;  2XM1 A;  3KBU A;  4YTP A;  4UEM A;  5L3D B;  1DU2 A;  4IHJ E;  4TX5 A;  2E9X D;  4ZS3 A;  4PK5 A;  1B7T A;  2JMH A;  3RIU C;  3ZJ2 A;  1WFD A;  2BS4 A;  4IT4 A;  3S4U A;  3LBX A;  3ZMU B;  2M67 A;  3I1A A;  3RC3 A;  3IEE A;  1US7 B;  4WYV A;  4ZS2 A;  2HHH T;  2X9H A;  3T1H T;  4QH5 A;  4H9S E;  3DJB A;  2E2A A;  3CK6 A;  3SFE A;  3P50 A;  4KBM B;  2WSS V;  5E0O A;  3ZYL A;  2V26 A;  4GOU A;  3NVO A;  5AQH B;  4CI3 B;  3OPC A;  3Q2M A;  1MND A;  2WCA A;  1BR0 A;  2BKP A;  2NTY A;  2V6Y B;  4ILU A;  5BR8 T;  4LF6 T;  2V6X A;  3HR0 A;  2WWU A;  2X66 A;  3AE5 A;  2KWH A;  3MJX A;  4LMK A;  2CBI A;  2DNX A;  5AQJ B;  2EHO C;  2I0M A;  2LOP A;  4I4T E;  3UUL A;  2JQ9 A;  2LLY A;  4HN9 A;  5AQP B;  5LOV E;  4ZI2 D;  2VKO A;  4UEL A;  5L3C B;  3RLF F;  4HFC A;  3RYF E;  3ZJ1 A;  2YOE A;  3HKD E;  2ZM2 A;  2YDR A;  4U3C A;  4UVA B;  1MIW A;  3UU4 A;  1UK5 A;  2V5D A;  2XQ5 A;  4IGU A;  2DLR A;  1SA0 E;  2JJ9 A;  3PJA A;  3U78 A;  3VKH A;  3NWI A;  4B3S T;  1KNR A;  2WY2 A;  4X65 T;  3F2E A;  4B3R T;  5KMG P;  1VCS A;  3FXD B;  3N2G E;  5EK3 A;  3UU3 A;  5J2T E;  4HE8 A;  2C5I T;  2XAH B;  4QX7 B;  2GK9 A;  3CWZ B;  5CB4 E;  4X5T A;  3ZPO A;  4TUY E;  4AIU A;  4U31 A;  1LVF A;  1U4Q A;  2YK0 A;  4QX8 B;  4ZOL E;  2WDR A;  2Z6E A;  2OLT A;  2JQH A;  3N9Q A;  4A56 A;  1HCI A;  4IE4 A;  2N9D A;  5DAB A;  5HEU A;  2KZ7 B;  3AAA B;  4FI5 A;  4CZZ B;  2BVL A;  2X9W A;  4PFO A;  2WWV A;  2WDV A;  3K1S A;  4G63 A;  4CXW A;  5LA6 E;  5C2T A;  4TN7 B; 
#chains in the Genus database with same CATH homology
 2QGS A;  3N9N A;  4WW0 A;  4DMV A;  5H6R B;  5FXZ A;  1BR1 A;  2D0T A;  5FXX A;  3ANW A;  4WNK A;  2JRK A;  1YKE B;  3ZC1 A;  2DCF A;  2V7I A;  4PK4 A;  4YLH A;  3ONX A;  5JRE A;  3MZK B;  5JDF A;  4L5G A;  5HXE A;  3KVA A;  3MA9 A;  3SS1 A;  5LJM A;  4C90 A;  3KFW X;  3NZP A;  4P0B A;  4IDZ A;  3SOL A;  2LSK A;  3W15 B;  3N9L A;  2CM0 A;  2ODU A;  3NZQ A;  3UUX B;  1HFA A;  2Y6X A;  3P8C D;  4O4L E;  5HAX A;  5DQV A;  3OYX A;  3C98 B;  2VWA A;  4JEH B;  4BA9 A;  2KWI B;  2Q9Q A;  2N1G A;  2ZM0 A;  3N2O A;  3AA1 B;  3H3A A;  5HXC A;  5L2L A;  2XAQ B;  4QXH B;  1D0Y A;  1IJ5 A;  4NUU A;  2CEA A;  5LGT B;  3ZYM A;  3KDS E;  3PE0 A;  5FP3 A;  2KMF A;  1NWM X;  3SRZ A;  5L3E B;  2EHO A;  2C5K T;  3FBL A;  2WAU A;  2XAF B;  2D0U A;  3IBP A;  5F8P A;  2W63 A;  4N78 D;  1V9D A;  1MMG A;  2CCQ A;  4H9R C;  1ZKE A;  4WBO A;  3CQC B;  1EZ3 A;  2A2F X;  4TV9 E;  3ZMZ B;  2X68 A;  4QHO A;  2BVM A;  1HX8 A;  5IHY A;  4GIW A;  4Z8X A;  5J2U E;  4J2C A;  1IZN B;  4TZ4 C;  3HKE E;  3VKG A;  2VB6 A;  3C4X A;  4X20 E;  3L3P A;  5LYJ E;  2CLY C;  2D2S A;  1FIO A;  1HF8 A;  2J1D G;  1MMN A;  3H37 A;  2VKJ A;  4YFS A;  2NWB A;  3DTO A;  1QSD A;  4MFR A;  2V1D B;  4UVB B;  2ODV A;  3C4Z A;  3L09 A;  4HTE A;  3VHL A;  1FMW A;  2LE8 A;  2EHO B;  4IE0 A;  4PJJ A;  5FNV E;  3N9P A;  4AQG A;  3KV6 A;  3WI3 A;  1FEW A;  4CI1 B;  1ZEE A;  2V7M A;  1BR4 A;  4MAL A;  1WR6 A;  3CML A;  1H7C A;  5DJQ C;  3ESL A;  2LSY A;  3HI2 A;  4PW8 A;  4BAY B;  3OBV E;  5GON E;  2HPL A;  4BJM A;  3GWH A;  3N9M A;  5LGN B;  4OFZ A;  4AQF A;  2XHE B;  5LXT E;  1WRD A;  1UX4 A;  4AKG A;  5LP6 E;  2VL8 A;  2LSI A;  3KV5 A;  3MK7 C;  3V5S A;  1S35 A;  2I59 A;  3OKQ A;  3P7I A;  3UT5 E;  3C4W A;  4H63 V;  2C5J A;  3I0Q A;  4PJL A;  3RYC E;  2K5B B;  3RRC A;  4UF0 A;  4HKA A;  3AAE B;  3RX6 A;  2V7L A;  4DO0 A;  4CQI A;  4PK6 A;  3A5X A;  5FY7 A;  3F31 A;  2ZMA A;  4E7Z A;  5JDQ A;  3PUG A;  3K3Q C;  5JDN A;  3AAI A;  2LT3 A;  3CX6 B;  2L8K A;  4GYS A;  4IST A;  2MYS A;  2C0S A;  1T98 A;  5H6Q B;  3BQK A;  3MKD A;  3K3O A;  3EUH A;  3FXE B;  2H7V C;  1MMD A;  3AA7 B;  1KNZ A;  5EK2 A;  5JDL A;  2X67 A;  1HTJ F;  2ZM8 A;  2PJQ A;  2LEH A;  2DHR A;  5LNK A;  1MNE A;  3ZEF B;  3GA8 A;  4IIJ E;  3ZLI A;  2K48 A;  3BQI A;  3CPZ A;  3F57 A;  2W61 A;  2YIN A;  3B57 A;  1Z0P A;  4ISS A;  4PFP A;  3ZMT B;  3UUN A;  4PJN A;  2MTQ A;  2PFV A;  4O4H E;  5DQW A;  3FBZ A;  3LBX B;  3TKL B;  2CWO A;  5JDG A;  5JH7 E;  2W62 A;  4I43 B;  4UIG A;  2UXN B;  3DP7 A;  4ZHQ E;  3E0Z A;  3JC6 C;  2XAS B;  3CQX C;  3GMI A;  2V7J A;  4OHF A;  3ZYK A;  3RC8 A;  2BDE A;  3D0T A;  3PUS A;  2NW7 A;  3ZMV B;  4GK5 E;  3AA0 B;  4ZI7 E;  5CA0 E;  3AVR A;  3JC6 D;  5J1G A;  4GK0 E;  4BJN A;  1G73 A;  5JRC B;  3KVB A;  2ZLY A;  2WMO A;  4DVD A;  3SWH A;  3ZCJ A;  5JDM A;  2W0G A;  3HL6 A;  4EYY R;  4AKR B;  2K24 A;  5FXV A;  4E7S A;  3O9X A;  4QWN B;  2QA7 A;  1VRB A;  3ZC0 A;  1D0X A;  3RYI E;  3CX8 B;  3ZCI A;  2B1E A;  4ANJ A;  4YJ2 E;  2ES0 A;  2KT9 A;  1OXZ A;  3O1H A;  4AI6 A;  2H7O A;  2V7K A;  2X51 A;  2RA1 A;  1D0Z A;  3ZMS B;  4NUV A;  3EDU A;  4PJM A;  2Q9Q B;  5F3J A;  5L3G B;  4H63 H;  3HA4 A;  2XAJ B;  2KND A;  2NOX A;  4OK0 A;  3U3I A;  2VK9 A;  3O1I A;  1KK7 A;  3FB2 A;  1D1A A;  4JUY A;  2D5U A;  5JRC A;  3IF8 B;  3RKO A;  3LG7 A;  4EYU A;  1E1H B;  2X9Y A;  3GN5 B;  4IE7 A;  5JVD E;  5HWY A;  4UV8 B;  2X0L B;  5LGU B;  2VAS A;  2LSJ A;  3KV4 A;  5A1L A;  4YJ3 E;  5LHG B;  3NBX X;  1OWA A;  3PDY A;  2LOS A;  2L9Q A;  3N5L A;  4AQF C;  1MIY A;  4EB6 E;  4IE5 A;  2NW9 A;  5HXR A;  3FHN A;  1O3X A;  5HWX A;  4XAX B;  3K3N A;  2ACX A;  1U5P A;  3C64 A;  2JQQ A;  2MBG A;  3LK4 2;  1UX5 A;  3UFE A;  5CA1 E;  2E8I A;  1D1C A;  2CXD A;  4DBQ A;  3CQG B;  4HFV A;  3KV9 A;  1ZV4 X;  3QUJ A;  2XAG B;  3LFM A;  4H9N C;  5L3F B;  5JR9 A;  3J9X 1;  3EDV A;  3PU8 A;  2NTX A;  3PUA A;  4O8S A;  1LRZ A;  4JLE A;  3ETV A;  5FMN A;  4C91 A;  5C8Y E;  4O4J E;  3GN5 A;  3CVR A;  5LG4 A;  2HPJ A;  5JR9 B;  5EZY E;  3PTR B;  5HXS A;  3EVY A;  4AXP A;  5LBQ B;  1ZHC A;  5FY0 A;  1G8X A;  2LJL A;  3O1J A;  4IE6 A;  1MMA A;  1HG2 A;  2JMK A;  4QXC B;  4ADZ A;  2W00 A;  1VOM A;  2K9A A;  3R84 B;  2CE7 A;  2HH7 A;  4I55 E;  4TV8 E;  4KMC A;  1YW0 A;  2YEV C;  3M65 A;  4O4I E;  2CLY B;  2Y8D A;  4K0U A;  3RPU A;  2X9X A;  3PUR A;  5LHH B;  3QK6 A;  1YD8 G;  3OJA A;  3UUM A;  5FYM A;  2EHO D;  3NRY A;  2VKH A;  5JR9 C;  3MAC A;  5KX5 E;  3LJC A;  2YU2 A;  4DND A;  3K8P C;  4XBF B;  3E08 A;  4H9O C;  5AFU L;  3J7Y q;  3T8O A;  4MBQ A;  4OYJ A;  5LCY A;  1WYB A;  4CXX A;  3Q5W A;  5BMV E;  4QXB B;  3Q5X A;  3KBT A;  5LJN A;  2BZB A;  2Q9Q D;  3PUQ A;  2L3L A;  4I50 E;  1D1B A;  2LHR A;  2OA5 A;  1MIV A;  3ANW B;  3ZN0 B;  2E9X B;  4QKN A;  4V1A v;  1IAP A;  3RH3 A;  5M4Y A;  4L9I A;  3V5U A;  3CX7 B;  5ADX L;  3MXZ A;  1NAF A;  3I9W A;  4ZI2 C;  2XTL A;  3ETU A;  4HEA A;  4EIW A;  3AVS A;  2PBI A;  3WAK A;  2CA5 A;  2IC9 A;  4X1K E;  1S94 A;  4AKL A;  4JEU B;  4P0A A;  1SHZ C;  4FJO A;  3C50 A;  4EZ4 A;  5JQG E;  4X1Y E;  2Y48 B;  4H9Q C;  1WLX A;  4CI2 B;  2LM9 A;  2DWK A;  4ASK A;  1BR2 A;  5FXW A;  1AJ3 A;  4ERR A;  4P09 A;  3O4X E;  4O2A E;  1YKH B;  3AB3 B;  2E9X C;  1FMV A;  4H9P C;  5JDH A;  5L3B B;  2DI4 A;  3BQL A;  4UV9 B;  3KIN B;  4EOZ B;  2E9X A;  5IYZ E;  2YU1 A;  4U72 A;  4AKI A;  4AKH A;  3C51 A;  3CKD A;  5HXH A;  4U74 A;  3QC9 A;  2DWG A;  2WMN A;  4CXY A;  2WBL A;  4G2A A;  4X1I E;  3I0O A;  2CWY A;  2CXL A;  4YHJ A;  2A72 A;  2NW8 A;  4F6R C;  4DBR A;  2LHN A;  2LSG A;  2N2N A;  4UVC B;  4ZI3 C;  4B6X A;  2VKD A;  2A3D A;  2IC6 A;  2XQY A;  4M1P A;  3ZN1 B;  2PG8 A;  3RYH E;  5HYA A;  3UTK A;  1QUU A;  4UXN B;  4KUM B;  4XZC A;  3R6N A;  4EXT A;  4MLK A;  4PNI A;  5EK4 A;  3OYZ A;  5KDM C;  2UXX B;  2IAK A;  2WM9 A;  5LBM A;  1IJ6 A;  3LK3 B;  1WYC A;  4EZH A;  2MOZ A;  2Q9Q C;  3I9Y A;  5ETW A;  3PU3 A;  1LVK A;  4GYR A;  4MHC A;  3LK2 B;  3BK9 A;  1LKX A;  4DMW A;  3N2K E;  2CXF A;  1UCU A;  2P9B A;  4ZI3 D;  4HGA A;  1X79 A;  2KLQ A;  2XUE A;  3E22 E;  4O2B E;  3Q9D A;  3NRX A;  4KP3 C;  2SPC A;  3AA6 B;  2IW5 B;  2G0U A;  4EAH A;  2H3R A;  3N9O A;  2RP4 A;  1Y64 B;  5LHI B;  1HG5 A;  4WBN E;  3HKB E;  2NP9 A;  4L0R A;  4OYK A;  2JPF A;  4UF0 B;  3IHR A;  5TAO A;  3HKC E;  3RRW A;  2KXP B;  3B13 A;  4PAG A;  5FY1 A;  1CUN A;  2KIN B;  2CMR A;  3KBU A;  1HS7 A;  4UEM A;  5L3D B;  4IHJ E;  4TX5 A;  2E9X D;  4ZS3 A;  4PK5 A;  1B7T A;  2JMH A;  3ZJ2 A;  3S4U A;  3LBX A;  3ZMU B;  2M67 A;  3I1A A;  3RC3 A;  3IEE A;  1US7 B;  4ZS2 A;  2X9H A;  4H9S E;  3DJB A;  4KBM B;  2WSS V;  5E0O A;  3ZYL A;  2V26 A;  4GOU A;  4CI3 B;  3Q2M A;  1BR0 A;  1MND A;  2NTY A;  4ILU A;  3HR0 A;  2WWU A;  2X66 A;  2KWH A;  3MJX A;  2DNX A;  2EHO C;  2LOP A;  4I4T E;  3UUL A;  3VU7 H;  4HN9 A;  4ZI2 D;  5L3C B;  5LOV E;  3WAJ A;  2VKO A;  4UEL A;  3ZJ1 A;  3RYF E;  3HKD E;  2ZM2 A;  4UVA B;  1MIW A;  4IGU A;  2DLR A;  1SA0 E;  2JJ9 A;  3U78 A;  3VKH A;  3F2E A;  5KMG P;  3FXD B;  3N2G E;  5EK3 A;  5J2T E;  4HE8 A;  2C5I T;  2XAH B;  4QX7 B;  2GK9 A;  3CWZ B;  5CB4 E;  3ZPO A;  4TUY E;  1LVF A;  1U4Q A;  2YK0 A;  4QX8 B;  4ZOL E;  2Z6E A;  3N9Q A;  4A56 A;  1HCI A;  4IE4 A;  2N9D A;  5DAB A;  2KZ7 B;  3AAA B;  4FI5 A;  4CZZ B;  2BVL A;  2X9W A;  4PFO A;  4G63 A;  4CXW A;  5LA6 E;  4TN7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...