1BREA

Immunoglobulin light chain protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCQASQDISDYLIWYQQKLGKAPNLLIYDASTLETGVPSRFSGSGSGTEYTFTISSLQPEDIATYYCQQYDDLPYTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BENCE-JONES KAPPA I PROTEIN BRE
publication title Tertiary structure of an amyloid immunoglobulin light chain protein: a proposed model for amyloid fibril formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 20
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1995-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1breA00
2PR4L 5D2NA 1RMFH 4QRSB 4WFEE 1A6ZA 4CADB 4EI6A 1HCFX 5JW3H 3K0WA 1U6AL 3RWCA 1FRGL 3JTSB 1QLFA 1W72A 4HWNA 5INCB 3UBXB 2HWZL 2VC2H 3OWEA 4XP9H 5F21B 1EEZA 2RCSL 1NC4B 4LQFH 1TETH 5C0BA 4UI2A 2VZTA 3FAWA 5CILH 4TTDD 2VL5B 2NNAB 5C0JB 5JXEA 3L3HA 4ZUWB 4C54A 3RUGF 1BECA 2FATH 4OTXH 2D7PA 1WAAF 4JN2B 2FB4H 5B8CA 4JHAL 3W0WB 32C2A 5E1AB 4C55A 3VXRB 5IHZB 1YNLH 2FX7L 3OG4B 4NT6B 1NSNL 3QUZD 4MGXA 5D96C 4PJGF 4H88L 3EOAA 4XCFL 3OV6A 4OD3L 4J1UA 1VFBA 1ZHNB 1N3NA 4I5BA 5SX5H 2IBBA 3S96B 2VXVL 4GRWH 3PIQB 3ARYA 2GW5A 2F54E 4TQEL 4Q6IB 3DYOA 4GXUN 1C12A 2VABA 3WYRA 1Y18A 1QP1A 5T5FL 5F6IB 1PKQE 2NXZB 2MHAA 5ELIA 1IEAA 3PNWA 3QSKB 4AT6A 3O8XC 3MJ7A 4AENA 1HSAB 3CU1A 3LS4H 3HLAA 3PQYA 4JFYA 3CPLB 1AD9B 5E8PA 3U79A 4NNPL 1J1XH 3B9KA 4FQIL 5D7JD 4ODUA 3EO0B 4YDIH 4NYLB 1PG7X 5IR1A 4URTB 1OQOA 1T2JA 1MJ7L 4LEXH 3ZDZE 2P5EA 4KGLA 4PJFB 2PYEB 3EYSH 5EU6A 3C5ZA 4NC1E 4PRAB 2F74A 3GHBH 1NCWL 4UBDC 4M3JA 5BQ7A 5CLTA 2ZUSA 3LHPH 1FZMB 3U36B 1LO4L 5C8JB 1JGDB 2HVJB 3OQ3B 4E41A 5MENA 3QFJB 4QRPD 3GI9L 1IGTA 1NKOA 2CK0L 3VFRA 1DQQB 4PRPD 5KTEL 2VJXA 3HMWL 1UWEL 4LSRH 2NXZD 1FGVL 1V7ML 4FFVD 3O3DB 1XCQA 3RTQA 4TVPE 4P2OC 1I9EA 1CL7H 2AJUH 4JFQA 2HRPL 2IFGA 4HBQA 2WNGA 3V5DB 4C56D 2P8LA 2B0SL 3L3GA 3SGJC 2X70B 3V4VH 5IHLB 4NWTH 3MV9D 4X6DB 5GXBB 1RK0B 1NLBL 2Y5TB 1R24A 2DWEB 4CJ0A 3BXNB 3KR3H 4LVNC 3MRCA 1KN4L 1GGUA 4MA8L 1CGSL 4IRJC 3AXLA 1C5CH 3I9GH 4FP8L 5HGDA 4YK4B 3ZTJG 5HDQH 4K94C 5EIIB 4N8VB 3QHFL 2VXSL 2N7AA 1BVLA 1DL7H 4OIIL 4F7EA 2CMRH 3QQ4B 1BLNB 3HC0B 4FFZL 1XR8B 1T89A 1OSZB 2IAMA 2PO6C 2R15A 3UTSB 1YEDB 3LKNA 1PJ9A 4TSBH 1INEH 1J8HA 3FOLA 4NQDD 1RURH 4ODSH 4PJBE 2NQCA 4HWZA 1Q94A 3OB0K 5LAXA 4S1DD 2E7HA 3VGAC 1G0XA 1IAII 5D6CB 4OLWH 5IBTH 2F19H 4FQCH 4YEFA 2HT4C 4RA3A 5FHAL 1DLHA 3QDMB 3V79C 4I0PA 2AV7A 4LSDA 5B3JF 5CZXD 2FNBA 3D9AL 3MNWA 3QNXA 2B4CL 2FZ3A 1T20B 2A77L 1Q9OB 4OZFG 4F2MA 2CK2A 4XHQA 5D96B 5ABDE 5C08A 5KSVA 3ILQD 3T2OA 4Z7QF 4UQ3A 4OCSH 2O61B 1ZTXH 5F1SA 5FOJA 3KYNB 3UTSD 1DVFA 3LEVL 3RQ3A 3FQRB 4MZ3A 4DVBA 1EIBA 5C7XL 3TLRA 1B4RA 3CK0L 5IIEB 4NN5B 4U6TA 1J5OH 4OZHE 3BSZL 4Y88A 3T0DA 4JDTL 3P4NA 3O8XB 3GIVB 5DJXA 4NSKB 2X42A 1V3MA 4EN3A 3RFZC 1RIUH 4JFDA 3D69A 2DBJA 4M1CC 3EOBA 2B8OT 3JV5A 2O5YH 1INDL 3O2DA 3FONA 2XXMB 1FFNA 4HF5L 4AEIH 3SBWC 3S6CA 5IQ9B 2VLRB 2IBZY 2FWOB 3FB7B 1JCKA 3DBXB 4ZFOB 3AVEA 3VXOB 2J8UB 3J7HA 2BOCB 1HWHB 1CFSA 3VXUD 4F37K 5BZDB 1B3JA 2W0LA 2OBGA 1TVBB 2VZUA 3GJEA 2Y5EA 1NJ9A 3IFNL 4FQXC 4HK0A 4H5SB 4Y4FC 3I6KB 1R5WB 4GAGH 3O8XD 4P2OB 4GW4A 3QUXB 3OGOE 3BP7A 4J2XA 1F3RB 3VXRE 5CZKA 5DFTA 5KG9B 5IMLA 1J11A 4KQ4H 1GZQB 4MNGB 3HZYB 4V1DB 1XR9B 1CQKA 5IBUG 3ZTJH 2BVTA 3MCG1 4UBDD 5LGHH 3EOYG 4X6CB 1LO2L 1X5FA 3SKJH 1RIVH 2LABA 5FYLH 2X4NB 5MHSD 3MRDB 4IRJB 1HI6A 1YY8A 2V2WA 1EZVX 3QEGH 1MHEA 1BJ1H 4UMGA 4PRPE 4TUOA 4OCYL 1H3PH 5EH1A 4C4KO 1FO0L 1X5YA 2MQ0A 4U7SA 1CFNA 1X4YA 3ULVC 2FO1A 4U6YB 2YK1L 4WWKB 1IQWL 4X9FA 3X3GH 5IJKA 4P2OD 2AXFB 4EEEA 4YE4H 3WDHA 2WM0A 4HKZB 3B2UC 4KK8C 4C56E 4WDIB 2DQJL 4HUXA 4MA7L 1N8ZB 4E9LA 5HDOA 3VXNB 3ZYJA 3MV9E 5F7NC 4PJFE 1NCAL 2G75B 2F54A 4CVZB 2QTEA 4V1DD 1BVKB 3OKKA 1VFMA 5CIPB 3LV3B 3KNBA 1PKQA 3MLVH 2ORBL 4OZFH 1YN7B 5BRZD 3QFJE 1A1MB 3G5ZB 4IRJD 4QXWA 1DN0A 1YJDH 4Y5YC 3TIEB 1Z9MA 1ZT4B 1LEIA 4JM2C 1UCBH 4EI5A 2L4OA 5F9OL 3WSQH 5I1LB 2RFXA 1F6FB 2DL2A 3S35L 4Z7NF 5K9JH 2IJ0C 2VAJA 2PO6D 3INUH 4L3CB 5DLMH 2WBJC 5LJYH 3BKJL 1T83A 1ZVSA 4NQDE 5JIHA 3REWA 5CEYA 1FIGL 4LDEB 3HB3C 3PWNA 4N0UB 5IHUL 1R3KA 5JR1L 1I8LA 3TBWB 5F3BA 4GRLB 5HYJD 3B4NA 1UCTA 2Q87A 3O2VL 2HT4D 4WEMB 3B5GA 3T04D 1NGWA 4EQ3A 1Z9OA 5J1SC 2D3VA 1I8MA 4MDIB 3HE6C 3QPXL 3QULA 2Q8AL 5HYIA 4JPIB 3RGVA 4JKPH 4AEHL 2EDJA 1KN2H 2EEAA 2YD4A 3BMVA 4O51A 3KDMA 1WWAX 2PYFA 3SGKA 2YRZA 4JPWH 1A02N 5I1IH 5TQ2H 1I3RB 3TH4T 1ZT1B 5DVNA 3TVMC 3UTSE 3BPLC 4Z95H 4HWBL 2ZUXA 3G04A 4MVBC 2BFVH 2F5BH 4QXGL 3MYZA 1WEJL 2PXYA 3T77B 2OR7A 4RMSA 3FZUC 1FG2B 3NPSB 1KT2A 1G1CA 4GRLD 4FQXB 4Y4FB 5FUZH 5FAAA 3QIBA 4BQ9A 1MPAH 2GJ6D 3MMEB 3U48A 4RAVA 5DD1L 1QSFD 1HDMB 4K23L 4YHLH 1DBBL 4K9EL 3QXTA 3VWJA 4H0GA 1OGAB 4G7VL 4JANA 5FF6A 4HMEA 5I19H 5I1DB 2YD2A 3A6CH 4M1CD 4B7IA 1KBGH 1BQSA 2ZOKB 3DGCR 3ILPB 3P77A 4CN1A 5JMOC 1BD2B 5K9OB 3L9RB 2P8MA 2A38A 3B8SA 1E6JL 3BW9A 4X6FA 5C0FA 1XGUA 2WAHA 1M6OB 5TPWL 1E4XH 5JDSA 2YA1A 5DI8A 1UXSB 1MLBA 3HR5A 2DLTA 4RQQB 4IMKA 4RGNC 4UIKH 1MFBH 4K07A 4YHNA 3SDXB 12E8L 4ZS6C 4U1IB 4MA1C 4UU9B 2J12B 5KSUA 3GMNA 1UM6L 3NZ8B 2R2BB 3OR7A 4FQXD 4NRYB 4Y4FD 5C6TH 3S37H 4LSSH 1FQ9C 2A73B 1IAOB 5L2KB 3RNQA 4LIQE 2PTUA 5LWYH 3MRRB 4C58B 1K5NB 4I13B 4UNVA 4MA3B 3UC0H 3WFHB 5DMIH 4F33B 1WT5A 3MOBL 5JORA 1VGEH 4GKOA 5IMMA 2W38A 1AJ7H 4M1DH 5MHSE 4KFZC 4K3GA 5JHDB 4Y5YB 1NCNA 3DV6A 3QXWA 4NUJA 4JM2B 1KIUA 1URLA 3QUZA 4BZ2H 1OSPH 4NM8L 2GSGB 2AXGA 4NZTH 4F7CB 5I71C 1BAFL 2CXGA 3ULVD 1ZXQA 5ILTH 5FECB 4PRBB 4OKDA 1R3JB 4WUUB 4O4YH 4CADA 4MNHA 1DQJA 1P7KB 4XMLH 2J88L 1AGCB 3B2UD 4KK8D 3ARGB 1MAKA 5SWZD 5INCA 3UBXA 3MCKB 4JY4A 3C9NB 2E27H 3L5XH 4V1DE 5CUSL 2WSKA 3G5YA 1NC4A 1UM5L 4HMDA 2VL5A 1WWBX 2NNAA 5C0JA 2B1HH 4JRXD 2NY2B 2D9CA 4ZUWA 2VE6A 5BRZE 4R3SB 4UB0H 4PGBB 4U33A 5DFVC 1E6OL 5D7JA 4R6UA 1FAKT 5E1AA 4JM2D 3VXRA 5IHZA 4AYFA 1FVCB 2CUIA 3D1MC 4JREC 4O2FB 3DSFH 2OL3B 4G80B 3TVMB 3ARZA 3BAEH 2BVOB 2WBJD 2BC4A 4R8WH 1F6AB 5DURB 3S96A 4OIAA 1P84J 4XX1G 3QEUB 3PIQA 3V6OE 1A7QL 1A7PH 3MA9H 5E2JA 3HB3D 4Q6IA 5GS0C 1PVHA 5HYJE 3FOMB 4OIBA 3X3FL 2DTMH 3O2WH 1OAZH 4OLXL 1OAQL 3GO1H 1MHPL 1TJHH 1LMKA 1HSAA 3RDTC 1NDMA 3CPLA 1AD9A 4OCMC 1MCKA 3S36L 3U1SH 2EEBA 1A7OH 3HE6D 5CBAB 4S1QL 2DQUL 4C56A 1WIOA 3EO0A 3HZVA 1G7IB 1AGEB 4FNLH 4PRNA 3K4AA 3O6ML 3MV9A 4PJFA 4K3EL 1ZA3B 4PRAA 3Q6FB 3TVMD 4RWYH 3TV3L 4WW2F 1CXIA 1FZMA 5DURD 5IWLC 4MVBD 5C8JA 4OCLC 3P11H 4CN4A 1IGMH 3SDAC 1I9RL 3QFJA 5HDLA 4N0UE 1JWMA 4NCDA 4XGZB 3GJFB 1X5IA 4U1HB 2VDLH 3FZUD 3WN5A 4MA1B 1MFAL 1MLCA 1WIPA 2EIBA 2V7NA 4TSCH 3MBXL 2WWKT 2AK4B 2GJ6E 3O3DA 4L29B 4Z8FL 1T3FB 3PG2A 1FL3B 2VN7A 1UZ6E 1KXTB 3EOTH 1QFWI 5F7UA 5I18L 5C70A 1CFTB 3LN5B 4NQDA 1MI5B 5DJ2A 3V5DA 3ZE2E 5I8CB 3MLTB 4OBRA 2X70A 1C5DB 5HDBE 3NN8B 1J10A 3O3UN 1A0QH 1RK0A 3BGFC 4GG8A 1VPOL 2Y5TA 4QY8B 4C83A 1X4ZA 3MREB 1HXYA 1JNHA 4Y4HC 3MO1B 4P9HC 3FT4B 5FM5O 3WLBB 1TENA 3OPZL 2VDQH 4MXQC 4JCMA 1T03L 1UWGL 5EIIA 5JOFB 4RGND 4N8VA 4JHZA 2JELL 3CVHB 4A6YH 3S88L 5D8JH 1X5HA 4GMSL 1MFCH 4ZS6D 3V5HA 1BLNA 1X6NA 1IM3A 3HC0A 2AK4D 1A7RH 1XR8A 1OSZA 1AGFB 2AAVA 3KLHC 3KPNA 3UTSA 3S34H 4JQVC 1MWAH 1YEDA 1GGCH 4PJAB 4P99A 1OGAE 2YD1A 1J05B 1EJ6A 1KTKE 4TNVK 2HH0H 4XVUC 3CDYA 3EO1B 4TRPH 3GSNA 3SKUD 2YA0A 3O6LH 5C0RL 2QR0B 2XV6B 5ICYB 5I1EH 1QLRA 3ULUC 2NX5D 2CH8A 4XP5L 1T20A 3LKSB 3VFMB 1FE8H 3C2SA 3F6LA 3ULVE 4KQ3L 4CJ1A 1CE1L 5IT2L 3OAYH 1BF8A 5KVFH 2IH1B 2DQDH 4HG4J 1RZIB 3BJLA 4ETYA 3VW3H 4U1MB 5L2KE 4XTRC 4YFLI 5SWZE 5DA0B 2XTLA 3FQRA 3O3AB 4R7NB 1RFDL 1N64L 1BPVA 1RD6A 5F7EH 5L88H 1SEBB 2C1OA 1CLZL 4JRXE 4S2SA 1TIUA 1JNLH 3G6JF 3O8XA 3GIVA 4HS3B 2E9WA 1DLFL 1B88A 1SQ2N 5JHDE 3RDTB 1NBVL 2XWTA 5DFVD 1YEGH 3RIAK 5DWUH 4LSQH 3IDJB 1RUPL 3VI4E 2NCMA 1OAXL 1KG0B 5J56B 2DI7A 1D5XB 5D7KD 3IDMB 2EDEA 4ZAKC 1ZHKB 1OB1A 2CUHA 3MBEB 5IQ9A 1NGQH 1QBLH 2EDXA 3FAXA 1U42A 1DQML 2EDOA 2EH7H 3SDAB 1HEZB 5T1LB 4Q9QH 2KDGA 2EIDA 3FRUB 1AFVH 4X7CC 3NIGF 4QHMB 5FGSA 1TJIH 5GS0D 5KJRL 1TVBA 4PPTA 2VXQH 3U4AA 1RHHB 4PD4K 3REVB 3U7YH 5GPRA 4H5SA 1MCDA 3I6KA 1QFOA 1DBML 3PHQB 1OM3L 1MCRA 2YD7A 1IT9H 2YHGA 4P2OA 2Q6WB 2W92A 4JM4H 1RK1B 3RDTD 3H3PH 2DJ4A 5HPMB 3RU8H 4MJIB 1TLKA 1LHZA 5KG9A 2H6PB 1GZQA 3SGJA 3CFDB 1L4IA 3HZYA 4V1DA 1XR9A 3DX7A 4FHBD 1TNMA 5H94B 3VWKC 3ZE1E 2FD6H 3BGFB 4WU7B 3BPNB 1ZHBA 3T2NL 4FQ2L 3VFOA 2X4NA 5BRZA 4FQHB 4NHCL 4IRJA 5EN2A 1ETZB 3SDAD 2FGWL 2R2EB 1FFPB 4QLRA 1G7HA 3MRKA 1YEKH 4PGCB 4WRLA 2QQKL 1FGNL 3MCLL 3UJIL 3VA2C 4LLQB 3W9EB 4KHXH 4MWFB 2PO6A 4U6YA 4YHKH 1S7SA 1MJUL 2AXFA 3M1BB 3H7BB 4PP1C 2WINB 1U93A 2G9HB 4ZXBC 4MJID 4KTYA 3B5TA 4TOYH 1E27B 1N8ZA 3OAUL 4CW1A 3V6OA 1NMBH 3O6KH 2G75A 3GMOB 3IJHA 3LN9A 1JE6A 3SGEH 3VMPA 4CVZA 4KZDH 3TH2T 1BVKA 5E2TL 1TZGL 1GYAA 3TT3H 5CIPA 1JV5A 1LO3H 5CHNB 5HYJA 2N1KA 2GUOB 3OB0H 1X5ZA 1YN7A 1E4WL 2EE6A 1Q0XH 4GUPA 1A1MA 1RQ5A 5GISL 1NAMB 1RJYB 3TIEA 4MXQD 4RBPH 4KUZL 3THMH 3MLWH 5EOCL 4J3TA 4OGXL 1FN4B 5I1LA 1HIML 5F72S 1F4XH 3CFKB 3UPRB 2AK4E 3NIDF 5E2VH 1F3DH 2HFTA 3LIZH 3WD5L 4U49A 3KLHD 1L6XA 1SYSB 1KCSL 1MI5E 2CLVB 4HKJA 3KPSD 2BY1A 1IGIH 5GGUB 1A4JA 4ZSOB 2N56A 4N0UA 4XVUD 4LLUB 4XPGL 2EDQA 4HWUA 3TBWA 4DVRL 3GMLA 4GRLA 1KGCD 2O5XL 2GJ6A 2I5YL 3SJVB 5AAMA 2NX5E 5FM8A 3ULUD 3TIDB 1NAKL 3E6FB 1ADQL 4EUPA 3PV6B 4HIJB 3IDIA 5DRNB 2QQLL 3H3BC 2Z8VC 1I3RA 3BGMB 5C1MB 1ZT1A 4WO4C 2IPTL 4ZAKB 2XA8H 3D48R 3SBWA 4M5YL 5I1AB 4XTRD 2GFBA 4PJAE 3DVIA 1GPOH 1LO0H 4M43L 4GQPH 3U4EB 3T77A 1A22B 5I1JH 1JHKH 2H1PH 1CLOL 1FG2A 1QBBA 1ZANH 5TE7H 3NCYP 4FQXA 4Y4FA 4LSVH 2BY2A 4XNUH 4QCIB 5TDNA 2OS7A 4Q9BA 1MFEL 4NCC1 2DQCH 5DT1H 5E1HB 5CJ8A 3RAJH 1S7QA 1KPUB 2OR8A 1OGAA 1DEEB 2KZ1B 4OCNC 5I1DA 5C0AD 5D7KE 3TT1H 3P0YH 3UTOA 3L9RA 1JN6A 1D9KB 3WFEL 4LGSB 4ZAKD 2R2CA 5GZNC 2PETA 1KB5H 1RPQA 1JIBA 1M6OA 5LBSH 5AYUL 1UXSA 3NCYS 2X40A 3GSWA 2IADA 4RQQA 4Q74A 1MCOL 5B38G 4JJHA 1JZ3A 1FNEB 4U1IA 2A9MH 4UU9A 3SE8H 3T3ME 3ZKXC 3JBG7 1AE6H 5HVWA 5HI3C 1FPTL 2GYSA 4F15C 2R2BA 5J13C 2QKIB 3RKPA 2R0WH 1FJ1B 5JPMA 2A73A 2H32B 4JB9H 2DM4A 2Z92A 5L2KA 4ZXBB 4ZS7H 2DWDB 4LHUB 5SWZA 35C8H 1GXEA 3LD8C 4CUCA 4IHOB 1K5NA 1WJ3A 1JHLL 2HA1A 3OBAA 4QOKB 4MA3A 4YGVB 2GI7A 1S7WA 3S35X 2VLMD 3LDBC 4ZQKA 3VWKD 5D72H 5LQBH 4JRXA 4ZOAA 2P4AB 4L3AA 5F1NB 4HGKC 1MIEH 2R0KH 4JG1L 2GITA 1HOCB 1NL0L 1OTTC 5JHDA 4Y5YA 5F6HJ 2HFFB 5IG7B 4JM2A 4LLVB 2NLJB 2G5BB 5IK3B 2VDPH 1T2QH 2GSGA 3C6SA 3V95A 2VR4A 1CU4L 5GS1C 1A3RH 2OLDA 5FECA 4PRBA 1R3JA 1KIPB 5CKGA 4YC2B 5FCSH 2WLYA 2XT1B 1H3XA 4KY1L 1K3IA 4MJIE 3A6BL 3PP4H 4PP1D 5ALBL 4R2GC 3VI3F 4OCXH 4ZXBD 1EAJA 4I3RL 5CSZA 2GJZA 1A5FH 4XBGA 3C9NA 4PGEB 4GW1B 4QOKD 5FYJD 1GOGA 1P4IH 3MYJA 2X10A 5EA0L 4XC3H 5D7IB 3A67L 1G1YA 5D6DA 4WGWB 1JPSH 3LEXB 4IRZL 1DBAH 1IZKA 1YNTB 4R3SA 3JV0A 4HHAA 1IVLA 1BFSA 4PREA 5SV4A 4UTAH 1ZLVK 1U2HA 3HE6A 3UEZA 4AIXA 4M6ML 3K1DA 1FVCA 1UYWL 3VFUB 3V4UH 2OL3A 2FBOJ 1X3DA 2BVPB 5ECJE 1QEWB 4OI8A 2EE3A 4WO4B 3TVMA 2BVOA 3X14A 2GTWB 5BOPA 1P4BL 1EAPB 3P30L 3VXMD 1B90A 4HGWB 4JO4L 1DQDH 5CEZH 4YDLC 3KPSE 3WKNA 3UJTL 4Q9RH 4I77L 4PP2B 2Y1VA 1AP2A 4R90H 3JWDL 3FOMA 1KGCE 2PW2B 1QO3B 1P1ZA 1N6QL 5FYJL 1VGKB 3WNOA 5B3NA 3ULUE 1A3LL 3QH3A 2EDTA 5DD6A 1PSKL 4M3KB 1U8HB 1WBZB 5CBAA 1GC1H 2HLAB 1WCBB 1NBYB 1AGEA 2YOCA 3BH9A 3JTTB 4JGJA 1ZA3A 3Q6FA 4WO4D 1TXKA 1B2WH 1IKNC 2VUOA 4TULL 5F96L 4ONFL 3GBML 1UB6B 3X17A 1MCSA 2DI9A 1UM4L 3FQTB 4JY5H 3BZEA 3LOWA 2BMKB 5LXGL 1GGYA 3VFSB 4XGZA 3GJFA 1UVQB 2DQGH 3VGFA 4FZ8L 2WQ8A 4JJ5B 2XKNB 3KPRD 3UROR 3QDJB 1QNZH 2AK4A 5J13B 4L29A 1NC2B 4X4XB 1PY9A 4YHOL 4U1KA 1P2CB 5A2FA 4I3SL 1FL3A 5KVGH 1UZ8B 4QNPE 5IKCB 3LN5A 4AH2A 4GLRI 1MI5A 1NCCH 1G7PB 1N4XL 3UZVB 5I8CA 3HG1B 4DN3L 5C0AE 4DEPC 1DSFH 1C5DA 2MNUA 3LDBB 3NN8A 1DZBA 4HZLB 4QY8A 4AIZB 4KJWC 3SOBH 5JW4Q 3MREA 4J3UA 2DB8A 5GZND 1KULA 3RGHA 3FT4A 1EUUA 3OXSB 3FO0H 2NX5A 5AD0B 4KZEL 5JOFA 1L0QA 5EIQA 4Y5XC 1NGZB 3CVHA 2DM7A 2DYPB 2Z35B 1IL1A 5F44A 4MAUH 2YXMA 3QDJD 5HI3D 4F8TA 5GS1B 4OV6F 4F58L 1HHIA 1FBIL 4GBXB 1AGFA 4JPVL 2DRUA 3R1GH 1BM3L 2VB5A 1V5JA 1A6WH 2ZOLB 3QWQB 2ZUQC 4PJAA 3HI6L 4ODBD 2XZAL 1J05A 3CLFL 4K7PL 4OLZL 3HG1D 2VLME 3RVVC 4KKCD 1BX2A 4ZNCD 4X4ME 4NQED 2V9QA 1J7VR 3EO1A 4RNRA 4XPFL 1I7RA 4YXKH 3RHWK 2P48B 5ICYA 3QUML 1OP5H 4J3OC 3IU3B 4E0RB 2GTZA 1OTTD 4OB5L 5JZ7C 5B39G 1CCZA 3QWOB 3VFMA 3LKSA 1CG9A 1IAIH 2DQEH 2GAZA 3M17B 3ZDZF 3M8OH 5E4EB 2J1KA 4P3CL 3S97C 2P24A 1KIQA 3S36X 2IH3B 4JFXA 4NJAH 4R2GD 1WK0A 4YBQC 2IEPA 1G7QA 1WVZA 3O3AA 1N0XH 1QOKA 4QOKE 3D2UB 5FKPB 3QJHA 5EPMA 3BQUC 3DVGB 4X6BB 3GMPB 4K55A 1FYHB 1K9TA 1A14L 4KRPC 5D1XB 4X9GA 5TFSL 3UX9B 2Z9TA 3X11B 2KKQA 4HS3A 3VFPA 5TE4L 5JXAL 3RDTA 4DGIH 4FZEH 2DMCA 5J3HC 1Q9KA 2D7QA 3STZB 4U7KA 2ZJSH 1WWWX 5FDYA 3F6IA 1W0YT 1OQXA 5C2BL 4XWGH 3GSRB 4HJJL 3AAZA 3A6OA 3IDJA 5C6PB 1OAKL 3DXAB 3QG7H 3ZHKA 3HCVA 3NACH 3U6RB 1ZHKA 2D7TH 3MBEA 2J6EH 5HI4C 4U1GC 5I75C 4ISVB 5IWLA 5GRXG 3U0WH 3GK8H 3SDAA 2OTWA 1HEZA 1IAMA 5T1LA 2QADB 3MXVH 4GO6B 5E0QA 4EQ2A 3FRUA 1T5XB 4LDOB 5D7IE 1YNKH 2CDEB 2VERN 3QR2A 1WZMA 1S9WB 4XNZB 3WXVH 3PHQA 4AMKL 3DO7B 2Q6WA 1T7ZA 1RK1A 3PGFH 1CXHA 1FO0B 1JZ4A 4MJIA 3T0EB 2B1AH 3K4ZA 4PIRF 4P3DB 2H6PA 5EULV 4ENEC 3CFDA 5H94A 2EO1A 1NKRA 3L3IA 1HHGB 3T4AB 4LAQL 3P9LB 1WSST 4X6EB 4Z7VE 3MUJA 3KXFD 1Y6KR 4FQHA 3BKCH 4U3XA 3PWUB 1ETZA 2R2EA 5CCKL 3H9HB 1Q1JL 1KEGL 2R4RL 4W81A 4Y5XB 5E2UH 1H3VA 3KPRE 2HMIC 4J6RH 1JGUH 1A9EB 3W9DA 4N1EA 1F6LL 2EKSA 2EXWC 4MWFA 1CF8L 4X99B 1F3JB 2VC2L 3M1BA 3H7BA 1NUFA 3MJ9H 1UENA 3UO1H 3LSOB 4WI9A 1TETL 1QYGH 3KPSA 1E27A 1H9VA 3OG6B 3SE9L 5CILL 1MCNA 1LNUA 2B39A 1F58H 1JYVA 4XPTH 3MV11 2A74B 4HUNB 2FATL 4KJWD 2GUOA 1QHOA 2JJTC 4LPWA 2FB4L 2AQ2A 1LD9A 4Y19B 1UB5B 1YNLL 1RJYA 2V5RA 1EUTA 3RZCB 5HYSB 3T0XA 2VR9A 3CXHK 2BNRB 1EERB 4PJHE 3QDJE 2W07A 3CFKA 3UPRA 4U1SA 1SJHB 4HUWB 1SYSA 3WIIH 1KCLA 3ARBB 3EFDH 3HG1E 2AJYL 5DQJB 2W9DH 4NQEE 5FKAA 3RVVD 4OCRH 4XMKH 4LLUA 4XPHH 3AFLA 4ZDHB 3M45A 4PJ7E 4KRPB 4QHUB 2DICA 4XBPB 3T65B 3LS4L 5JHLL 3B9VA 4PGDB 3IKKA 4F7TB 1FL6A 2R4SL 4Y19D 4B7LA 1A6AB 3FO1B 1A6TB 1GAFH 3E6FA 5JZ7D 2CJUL 4QT5B 4KK5C 3TCXA 3PV6A 4HIJA 1AHWB 3LKPA 5C0AA 2OTUB 1S9XB 5I9QC 3QBTB 1UA6H 1L9NA 2AK1L 1YJDC 3O4OC 3BGMA 1UH4A 1CLCA 4ZAKA 3ZYIA 5I1AA 3EDEA 1YEIH 2C3WA 4YBQD 3U4EA 4LSRL 3MLZH 4HIIB 1P5VA 1A6VL 3BQUD 2QQQA 2X4QA 4KRPD 4KK6C 1FAIH 3NAAL 5E00A 4KRLB 5IHBA 5FOBA 5HGGS 4G8FB 1QHPA 1I4FB 5BOZG 4GRMB 5J3HD 1J1OH 3V4VL 5CGMA 1RUMH 3UTPD 1YMHB 1DEEA 4H20L 4PJFF 3N0PB 4U6VL 4EDWL 2VDML 1LK3H 3VWKA 1KC5H 4X4MA 5D5MB 1KJ2L 5HI4D 1KB9K 2Y07H 2X4SB 2HJKB 1S7UB 5GSRB 1IBGH 4OGYL 4TUKL 5EC1B 4OZIB 1LDPL 4BFBD 4O2EB 3L95B 4KTEL 1QFHA 4Y1AB 3X13B 4ZTOL 1FNEA 2FX8H 4K7PY 2QEJA 3KGRA 5CD5C 1ZLUH 1MFDL 2QKIA 2MPAL 4H8WL 1FJ1A 1H8SA 3T08A 4OF5A 1KACB 4IOIB 5JQHC 2H32A 1XIWB 2EDKA 1RURL 2WUBH 3MRGB 5DGQA 5F7LB 1KYOJ 4GKNB 1G9MH 1X5KA 2DF3A 4ZXBA 4I3GA 3TBSB 4D9LH 5TE6H 2DWDA 1QBMH 2ICWB 1JI2A 4IHOA 4L8BA 3O11B 3RPIB 4OLWL 4FQCL 5IMOB 4QOKA 4ENED 5IFAL 5GGVH 3CFBB 4X6DF 1FFRA 5IW1B 5T3ZL 1EEQA 2EDWA 2OR9H 3KXFE 5F1NA 1UXWB 1IE5A 1ZT7B 3HNVL 2W9EH 1RIHH 4YNYA 1A7NH 3L5IA 2HFFA 5IG7A 4LLVA 2NLJA 1NCBH 2G5BA 4OCSL 2HMID 4GRWE 1U8MB 1ZTXL 3BDXA 4N8VG 1X5JA 5C07D 2EXWD 1F42A 3LQAL 1KIPA 4O2CA 2GCYB 5ESVB 4DGVH 3WLWC 1L0YA 3MJGX 1EMTH 3N1PC 1QSED 3O4LB 3GUTB 1H8OA 4PGEA 3HAEG 1GGIH 2X4UB 4WHDA 1HHHB 3S4SB 5D7IA 3F12B 3LEXA 3C08L 1R3HB 1A7BA 1RZFH 4XI5C 1JYNA 1FHGA 3B5HA 1MJJB 4ELKA 3H9ZA 4NO0D 5TF0A 3DYPA 3W82A 5J0BA 1UQSB 4OGZA 4LVOC 1G7MB 5FYLD 4PTTA 5EBLB 4GQ9L 4GKZB 3F58L 3P4LA 4HLZG 5I9QB 3VFUA 4OM1L 1QEWA 1FL5B 4WO4A 2ITDB 2FJGB 2GTWA 2I60L 1U8QA 3BUYB 4KVCH 4WI8A 3PDDA 1ZWIA 4PJDB 2BHYA 4Z7VA 5JW4N 4KUCD 3LEYH 3BRDA 4Y5VC 2OK0H 3CD4A 4PP2A 5MEQB 3JWOH 3WE6B 4HEPG 4GAGL 2OZ4A 2PW2A 3TA3C 3MRLA 4Y19E 4XMPL 1CFBA 4YBLC 2BNQD 4BFIB 4YFLF 3QDGB 5JA9A 4L4VD 2XTJC 5F9WC 1I75A 1WBZA 4QRQB 4KK5D 2YPLD 5E08H 1WCBA 3EGSB 1NBYA 4XP6H 5A16B 4D0CB 4HUVB 1D5ZB 3SKJL 1RIVL 5FYLL 2ENSA 5DQDH 3LKRA 5C71A 2CLZB 3K74B 1U3ZA 2I9TA 5L8JB 4OT1L 1UB6A 3CMOH 3U0TB 3MPCA 3FQTA 3HI5L 2BMKA 3MRBA 5I0ZA 3F7YB 1UVQA 4O5LH 5HVHB 5DK2B 4JJ5A 4ZUUB 1FIEA 2WIIB 3X3GL 2XKNA 3B83A 1CGUA 4NO2A 4PJHA 3QDJA 5D93B 4KK6D 1CLYH 2AJZB 4J12A 4R4FL 3NGBB 4OQTA 1D6VH 2ADJB 3QDGD 5AUMB 3UTPE 4FFWC 4BSVA 4NM4L 1CYGA 3U9UB 1FNAA 2A6IB 1XEDA 15C8H 2R0ZL 3T0WA 1EPFA 3HG1A 4PJXB 2X1QA 1MJ8H 3BZFA 3UYPA 5T3XH 1LE5B 4NQEA 1T2XA 2HN7B 5IBUB 4HZLA 5FV2A 4C57C 4PJGE 4AIZA 5E8OB 4PJ7A 3PE9A 1JPGB 4PFEA 2LAGB 1QFWH 3TWCH 1UCBL 3ALXA 3E2HB 3OXSA 3WSQL 4DFHA 5AD0A 3OX8A 1I1AC 2A6JA 4POZC 1ZLWK 1NGZA 2Z35A 1PEWA 3CFJB 3CJJA 4L3EB 4K2UL 3QQ9C 5CD5D 1Z2KA 3MJ8B 5GS1A 4AY0A 3HAEH 5GGRB 4JVPA 4M7LL 4NQXB 3U82B 3WO3B 1CDIA 1IAKA 1XGTB 4PS4L 4JFHD 3QCUH 4FQ1H 5F1KC 3RWHB 3QEQD 4Q58C 4HFUH 1HHJA 2DDQH 4C4KT 4RISH 4MJ2A 4KI1A 4YR6B 3QXUA 1BFOB 4HLZH 1XZ0A 5I17B 4X0KB 4OZIE 3LKOB 2D03L 3WV0A 1FORL 3BWAB 1XGRB 1NFDB 2D9QB 3RA7L 2UZIH 5C07E 2ZSVA 1ZLVH 1KF9B 2Q7NA 3GZKA 4L3ED 1HQ4B 1QUNA 4Q0XL 4ZO6A 3VGDA 2BFVL 5TF1H 2IH3A 1F4AA 2ADGB 1YEHL 3WIHA 3TO4B 2V9RA 5DFWH 1QSEE 1SJVA 3WLWD 1CS6A 2X9YA 2UZXB 4Y5VB 3Q3GB 5FKPA 3DVGA 3FFCD 3GMPA 2DLFH 2ARJB 5KVMC 3TA3B 1IMHC 1CXKA 5BZWB 4NWUH 2OMBA 4XI5D 2OP4L 1AY1L 4LIQH 4Y2OA 3VG0H 3MLYH 2GKIA 1UZ6F 3STZA 1KBGL 5DUMH 2E7CA 4RRPG 3GSRA 2QQNH 4APQB 2Y06H 4G43A 5HDBF 1EO8H 1A2YA 1NCUA 1L6ZA 2ED8A 1E4XL 3U6RA 1C1EH 5TH2A 1IKNA 3NFSH 4FFYH 7FABL 3MLXL 3KXFA 4ZOCA 3W39B 4UIKL 3U4BH 5I6XB 4K3DL 1CICB 4NQTA 4XXCC 2RHEA 1T5XA 4XBEL 3UXFA 5JLZB 3IDGB 3LKQB 3IKCB 5DJCA 1BIIB 3S37L 4K3JH 5HD8C 1I85A 1KTRL 3D0VB 3TA3D 3I50H 1RZ7H 4TPRH 5JDJA 1S9WA 4NZJA 3K8KA 2P5WB 4L4VE 4PJ8C 3RX8A 1CDGA 4D3CL 2XTJD 5IB5B 2YPLE 4WU5B 3P4MB 4BELD 2FDBP 1T1WA 1FLTX 3GNML 3P9LA 2YD3A 4NN7C 3TNMB 4HUUB 2E9JA 3GI8H 5EB9A 4K7PX 3PWUA 4BZ2L 4WW2C 1SEQH 1OSPL 3H9HA 4NZTL 3BT2H 1CL7I 3SDXF 5LVEA 4Y5XA 1YC8A 5K9KA 4NQSB 1BF2A 3ULVF 1WZLA 5DF0A 4NJ9H 3DVNA 3CZFB 3EZ8A 1VADB 3HPJB 1B9ZA 5CJQL 4OLEA 1CGWA 3MLUL 1AQDB 4MMZC 2P5WD 4X99A 3QDGE 3DRQB 1C08B 3IU4L 3F62A 1D5MA 3L5XL 4FFWD 5J12C 3LSOA 3VD5A 1EXUA 1U3YA 4KAQH 4OUUA 4LPYA 2BRQA 3QNYA 3FO9B 4UAOC 1OW0C 4YWGL 5MP6L 2COQA 2H26B 1Y6NR 3DRTB 4Y19A 5INDB 3T4YB 3T0AA 2CKBL 4QYOA 1Z3GH 4JM2F 1SY6H 5EBWA 2CDGB 2YC1A 3NABH 1I1AD 5EUKB 4POZD 1F4YH 2AKRB 3QHZL 2VDOH 3VI4F 1B0WA 4R8WL 3BRGC 3QQ9D 3ZTNL 1CDJA 4IIQB 3MV7B 3QO0A 1A7PL 3MA9L 5JNYB 2JCCB 3V0WL 3ARBA 1AC0A 5DS8B 3V4PH 4DZ8B 4QKXB 1WUNT 4PJXE 4XVTH 4JFHE 2R1YB 4CN6A 4X7FC 4NRZB 4NKQB 3RZWA 3BQUA 2P7TB 4ZDHA 4H1LB 4BYHA 4Z7OE 5KW9H 5A2KH 4YIQB 1IRAY 3ZT5A 3CFCH 3T65A 4JPKH 5IVNA 2EIZB 4HPYL 4X7SH 1WCQA 5E95B 4PGDA 1A7OL 1QR1A 5I8KH 4F7TA 5EZJB 4OLUH 3TBYB 3R0NA 1UEYA 4QT5A 1AHWA 4FABL 1R0AH 2AXJA 1S5IH 4L3EE 4RWYL 1HCVA 2OTUA 1S9XA 3GDBA 4KGJA 4ORGB 2WBKA 3BP5B 4JLRA 2DBLH 2ITCB 4LVEA 3ZE1F 1IGML 4PJGA 3MV7D 4CU6A 1T0PB 2R69H 3OGCA 1BVZA 3IETB 2HJLB 2WWMC 1OAUH 1GZPB 2AGJH 4LCIH 1EHLL 4OSUH 5DQ9B 3FFCE 4OV5B 2R1XA 1KJ3H 3P73B 3AS2A 5JIKA 5GJSH 1M7IB 3GGWB 4KROC 4LCYB 1RJCA 1MVFA 4D0DB 1ZVHA 3GSXA 4PJ8B 4GRMA 1K8DB 5H2BA 4Z7WB 1ND0B 4LSUH 4LF3A 3CNKA 2FBJH 2QSCH 4L5FH 1PLGH 5CZVL 4PY7B 3QEHA 3J8F7 1AD0B 4QTHA 4RGMB 2JB5H 5DRZB 4JFPB 1JPTH 4W4OC 5EOTB 3X12B 1X5AA 3EDFA 4NN7B 3QUYC 1N59B 2AW2A 5ISZB 2X4SA 2HJKA 2G2RA 4MXVE 1U8PB 5GSRA 4HC1A 1EK3A 2ICWI 5EC1A 4OZIA 4A6YL 5IOPA 1FH5H 1IC5L 3L95A 5ITFB 3X13A 1A7RL 3IDXL 2DQFB 3B9EA 3DIFB 2VIRB 5HD8D 5C07A 6FABH 1YEJH 3S34L 1MWAL 2WK2A 4LHQB 3NH7H 4PJ8D 5AZ2H 1XIWA 2XTJE 3B2VH 3MRGA 3RL1B 5J9PB 5J12B 1WZ1L 3S3SA 1PAMA 1GSMA 2ICWA 1QSEA 3O11A 2YRPA 5IMOA 5DEFB 4CMMB 3CFBA 4NQCB 2IFFL 4Q7DA 4P57B 3O6LL 3O45A 4PR5B 4Z0BL 2JJTA 1WTGT 1QLEH 3KJ6H 4WHTB 5ISZD 4NO0A 4MB4A 3DV4B 5F7MC 1MREH 1ORSB 3H9SB 4JKWA 2OXGA 2D31B 4DTGL 5KVFL 2DQDL 3GMRB 2NW3A 4LU5H 1H0DB 1B0GB 5C3LD 5L8LB 1UWXH 2P5WE 4PGZA 4JY6B 5IFHH 1YQ2A 4GW5B 1REIA 2DKUA 3JUZA 3WXWH 3QDHA 2NXYB 4FN0A 4PJAF 3EJJX 2WUCL 5CGYC 5F7EL 1D6EB 5D70L 6CGTA 1NGPH 4P59L 4RDQG 4E5XB 1HYRC 2JB6B 3PABA 3MROB 1VHPA 1JNLL 3S4SA 3VFVB 3F12A 3RWEA 3KPPB 3NFNB 5I1HH 5DWUL 5EDXA 4IEFB 1MJJA 4L4VA 3V52H 1MAJA 4G6FB 3H9SD 2YPLA 4OZFA 2C3GA 5GGRY 1G7MA 5F7DB 4GKZA 5A2IH 3AB0C 4UQ2B 4RFEA 1FL5A 2ITDA 2EH7L 2FJGA 3FB8A 2LV4A 4KVNH 4HKXB 1M05A 1AFVL 5EBGA 1F8TH 3ESUF 3QHTC 1UH2A 3CCHB 4EVNB 4NZRH 5F3HB 2VXQL 5MEQA 5I76A 2FCBA 5D2LB 2R29H 3WE6A 2APBA 3T3MF 4KROB 1IT9L 3ES6B 2OI9C 3OAZK 5ICXA 1I3GL 3RU8L 1MCFA 1Q9WA 4X7EC 4D0BB 4BFIA 3F7QA 3QDGA 4HCRL 3VE0B 2XOTA 3LAFA 3MGAA 3HZMB 2EXYD 4LKXA 4P2RD 5GHWL 2XY2A 2R0LL 1I7ZB 3EGSA 4PJIB 5B8CC 5T1MB 4HUVA 4NO5B 1JTTA 3TJEL 5E8DH 3TNNB 1S9VA 5EU3B 1YYLH 3UTQB 3MV7E 2XFXB 3RKDC 4LKCB 1Z0NA 2CLZA 4U1LB 2HG5B 1YEKL 2YUZA 5HVFB 3GJFH 4CRPA 4NKDB 5DJ8A 2WWMD 3U0TA 5C0IB 3QIUC 5B4MC 2PKDA 3F7YA 4YHYC 4KHXL 4K71B 4UZGA 1OPGH 4XNXH 5IESH 5J6GB 4KROD 1R3IH 4OD1L 1ZLSH 3D18A 2X1WL 5DZNA 4NZUH 1K8IB 2ADJA 3MLRL 4D9RD 5AUMA 1NMBL 3O6KL 3U9UA 4AK1A 4KZDL 1I8KA 2A6IA 1KLFA 3UCRA 4MJ5A 1FV1A 4MQ7B 1JPST 4MS8C 4L8DB 1LO3L 1U58B 4PJXA 2YWYA 5BW7C 1LE5A 2HN7A 3VFWB 3F5WB 2YD8A 4Y8DC 1ZK9A 5E8OA 1GC1C 4HZAA 3WS3A 4ODXA 1K85A 1TDQA 4GLRH 3I75A 3QUYD 1AKJB 4I48A 3O6FC 5CWSB 4S0SD 1F4XL 3FT2B 2FHBA 3D85B 1VFAA 1ONQB 3LCYA 1KB5B 3IF1B 5MI0C 1FDLH 1SJXA 4L3EA 4YX2H 3MJ8A 5ID1B 2M26A 3GRWH 3QQ3B 5GGRA 2UUDH 2CQVA 4Z7WE 1IGIL 2V2TB 2YD5A 3P9MB 4NQXA 4YDJA 4AL8H 1B4JH 1XGTA 2ZUVA 3BO8A 4ODWB 4JFED 5C09B 3WFBH 3FFCA 4YXLL 5J06A 2PCPA 4Y2DC 5HYQA 5ISZE 1PX4A 3ULUF 1BFOA 3T2QA 4X0KA 4ZTPH 3HMXL 4ZYKB 4P2QB 1EHAA 3BWAA 4L8SC 4R9HA 1OLZA 3MOAH 3AB0B 2XA8L 1U91A 2MFNA 1HQ4A 3CFIC 1QR4A 1TZHA 1C5BH 4OCWH 1GPOL 4NIKB 5KANG 2YBRB 2WP3T 2ADGA 3H42H 5I1JL 1SJEB 1WBXB 2OJZH 4ZD3H 5CGYD 4Y5VA 4WW1B 5TE7L 1XGPB 2Q1EA 4IJ3C 4ZPVA 3Q3GA 3QZWB 4LFHD 3HNTH 2IQ9H 5C09D 4PUBH 2X6MA 4UV4L 1BEYL 3E1F1 3SQOL 2ARJA 3TA3A 5C0GB 5D71L 2OI9B 4UT9L 1G9NH 2J5LC 1QRND 3BJ91 4D9QD 1IKFH 2ZCKL 3H9SE 1GVIA 3O0RH 4P2QD 4XPBH 4DW2H 4M4PA 1F11B 1QACA 1DBJL 4GAJL 2ICWJ 2AI0H 2N7BA 5GJTH 3F8UB 2V2XA 4WEBH 3W39A 3MLSH 1AE6L 4O02H 1ZAGA 5GGSB 4YHYB 5JLZA 1BIIA 2DL9A 1BIHA 2ZCLL 3SKNB 4HQQH 4JB9L 4L8CB 3D0VA 4DCQB 3KPLB 3RVWC 4WCYH 2P5WA 5H37G 4OM0H 1BJ1J 4JE4B 4L1HA 2Q8BH 5LGKA 1MQKL 4OF3A 2QHRL 3CH1B 1FZOA 4EN3C 3D0LA 3VXTB 2HVKB 5D72L 3P4MA 5LQBL 3QP3A 4XPAH 5CMAB 1MIEL 4FOMA 4ERSL 2DMKA 1HYSC 3RKDD 1N5AA 1PYWA 3TNMA 4RFNC 4X7DC 3O6FB 1CXLA 4XNYL 1T2QL 3QIUD 2B7DT 3FQNB 5EO1A 5B4MD 1L7IL 5B38B 1A4KB 1I1AA 5D2LE 1JK8B 2Q7YB 1A3RL 4NQSA 4POYA 4CVUA 1GHFH 3S3PA 1W72L 4UILH 3CZFA 3HPJA 1VADA 5E94B 4X98B 1ZLWH 3D39B 4NZDA 3TBVB 4PJ9B 4D9RE 3DRQA 3C8DA 3G6JE 1A6UH 1TNNA 1CDBA 4Z18A 1XAUA 5GZOC 2YEZB 4PJIE 3PQYD 4DK6A 1ZKAA 3PGDA 5BJTA 3BHBB 3SKMB 4MS8D 4GMTH 4MLIA 1XF3A 4LHUG 1JPSL 1KCVL 1DBAL 5ESAB 3FO9A 4Y2DB 1A8JH 1NAMH 5E4IA 3QNZB 4NHUB 4UTAL 4H0HB 3QIWB 2NY5H 4WIQA 3DRTA 4HUMB 4OUOA 3O6FD 4FXKA 5B22A 3L3DB 1MRFH 1EGJH 1Q0YL 1YMMD 2CDGA 3TN0C 4GSDH 5EUKA 2C5DC 5DC9B 1RZKL 3NIGE 5JW5B 2VKWA 4NUGH 3FQUB 1DQDL 4IIQA 5CEZL 3QI9B 2WBWB 3MV7A 4OD2B 43CAB 4Q9RL 2E7BA 3CC5B 4YQXH 5JNYA 4NRXA 3NIFE 3C2AH 4LCWB 2FIRT 5I1CH 3HS0B 2R1YA 4WWID 2KL6A 5IV2A 3CVIH 5D7IF 2P7TA 4JQIH 4XRCB 4Y2DD 4XC1L 4YIQA 4U2ZA 3AMKA 2XWJB 2EIZA 2IANB 3D3VD 1RUKH 4YDVA 5LCVL 3TBYA 4HKBB 3QQNA 1VEMA 3D87B 4OJFH 4R4BB 1S9YB 3S37X 4FXGB 1FZJB 1KCRH 5L6YL 4EDXA 2JIXD 5IQ7H 4MCYB 2XRAH 2RAMA 1IGCL 1ZHLB 4ORGA 3UPCA 3ZSSA 1IQDB 3BP5A 1OP3H 2BSSA 3VXQB 4YFDB 2EICA 5F8QC 3ROLB 5DHYA 5ICZB 3DX9B 4Z7VF 2NY4B 4LLMB 2HJLA 1QFPA 4PRIB 4M8QB 4HAGA 4WJ5A 5DQ9A 5C09E 5H37H 4HV8B 5MEOB 1JUFB 1DFBL 3OR6A 3O3BA 3P4OB 4LLDB 3IFLL 5F1IB 3I3EA 1JZ8A 1RUAH 1WWCA 2MMXA 1QRNE 4LSTL 5KVGL 4D9QE 5DJ6A 1HZHL 2IAND 3FMGL 4PJ8A 1UGNA 1NCCL 5E99H 3V2AR 1K8DA 3RWIB 4Z7WA 5EORL 4ALAH 4P2QE 3K3QA 1BP3B 2VO5A 4AZ8A 2IPKB 3NA9H 3SOBL 4PY7A 2XYCA 2DIBA 2F58H 4GOSA 2VISB 4UUJB 5H35B 4JFFD 1AD0A 4F80A 1JGVL 3X12A 1N59A 3RUGB 4RFNB 5ISZA 4NGHH 4BQCA 4PRID 5FM5M 3T1FA 2XXCB 2A6DB 4OGAC 3MXWH 4BFEA 2Z91A 2QV2A 5DD0H 2PXYC 3PWLB 5GGTH 5EZOH 1FNGB 3NBNA 1EBAA 4XVSH 2BJMH 2DQFA 4PJHF 2VIRA 1CFVH 2H32H 1BFTA 4YHZL 3L7EA 3WJJC 1A6WL 1NCTA 5HJ3B 3RVWD 1AH1A 1F00I 1N26A 3QIBC 1FGNH 3TZVC 2H9GB 2EC9U 3EIFA 5JMRA 5J9PA 4G6KL 5FFLA 4E42B 3N9GL 4EN3D 4LCUA 2HP4A 5IMKA 4JFDD 4CMMA 1FRGH 2HWZH 2ZG3A 4PR5A 4PJ7F 1OW0A 2OTPA 4ZFGL 2RCSH 4QXTB 1HILB 1HYSD 5BV7L 4KC3B 1ZGLM 4WHTA 4J8RA 1ZA6B 2YPVH 3RNKA 2AEPL 3IJYB 3DV4A 2DQEL 3NTCH 3H9SA 3G08A 2C3XA 2D31A 2RQ8A 2CKNA 4JHAH 5FGRA 4U6XA 1B0GA 2FX7H 3IJSB 3KPOB 1NSNH 3OTTA 4MAYC 1DDHB 4LEOB 3TO2B 4K8RL 4H88H 3C60B 4OD3H 4XCFH 1QBAA 4UT7L 5GZOD 4WFED 3WHXB 1H5BC 4BA8A 5TGBB 3I02B 2R1WA 2VXVH 4QF1A 1G9MC 1WV7T 4N8PA 1UJ3C 2VAAA 1WBYA 1AXTL 3KPPA 4TQEH 3NFNA 4DGIL 1PD6A 3FB6B 3DMMC 4NP4H 3VMOA 1KLGB 5BVJA 2NY3B 4RAUA 5ID0B 2PUQT 4BKLA 4HD9A 5B39B 1N7ML 1YMME 4ZG1A 3TN0D 5F7DA 4WUKL 3NOIA 2JJVA 4NNPH 2GHWB 4RZCA 4FQIH 5DHVH 2D7TL 1WICA 4PBXA 1CBVL 3U0WL 5ACLA 1MJ7H 2DI8A 3GK8L 1A3QA 4MB5A 4Z5RB 2OSLA 2XZZA 2VDRH 1KNOA 1BZQK 4HKXA 3OKLA 4G42A 1NEZG 3I6LD 4GH7B 3ARDB 1LO4H 1I8IB 2DJUA 5D2LA 3GI9H 3EO9L 1O5DT 5FO8A 3ES6A 3RL2B 5KTEH 3D3VE 1RVFL 4DK3A 3PP3K 1UWEH 2B1AL 4P2CG 3SQBA 2Y7QB 1FGVH 1QTYT 1V7MH 5IROC 3G6JA 3JV6A 5KS9B 4CVXA 3HZMA 4YXHH 5J6HA 1I7ZA 4PJIA 5C0DA 2HRPH 1W8OA 5T1MA 4Z6AT 4NO5A 1DP0A 3DNKA 3WNPA 3C6LB 2W0FB 5E03A 3UTQA 4ZUSB 3SY0B 2XFXA 3BKCL 4CBPA 4W4OA 2FX9H 1BZ9A 1NMAH 4U1LA 3MA7B 3QUYA 2HG5A 3VH8B 1NLBH 1XF4B 3KLAA 5E2UL 5L2JA 2BOBB 4J6RL 4PB0L 5FB8A 2VZOA 1JGUL 1KN4H 2VXTL 5DTFB 1CGSH 2X4RB 4FP8H 5J6GA 1ES0B 2YUVA 3HRZB 1S5HB 1YQVL 5L9DL 5F6IC 2IANE 3QHFH 4Z7UB 4LNVA 2VXSH 2IALB 3JWOC 1JRHL 4Z76B 4ZUTA 5CJ5A 4UOJA 2Y36L 1F58L 4MQ7A 1N2RB 4L8DA 1U58A 3FJTA 1T4KB 2Q76B 4JFFE 5C0CB 3F5WA 2VH5L 4P2YA 1OCWH 5EUOB 3GB7B 1T1YB 5KAQF 5GGSY 4PRIE 2AJVH 4G9FB 4M4RA 1WFNA 2CUMA 4UT6L 2YWZA 4XNMA 5FHAH 1PQZB 5CWSA 5KAQG 1I3VA 1I7TA 4OGAD 1MCCA 4Q2ZB 2ESVB 4M6OL 2PXYD 1KB5A 1CGVA 3LPWA 3BFOA 1CGTA 3BVNA 1U95A 1FLRL 4JHBA 5BXFB 2A77H 3FL7A 3WIIL 1IZJA 2D4DA 3QQ3A 1L0XA 1NGXB 4KKAD 3QIBD 4BK4A 2V2TA 3TZVD 1EFXD 1DANU 2W9LA 1ZGLA 4XPHL 4N68A 4ODWA 1H5BB 2OJEB 3LEVH 4TVPL 5AZEL 3HUJB 5C09A 4JRYB 5C0CD 3BWUC 4LVHC 5C7XH 3VDAA 3CK0H 4M61B 3L5WB 1QRNA 3GSUB 5IB1A 3U30B 1CD0A 4XP4L 1KPRB 3BSZH 4G3YH 3H0TB 4J3SA 3OB8A 4W4NA 1L9MA 4ZYKA 4P2QA 4YK4C 2ESVD 2DJSA 4P5MA 4I18B 5JPNB 4HXBL 1BQUA 5HYSG 4ORZC 4LLAA 4KH2A 3C8KB 5ERWB 4LBEA 4MAYD 3VGEA 2ZPKL 4OF7A 2YBRA 4WI3A 4ONGL 1INDH 1SJEA 1WBXA 3E8UH 3KPQB 4HF5H 1CK0L 4WW1A 2NMSA 5E8NB 5DJYB 2HAZA 3QZWA 2XQYK 4JRYD 1IAIM 1AQKH 3LN4B 4R0LB 3VRIB 3B9DA 2IC2A 2FL5B 3DMMD 2XZCH 2WZPD 1IC7L 4G7YH 4P5TB 3OJDA 3DUUB 1O0VA 3IFNH 1LVEA 3OAZH 5DJDB 4ELMB 5JOEA 5E9DB 1KC5L 4MNQB 5IF0B 3JSSA 4YPGB 2A6KB 4WTZA 3K2UL 4U1NB 5IVZA 2X4OB 4HH9B 4LARL 1CD9B 4OZGE 1IGFL 3AS1A 5EBMB 3DUSB 4HX1A 1BQHB 1FVDB 3ALWA 3I6LE 4PY8I 4ZFFB 3QIUA 1EO5A 2NR6C 1LO2H 5KVEL 4LOUC 3WUWB 5GGSA 3PGCB 4WFGD 1KOAA 1LEKB 3SKNA 4OCYH 2WUBL 1NC4D 2X4TA 3L7FB 4NN5C 4W70A 4L8CA 2D0GA 2FHFA 3LMJL 1FO0H 3RI5K 3TGXA 3KPLA 2C4FU 3BESR 4CL7A 1MHCA 1BWWA 4Q97A 3G5XB 5EU4A 2NTFA 5FO9B 1VSCA 4QTIH 2XIDA 2QSVA 3LRGA 5GGVL 1QSVA 3QCVL 5E9DD 3RY6C 2HVKA 3VXTA 4YDKH 3W0WD 4X7TA 4F8QA 3TP4A 5DC0A 3VXRD 5BW7A 2DQJH 2MOVA 4I9WD 5IW6B 1RIHL 1P4LB 1A7NL 5IJVB 4JZNB 4XXDA 4M8VA 5ACZB 3EYUL 4PRHB 3O6FA 4OZIF 2ORBH 1B6UA 4Q6YA 5B38A 1EFQA 1YMMA 1OHQA 4JHWL 4NBZB 2BSRB 2Q7YA 1F13A 2H3NA 4TUJB 4BQ6A 3DX8B 4LDLB 5FDWB 5E94A 5F9OH 1HNFA 5IEKA 2CKBB 2NPLX 3PWPB 3ARQA 5D9SA 4DZBA 3U0PA 2X05A 1EMTL 1CZ8L 4O00A 4P4KB 5KS9E 3S35H 4UNUA 1J1PH 3QUXC 3BEWA 3BKJH 2R8SL 3BHBA 3SDYL 3SKMA 1F3DJ 5IVXB 5ESAA 2VDNH 4Y2DA 1N0LA 4LVHB 5CEXB 1NQBA 5I16B 3FTGB 5C9JB 2PYED 3G9VA 3C87A 5IHUH 3QNZA 5JR1H 3DPBA 3D3VA 2M2DA 3O2VH 3NCMA 3H7LA 4QGTA 3DOSA 4LPVA 1RU9L 3QFJD 4L8SA 5DUPH 1F2QA 1ACZA 2VDKL 2JIXA 5JW5A 3QPXH 3DO3A 2Q8AH 1K6QH 4Z7UE 4H26A 4AEHH 3VCLB 3FQUA 4CDGC 5BVPH 1VACB 1TZIB 3HC4L 4OD2A 3LEYL 4WWKC 2OK0L 2IPUG 4KUCF 3VA6A 3JWOL 3BDYL 2LU3A 3HS0A 4JO2H 4K3HA 1INQB 3SCMB 3HAEB 4HWBH 5A40E 5C2UB 1BQLH 5C0CE 3GSVB 4QXGH 3V6OC 1WEJH 4XRCA 5EUOE 5IUSA 4OLYH 2VNCA 2XWJA 4LASL 3S4SG 1NUDA 2IANA 2XACC 4X9IA 1S7RB 3IFPB 5T3XD 2EO9A 2DIJA 3PXJA 5I66B 3AC0A 2ESVE 5T33H 1WGOA 1S9YA 5DD1H 3VXSB 4FXGA 5DQDL 4K23H 4K9EH 3BKYL 5BS0B 1IQDA 5EU5B 4JFFA 3VXQA 2VN4A 3ROLA 4DAGL 2C1PB 2EEDA 1ZE3C 4PRIA 4O5LL 3PWJB 4M8QA 5C0EB 1MSPA 1E6JH 1U36A 2DOCA 2EH8L 4G8GB 1FFOB 3FN0L 5ADPL 3IDYB 5CP3H 5MEOA 4JRYE 1JUFA 5TPWH 3OSKA 1CLYL 3BPOB 1MNUL 2W65A 4LLDA 3MGTB 5AYQA 3PDOA 5F1IA 1PFCA 3EZJB 1ULVA 5GRUH 4HBCL 4NO3A 12E8H 4GRLC 3P0VH 4QXUL 4EOWL 4F57L 3QDMD 15C8L 5I73B 2OX5A 4M9PA 5IBLC 1MJ8L 3U46A 5BMFL 1U41A 4HIHA 1NGYB 1TJGL 3WFCH 2IPKA 1LP9E 3EYFB 1NFKA 3IYLW 3FO2A 5H35A 4UIMB 2C9AA 4G8IB 4HC1H 3HE7B 2ADFL 3EFFB 5FGBC 5TDPB 5IB4B 2NR6D 1RZJH 4WFGE 4LOUD 2JF1A 2J6EA 3V0VB 3AU1A 1MEXL 3NPSC 1SMOA 2X4PB 1PZUB 5ANMB 1HINH 3IFOB 1BAFH 1TQCB 1CVRA 5GGQL 2C26A 3GSNL 4RMUA 4ETQB 3K46A 5E9DE 3QO1B 4G6JH 3K81A 3W0WE 4E42A 2YRLA 4KDWA 1YECH 4PJXF 2L7JA 2AJSL 2J88H 1G7JA 3V6ZA 4I9WE 1XT5A 4Z7OF 4P3WA 5FO7B 3HC3H 2EIEA 4QXTA 1IM9B 1HILA 4LP4A 2G60L 4CVWA 1UM5H 3SN6N 4K7FB 3WIFB 4ACPA 3IJYA 4LRNH 2VLRD 1UADC 1MAMH 3TN0A 2VKXA 2JTDA 1S7VB 3CGTA 3QXAA 4M1GL 3N85L 3VD4A 3IJSA 3KPOA 5GSVB 3W2DH 5EZLB 3ZKMC 1DDHA 4LEOA 8CGTA 5DJAB 4OZGA 4U1JB 4P4RB 4F3FA 3IXTB 1J0HA 3AGVA 3QUXD 2F8VA 4YHML 2F53B 3I02A 2CO7B 1G0YR 3TYFB 2IMNA 3OKNB 1SVCP 1A7QH 4KI5C 3MJ9A 2PYEE 2NZ9C 4IRSB 4LIQL 3MLYL 3FB6A 2GIYA 2X1PA 1GOHA 5ID0A 3X3FH 4UNTA 4WNQB 4JEGB 5B39A 1OAQH 2QQNL 2BDNL 1MHPH 5I30L 1EO7A 1EO8L 2DN7A 4KDTA 3O3EA 2BNUB 3S36H 1CVSC 5J11B 2DQUH 4ZFOL 1U8OB 2VL4A 4M7ZB 1MH5A 1GGBL 4Z5RA 1BZ7A 3I84A 5E24E 4WWKD 3Q5YA 4K3EH 4GAYA 4F7MA 4MXVF 1W0WB 3TV3H 3SDCB 3E6HB 2I24N 1PGRB 1J8KA 1XCTB 4K3JL 3ARGC 3ARDA 1I8IA 3DGGB 2F53D 5IVXE 5GGVY 4LMQE 1FC2D 5DR5L 1I9RH 3PF2A 1K4DB 1M7DA 4X6DE 2GJJA 5T3XE 5D6DC 3MNVA 5KSBB 1RZ8A 2NY2C 2Y7QA 3MBXH 5KBNC 5JUEH 2XA3A 1TVHA 1YA5A 5KS9A 1YYML 2YPKB 2I25N 4WEUD 3D25B 2W59A 4X8JB 3FFDA 5DC4B 4N8CH 4M5ZL 1JWUB 2W0FA 4HDIB 4K94L 1AO7B 3SY0A 1SEQL 2XI9A 2GT9A 1WLHA 1XF4A 1VPOH 1M7XA 1T66C 2AERT 2XY1A 2BXYA 2BOBA 1VEOA 2A1WL 1F2XK 2HFEB 4BQ8A 3BD5A 1U8IB 2GK0B 3KWWB 2X4RA 3OPZH 1JGEA 4G5ZL 1ES0A 3L5HA 2B20A 1T03H 1S5HA 1UWGH 4KHTL 3MSPA 2JELH 4Z7UA 1IGYA 3WJJA 3S88H 3QDME 2IALA 4GMSH 2CLRB 4WFFD 1KJMB 2UV3A 4Z76A 2BK8A 3TZVA 3JVGC 1EFXA 5IBLD 2NY1B 4OFKA 5EO0A 5HHVH 1N5YL 5L8KB 3L3KB 2E5EA 4PV8A 1T4KA 2Q76A 5C0CA 1JPFA 8FABB 5EUOA 5KVDL 3T0BA 3QJFB 1UH3A 1Z3GL 4JO3L 3L3JA 1RZGA 3K4DA 5E56A 3VDCA 5C0RH 1G7LB 2ZUUA 4X4YB 2VDOL 3CIQA 5HY9B 3C5JB 2ESVA 4Q2ZA 43C9B 2UVFA 5GRZA 4DKEL 4XP5H 5BXFA 3S5LB 5SX5K 3AS0A 3ZYZA 4MD4A 4MAYA 4HXAL 4KQ3H 3MACH 4UV7H 1UEMA 1CE1H 1Q72L 5IT2H 3VFTB 1QQDB 1QFWM 3BP6B 1CD8A 5DRWB 2YSSA 4JFOB 5KW9L 1H5BA 5GRJH 4XCYB 3WMSA 3CFCL 3V7MA 3EUUA 4JPKL 3HUJA 4M62L 3ZKNC 1OGAD 4JRYA 4X7SL 3U7AA 1UJ3A 5I8KL 1N64H 5E6IC 3DMMA 2APFA 3L5WA 4M61A 1BD2D 4KU1A 3QDAA 4LGRB 3ARFC 3FRPA 3GSUA 3OL2A 2VLRE 3CLEL 1CLZH 4QRRB 1KPRA 3H0TA 1JF1B 1S5IL 2Z8SA 5I1GH 1DLFH 4UDUB 2J8UE 3C5SB 5C86A 1NBVH 3MRJB 2DBLL 1JGLL 1LP9A 4NKOA 3MC0A 5ANME 4OFPA 5DK3A 2R69L 3C8KA 1RUPH 5ERWA 3ZKMD 3MRFA 1OAXH 4QRSA 2JCCF 3UTTB 1KJ3L 2CR3A 3VDBA 5L2KD 1DQMH 3JTSA 4LLYB 4YHPB 5E8NA 3W81A 4MNGE 3OHXB 4R7DB 5FM4A 4CNIB 2VLKB 3LN4A 4KI5D 4R0LA 2NZ9D 2JJWA 4H1LG 2FL5A 3AM8A 4OLVL 5KJRH 2I9LB 4X6CE 4C59B 5IROA 2FBJL 2IG2L 1DBMH 1PLGL 4NKMB 1OM3H 2FR4B 2ATPB 3PP3H 1S3KH 4JN2A 5JHDD 5E9DA 4MNQA 3W0WA 4XHJC 3PJSB 5IF0A 1F4WH 2ZSWB 3DX6B 4YPGA 4NT6A 3CXDL 4U1NA 1JPTL 3MR9B 2XG4A 5EBMA 4P9ML 1A1OB 1BQHA 1ZHNA 3CSBA 3ULVL 4WUUD 5A43C 3G6AB 3V8CA 3T2NH 3I3BA 2FO4B 4FQ2H 2F53E 3WUZA 4CAGA 3ARGD 2AEIT 3WUWA 6FABL 1YEJL 4FRWA 4NHCH 3NH7L 4AQ1B 3V9FA 4X5XB 5D2NB 4MD0B 2QQKH 1IEBB 3MCLH 4S10A 3UJIH 3BRFA 2NY2D 4Z7WF 1I1CA 1MJUH 3QA3B 4IMLB 1G9NC 3UYRH 3VRJB 4NYLA 5C0BB 3OAUH 1QLEL 2LTQC 1S8DB 5IW6A 2OMNA 2IBZX 2PYEA 4HK3N 3N50A 1P4LA 3L3HB 1MREL 4JZNA 4FQPA 2YMXL 5ACZA 1T0NB 4RGOL 3MBEC 4CKVX 5AAWA 1T66D 3U36A 1NLDL 1JGDA 2HVJA 2P45B 32C2B 1E4WH 4R97C 1XGYL 2MKWA 2HLFC 4LU5L 2BSRA 2Z31C 3ZT7A 5GISH 1YEFL 4LMQI 1DQQA 2FIKB 5CD3B 5FDWA 3EOAB 3Q48A 1NMCB 3B6SB 5EOCH 3WXWL 5KSBE 4WFFE 1HIMH 1YPZB 4P4KA 1N3NB 3GM8A 4UINH 4DWHA 1F97A 4I5BB 4U3HA 1MCIA 3FCTB 3IAPA 4IOSD 3VGHA 4RWHA 3BKML 2VABB 1KXVC 4X9BA 5IVXA 3G6DL 4HEME 5CEXA 3PNWB 3FTGA 4X6DA 5E6IB 3V52L 4AT6B 1MVUB 4XPGH 1FSKB 1P5UA 3ARFB 2YD9A 3BPNC 1PBYA 5IW3A 4DVRH 1I1YB 3KHQA 2DWEA 2OL3L 4NBYB 3HLAB 4JFYB 5A3IC 3BXNA 2O5XH 4LSPH 2I5YH 3B9KB 2QSTA 2C3HA 1NAKH 4OFIA 1E4KA 1ADQH 1KENL 2BY3A 2P5EB 3ULSB 5ALCL 1FNSL 5EU6B 3C5ZB 4KVNL 3TBTB 3VCLA 2DLGA 1NEUA 3QQ4A 1ZMYA 2F74B 2KQNA 5BQ7B 3MX0A 2NY6C 4E41B 5JO5B 2IPTH 3V7AG 5MENB 2R29L 4H1LH 1INQA 2CPCA 3HAEA 5TDOB 3CAFA 1MI5D 4M43H 1MHHB 3GSVA 3ZKND 4P46B 5SWSB 1BD2E 5CLWA 2CXKA 5D6CA 2VOTA 3FB5B 4Y4KC 5E6ID 1CIUA 3RTQB 3LH2H 3ARFD 3IFPA 3QDMA 4GJTB 1WISA 5I66A 1E0OB 3QXDB 1MFEH 2F15A 4CDHA 2NY5C 5CS7A 1Q9OA 3SDXE 1PEZA 5EU5A 4FQJH 4EKXA 4PD4J 4ZODA 1R24B 5FV1L 2O61A 1WIUA 3MRCB 3IXAB 3KYNA 3WFEH 1OPGL 1G6RB 3AXLB 5HGDB 2AQ1A 3T3PF 4AG4H 4N0CC 5D2LF 4KI5E 1R3IL 1ZLSL 5AYUH 1BVLB 4XWOD 4NZUL 5IIEA 1MCOH 2CGRL 1K2DB 1A9BB 2IAMB 5ESQB 2LFGA 3V0AC 4QRRE 3F7PC 4QHNB 5T5NG 4P48A 2C4XA 1ITBB 1J86A 1FPTH 3LKNB 3ZKSD 4NSKA 3BP4B 4JFZH 1TTGA 4PJIF 4HJ0C 1NGYA 1MY5A 2NZIA 3RY6A 4XHJD 4JKMA 1Q94B 4YZFE 3EYFA 1FNLA 5LAXB 4CMHB 4OFDA 2LTQB 4KRMB 4UIMA 1JHLH 4FTVB 4G8IA 3O9WC 1DLHB 3KVQA 3CVHL 3HE7A 4WUUE 3EFFA 4JKLA 4RFOL 1VKXB 5TDPA 2AV7B 2J7LA 3A0OA 5IB4A 2VLRA 2E9BA 1UFUA 1FDLL 2FWOA 3FB7A 4JG1H 2FZ3B 3DBXA 2XPGB 1YN6B 4R97B 3TYGH 1ACYL 5LG1A 4ZFOA 4MD5B 3V0VA 2Z31B 1NL0H 2J8UA 3VXOA 2BOCA 5BV7B 5BZDA 3I2CL 2FJHB 2YA2A 5ANMA 4H0IA 3WFZA 1OLLA 4AL8L 1R5WA 1CU4H 4M00A 4F37F 3QUXA 3N1GC 3WFBL 1KPVB 3NIFF 3QO1A 4KY1H 5I8OL 1DN2A 3A6BH 4YUEH 2VXUH 4MNGA 3HPLB 5LKNA 4ZTPL 5EA0H 5HYFA 3ME0A 1D9KC 3BE1H 3MBED 4O58L 4X6CA 4IRZH 4W6XB 1B6DA 3MRDA 3D69B 2X44D 3IS0X 1MRDL 2HLFD 4WI2A 5T1LD 2Z31D 1C7SA 1S7VA 1MCWW 2AEQL 3QB7C 5GSVA 2FEEI 4HIXH 5EZLA 5DJAA 5GS0L 1FFNB 2OJZL 4U1JA 1UYWH 4ZD3L 4P4RA 3WEXB 4WWKA 2NY6B 2B5IB 3IXTA 4ODHL 2IQ9L 4XVJH 4HKZA 4WDIA 4JO4H 2F53A 3ECBB 5FA4B 2D2OA 3VXNA 4BSWB 3OKNA 5I0DA 1G9NL 3UJTH 5SWQB 1NDGB 4LFHG 4I77H 1IKFL 1NJ9B 3KLSA 1QRKA 4Y4KB 3JWDH 3LV3A 1ZSDB 5EO9B 5FUOL 4GW4B 3O0RL 5K59E 2PF6A 5A3ID 3DTXB 5CSBA 2AI0L 3G5ZA 1ZT4A 2BNUA 1U8OA 2ICCA 1SY6A 4WEBL 1YPZE 2RJMA 3QPQC 4L3CA 1HKLH 5EOQH 4YC2C 2NY6D 4O02L 4IDLA 3T8XB 1W0WA 5IEHB 1CR9L 1HI6B 3E6HA 1YY8B 2V2WB 4TULH 1XCTA 1MHEB 5F96H 4TUOB 3DGGA 1QD0A 3GBMH 5D4QA 4WCYL 3OJVC 4KKNA 3QZWG 1CFNB 5LXGH 4NPYB 4Y4KD 3Q1SL 5KSBA 2KQMA 3HFMH 4XP1L 2ZCHL 2VSCA 2YPKA 5A1AA 4HUXB 3L1OL 4RRPA 1KFAH 4MDIA 3D25A 5HSFA 4X8JA 4P9HL 4JPIA 5DVOA 1ORQB 2F54B 1JWUA 4Z78B 1N4XH 2X9WA 2EE2A 3OKKB 4FXLA 4WTZG 3KNBB 4FQLL 1QKZL 1OOAA 3O9WB 4HS6B 4N90D 4L9LC 1ZV5A 4PB9L 5T1DL 5FGBA 3TF7C 3FN9A 1DN0B 3N1MC 2HFEA 2VQTA 1LEIB 4N0CD 4EI5B 4UILL 1U8IA 2GK0A 3KWWA 3UP1A 2RFXB 3BYYA 1CN4A 2CIIB 3IT8D 5SWSE 4KZEH 1A6UL 3ZDXE 2CR6A 3UDWC 3MMEA 1ZVSB 3SJVD 4F58H 4BZ1H 1FBIH 4HJ0D 1HDMA 5CEYB 2YZ8A 3ZT6A 1I9IH 2ZUYA 3SGDI 3ULUL 3GIZL 3HI6H 1R3KB 2XZAH 3CLFH 4OLZH 2NY5L 3ROOB 4UTBH 4RMVA 1S7TB 1U8LB 4CU8A 5K9OA 2ZOKA 3ILPA 3QJFA 1BD2A 3O9WD 1EGJL 4I2XB 4TNWF 4HT1H 4HULB 2RBLA 3AS3A 1QZ1A 1TQBB 1I8MB 1G7LA 1BBDL 4X4YA 5HY9A 3QUMH 3C5JA 43C9A 1MRCH 1I9JL 4OB5H 1IC1A 25C8H 3SDXA 2P8PB 1KEML 4DOHB 3GBLA 2V5YA 4NRYA 3NZ8A 2EDDA 3C2AL 2B2XH 1XF1A 4DN4L 5I1CL 1MIML 3VFTA 1R5VB 4P3CH 4N0FB 2GEEA 1IAOA 3FQXB 1OAYL 1DUZB 3KHOA 4JFOA 4XCYA 3MRRA 4OQ1A 1RI8A 1KT2B 4KKCC 1E28B 1JBJA 3WFHA 2RR3A 4ZMAT 1H3WM 3LZFL 4F33A 1IGJB 3RX5A 1D9KD 1A14H 1BHGA 4J3VA 5TFSH 4QRRA 4AEFA 1JF1A 4ODVH 3GM0A 5IQ7L 4JVWA 4M48H 1MCEA 4UDUA 5TE4H 3C5SA 4LCCC 4JANB 5ADOL 4PJBB 2WV3A 5E70A 4LAJH 5C2BH 3BX7C 4HJJH 4F7CA 4WENB 2XQBL 4ZOEA 3MZTA 1OAKH 2DKSA 1MFNA 4GBXC 4WUUA 2GQHA 2DD8H 3BN3B 1P7KA 4HPOL 3KJ4B 1AGCA 1MLBB 3ARGA 4LLYA 4LHUD 1BOGB 3EDKA 3MCKA 4M6NL 4CNIA 2ENYA 2Z93B 1PZ5B 4TN9A 2F5AL 1MCPL 3M07A 1FP5A 5E99L 2NYYC 3OR7B 3STLB 4PRDB 4Q9CA 2I9LA 1OVZA 4YJZL 4NKMA 2FR4A 4PGBA 1CT8B 1OGTB 4NOFA 3LS5H 5HHPB 5IP4A 3MR9A 1KCKA 3ZHDA 1IARB 4O2FA 5E4EC 5JORB 4OZHB 3HNSL 3MFGB 4G80A 4L9LB 3QPQD 2KH2B 5DHVB 1F6AA 3G6AA 4XNQB 1FCGA 1KTLB 4XVSL 4X4ZA 3QEUA 4NUJB 1CFVL 3OF6A 5FHBH 2DM3A 3Q5TA 5CCKH 2AXGB 4Y16C 4DKFL 1NANI 1WFTA 1Q1JH 4X5XA 1KEGH 2R4RH 2ADIB 5I74C 4MD0A 5D1XC 5I15L 5CFHA 4ZPTB 1IEBA 1DQLH 4MNHB 1DQJB 1IFHL 3JVGA 1CF8H 4I0CC 4IDJL 1LK2B 3NMEA 3QA3A 4IMLA 4JY4B 1VFUA 1V8HA 2DKMA 1MY7A 3TEUA 3VRJA 3G5YB 1G7IA 4OF0A 3SE9H 1S8DA 5I1KL 3EDJA 2YPVL 4N90E 4GXVL 2UWEB 3NTCL 2HKFH 2VE6B 1T0NA 5D7JB 3OAYK 4ZSOE 2QADC 2Y72A 2FIKA 2C3VB 4U1HA 5DD3H 5CD3A 1NCDL 1JNNL 3B6SA 1I85C 2AJXL 4XNZC 2BC4B 1YPZA 3SJVE 3CX5K 1T3FA 3O41B 4OFYD 3FCTA 3MRMB 4LHJB 4QRPB 1CFTA 3T0EC 4JG0L 4PRPB 4NP4L 3MLTA 2AJYH 5CKAA 5FYKU 3ZLQC 5A2LH 1FG9C 1EHNA 5E6IA 1MVUA 3ARFA 2A2QT 1I1YA 4ODTH 3BH8B 4DUVA 1NDMB 5JHLH 3MO1A 1TPXC 3WLBA 4C56B 3HZVB 4LCCB 2R4SH 1GRWA 3LRSB 1P7QB 4PRNB 4N9OB 4BFGA 2CJUH 3MV9B 2AABL 3ULSA 2E6PA 4U2YA 2VDRL 3TBTA 4OZGF 1OARL 5IB2B 1JHTB 2VSDA 1NC2D 2VWEC 2AK1H 2OZ4L 1ZGLP 1YZZA 5JO5A 4NKIH 2XG5A 3OKYA 5GRWA 3GRWA 1JWMB 5TDOA 3ZDYE 1ZVYA 4P5KB 1MHHA 4PGJA 4P46A 5CJBA 3WN5B 1MLCB 2V7NB 5SWSA 1A6VH 3FB5A 3QUKB 4YXHL 4I2XE 3ZL4L 2QR0A 4HUKB 5J57B 3NAAH 3QXDA 4M7JL 3U7WL 4TNVF 4EIZC 4NQDB 2KPNA 5DJ2B 4HAFA 5IVOA 1P7QD 3RZCC 1BFVL 5GRYA 2FX9L 5FYKE 4DOHE 1NMAL 3H8NA 2DYPD 3SO3B 2BVEA 1VB9A 4GG8B 4H20H 4B41A 3ZE0E 1T7YA 3MLPA 4C83B 4U6VH 4EDWH 2IH1A 2VDMH 1HXYB 1JNHB 4O9HL 1RZIA 5L7XL 4GBXD 4U1MA 1NEZB 3IXAA 1KJ2H 3CDFA 1G6RA 3ARBC 2Y6SC 4EZMA 4OQTL 4EXKA 4R7NA 4OGYH 4TUKH 3DUHA 4F9PC 1UKSA 4Y16B 3V5HB 1LDPH 1LILA 1K2DA 1IM3B 1A9BA 2NYYD 1SEBA 1HH9B 4KTEH 4ZTOH 5I74B 3KAAA 5ESQA 2A9NL 4QHNA 3KPNB 5KS9F 1MFDH 2MPAH 5DA4A 3NCBB 4H8WH 5GQBA 3BP4A 3RWGB 3CUPB 3Q0HA 5FGCB 3W5MA 2WLZA 1OCWL 1AHWC 4XCEB 5JOPD 1KUMA 3GSNB 2AJVL 4HS8H 1KG0A 4FTVA 1F90H 5IFAH 4HJGB 1D5XA 2FGZA 5JQ6H 4RBPK 3RIAF 3IDMA 1VKXA 4K9EC 4Z77B 5T3ZH 1QLRB 2EYSB 2H45A 1BJ8A 3VH8G 2XPGA 1YN6A 3HNVH 1JFQL 4MD5A 4RX4D 2Z31A 2V17L 3HZKB 3D2UD 2O5ZH 1R5IB 4QHMA 1N6VA 4Y16D 2DQHL 4Z7UF 2FJHA 2MWCA 1L7TL 1YY9C 1RHHA 3QRFM 3REVA 5D1XD 5FXCH 4TSAL 3GHEL 2MCPL 4JO1H 5ITBH 3LQAH 1KPVA 5HPMA 5C3TA 5HHXH 1S78C 4FQQB 1X5LA 3VXUB 5H8DA 4KTDH 3HPLA 3CXHJ 5AWNL 2C1OB 5EUOF 2D4FA 3DXAD 4G3YL 1AI1L 4S2SB 1A47A 3QRGL 4WU7A 3OZ9L 5HPOA 3BIKB 3C08H 2XWTB 1FVEB 1TPXB 1FFPA 4WY7H 1IC4H 2QADD 3WIHL 3BI9X 2IF7A 4PGCA 4S11A 3K1KC 3NCFB 4PG9B 1RMFL 3K80A 2YZ1A 2HT2C 1RZJC 3W9EA 4LLQA 1XGQB 3E8UL 5JW3L 2PTTB 4GQ9H 3F58H 1OB1B 2R2HB 4OM1H 4ZFZB 3WEXA 5GIRB 1XIWC 2WINA 2I60H 1TTFA 2IWGA 2G9HA 2BZDA 1AQKL 4XP9L 3T0ED 3HUJF 4LQFL 3ECBA 3VMNA 5FA4A 1HQRB 3HTLX 4BSWA 2XZCL 3GMOA 5SWQA 1NDGA 2UWEE 3ZMRA 4G7YL 1HXMB 5KANI 4KKLC 3HI1B 4Y4KA 5CHNA 1ZSDA 3BEVB 5EO9A 3ARUA 4OTXL 1HKFA 4PG2C 3DTXA 2VYRE 3FRPG 4XMPH 1NAMA 4LK4A 5DD5H 5JIPA 1JTOA 1LP9F 1QFUH 3DX7B 1FN4A 3N1QC 5DMYA 1U8KB 1EGJA 1ZHBB 2R9HC 4LVNB 3VFOB 2H41A 5BRZB 4GG6B 3T8XA 4QRPE 5EN2B 5IEHA 4S0TD 1G7HB 2CLVA 3MRKB 3CH8A 4OT1H 3G5VB 4KMTH 5GGUA 1JRHI 4ZSOA 2VLJB 2MQ3A 3HI5H 4JDZB 4NPYA 2PO6B 4UOW1 4QTIL 1I3UA 3NA4A 1S7SB 3SJVA 1U93B 1J1XL 1KB9J 4YDKL 4F7PB 4ELMF 4YDIL 4R4FH 4J3XA 1TMCB 4NDMB 3TIDA 4U3CA 4LEXL 4WVRA 4CW1B 4NM4H 3RZCD 1AGDB 3EYSL 1ORQA 3IJHB 5DRNA 3VGAB 2R0ZH 4Z78A 2BNRD 3GHBL 1JV5B 5HYJB 3CSPA 3WDIA 3LHPL 3O9WA 4HS6A 2HFGH 5HGAB 4GUPB 2OQJB 1BQHG 3ARBD 2Y6SD 5J1TC 1HHKB 3BPCB 3CDCA 1JVKA 2CIIA 4L1DA 3WUWG 1P53A 2VLJD 5F7HA 3V8OA 4V2CB 3KPTA 1TFHA 1CL7L 1J1PL 2AJUL 5DGRA 3ZYOA 4QCIA 1AR1C 3K8MA 1Q9LB 4K2UH 1GOFA 2V6HA 4HKJB 2V5SA 2VDNL 5JOPE 4NWTL 1A4JB 1KPUA 4JR9H 4M7LH 4WTXA 5J4MA 1SMAA 4PS4H 3ROOA 2YXFA 3GMLB 1S7TA 1U8LA 5F7YC 2Z0BA 1H3TA 3KR3L 2DQIH 2GJ6B 2WW8A 1D9KA 1GH7A 4I2XA 1C5CL 3I9GL 4NC0B 5DUPL 1QSFB 5HDQL 4JGUA 1TITA 4EUPB 4OI7A 1K6QL 3IDIB 2BP3A 1DL7L 2D03H 2CMRL 1JMZA 5BVPL 1J0IA 5HVHC 1FORH 2P8PA 3MFFB 3ARXA 1YY9D 3RA7H 5D93C 5GGTA 4XB8A 4JO2L 4TSBL 1INEL 2GFBB 4Q0XH 3NGBC 4KXZI 1R5VA 3WNMA 4N0FA 4ODSL 1BQLL 1QVOB 5FGCE 3FQXA 1DUZA 1YEHH 2K7PA 4LHUA 1S78D 2ICEB 2CO6B 4OLYL 5IBTL 5IVXF 2F19L 4V2BA 2A83B 3DXAE 4YGVA 1E28A 5DSCB 3VRLF 4LL9A 5SX4I 1IGJA 2ZNWA 5TDNB 3JXAA 2LU7A 3WNLA 5F70A 1W2KT 5T33L 3TESA 1YUHB 3E2HC 3MJ6A 5F8RC 4TNWK 1HOCA 1S7QB 1AY1H 2OP4H 5M94B 4AJ0A 3K7UA 4PJBA 5F7WC 3ZO0A 5IK3A 4KRNA 4Y1AD 5J89A 1JJUA 5D7SH 3VFNB 1LGVA 1UKQA 2HT2D 1JN6B 3VFGH 2BHUA 2KZWA 1XIWD 3T0EE 1PW3A 3VXUE 3W11C 3GSWB 3AREC 7FABH 2IADB 3MLXH 1BOGA 3JV4B 3KYKH 4K3DH 5GRUL 3DI2B 1J5OL 4GW1A 2Z93A 1PZ5A 3P0VL 3MUGB 4XBEH 4KKLD 3STLA