1BRFA

Rubredoxin (wild type) from pyrococcus furiosus
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
53
Chain Sequence
AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RUBREDOXIN)
publication title Crystal Structure of Rubredoxin from Pyrococcus Furiosus at 0.95 Angstroms Resolution, and the structures of N-terminal methionine and formylmethionine variants of Pf Rd. Contributions of N-terminal interactions to thermostability
pubmed rcsb
molecule tags Electron transport
total genus 9
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1998-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1brfA00
3MPSA 2GMGA 2PVEA 1R0IA 1ZRPA 2VL6A 1FHMA 1B13A 1IU5A 1SMWA 1RDGA 1CADA 1YK5A 4RXNA 1R0HA 4POFA 3RYGA 2DSXA 4YWMA 6RXNA 2RDVA 1C09A 1SMUA 4AR6A 1IRNA 2MS3A 1RDVA 2QL0A 2PVXA 3KYVA 8RXNA 1CAAA 3A44A 4TPUA 3KYXA 2KKDA 4AR4A 1R0FA 5IY0A 1YUZA 1B71A 1R0GA 1T9OA 2KN9A 1YUXA 1S2ZA 2PYAA 1LKOA 1T9PA 5AI2A 1BQ9A 1YV1A 3KYYA 4YWLA 1E8JA 5RXNA 1QCVA 1BE7A 3KYUA 1H7VA 2LCQA 3SS2A 2K2DA 3RZTA 1BFYA 4AR3A 1IROA 4POGA 3KYWA 1YK4A 3PWFA 4ME3A 7RXNA 3RZ6A 5AI3A 4AR5A 1BQ8A 1RWDA 1LTLA 1QYBA 1NNQA 4K9FA 1JYBA 1IU6A 3PZAA 1FHHA 1VCXA 1SMMA 1DVBA 1R0JA 1LKPA 1S30A 1LKMA 1RYTA 3QVDA 1S24A 1DX8A 1T9QA 1BRFA 1B2JA 1RB9A 2HR5A 1B2OA 2V3BB 2M4YA
chains in the Genus database with same CATH superfamily
3S17L 5EIOC 3S16L 4XXBB 4ZN1B 3S2HL 1IU5A 2XJSA 5C44L 1YK5A 3HOXL 3H9CA 1R0HA 4POFA 1TWCL 3GTJL 4TVMA 3LWQB 3S1ML 2MS3A 4AHZA 4AHWA 2ZIXA 3GTML 3KYVA 3HOVL 5JVH1 5M5XL 4BY7L 3M3YL 1SFOL 1T9OA 2A68D 2C6AA 1PFUA 2PYAA 2BE5D 5M5YL 2CKAA 4AI2A 3S15L 1OWCA 2HVYC 2PSMC 1NXEA 4QIWP 2R92L 1PZXA 4BBSL 1BE7A 3KYUA 4A3IL 4AI0A 2LCQA 3WWLA 2K2DA 2EY4E 3S2DL 3GTQL 3LWRB 4AR3A 1IROA 5M5WL 4LHNA 4UY81 2M4VA 3PWFA 3NFPI 3I4NL 4A3CL 2A69D 2CR8A 3HOUL 1I50L 5FLML 1VZHA 3GTPL 3PKJA 1ODHA 3HOZL 1LKPA 1S30A 2NVQL 1Y1VL 1BRFA 2H12A 5MLC3 2JA8L 3I4ML 4A3LL 2M4YA 3FKIL 3MPSA 5M3ML 5GAEc 1R0IA 2VUML 3LNLA 1WJVA 3MQKB 1CADA 1VZGA 3FDJA 1F4LA 4RXNA 1OWBA 3HOYL 4GS7D 2Z3QB 3J7Y1 1SMUA 1Y1WL 1IRNA 1RDVA 5GADc 4AHXA 3S1NL 1CAAA 2L0ZA 3A44A 5MFPA 4A3GL 5IY0A 1YUZA 1B71A 3WWNB 1QQTA 1PFWA 2M6OA 2NVTL 1T9PA 2V0EA 2XJUA 5AN9H 4JAGA 3CQZL 2E2HL 5FJ8L 1BQ9A 4JAFA 1YV1A 2A6HD 4A3KL 4BY1L 1P7PA 2R93L 2B5ID 2R7ZL 3SS2A 5GAGc 1WCML 3RZTA 2YU9L 1BFYA 2JI3A 2NVYL 3IU3I 3KYWA 2AQCA 4ME3A 3RZ6A 4G6BA 4AR5A 3VPBE 3J7Z1 1LTLA 3LPEB 3S1RL 4K9FA 4V196 5H1Sc 3B08B 1RYQA 1VCXA 1LKMA 2O5JD 1I3QL 1DX8A 3H97A 4A3ML 5GAHc 2NYDA 4AHYA 3M4OL 1Z92B 2PVEA 1ZRPA 2VL6A 1B13A 3PO2L 1SMWA 3S14L 3LWVB 3JR7A 2Z3RB 2RDVA 1C09A 5IYCL 4AR6A 5MGNA 3PIP1 1TWGL 1TWHL 1PFYA 2QL0A 1TWAL 3LWPB 2PVXA 8RXNA 2PPTA 2PMZP 4TPUA 4BXXL 4AR4A 3S1QL 3HAXC 4A3FL 1R0GA 2J9UB 3HJWB 4JAEA 2XJRA 3H0GL 5AI2A 1R9TL 3RZDL 2WB1P 5C4JL 4B8CD 2XJVA 3KYYA 5RXNA 1QCVA 5IYBL 2CKCA 5DM61 5DM71 2A6ED 5IYDL 2XJPA 1IW7D 3PO3L 4POGA 1NXGA 2JA7L 1VZIA 3P8BA 4BBRL 2AUSB 1PFVA 5C3EL 1BQ8A 1RWDA 4A3DL 3PL5A 4A3JL 5M3FL 3ZG6A 4WFN1 1NNQA 5K2ME 2C6BA 3H99A 2NVXL 3PZAA 1DVBA 1R0JA 4AYBP 3QVDA 1S24A 1B2JA 2APOB 1RB9A 4C2M1 3H3VM 4JADA 2JA6L 1B2OA 2Y0SP 2V3BB 3GTKL 2GMGA 1FHMA 5MF6A 1RDGA 5IP7L 2B63L 2RFKB 4C3IL 3PKIA 4Y52L 3HKZP 3RYGA 4C3HL 2DSXA 4A3EL 4YWMA 6RXNA 3RZOL 4Y7NL 5JVG1 3MSUA 3KYXA 5EINC 2KKDA 2JA5L 1R0FA 4E6YA 1TWFL 2KN9A 1YUXA 1S2ZA 1LKOA 2ERSA 3B0AB 3P2AA 3K35A 4ZN3B 3LWOB 2E2JL 3GTGL 4A93L 4LHLA 3K7AL 3GTLL 4AI3A 4YWLA 1E8JA 2JI1A 4XGHA 1H7VA 3QQCE 2XJTA 3PIO1 4U671 2JI2A 4AI1A 2M6PA 2V0FA 3GTOL 5MFZA 5IP9L 1YK4A 7RXNA 1I6HL 5AI3A 3HOWL 5C4XL 4C3JL 2ERJA 2WAQP 1QYBA 1JYBA 1IU6A 4A3BL 1FHHA 1SMMA 2XJQA 3H9BA 2E2IL 1K83L 1RYTA 1T9QA 4X6AL 3HJYB 2HR5A 2AYJA
chains in the Genus database with same CATH topology
3MPSA 2NYDA 4AHYA 5GAEc 1Z92B 2GMGA 2PVEA 1R0IA 1ZRPA 5EIOC 2VL6A 4XXBB 1FHMA 5MF6A 1B13A 3LNLA 1WJVA 4ZN1B 1IU5A 1SMWA 1RDGA 1CADA 1VZGA 2XJSA 1YK5A 3PKIA 4RXNA 1OWBA 1R0HA 4POFA 3RYGA 2DSXA 4GS7D 2Z3QB 2Z3RB 4YWMA 6RXNA 2RDVA 1C09A 4TVMA 3J7Y1 1SMUA 4AR6A 5MGNA 3PIP1 1IRNA 5JVG1 2MS3A 1RDVA 4AHZA 2QL0A 4AHWA 2ZIXA 2PVXA 5GADc 3KYVA 4AHXA 8RXNA 2PPTA 1CAAA 2L0ZA 3A44A 3MSUA 5MFPA 5JVH1 4TPUA 3KYXA 5EINC 2KKDA 4AR4A 1R0FA 4E6YA 5IY0A 1YUZA 1B71A 3WWNB 1R0GA 2J9UB 1T9OA 2A68D 2C6AA 2KN9A 4JAEA 2M6OA 1YUXA 1S2ZA 2PYAA 1LKOA 2ERSA 3B0AB 2XJRA 3P2AA 3K35A 1T9PA 2BE5D 2V0EA 4ZN3B 2XJUA 5AI2A 2CKAA 4AI2A 5AN9H 4JAGA 1OWCA 4LHLA 2PSMC 4B8CD 1NXEA 1BQ9A 4AI3A 4JAFA 1YV1A 2A6HD 2XJVA 3KYYA 4YWLA 1E8JA 5RXNA 2JI1A 1QCVA 1BE7A 2B5ID 3KYUA 4XGHA 1H7VA 4AI0A 3QQCE 2LCQA 2XJTA 3PIO1 2CKCA 5DM61 5DM71 4U671 3SS2A 2JI2A 3WWLA 2K2DA 2A6ED 4AI1A 5GAGc 3RZTA 2M6PA 2XJPA 2V0FA 1BFYA 4AR3A 1IW7D 2JI3A 1IROA 4POGA 1NXGA 4LHNA 5MFZA 3IU3I 1VZIA 3KYWA 4UY81 2M4VA 1YK4A 3PWFA 3P8BA 4ME3A 7RXNA 3NFPI 3RZ6A 4G6BA 5AI3A 4AR5A 1BQ8A 1RWDA 2A69D 3VPBE 3J7Z1 2ERJA 2CR8A 1LTLA 1QYBA 3LPEB 3ZG6A 4WFN1 1NNQA 5K2ME 2C6BA 1VZHA 4K9FA 3PKJA 1JYBA 5H1Sc 4V196 1IU6A 3B08B 1RYQA 1FHHA 1VCXA 1SMMA 3PZAA 1ODHA 1DVBA 1R0JA 2XJQA 1LKPA 1S30A 1LKMA 2O5JD 1RYTA 3QVDA 1S24A 1DX8A 1T9QA 1BRFA 1B2JA 1RB9A 2H12A 5MLC3 2HR5A 4JADA 5GAHc 2AYJA 1B2OA 2V3BB 2M4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MPS A;  2GMG A;  2PVE A;  1R0I A;  1ZRP A;  2VL6 A;  1FHM A;  1B13 A;  1IU5 A;  1SMW A;  1RDG A;  1CAD A;  1YK5 A;  4RXN A;  1R0H A;  4POF A;  3RYG A;  2DSX A;  4YWM A;  6RXN A;  2RDV A;  1C09 A;  1SMU A;  4AR6 A;  1IRN A;  2MS3 A;  1RDV A;  2QL0 A;  2PVX A;  3KYV A;  8RXN A;  1CAA A;  3A44 A;  4TPU A;  3KYX A;  2KKD A;  4AR4 A;  1R0F A;  5IY0 A;  1YUZ A;  1B71 A;  1R0G A;  1T9O A;  2KN9 A;  1YUX A;  1S2Z A;  2PYA A;  1LKO A;  1T9P A;  5AI2 A;  1BQ9 A;  1YV1 A;  3KYY A;  4YWL A;  1E8J A;  5RXN A;  1QCV A;  1BE7 A;  3KYU A;  1H7V A;  2LCQ A;  3SS2 A;  2K2D A;  3RZT A;  1BFY A;  4AR3 A;  1IRO A;  4POG A;  3KYW A;  1YK4 A;  3PWF A;  4ME3 A;  7RXN A;  3RZ6 A;  5AI3 A;  4AR5 A;  1BQ8 A;  1RWD A;  1LTL A;  1QYB A;  1NNQ A;  4K9F A;  1JYB A;  1IU6 A;  3PZA A;  1FHH A;  1VCX A;  1SMM A;  1DVB A;  1R0J A;  1LKP A;  1S30 A;  1LKM A;  1RYT A;  3QVD A;  1S24 A;  1DX8 A;  1T9Q A;  1BRF A;  1B2J A;  1RB9 A;  2HR5 A;  1B2O A;  2V3B B;  2M4Y A; 
#chains in the Genus database with same CATH topology
 3S17 L;  5EIO C;  3S16 L;  4XXB B;  4ZN1 B;  3S2H L;  1IU5 A;  2XJS A;  5C44 L;  1YK5 A;  3HOX L;  3H9C A;  1R0H A;  4POF A;  1TWC L;  3GTJ L;  4TVM A;  3LWQ B;  3S1M L;  2MS3 A;  4AHZ A;  4AHW A;  2ZIX A;  3GTM L;  3KYV A;  3HOV L;  5JVH 1;  5M5X L;  4BY7 L;  3M3Y L;  1SFO L;  1T9O A;  2A68 D;  2C6A A;  1PFU A;  2PYA A;  2BE5 D;  5M5Y L;  2CKA A;  4AI2 A;  3S15 L;  1OWC A;  2HVY C;  2PSM C;  1NXE A;  4QIW P;  2R92 L;  1PZX A;  4BBS L;  1BE7 A;  3KYU A;  4A3I L;  4AI0 A;  2LCQ A;  3WWL A;  2K2D A;  2EY4 E;  3S2D L;  3GTQ L;  3LWR B;  4AR3 A;  1IRO A;  5M5W L;  4LHN A;  4UY8 1;  2M4V A;  3PWF A;  3NFP I;  3I4N L;  4A3C L;  2A69 D;  2CR8 A;  3HOU L;  1I50 L;  5FLM L;  1VZH A;  3GTP L;  3PKJ A;  1ODH A;  3HOZ L;  1LKP A;  1S30 A;  2NVQ L;  1Y1V L;  1BRF A;  2H12 A;  5MLC 3;  2JA8 L;  3I4M L;  4A3L L;  2M4Y A;  3FKI L;  3MPS A;  5M3M L;  5GAE c;  1R0I A;  2VUM L;  3LNL A;  1WJV A;  3MQK B;  1CAD A;  1VZG A;  3FDJ A;  1F4L A;  4RXN A;  1OWB A;  3HOY L;  4GS7 D;  2Z3Q B;  3J7Y 1;  1SMU A;  1Y1W L;  1IRN A;  1RDV A;  5GAD c;  4AHX A;  3S1N L;  1CAA A;  2L0Z A;  3A44 A;  5MFP A;  4A3G L;  5IY0 A;  1YUZ A;  1B71 A;  3WWN B;  1QQT A;  1PFW A;  2M6O A;  2NVT L;  1T9P A;  2V0E A;  2XJU A;  5AN9 H;  4JAG A;  3CQZ L;  2E2H L;  5FJ8 L;  1BQ9 A;  4JAF A;  1YV1 A;  2A6H D;  4A3K L;  4BY1 L;  1P7P A;  2R93 L;  2B5I D;  2R7Z L;  3SS2 A;  5GAG c;  1WCM L;  3RZT A;  2YU9 L;  1BFY A;  2JI3 A;  2NVY L;  3IU3 I;  3KYW A;  2AQC A;  4ME3 A;  3RZ6 A;  4G6B A;  4AR5 A;  3VPB E;  3J7Z 1;  1LTL A;  3LPE B;  3S1R L;  4K9F A;  4V19 6;  5H1S c;  3B08 B;  1RYQ A;  1VCX A;  1LKM A;  2O5J D;  1I3Q L;  1DX8 A;  3H97 A;  4A3M L;  5GAH c;  2NYD A;  4AHY A;  3M4O L;  1Z92 B;  2PVE A;  1ZRP A;  2VL6 A;  1B13 A;  3PO2 L;  1SMW A;  3S14 L;  3LWV B;  3JR7 A;  2Z3R B;  2RDV A;  1C09 A;  5IYC L;  4AR6 A;  5MGN A;  3PIP 1;  1TWG L;  1TWH L;  1PFY A;  2QL0 A;  1TWA L;  3LWP B;  2PVX A;  8RXN A;  2PPT A;  2PMZ P;  4TPU A;  4BXX L;  4AR4 A;  3S1Q L;  3HAX C;  4A3F L;  1R0G A;  2J9U B;  3HJW B;  4JAE A;  2XJR A;  3H0G L;  5AI2 A;  1R9T L;  3RZD L;  2WB1 P;  5C4J L;  4B8C D;  2XJV A;  3KYY A;  5RXN A;  1QCV A;  5IYB L;  2CKC A;  5DM6 1;  5DM7 1;  2A6E D;  5IYD L;  2XJP A;  1IW7 D;  3PO3 L;  4POG A;  1NXG A;  2JA7 L;  1VZI A;  3P8B A;  4BBR L;  2AUS B;  1PFV A;  5C3E L;  1BQ8 A;  1RWD A;  4A3D L;  3PL5 A;  4A3J L;  5M3F L;  3ZG6 A;  4WFN 1;  1NNQ A;  5K2M E;  2C6B A;  3H99 A;  2NVX L;  3PZA A;  1DVB A;  1R0J A;  4AYB P;  3QVD A;  1S24 A;  1B2J A;  2APO B;  1RB9 A;  4C2M 1;  3H3V M;  4JAD A;  2JA6 L;  1B2O A;  2Y0S P;  2V3B B;  3GTK L;  2GMG A;  1FHM A;  5MF6 A;  1RDG A;  5IP7 L;  2B63 L;  2RFK B;  4C3I L;  3PKI A;  4Y52 L;  3HKZ P;  3RYG A;  4C3H L;  2DSX A;  4A3E L;  4YWM A;  6RXN A;  3RZO L;  4Y7N L;  5JVG 1;  3MSU A;  3KYX A;  5EIN C;  2KKD A;  2JA5 L;  1R0F A;  4E6Y A;  1TWF L;  2KN9 A;  1YUX A;  1S2Z A;  1LKO A;  2ERS A;  3B0A B;  3P2A A;  3K35 A;  4ZN3 B;  3LWO B;  2E2J L;  3GTG L;  4A93 L;  4LHL A;  3K7A L;  3GTL L;  4AI3 A;  4YWL A;  1E8J A;  2JI1 A;  4XGH A;  1H7V A;  3QQC E;  2XJT A;  3PIO 1;  4U67 1;  2JI2 A;  4AI1 A;  2M6P A;  2V0F A;  3GTO L;  5MFZ A;  5IP9 L;  1YK4 A;  7RXN A;  1I6H L;  5AI3 A;  3HOW L;  5C4X L;  4C3J L;  2ERJ A;  2WAQ P;  1QYB A;  1JYB A;  1IU6 A;  4A3B L;  1FHH A;  1SMM A;  2XJQ A;  3H9B A;  2E2I L;  1K83 L;  1RYT A;  1T9Q A;  4X6A L;  3HJY B;  2HR5 A;  2AYJ A; 
#chains in the Genus database with same CATH homology
 3MPS A;  2NYD A;  4AHY A;  5GAE c;  1Z92 B;  2GMG A;  2PVE A;  1R0I A;  1ZRP A;  5EIO C;  2VL6 A;  4XXB B;  1FHM A;  5MF6 A;  1B13 A;  3LNL A;  1WJV A;  4ZN1 B;  1IU5 A;  1SMW A;  1RDG A;  1CAD A;  1VZG A;  2XJS A;  1YK5 A;  3PKI A;  4RXN A;  1OWB A;  1R0H A;  4POF A;  3RYG A;  2DSX A;  4GS7 D;  2Z3Q B;  2Z3R B;  4YWM A;  6RXN A;  2RDV A;  1C09 A;  4TVM A;  3J7Y 1;  1SMU A;  4AR6 A;  5MGN A;  3PIP 1;  1IRN A;  5JVG 1;  2MS3 A;  1RDV A;  4AHZ A;  2QL0 A;  4AHW A;  2ZIX A;  2PVX A;  5GAD c;  3KYV A;  4AHX A;  8RXN A;  2PPT A;  1CAA A;  2L0Z A;  3A44 A;  3MSU A;  5MFP A;  5JVH 1;  4TPU A;  3KYX A;  5EIN C;  2KKD A;  4AR4 A;  1R0F A;  4E6Y A;  5IY0 A;  1YUZ A;  1B71 A;  3WWN B;  1R0G A;  2J9U B;  1T9O A;  2A68 D;  2C6A A;  2KN9 A;  4JAE A;  2M6O A;  1YUX A;  1S2Z A;  2PYA A;  1LKO A;  2ERS A;  3B0A B;  2XJR A;  3P2A A;  3K35 A;  1T9P A;  2BE5 D;  2V0E A;  4ZN3 B;  2XJU A;  5AI2 A;  2CKA A;  4AI2 A;  5AN9 H;  4JAG A;  1OWC A;  4LHL A;  2PSM C;  4B8C D;  1NXE A;  1BQ9 A;  4AI3 A;  4JAF A;  1YV1 A;  2A6H D;  2XJV A;  3KYY A;  4YWL A;  1E8J A;  5RXN A;  2JI1 A;  1QCV A;  1BE7 A;  2B5I D;  3KYU A;  4XGH A;  1H7V A;  4AI0 A;  3QQC E;  2LCQ A;  2XJT A;  3PIO 1;  2CKC A;  5DM6 1;  5DM7 1;  4U67 1;  3SS2 A;  2JI2 A;  3WWL A;  2K2D A;  2A6E D;  4AI1 A;  5GAG c;  3RZT A;  2M6P A;  2XJP A;  2V0F A;  1BFY A;  4AR3 A;  1IW7 D;  2JI3 A;  1IRO A;  4POG A;  1NXG A;  4LHN A;  5MFZ A;  3IU3 I;  1VZI A;  3KYW A;  4UY8 1;  2M4V A;  1YK4 A;  3PWF A;  3P8B A;  4ME3 A;  7RXN A;  3NFP I;  3RZ6 A;  4G6B A;  5AI3 A;  4AR5 A;  1BQ8 A;  1RWD A;  2A69 D;  3VPB E;  3J7Z 1;  2ERJ A;  2CR8 A;  1LTL A;  1QYB A;  3LPE B;  3ZG6 A;  4WFN 1;  1NNQ A;  5K2M E;  2C6B A;  1VZH A;  4K9F A;  3PKJ A;  1JYB A;  5H1S c;  4V19 6;  1IU6 A;  3B08 B;  1RYQ A;  1FHH A;  1VCX A;  1SMM A;  3PZA A;  1ODH A;  1DVB A;  1R0J A;  2XJQ A;  1LKP A;  1S30 A;  1LKM A;  2O5J D;  1RYT A;  3QVD A;  1S24 A;  1DX8 A;  1T9Q A;  1BRF A;  1B2J A;  1RB9 A;  2H12 A;  5MLC 3;  2HR5 A;  4JAD A;  5GAH c;  2AYJ A;  1B2O A;  2V3B B;  2M4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...