1BRGA

Crystallographic analysis of phe->leu substitution in the hydrophobic core of barnase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
VINTLDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of Phe-->Leu substitution in the hydrophobic core of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 28
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1994-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brgA00
1BRHA 1GSPA 1BRJA 1RN4A 1AQZA 1RGAA 1RTUA 1RGFA 3DH2A 2C4BA 1B2XA 1BRSA 1BNSA 1BANA 1I0VA 1X1XA 1B3SA 1FUTA 1FYSA 3D5GA 1BSDA 2KF3A 1B20A 1BUJA 1RDSA 1I2EA 3WR2A 1B2ZA 1UCIA 2KAAA 1UCJA 1B2UA 2F5WA 3D5IA 3SYUA 5RNTA 1RN1A 1C54A 1LOYA 3GSPA 1TTOA 1RGKA 1I2GA 1AY7A 1YVSA 3BIRA 1DETA 1GOUA 1RGLA 1IYYA 1BNEA 1YGWA 4BU4A 1RGEA 5HOHA 2BIRA 1GMRA 1BRKA 1ZGXA 1TRPA 3AHWA 1X1UA 1I8VA 5GSPA 1RLSA 1BRNL 1FZUA 1DE3A 4GSPA 1BRGA 1GOYA 1RHLA 3RNTA 1I3FA 2RNTA 9RNTA 1PY3A 1BNGA 1BRIA 3A5EA 1LOVA 3BU4A 3WHOA 1I70A 2AAEA 1BIRA 1T2IA 1BSCA 1RSNA 1JBSA 1PYLA 2RBIA 3D4AA 1JBTA 2HOHA 8RNTA 1Q9EA 1B21A 2KF5A 3AHSA 3AGNA 1FUSA 1GOVA 1BNFA 3Q3FA 6RNTA 2F5MA 4J5KA 2AADA 4HOHA 1LOWA 4J5GA 1BVIA 1B27A 1GMQA 1UCKA 1BSEA 1HYFA 1G02A 1RNTA 1SARA 2F4YA 1FW7A 3HOHA 5BIRA 1HZ1A 1JBRA 1MGRA 3KCHA 1GMPA 1T2HA 1I0XA 2BU4A 1BGSA 1BSAA 1UCLA 1BSBA 1LNIA 2KF4A 1B2SA 2SARA 2ZA4A 1I2FA 1YNVX 1X1WA 3AGOA 4RNTA 1B2MA 4HAAA 1TRQA 1BNJA 6GSPA 2F56A 5BU4A 1R4YA 2GSPA 1RMSA 1RGHA 2KF6A 7GSPA 1X1YA 1RCKA 3URPA 1BNIA 1LRAA 1BAOA 1RGGA 1I3IA 1MGWA 1CH0A 1RGCA 3DGYA 4GHOA 1BOXA 7RNTA 1RNBA 1BNRA 1A2PA 1RCLA 4BIRA 1BU4A
chains in the Genus database with same CATH superfamily
1IV9A 1KC84 3EN8A 3M8CA 3F7SA 1IT7A 2Z76A 4FMCA 5IG3A 3UL5A 1OHOA 1OF5B 1W7CA 2ML5A 3KIIA 1I0VA 1QAFA 1BANA 3UL6A 3X42A 1YVBI 2W04A 3D5GA 2OTL3 5JBSA 1LQGC 5FW5A 1I2EA 2Z6BA 1FA3A 1B2ZA 1QAKA 3WA3A 4RZMA 2F99A 4MEIA 4R9KA 2PZVA 3I553 2F5WA 1Q814 3HX8A 1A67A 1FGOA 1RN1A 1LXEA 2RCDA 3F40A 4GL6A 4EBGA 4EV5A 3LOYA 2XR8B 1FGQA 2OWPA 3LTDA 1JJ22 1I2GA 2RGQA 5JPUA 1EEJA 1YVSA 1DETA 2E2VA 4HM0B 5AEUB 5JPPA 3Q90A 2W03A 3CNXA 1NWWA 4AEQA 2OTJ3 1YGWA 2K3DA 1Q42A 4LSOA 4N6OB 3DXOA 3ZFZA 1KSIA 2BIRA 3EC9A 4N6NB 4R9LA 2CH9A 1VQN3 3AHWA 1RJOA 4NHFA 3WOEB 1RLSA 1BRNL 2CG1A 3LH4A 1TUHA 2LQVA 4KFFA 2V1LA 2GU3A 4CCVA 4XDWA 1W6GA 5CLKA 3BNBA 9RNTA 1OGZA 2HMMB 5M1AA 3KKGA 4MMXB 2M7OA 3A5EA 1JB5A 1LOVA 1OACA 2CKFB 3MKIA 3S28A 1HU9A 1K41A 3FG3A 1BSCA 1AVKA 1JBSA 2RBIA 1JBTA 4WYKB 3G713 8RNTA 2BMQB 3JVCA 1M904 2P38A 3NHXA 2CW9A 1WQLB 1A2KA 1BNFA 2QGUA 3EX9A 4J5KA 1F8NA 1W2ZA 3F14A 1GYBA 3IPTA 2XSOB 3LYGA 1UI7A 1MOLA 2CHCA 1HKXA 1UUGB 3LT9A 4FCZA 5A0OB 3BNCA 1VQ83 1EG9B 3DZLA 3X41A 1E3VA 1FUWA 2R41A 2SBLA 2F4YA 3PZWA 3OWUA 1Q40B 2ZDJA 3ZG0A 1LQMB 1W4NA 3LTCA 1IVUA 4LGQA 1DMMA 1JZOA 4WWUC 4AKZA 1FGMA 4XBYA 3EF8A 2XRXB 3V98A 4RNYA 1T2HA 3CME3 1N9EA 1BGSA 2L4VA 5ELJA 1NB5I 3B8LA 2W56A 2QEX3 3WODG 1QVF2 3LTBA 1SIIA 1R4CA 2ZL8A 3G8ZA 2XFTA 2SARA 4DKIA 1Q824 1OF5A 2ZA4A 2HMJB 3MPHA 1YNVX 3AGOA 4RNTA 3D9RA 3KE7A 4GB5A 3X40A 2F56A 2P05A 3JUQA 1NNVA 2GXFA 2YFLB 1RMSA 5EQLA 4CPKA 1M9GA 1K28A 1SPUA 1MNLA 4ZM8A 2OOVA 5IF6A 3LMLA 1IVVA 2CWVA 3ALAA 3URPA 2CFWA 1RN7A 2W2CA 3X3XA 1LRAA 3DGYA 1RGGA 3G4S3 3NBBA 1BOXA 3IMAB 1RCLA 3CMA3 1QMAA 1BU4A 1EUIC 2W56B 4BIRA 3FLJA 1BRHA 1GSPA 3PYJA 3QRDA 4L8OA 5IERA 3JUPA 1AQZA 1RGAA 2IUKA 3BB9A 1RKYA 1TU5A 2GU1A 2WOFA 2C4BA 1EKMA 1W6YA 2CFKA 3TDGA 1RRLA 2C10A 1BRSA 1BNSA 1X1XA 5D82A 4N6LA 3SVAA 1IQ8A 1FYSA 1LOXA 1UDII 2JQ5A 2P09A 1MWRA 5ELUA 2QIYA 5IG0A 4BTWA 1VQM3 3MG2A 1BUJA 1RDSA 3OV4A 1AVLA 1OCVA 2BNGA 3BLZA 3DM8A 3GZYB 3NBJA 1IU7A 2RSXA 4O8SA 2BT3A 4WP5A 4TX4A 1PU4A 1STDA 4HM6B 4HM3B 3D5IA 3OW22 1JNQA 4R80A 1C54A 2H0GA 3ER7A 1MWTA 3LTAA 1W02A 2MC8A 1EQKA 4KVHA 1SIHA 2XF3A 1OHSA 2BHMA 1RGLA 3BNEA 3F7XA 1V58A 3H3HA 2IYJA 1VQK3 1AR0A 1BNEA 4JRFA 4BU4A 4U13A 1WMOA 1WTHA 1Q864 3NXJA 2OQEA 1ZGXA 2YFJB 1A90A 1I8VA 3T8UA 2CWTA 5EEOA 4FR9A 2CX0A 3J7Yd 3QK9A 4N6UA 3VGNA 1STFI 1M1XB 4FCJA 1W5ZA 1BRGA 1GOYA 1RHLA 4XBTA 1US1A 3JUOA 3S67A 1CYUA 1BNGA 1TFOA 4HZ9B 3WHOA 2PNCA 1ZX2A 3NM7A 1Q40A 1N9JA 3FCSB 3NM2A 2LYXA 1ROVA 1PYLA 3ECFA 1LNHA 1N8R4 1OGXA 1Q9EA 6STDA 3FKAA 3HK4A 1TP6A 3EHCA 2KF5A 3MSOA 3AGNA 1GOVA 1TFKA 2HMKB 1IV7A 1UGHI 4O02B 5G2GA 3T0UA 2WGOA 5BXQA 1D6ZA 4J5GA 4K1VA 2INXA 1N5HA 3K7CA 1B27A 3PXMA 1IVWA 1Y4KA 3GZXB 2W9QA 2RFRA 5AIGA 3B4PA 1JN5A 3HOHA 2A15A 5BIRA 1GS3A 3PCRA 1N8QA 1HZ1A 1JBRA 2IA7A 3KCHA 3ROBA 2WGQA 5AYSC 2Y74A 1YGEA 2IMJA 1I0XA 1UUWB 1U5OA 1PFPA 2R4IA 3CC23 4FMBA 3FGYA 2YX9A 1JV2B 2F86B 1V57A 1ULJB 4KFDA 1L5GB 1B2MA 5IEPA 6GSPA 5BU4A 4CJNA 8CHOA 1R4YA 4HM8B 4HBRA 2D42A 3UNLA 4PEJA 1W6CA 2OCTA 2KF6A 2P0XA 3K9MC 2XH9A 3NV0B 1VQ73 1X1YA 1RCKA 4OK0A 1GD4A 3F9SA 3S27A 1JN5B 4FMDA 2ML6A 2IUJA 1I3IA 3STDA 1RGCA 3UB1A 3U1WA 7RNTA 5FGOA 3LXUX 1RNBA 2FGTA 1JKGA 5AIHA 2ZHXB 3CU3A 3X3YA 1YHQ3 3I0YA 4L7KA 1RGFA 2L1SA 3F8HA 3KSPA 3S5CA 2OOVC 4LMIA 2I9WA 3B7CA 3FSDA 1GY6A 1OH0A 2OQEC 3FF0A 5D83A 5IG5A 3CCL3 3L0RA 3O8YA 3CCR3 5CF2A 4MMZB 3FG1A 2K0MA 2KF3A 2MF7A 5IENA 1ISKA 2CC3A 1W01A 3WR2A 1IQYA 1TIJA 1D6YA 1K734 1ZO2A 1FGTA 5RNTA 2H0IA 1Z1SA 3AMOB 3NQYA 3CCV3 1TTOA 4HZBB 2FXTA 2Q07A 4EC6A 3KN4A 2E2TA 3BIRA 1GOUA 1Q7HA 2BMOB 3X3ZA 1J2BA 3MWZA 7STDA 4MJDA 3GZBA 4WFOA 1IYYA 1OUNA 3WA2X 1CQSA 1AV4A 3EBYA 2K54A 3BNDA 3DGOA 1X1UA 1E3RA 4HM5B 4K1UA 1O7WB 1UW1A 2GEXA 4BTYA 1S5AA 1FZUA 4EXRA 3FH1A 5CXOA 2Y73A 1JRQA 2H0HA 3N54B 1YIT3 3DUKA 1K9M4 2D1WA 3RNTA 1MWSA 1I3FA 1QVG2 1BRIA 1W00A 5BVBA 1ROAA 3NUVA 4HM4B 4I4KA 1BIRA 3K0ZA 2BMRB 2W0QA 4OUQA 1T2IA 1G0TA 4XBXA 2B24B 3D4AA 4BL2A 4EV2A 1YJW3 1K8A4 1O7GB 1GY5A 3A76A 1FUSA 2JDIH 3GAXA 3G6E3 5LC6A 1VQ53 3Q2PA 3K63A 3DY5A 6RNTA 3GWRA 1DVDA 4XDVA 1T3BA 3KSED 2AADA 4HM2B 4NREA 4HVNA 1CYVA 2O3OA 1BVIA 1UCKA 1GMQA 1E97A 3EE1A 3N9HA 2KXGA 2STDA 2Z77A 3E99A 3RDEA 1DYUA 1HYFA 3T8NA 1SARA 4EYCA 1NO3A 3SXXA 2KCDA 1FW7A 5AI1A 4IT7A 3HI7A 1NJI4 4HKVB 1UUVB 3LZAA 1MGRA 5IG4A 4RBNA 2BU4A 1VQL3 3CCE3 3CCJ3 2YFIB 3EQQB 1BSAA 1D6UA 3LT8A 2XGLA 4X2OA 1UCLA 3MG1A 4H3UA 1VQP3 3V92A 1VQQA 1IVXA 4J8TA 1VQO3 4HM1B 2UX0A 1DVCA 1X1WA 4NPBA 5M18A 4HAAA 1TRQA 4H61A 1A2VA 1BNJA 1BUQA 1NU3A 4JF8A 4LZIA 5G1KA 1YJ93 1JKGB 1JB2A 3S29A 2GBXB 2XEPA 4X2HA 2B1XB 1RGHA 2IY2A 1LVNA 1CEWI 1SJWA 7GSPA 4ORLA 4O3VA 5IW9A 1VQ63 3NBRA 2CFLA 4MMYB 4KFEA 4N6TA 1WNHA 1BAOA 4EW5A 3FG4A 1CH0A 3GRDA 4IPBA 3EN1B 4LYLB 2E2UA 3SOAA 3CCU3 3D79A 3F8XA 2CIUA 3CNMA 3SEDA 4N3VA 1GD3A 1BRJA 1RN4A 1RTUA 4J9AA 3NQZA 1OPYA 3DH2A 3IJEB 3PGBA 3SLUA 3VF1A 4N6MA 1TJDA 3N8BA 4G1MB 4HYZA 1B2XA 1O7HB 4STDA 4IIAA 4HJLB 3JUMA 2KRTA 3Q1CA 1B3SA 1FUTA 1WMNA 3JUNA 1ULIB 4WYKA 3V99A 5AEWB 1ASKA 1BSDA 2XSHB 4XB5A 1W2B2 1B20A 5IEOA 1IQXA 1KWIA 1DMQA 2GEYA 4KZ1A 5EVHA 1V74A 1UCIA 2KAAA 4AKYA 1UCJA 1B2UA 3K5TA 3SYUA 3KFQC 1RRHA 2HMLB 4Q53A 1LOYA 3GSPA 1OHPA 4BL3A 3WMDA 1RGKA 4CDLA 1AY7A 3DMCA 1YI23 5TGNA 3I563 5KP3A 2XGNA 5DREA 1G96A 1MWUA 1VQ93 2UGIA 2QA43 2WO0A 1RGEA 1M1K4 3EBTA 5HOHA 1GMRA 5G1LA 1BRKA 1TRPA 1WMPA 5AYRB 5GSPA 3EB8A 3VSYA 3B4OA 2CWUA 4R4KA 4WHAA 1DE3A 3CPW2 1T5YA 3ZG5A 5STDA 4N6V0 1U8CB 3D3LA 3GZRA 4GSPA 5I97A 3CCM3 2RNTA 1FGRA 1PY3A 4LEHA 3BU4A 1VQ43 2CFGA 1I70A 2FNQA 4OVMA 2AAEA 1YJN3 3CC73 3OWSA 2W6JH 1RSNA 5CK6A 5HGRA 2HMOB 1SQWA 3MHEA 3DGNA 2HOHA 3MG3A 4L8PA 2J8XB 1B21A 3AHSA 2CFDA 3H51A 4HM7B 1O7MB 1YIJ3 1JB4A 3MYTA 3HIGA 3Q3FA 2F5MA 1EA2A 1N5PA 5KP1A 2HMNB 4KT3B 3KZTA 3DGLA 1UI8A 1IK3A 4HOHA 1KQS2 1LOWA 3EJVA 3FF2A 1BSEA 3OX9A 3UJMA 1G02A 1RNTA 1IDPA 2O9UX 5DRVA 1UGIA 4I5QA 3SOYA 3WDGB 1DMNA 3HZPA 3WOFB 1JZDA 2WOHA 2UUGC 3CCQ3 3HIIA 2F98A 1C7HA 4RNZA 3CCS3 1GMPA 3FZWA 4BTXA 4XM4A 4FMAA 3CXC2 3NX0A 2C11A 1S723 1IT8A 1BSBA 1LNIA 2KF4A 2Z7AA 3OWYA 5LC7A 5M19A 4R1KA 1B2SA 5AIIA 1I2FA 2CK3H 4ILFA 4QWTA 2W9PA 2P0MA 3RGAA 2CG0A 5CF1A 4O2HA 3SX1A 1QJGA 1NDOB 3NV0A 1QALA 4K90B 1O7NB 3U97A 3PS8A 3AMOA 2GSPA 3OXAA 1GY7A 1VZZA 2GBWB 3PCSA 4K61A 2CX1A 3G16A 3RGRA 1ZS7A 2XFSA 5KP4A 5AIFA 1KD14 1BNIA 3CPOA 4FCMA 1MGWA 4GHOA 3DGMA 3CD63 3G0KA 1Q7Y4 3CC43 1NB3I 1O7PB 2BO9B 1A2PA 1BNRA 5D81A
chains in the Genus database with same CATH topology
1BRHA 1GSPA 1BRJA 1RN4A 1AQZA 1RGAA 1RTUA 1RGFA 3DH2A 2C4BA 1B2XA 1BRSA 1BNSA 1BANA 1I0VA 1X1XA 1B3SA 1FUTA 1FYSA 3D5GA 1BSDA 2KF3A 1B20A 1BUJA 1RDSA 1I2EA 3WR2A 1B2ZA 1UCIA 2KAAA 1UCJA 1B2UA 2F5WA 3D5IA 3SYUA 5RNTA 1RN1A 1C54A 1LOYA 3GSPA 1TTOA 1RGKA 1I2GA 1AY7A 1YVSA 3BIRA 1DETA 1GOUA 1RGLA 1IYYA 1BNEA 1YGWA 4BU4A 1RGEA 5HOHA 2BIRA 1GMRA 1BRKA 1ZGXA 1TRPA 3AHWA 1X1UA 1I8VA 5GSPA 1RLSA 1BRNL 1FZUA 1DE3A 4GSPA 1BRGA 1GOYA 1RHLA 3RNTA 1I3FA 2RNTA 9RNTA 1PY3A 1BNGA 1BRIA 3A5EA 1LOVA 3BU4A 3WHOA 1I70A 2AAEA 1BIRA 1T2IA 1BSCA 1RSNA 1JBSA 1PYLA 2RBIA 3D4AA 1JBTA 2HOHA 8RNTA 1Q9EA 1B21A 2KF5A 3AHSA 3AGNA 1FUSA 1GOVA 1BNFA 3Q3FA 6RNTA 2F5MA 4J5KA 2AADA 4HOHA 1LOWA 4J5GA 1BVIA 1B27A 1GMQA 1UCKA 1BSEA 1HYFA 1G02A 1RNTA 1SARA 2F4YA 1FW7A 3HOHA 5BIRA 1HZ1A 1JBRA 1MGRA 3KCHA 1GMPA 1T2HA 1I0XA 2BU4A 1BGSA 1BSAA 1UCLA 1BSBA 1LNIA 2KF4A 1B2SA 2SARA 2ZA4A 1I2FA 1YNVX 1X1WA 3AGOA 4RNTA 1B2MA 4HAAA 1TRQA 1BNJA 6GSPA 2F56A 5BU4A 1R4YA 2GSPA 1RMSA 1RGHA 2KF6A 7GSPA 1X1YA 1RCKA 3URPA 1BNIA 1LRAA 1BAOA 1RGGA 1I3IA 1MGWA 1CH0A 1RGCA 3DGYA 4GHOA 1BOXA 7RNTA 1RNBA 1BNRA 1A2PA 1RCLA 4BIRA 1BU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRH A;  1GSP A;  1BRJ A;  1RN4 A;  1AQZ A;  1RGA A;  1RTU A;  1RGF A;  3DH2 A;  2C4B A;  1B2X A;  1BRS A;  1BNS A;  1BAN A;  1I0V A;  1X1X A;  1B3S A;  1FUT A;  1FYS A;  3D5G A;  1BSD A;  2KF3 A;  1B20 A;  1BUJ A;  1RDS A;  1I2E A;  3WR2 A;  1B2Z A;  1UCI A;  2KAA A;  1UCJ A;  1B2U A;  2F5W A;  3D5I A;  3SYU A;  5RNT A;  1RN1 A;  1C54 A;  1LOY A;  3GSP A;  1TTO A;  1RGK A;  1I2G A;  1AY7 A;  1YVS A;  3BIR A;  1DET A;  1GOU A;  1RGL A;  1IYY A;  1BNE A;  1YGW A;  4BU4 A;  1RGE A;  5HOH A;  2BIR A;  1GMR A;  1BRK A;  1ZGX A;  1TRP A;  3AHW A;  1X1U A;  1I8V A;  5GSP A;  1RLS A;  1BRN L;  1FZU A;  1DE3 A;  4GSP A;  1BRG A;  1GOY A;  1RHL A;  3RNT A;  1I3F A;  2RNT A;  9RNT A;  1PY3 A;  1BNG A;  1BRI A;  3A5E A;  1LOV A;  3BU4 A;  3WHO A;  1I70 A;  2AAE A;  1BIR A;  1T2I A;  1BSC A;  1RSN A;  1JBS A;  1PYL A;  2RBI A;  3D4A A;  1JBT A;  2HOH A;  8RNT A;  1Q9E A;  1B21 A;  2KF5 A;  3AHS A;  3AGN A;  1FUS A;  1GOV A;  1BNF A;  3Q3F A;  6RNT A;  2F5M A;  4J5K A;  2AAD A;  4HOH A;  1LOW A;  4J5G A;  1BVI A;  1B27 A;  1GMQ A;  1UCK A;  1BSE A;  1HYF A;  1G02 A;  1RNT A;  1SAR A;  2F4Y A;  1FW7 A;  3HOH A;  5BIR A;  1HZ1 A;  1JBR A;  1MGR A;  3KCH A;  1GMP A;  1T2H A;  1I0X A;  2BU4 A;  1BGS A;  1BSA A;  1UCL A;  1BSB A;  1LNI A;  2KF4 A;  1B2S A;  2SAR A;  2ZA4 A;  1I2F A;  1YNV X;  1X1W A;  3AGO A;  4RNT A;  1B2M A;  4HAA A;  1TRQ A;  1BNJ A;  6GSP A;  2F56 A;  5BU4 A;  1R4Y A;  2GSP A;  1RMS A;  1RGH A;  2KF6 A;  7GSP A;  1X1Y A;  1RCK A;  3URP A;  1BNI A;  1LRA A;  1BAO A;  1RGG A;  1I3I A;  1MGW A;  1CH0 A;  1RGC A;  3DGY A;  4GHO A;  1BOX A;  7RNT A;  1RNB A;  1BNR A;  1A2P A;  1RCL A;  4BIR A;  1BU4 A; 
#chains in the Genus database with same CATH topology
 1IV9 A;  1KC8 4;  3EN8 A;  3M8C A;  3F7S A;  1IT7 A;  2Z76 A;  4FMC A;  5IG3 A;  3UL5 A;  1OHO A;  1OF5 B;  1W7C A;  2ML5 A;  3KII A;  1I0V A;  1QAF A;  1BAN A;  3UL6 A;  3X42 A;  1YVB I;  2W04 A;  3D5G A;  2OTL 3;  5JBS A;  1LQG C;  5FW5 A;  1I2E A;  2Z6B A;  1FA3 A;  1B2Z A;  1QAK A;  3WA3 A;  4RZM A;  2F99 A;  4MEI A;  4R9K A;  2PZV A;  3I55 3;  2F5W A;  1Q81 4;  3HX8 A;  1A67 A;  1FGO A;  1RN1 A;  1LXE A;  2RCD A;  3F40 A;  4GL6 A;  4EBG A;  4EV5 A;  3LOY A;  2XR8 B;  1FGQ A;  2OWP A;  3LTD A;  1JJ2 2;  1I2G A;  2RGQ A;  5JPU A;  1EEJ A;  1YVS A;  1DET A;  2E2V A;  4HM0 B;  5AEU B;  5JPP A;  3Q90 A;  2W03 A;  3CNX A;  1NWW A;  4AEQ A;  2OTJ 3;  1YGW A;  2K3D A;  1Q42 A;  4LSO A;  4N6O B;  3DXO A;  3ZFZ A;  1KSI A;  2BIR A;  3EC9 A;  4N6N B;  4R9L A;  2CH9 A;  1VQN 3;  3AHW A;  1RJO A;  4NHF A;  3WOE B;  1RLS A;  1BRN L;  2CG1 A;  3LH4 A;  1TUH A;  2LQV A;  4KFF A;  2V1L A;  2GU3 A;  4CCV A;  4XDW A;  1W6G A;  5CLK A;  3BNB A;  9RNT A;  1OGZ A;  2HMM B;  5M1A A;  3KKG A;  4MMX B;  2M7O A;  3A5E A;  1JB5 A;  1LOV A;  1OAC A;  2CKF B;  3MKI A;  3S28 A;  1HU9 A;  1K41 A;  3FG3 A;  1BSC A;  1AVK A;  1JBS A;  2RBI A;  1JBT A;  4WYK B;  3G71 3;  8RNT A;  2BMQ B;  3JVC A;  1M90 4;  2P38 A;  3NHX A;  2CW9 A;  1WQL B;  1A2K A;  1BNF A;  2QGU A;  3EX9 A;  4J5K A;  1F8N A;  1W2Z A;  3F14 A;  1GYB A;  3IPT A;  2XSO B;  3LYG A;  1UI7 A;  1MOL A;  2CHC A;  1HKX A;  1UUG B;  3LT9 A;  4FCZ A;  5A0O B;  3BNC A;  1VQ8 3;  1EG9 B;  3DZL A;  3X41 A;  1E3V A;  1FUW A;  2R41 A;  2SBL A;  2F4Y A;  3PZW A;  3OWU A;  1Q40 B;  2ZDJ A;  3ZG0 A;  1LQM B;  1W4N A;  3LTC A;  1IVU A;  4LGQ A;  1DMM A;  1JZO A;  4WWU C;  4AKZ A;  1FGM A;  4XBY A;  3EF8 A;  2XRX B;  3V98 A;  4RNY A;  1T2H A;  3CME 3;  1N9E A;  1BGS A;  2L4V A;  5ELJ A;  1NB5 I;  3B8L A;  2W56 A;  2QEX 3;  3WOD G;  1QVF 2;  3LTB A;  1SII A;  1R4C A;  2ZL8 A;  3G8Z A;  2XFT A;  2SAR A;  4DKI A;  1Q82 4;  1OF5 A;  2ZA4 A;  2HMJ B;  3MPH A;  1YNV X;  3AGO A;  4RNT A;  3D9R A;  3KE7 A;  4GB5 A;  3X40 A;  2F56 A;  2P05 A;  3JUQ A;  1NNV A;  2GXF A;  2YFL B;  1RMS A;  5EQL A;  4CPK A;  1M9G A;  1K28 A;  1SPU A;  1MNL A;  4ZM8 A;  2OOV A;  5IF6 A;  3LML A;  1IVV A;  2CWV A;  3ALA A;  3URP A;  2CFW A;  1RN7 A;  2W2C A;  3X3X A;  1LRA A;  3DGY A;  1RGG A;  3G4S 3;  3NBB A;  1BOX A;  3IMA B;  1RCL A;  3CMA 3;  1QMA A;  1BU4 A;  1EUI C;  2W56 B;  4BIR A;  3FLJ A;  1BRH A;  1GSP A;  3PYJ A;  3QRD A;  4L8O A;  5IER A;  3JUP A;  1AQZ A;  1RGA A;  2IUK A;  3BB9 A;  1RKY A;  1TU5 A;  2GU1 A;  2WOF A;  2C4B A;  1EKM A;  1W6Y A;  2CFK A;  3TDG A;  1RRL A;  2C10 A;  1BRS A;  1BNS A;  1X1X A;  5D82 A;  4N6L A;  3SVA A;  1IQ8 A;  1FYS A;  1LOX A;  1UDI I;  2JQ5 A;  2P09 A;  1MWR A;  5ELU A;  2QIY A;  5IG0 A;  4BTW A;  1VQM 3;  3MG2 A;  1BUJ A;  1RDS A;  3OV4 A;  1AVL A;  1OCV A;  2BNG A;  3BLZ A;  3DM8 A;  3GZY B;  3NBJ A;  1IU7 A;  2RSX A;  4O8S A;  2BT3 A;  4WP5 A;  4TX4 A;  1PU4 A;  1STD A;  4HM6 B;  4HM3 B;  3D5I A;  3OW2 2;  1JNQ A;  4R80 A;  1C54 A;  2H0G A;  3ER7 A;  1MWT A;  3LTA A;  1W02 A;  2MC8 A;  1EQK A;  4KVH A;  1SIH A;  2XF3 A;  1OHS A;  2BHM A;  1RGL A;  3BNE A;  3F7X A;  1V58 A;  3H3H A;  2IYJ A;  1VQK 3;  1AR0 A;  1BNE A;  4JRF A;  4BU4 A;  4U13 A;  1WMO A;  1WTH A;  1Q86 4;  3NXJ A;  2OQE A;  1ZGX A;  2YFJ B;  1A90 A;  1I8V A;  3T8U A;  2CWT A;  5EEO A;  4FR9 A;  2CX0 A;  3J7Y d;  3QK9 A;  4N6U A;  3VGN A;  1STF I;  1M1X B;  4FCJ A;  1W5Z A;  1BRG A;  1GOY A;  1RHL A;  4XBT A;  1US1 A;  3JUO A;  3S67 A;  1CYU A;  1BNG A;  1TFO A;  4HZ9 B;  3WHO A;  2PNC A;  1ZX2 A;  3NM7 A;  1Q40 A;  1N9J A;  3FCS B;  3NM2 A;  2LYX A;  1ROV A;  1PYL A;  3ECF A;  1LNH A;  1N8R 4;  1OGX A;  1Q9E A;  6STD A;  3FKA A;  3HK4 A;  1TP6 A;  3EHC A;  2KF5 A;  3MSO A;  3AGN A;  1GOV A;  1TFK A;  2HMK B;  1IV7 A;  1UGH I;  4O02 B;  5G2G A;  3T0U A;  2WGO A;  5BXQ A;  1D6Z A;  4J5G A;  4K1V A;  2INX A;  1N5H A;  3K7C A;  1B27 A;  3PXM A;  1IVW A;  1Y4K A;  3GZX B;  2W9Q A;  2RFR A;  5AIG A;  3B4P A;  1JN5 A;  3HOH A;  2A15 A;  5BIR A;  1GS3 A;  3PCR A;  1N8Q A;  1HZ1 A;  1JBR A;  2IA7 A;  3KCH A;  3ROB A;  2WGQ A;  5AYS C;  2Y74 A;  1YGE A;  2IMJ A;  1I0X A;  1UUW B;  1U5O A;  1PFP A;  2R4I A;  3CC2 3;  4FMB A;  3FGY A;  2YX9 A;  1JV2 B;  2F86 B;  1V57 A;  1ULJ B;  4KFD A;  1L5G B;  1B2M A;  5IEP A;  6GSP A;  5BU4 A;  4CJN A;  8CHO A;  1R4Y A;  4HM8 B;  4HBR A;  2D42 A;  3UNL A;  4PEJ A;  1W6C A;  2OCT A;  2KF6 A;  2P0X A;  3K9M C;  2XH9 A;  3NV0 B;  1VQ7 3;  1X1Y A;  1RCK A;  4OK0 A;  1GD4 A;  3F9S A;  3S27 A;  1JN5 B;  4FMD A;  2ML6 A;  2IUJ A;  1I3I A;  3STD A;  1RGC A;  3UB1 A;  3U1W A;  7RNT A;  5FGO A;  3LXU X;  1RNB A;  2FGT A;  1JKG A;  5AIH A;  2ZHX B;  3CU3 A;  3X3Y A;  1YHQ 3;  3I0Y A;  4L7K A;  1RGF A;  2L1S A;  3F8H A;  3KSP A;  3S5C A;  2OOV C;  4LMI A;  2I9W A;  3B7C A;  3FSD A;  1GY6 A;  1OH0 A;  2OQE C;  3FF0 A;  5D83 A;  5IG5 A;  3CCL 3;  3L0R A;  3O8Y A;  3CCR 3;  5CF2 A;  4MMZ B;  3FG1 A;  2K0M A;  2KF3 A;  2MF7 A;  5IEN A;  1ISK A;  2CC3 A;  1W01 A;  3WR2 A;  1IQY A;  1TIJ A;  1D6Y A;  1K73 4;  1ZO2 A;  1FGT A;  5RNT A;  2H0I A;  1Z1S A;  3AMO B;  3NQY A;  3CCV 3;  1TTO A;  4HZB B;  2FXT A;  2Q07 A;  4EC6 A;  3KN4 A;  2E2T A;  3BIR A;  1GOU A;  1Q7H A;  2BMO B;  3X3Z A;  1J2B A;  3MWZ A;  7STD A;  4MJD A;  3GZB A;  4WFO A;  1IYY A;  1OUN A;  3WA2 X;  1CQS A;  1AV4 A;  3EBY A;  2K54 A;  3BND A;  3DGO A;  1X1U A;  1E3R A;  4HM5 B;  4K1U A;  1O7W B;  1UW1 A;  2GEX A;  4BTY A;  1S5A A;  1FZU A;  4EXR A;  3FH1 A;  5CXO A;  2Y73 A;  1JRQ A;  2H0H A;  3N54 B;  1YIT 3;  3DUK A;  1K9M 4;  2D1W A;  3RNT A;  1MWS A;  1I3F A;  1QVG 2;  1BRI A;  1W00 A;  5BVB A;  1ROA A;  3NUV A;  4HM4 B;  4I4K A;  1BIR A;  3K0Z A;  2BMR B;  2W0Q A;  4OUQ A;  1T2I A;  1G0T A;  4XBX A;  2B24 B;  3D4A A;  4BL2 A;  4EV2 A;  1YJW 3;  1K8A 4;  1O7G B;  1GY5 A;  3A76 A;  1FUS A;  2JDI H;  3GAX A;  3G6E 3;  5LC6 A;  1VQ5 3;  3Q2P A;  3K63 A;  3DY5 A;  6RNT A;  3GWR A;  1DVD A;  4XDV A;  1T3B A;  3KSE D;  2AAD A;  4HM2 B;  4NRE A;  4HVN A;  1CYV A;  2O3O A;  1BVI A;  1UCK A;  1GMQ A;  1E97 A;  3EE1 A;  3N9H A;  2KXG A;  2STD A;  2Z77 A;  3E99 A;  3RDE A;  1DYU A;  1HYF A;  3T8N A;  1SAR A;  4EYC A;  1NO3 A;  3SXX A;  2KCD A;  1FW7 A;  5AI1 A;  4IT7 A;  3HI7 A;  1NJI 4;  4HKV B;  1UUV B;  3LZA A;  1MGR A;  5IG4 A;  4RBN A;  2BU4 A;  1VQL 3;  3CCE 3;  3CCJ 3;  2YFI B;  3EQQ B;  1BSA A;  1D6U A;  3LT8 A;  2XGL A;  4X2O A;  1UCL A;  3MG1 A;  4H3U A;  1VQP 3;  3V92 A;  1VQQ A;  1IVX A;  4J8T A;  1VQO 3;  4HM1 B;  2UX0 A;  1DVC A;  1X1W A;  4NPB A;  5M18 A;  4HAA A;  1TRQ A;  4H61 A;  1A2V A;  1BNJ A;  1BUQ A;  1NU3 A;  4JF8 A;  4LZI A;  5G1K A;  1YJ9 3;  1JKG B;  1JB2 A;  3S29 A;  2GBX B;  2XEP A;  4X2H A;  2B1X B;  1RGH A;  2IY2 A;  1LVN A;  1CEW I;  1SJW A;  7GSP A;  4ORL A;  4O3V A;  5IW9 A;  1VQ6 3;  3NBR A;  2CFL A;  4MMY B;  4KFE A;  4N6T A;  1WNH A;  1BAO A;  4EW5 A;  3FG4 A;  1CH0 A;  3GRD A;  4IPB A;  3EN1 B;  4LYL B;  2E2U A;  3SOA A;  3CCU 3;  3D79 A;  3F8X A;  2CIU A;  3CNM A;  3SED A;  4N3V A;  1GD3 A;  1BRJ A;  1RN4 A;  1RTU A;  4J9A A;  3NQZ A;  1OPY A;  3DH2 A;  3IJE B;  3PGB A;  3SLU A;  3VF1 A;  4N6M A;  1TJD A;  3N8B A;  4G1M B;  4HYZ A;  1B2X A;  1O7H B;  4STD A;  4IIA A;  4HJL B;  3JUM A;  2KRT A;  3Q1C A;  1B3S A;  1FUT A;  1WMN A;  3JUN A;  1ULI B;  4WYK A;  3V99 A;  5AEW B;  1ASK A;  1BSD A;  2XSH B;  4XB5 A;  1W2B 2;  1B20 A;  5IEO A;  1IQX A;  1KWI A;  1DMQ A;  2GEY A;  4KZ1 A;  5EVH A;  1V74 A;  1UCI A;  2KAA A;  4AKY A;  1UCJ A;  1B2U A;  3K5T A;  3SYU A;  3KFQ C;  1RRH A;  2HML B;  4Q53 A;  1LOY A;  3GSP A;  1OHP A;  4BL3 A;  3WMD A;  1RGK A;  4CDL A;  1AY7 A;  3DMC A;  1YI2 3;  5TGN A;  3I56 3;  5KP3 A;  2XGN A;  5DRE A;  1G96 A;  1MWU A;  1VQ9 3;  2UGI A;  2QA4 3;  2WO0 A;  1RGE A;  1M1K 4;  3EBT A;  5HOH A;  1GMR A;  5G1L A;  1BRK A;  1TRP A;  1WMP A;  5AYR B;  5GSP A;  3EB8 A;  3VSY A;  3B4O A;  2CWU A;  4R4K A;  4WHA A;  1DE3 A;  3CPW 2;  1T5Y A;  3ZG5 A;  5STD A;  4N6V 0;  1U8C B;  3D3L A;  3GZR A;  4GSP A;  5I97 A;  3CCM 3;  2RNT A;  1FGR A;  1PY3 A;  4LEH A;  3BU4 A;  1VQ4 3;  2CFG A;  1I70 A;  2FNQ A;  4OVM A;  2AAE A;  1YJN 3;  3CC7 3;  3OWS A;  2W6J H;  1RSN A;  5CK6 A;  5HGR A;  2HMO B;  1SQW A;  3MHE A;  3DGN A;  2HOH A;  3MG3 A;  4L8P A;  2J8X B;  1B21 A;  3AHS A;  2CFD A;  3H51 A;  4HM7 B;  1O7M B;  1YIJ 3;  1JB4 A;  3MYT A;  3HIG A;  3Q3F A;  2F5M A;  1EA2 A;  1N5P A;  5KP1 A;  2HMN B;  4KT3 B;  3KZT A;  3DGL A;  1UI8 A;  1IK3 A;  4HOH A;  1KQS 2;  1LOW A;  3EJV A;  3FF2 A;  1BSE A;  3OX9 A;  3UJM A;  1G02 A;  1RNT A;  1IDP A;  2O9U X;  5DRV A;  1UGI A;  4I5Q A;  3SOY A;  3WDG B;  1DMN A;  3HZP A;  3WOF B;  1JZD A;  2WOH A;  2UUG C;  3CCQ 3;  3HII A;  2F98 A;  1C7H A;  4RNZ A;  3CCS 3;  1GMP A;  3FZW A;  4BTX A;  4XM4 A;  4FMA A;  3CXC 2;  3NX0 A;  2C11 A;  1S72 3;  1IT8 A;  1BSB A;  1LNI A;  2KF4 A;  2Z7A A;  3OWY A;  5LC7 A;  5M19 A;  4R1K A;  1B2S A;  5AII A;  1I2F A;  2CK3 H;  4ILF A;  4QWT A;  2W9P A;  2P0M A;  3RGA A;  2CG0 A;  5CF1 A;  4O2H A;  3SX1 A;  1QJG A;  1NDO B;  3NV0 A;  1QAL A;  4K90 B;  1O7N B;  3U97 A;  3PS8 A;  3AMO A;  2GSP A;  3OXA A;  1GY7 A;  1VZZ A;  2GBW B;  3PCS A;  4K61 A;  2CX1 A;  3G16 A;  3RGR A;  1ZS7 A;  2XFS A;  5KP4 A;  5AIF A;  1KD1 4;  1BNI A;  3CPO A;  4FCM A;  1MGW A;  4GHO A;  3DGM A;  3CD6 3;  3G0K A;  1Q7Y 4;  3CC4 3;  1NB3 I;  1O7P B;  2BO9 B;  1A2P A;  1BNR A;  5D81 A; 
#chains in the Genus database with same CATH homology
 1BRH A;  1GSP A;  1BRJ A;  1RN4 A;  1AQZ A;  1RGA A;  1RTU A;  1RGF A;  3DH2 A;  2C4B A;  1B2X A;  1BRS A;  1BNS A;  1BAN A;  1I0V A;  1X1X A;  1B3S A;  1FUT A;  1FYS A;  3D5G A;  1BSD A;  2KF3 A;  1B20 A;  1BUJ A;  1RDS A;  1I2E A;  3WR2 A;  1B2Z A;  1UCI A;  2KAA A;  1UCJ A;  1B2U A;  2F5W A;  3D5I A;  3SYU A;  5RNT A;  1RN1 A;  1C54 A;  1LOY A;  3GSP A;  1TTO A;  1RGK A;  1I2G A;  1AY7 A;  1YVS A;  3BIR A;  1DET A;  1GOU A;  1RGL A;  1IYY A;  1BNE A;  1YGW A;  4BU4 A;  1RGE A;  5HOH A;  2BIR A;  1GMR A;  1BRK A;  1ZGX A;  1TRP A;  3AHW A;  1X1U A;  1I8V A;  5GSP A;  1RLS A;  1BRN L;  1FZU A;  1DE3 A;  4GSP A;  1BRG A;  1GOY A;  1RHL A;  3RNT A;  1I3F A;  2RNT A;  9RNT A;  1PY3 A;  1BNG A;  1BRI A;  3A5E A;  1LOV A;  3BU4 A;  3WHO A;  1I70 A;  2AAE A;  1BIR A;  1T2I A;  1BSC A;  1RSN A;  1JBS A;  1PYL A;  2RBI A;  3D4A A;  1JBT A;  2HOH A;  8RNT A;  1Q9E A;  1B21 A;  2KF5 A;  3AHS A;  3AGN A;  1FUS A;  1GOV A;  1BNF A;  3Q3F A;  6RNT A;  2F5M A;  4J5K A;  2AAD A;  4HOH A;  1LOW A;  4J5G A;  1BVI A;  1B27 A;  1GMQ A;  1UCK A;  1BSE A;  1HYF A;  1G02 A;  1RNT A;  1SAR A;  2F4Y A;  1FW7 A;  3HOH A;  5BIR A;  1HZ1 A;  1JBR A;  1MGR A;  3KCH A;  1GMP A;  1T2H A;  1I0X A;  2BU4 A;  1BGS A;  1BSA A;  1UCL A;  1BSB A;  1LNI A;  2KF4 A;  1B2S A;  2SAR A;  2ZA4 A;  1I2F A;  1YNV X;  1X1W A;  3AGO A;  4RNT A;  1B2M A;  4HAA A;  1TRQ A;  1BNJ A;  6GSP A;  2F56 A;  5BU4 A;  1R4Y A;  2GSP A;  1RMS A;  1RGH A;  2KF6 A;  7GSP A;  1X1Y A;  1RCK A;  3URP A;  1BNI A;  1LRA A;  1BAO A;  1RGG A;  1I3I A;  1MGW A;  1CH0 A;  1RGC A;  3DGY A;  4GHO A;  1BOX A;  7RNT A;  1RNB A;  1BNR A;  1A2P A;  1RCL A;  4BIR A;  1BU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...