1BRMA

Aspartate beta-semialdehyde dehydrogenase from escherichia coli
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
367
structure length
356
Chain Sequence
MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDLEALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of aspartate-beta-semialdehyde dehydrogenase from Escherichia coli, a key enzyme in the aspartate family of amino acid biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
total genus 108
structure length 356
sequence length 367
chains with identical sequence B, C
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 1998-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1brmA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1brmA01
4RF5A 3L9WA 3FRJA 4BNGA 3WMXA 1PJCA 1XWFA 2CF6A 5FI5A 1BXKA 3GEGA 3OH8A 1KVRA 4ALNA 5CDUA 3JYOA 2E37A 5KOIA 1KVQA 2OHXA 3JD4A 1ADGA 2FOIA 2JKVA 2V6FA 5CPFA 4L0QA 5ITWA 3JD0A 5JAMA 3V5NA 1T1RA 3GPIA 1PU2A 1LRLA 3OMLA 4BNZA 2E48A 3DQPA 2VZ0A 3S55A 4DPLA 3RD5A 4YT8A 1ENYA 1VL6A 3GG9A 4A0SA 3JQAB 4FFMA 4P22A 2HK8A 2TMGA 4AVYA 1YRLA 2VHYA 4KWIA 1N92A 4WKGA 4CMEA 5IDWA 4YRDA 1U8FO 1WP4A 1SPXA 3JQ9A 3HZZA 4ZQEA 3F4LA 4OXKA 1B16A 2JCYA 3QHAA 4W99A 4XQCA 1HE3A 5JDCC 2W98A 1YJ8A 4IS2A 1TT5A 3D4OA 3OBBA 1I5RA 5M6DA 5B37A 5DBGA 1I3MA 1PGOA 1EVYA 4WLVA 3RC7A 1V8BA 4NBVA 2O23A 2OBNA 3UVEA 3OA2A 2Y66A 1Z74A 5C37A 4IDFA 1S7CA 1BMDA 5AYVA 1BWSA 1DRVA 1PZEA 3WFIA 4FD3A 2B69A 4HFMA 2C29D 5JSFA 1E7SA 3PZBA 2Y99A 3KSDO 4PZDA 2PKRA 4I9NA 4CLOA 3IIEA 3Q11A 3UHAA 3RQSA 4CLRB 2HLPA 2VQ3A 1U3WA 2X5KO 3PHHA 3WTCA 3ZWCA 4J4TA 1UXJA 3BHMA 4J49A 1N1GA 5I7EA 5HWSA 1E1MA 4OSOA 2VN8A 2X22A 1K6XA 4B7UA 4C7JA 1R4NA 1R66A 5IXSA 3PJFA 3M2TA 2VWHA 3PJDA 1VE9A 5COAA 1NFQA 3QVOA 3UCXA 4M49A 1J4AA 4CM4A 3LT2A 2JFFA 4URFA 3Q1LA 1WMBA 1PQUA 3WBFA 1P31A 3HN7A 4J6FA 4PIVA 3ZN2A 3NJ4A 1IZ0A 2C5EA 4O6VA 4FJ0A 1ZSNA 1KBZA 5L4NA 4O1MA 1PJQA 4I9UA 2Y1FA 1UAGA 2B83A 3AWDA 3GH3A 2XAAA 4OO3A 5JCXA 2GCGA 1XA0A 2O4CA 3GG2A 3WS7A 6LDHA 5F1OA 3UH1A 5GY7A 1NM5A 5JNLA 1ADCA 3KYBA 2I9PA 4UUPA 4MVJE 4XRGA 3PQFA 3BMOA 4HNGA 1NHWA 2R00A 1UDBA 4IIUA 3ZHZA 1EMDA 4CM5A 1EUZA 1GAEO 4K1LA 2AQHA 1JA9A 1XG5A 3RAJA 2EKLA 1E1KA 3GVXA 4UVGA 3ZDFA 1LSOA 3H7AA 5JO0A 1PGQA 4HKTA 4OAQA 3INRA 1OFGA 4D42A 3CXRA 8ADHA 2DKNA 4LRSB 1B14A 4DQXA 3ETGA 1JN0A 1YOVB 4MIEA 1ENOA 1NQ5A 2YDXA 3DZGA 5AXCA 2X0JA 3MCVA 5ER6A 1ENPA 4Y9DA 3L07A 2Q46A 4WEOA 4AJ2A 4NFSA 3QJ5A 4MOWA 2G82A 3VOSA 1O9BA 3BHIA 1PR3A 2TMDA 4HFRA 9LDTA 4Q3DA 2QHXA 1JAYA 1ULSA 1XU7A 4NG5A 4AG3A 2DBVO 1MV8A 3L4BC 5TF4A 1SAYA 4DXHA 4PLHA 1LUAA 2QYTA 1YL6A 5G0UA 1PS0A 3R0IA 1UR5A 2NU8A 4ID9A 3EGOA 4YPOA 4BUCA 3R6DA 4PG8A 3VKVA 3KETA 2F00A 4BNJA 3E8XA 3F9IA 4WLFA 4BGEA 1DEHA 2HK9A 1GFSA 2VHWA 2ZB4A 3Q6IA 2GPTA 3F1LA 3KO8A 5A4DA 4RDHA 4XR4A 2NTNA 3TRIA 2IYPA 1DFGA 3FBTA 3OIDA 3ZW8A 3DHNA 2BFOA 3UN1A 4PGFA 1B3BA 1CQJA 3H5NA 4EUHA 4BNKA 3D3EA 4L4XA 3VVBA 3WQRA 3GK3A 2HK7A 1LA2A 2EF1A 1O0SA 4B8WA 3LF2A 1J5PA 2PA3A 1JVBA 2PLAA 4WCFB 3ZNNA 4Y6SA 4IQ8A 3T7CA 4X54A 2PD6A 1VRWA 3K30A 5L7WA 3WOHA 4FFOA 3ADOA 3VTZA 1HF3A 5I9MA 4PLWA 4N5MA 2CUKA 4NFYA 4UVDA 2C59A 1BDBA 4TRNA 2PNFA 2CVQA 3GNQA 4XCVA 4BNUA 4RJTA 2XOXA 3PWSA 5HS6A 1P0CA 2GD1O 2FPGA 2GF2A 2GSDA 1K5HA 1LX6A 1LQUA 2B0JA 2FR1A 4JX8A 4YR9A 1SC6A 3STHA 3TOXA 3P2YA 5HTOA 1PL8A 3PRJA 1U2GA 1Q0HA 3D1LA 3JTMA 2G76A 1H6BA 4U8GA 1P77A 4JROA 3U9LA 3K8ZA 1GYRA 3KHUA 3JV7A 3WLFA 2PV7A 5DCWA 1QLJA 1I30A 2AXQA 3BAZA 3CTMA 3I4FA 4ZU3A 2OL4A 8LDHA 4INAA 3ORFA 4D44A 3GQVA 2O48X 1HRDA 4FGWA 3BTUA 2ZTLA 5EIOA 4KUEA 4R1UA 5T67A 1B8PA 5U4QA 3W8EA 1AE1A 3MJVA 1LSUA 2NUAA 4JCOA 3EZYA 3FPLA 1LTHR 1TLTA 2CF5A 3HSKA 3JQBA 3B1JA 1T2DA 2HQ1A 2Z95A 1GZ3A 1P1RA 4E2WA 1DC6A 5CHEA 1IY8A 2EV9A 7MDHA 2Y1GA 1A4UA 1NP3A 3ETEA 3JYPA 1ZUD1 4LN1A 1CJCA 3MJCA 5BSGA 4FFLA 3IC5A 3WNVA 4OOFA 2B4TO 1SOVA 4NDNE 2NVUB 1NX6A 3AY6A 4LRTB 2VHVA 3H5AA 2X9GA 3IDSA 3JQ8B 5JMWA 3KSZO 4WLEA 3G17A 1NQAO 3GDOA 3WIDA 1H9BA 3WGZA 3TQHA 3NKLA 2YDYA 1QYCA 2NVUA 1ISFA 4LCJA 1EFLA 1X7DA 5HBRA 5AXBA 3OETA 4RPHA 3DEYX 2IDZA 2BI7A 4Y98A 1Y8QB 2CNBA 3VPGA 5A5EA 2QIOA 4UVIA 3ZWPA 2V6MA 4IS3A 3ROQA 1DLJA 2I66A 4K6CA 4XQ9A 1DB3A 4Q3BA 4B4UA 3UOGA 3CPSA 4DLLA 3ZU2A 3TF5A 2BKAA 4TZKA 3PYMA 3K5PA 3H5RA 4RO0A 1E3SA 4DREA 3WGYA 1LLUA 1UDAA 5L40A 5CDGA 4Z0HO 4WE3A 4IXTA 4RPLA 1CEQA 2DTXA 3WICA 1U8XX 1DJQA 3RC9A 1EUDA 1NFFA 3CINA 1D1SA 3JQ7B 2UDPA 4Y67A 2GR9A 1IHXA 4XIJA 4NK4A 2G5CA 1EFKA 3C7DB 5DNAA 4ALLA 4J90A 3DHYA 5ER9A 4RVGA 1E3WB 2WSBA 1I2BA 4R9RA 1DXYA 4ND3A 3IUPA 5ILGA 3U09A 3MOIA 2Z1NA 1V3VA 3OSUA 3GUCA 3K92A 1LSJA 5JC1A 4XKJA 3KLPX 4A5OA 2GRAA 4BMVA 3FTNA 2OBYA 3JQ7A 3JYLA 3PHIA 1V9LA 4Z9YA 5LCXA 2OGUA 2A4KA 1H2HA 3DZJA 3ZNQA 3GDFA 3EVNA 4XQEA 4GX0A 5TLSA 2UYYA 1GUYA 3T7EA 1PJ3A 2ZJ0A 3E5RA 1ZFNA 5BNFA 1M67A 1A7KA 3WGOA 3PDUA 4YJDA 2XXBA 3L6DA 3K73O 3VH3A 1YGYA 2NM0A 4DRYA 1GD1O 1C1DB 1QV7A 3LYLA 3D0OA 1R16A 4OKIA 5COQA 4BKOA 1YBMA 2I99A 1H6AA 2EXXA 4DGSA 1KEWA 3PGJA 2C7VA 5EINA 1VKNA 1YB4A 3WGQA 4J16A 1LLDA 3H9UA 4R3WA 1BDMA 4E33A 3W4JA 1YVEI 1MA0A 1LC0A 4HFNA 4K28A 5TQVA 5FWNA 1FDWA 1JKFA 3DBLA 4N5LA 3U3XA 4QT0A 1U4OA 3ETDA 3HB5X 3AM4A 4IMPA 5FEUA 1H0KA 1L7DA 3A06A 4DIFA 4RLHA 5ILOA 1ZK0A 1UDCA 1A5ZA 4JBIA 4YAIA 3LF1A 1E77A 4Q3CA 5CDYA 3FR8A 1F17A 1WZIA 4J0EA 5JW6A 1MG5A 4FFNA 3Q9NA 5IDYA 5IXYA 3FNGA 2G17A 4FB5A 2C20A 3SJUA 3LSYA 4YACA 3P5SA 2VNSA 2YJZA 1JWAB 3PYLA 3RC1A 2NLOA 3TZKA 2AEJA 4QO7A 3RUCA 4XB2A 1LDEA 2CZCA 3IL2A 1LLCA 1F8FA 3EW7A 3JQ6A 1GZ6A 4YT4A 5U9CA 1ZK1A 4FGSA 4J1SA 2H1SA 1SO8A 5MDHA 4WK6A 4OH1A 3ZV4A 3KRTA 3WJ7A 4BV8A 2C0CA 2HMSA 5B12A 3EVTA 3ONEA 4L76A 5C3MA 3NX4A 4BNYA 4RF2A 3EK2A 1QR6A 4XJTA 3HDYA 3F4BA 3ICPA 1BRMA 3DBHA 3IQDB 2OFPA 5AVOA 3RUAA 3QWFA 4ALIA 4D3FA 1WWKA 1DO8A 2VWPA 2FZWA 5TIIA 2D2IA 3A28A 1KERA 4YXFA 4BNIA 4CV3A 2E82A 5L7YA 4WPGA 1YL7A 1M76A 2C2XA 1KY4A 4L73A 3WGHA 4OIMA 3L6EA 2B5WA 1DIRA 1DIBA 1ZBQA 3UICA 2CFCA 2YV2A 4HX5A 4KUHA 3KLMX 1V0JA 4D0SA 3GRPA 5TS3A 2NWQA 4DQVA 2BELA 3HFGA 3MJSA 2PZMA 1R0KA 5IZ4A 5CG2A 4NJMB 4OMUA 2EIHA 4IZIA 2GZ3A 4PCVA 2JL1A 3RKUA 1OOEA 2AE1A 2HUNA 2CD9A 3I1JA 4WCFA 4DC1A 4M54A 5L51A 3I9MA 4NU6A 4WLUA 3KV3O 2I65A 1TT7A 2YV3A 4N7RA 1K89A 1W73A 1DIAA 4CUJA 2X0IA 4J4BA 1EVZA 4H16A 2NVBA 3H9GA 1MG0A 2WEKA 1DC4A 5LC1A 1GUFA 2GN4A 1T24A 3G3EA 4XX0A 4RF3A 5ICMA 1YWGO 5G2OA 2W2LA 4JIGA 3I4CA 3WX0A 3SVTA 3DTYA 1IOLA 4ZVVA 4CQMA 4FR5A 3MWEB 3QWHA 4Q9NA 3BA1A 4YAEA 4Z9XA 1EBUA 3DDNA 3PEFA 3CEAA 1FJHA 1WDLA 1ORRA 3D4NA 3V2GA 1I3NA 4MVJD 4BQPA 3HB4X 1BTOA 1PWXA 3JQAD 5A04A 4NBUA 3RCBA 1I8TA 5BT9A 3PPIA 4UVEA 1B2LA 1EQUA 1HDRA 4Z3DA 2OORA 3RKRA 4CM1A 3IKTA 4P38A 1CERA 2IZZA 4GX1A 1BGVA 4ONEA 2O3JA 1HYEA 1IL0A 1KYQA 5CAEA 5JY6A 1JTVA 1ISIA 3JQGB 2AQ8A 4Z9FA 3EC7A 3WMWA 4M86A 5DF1A 4A10A 3PYXA 3GNSA 5KTKA 4M55A 2ZIZA 2DBRA 5KJ1A 4UUMA 5DULA 1DIHA 5JMPA 2R00C 1Q7BA 4OL9A 5H81A 3B70A 1ZW1A 3KEOA 4F3YA 2ZYGA 2VHXA 3PDJA 2CVZA 4L75A 1HDXA 5G0TA 4E4YA 2I5PO 5JLAA 1WNTA 5TJ9A 2H6EA 1V6AA 3CSDA 4YT5A 1G1AA 3SEFA 1YB5A 3JQAA 3ASVA 4DPMA 4RZHA 5FFFA 1D4FA 2WD8A 3JQDA 1DPGA 2VYVD 3K6JA 4NIMA 1VLLA 2BGMA 4RVSA 2C2YA 3A1NA 3JQEA 4KDEA 4II2A 4GWGA 3UAGA 3WWZA 2P4HX 1T2CA 2O3UA 2YQ4A 3H8VA 4QFCA 2IEDA 4RDIA 2HMVA 3PI7A 2JCXA 5EQFA 4HADA 4Y6PA 5ICSA 2BFPA 5IAAA 1KVUA 3VHRA 5JE8A 4CMEC 4O0LA 4J1NA 4QFDA 4JBGA 3PP8A 3K2EA 1DSSG 4W6ZA 3PHGA 1P0FA 3OQ1A 4RF4A 3BIOA 1O95A 4GX5A 2OP0A 2W4QA 3WQSB 4BNXA 1PZGA 4BO8A 3DOOA 4FPXA 1KVSA 4O63O 3JQGA 4CM9A 2HO5A 3HG7A 5T64A 5BR7A 4CUZA 4DMLA 5GMOA 1E3WA 3RUIA 3H4VA 3OF2A 1ZCJA 4W82A 3OEYA 3PJGA 2WMDA 4NJOA 3TFQA 1JLLA 4TKLA 1CDOA 1YL5A 2WDZA 2VUUA 3AOEC 1TA4A 3B6ZA 2EERA 3N7UA 4YJHB 2D59A 4K9DA 4R1SA 2OXIA 4CMIA 4G65A 1I3LA 3OEWA 2ZQZA 5A1TA 3D7LA 1QYXA 1U3TA 4LGVA 1Z73A 2BMAA 4UAGA 1BVUA 2NU9A 1WLYA 2RH4A 5DCUA 4B3JA 1H93A 5KVSA 3H65A 4IM7A 4J3FA 1H5QA 2P2SA 2ZTMA 3GVPA 1ZSYA 3ROKA 3GGGA 3VAZA 3MTGA 1D8AA 2YY7A 1GPJA 1QORA 1NR1A 4BO6A 4FIZA 3IS3A 4RQUA 3A14A 1C0PA 3GHHA 5JCJA 3BMNB 4J7CA 5BSFA 1FDSA 4E13A 1R37A 3E48A 2GDZA 4AJKA 4XYBA 3KYDA 4GAEA 4MVJM 1TVEA 2Q1UA 5EMHA 1SZJG 2FR8A 1HLPA 3IMFA 4IXWA 5JDIA 3GEMA 1P1KA 5HA5A 3QE3A 3HJAA 4BGUA 3I52A 3GLQA 1R15A 2VCYA 1B7GO 3ZNPA 3JSAA 1BXZA 1HKUA 4RV9A 3AU8A 4CLHA 1AGNA 1SBYA 4CLDA 4KP7A 3FF4A 2CDCA 3RBXA 1NAIA 5K6AA 3RBVA 3KYDB 2WE8A 1QYWA 1K6IA 1FK8A 3WLEA 2Q22A 3Q9UA 3QRWA 4ZQFA 3KB6A 3WWYA 1LDYA 1MGOA 3MJEA 3GEDA 2HRZA 2PGJA 3PWKA 1Y5RA 1WPQA 3GDGA 2Y1CA 3GHYA 3JQ9C 4J7XA 3M1LA 1L1FA 3EUWA 1JQBA 4IINA 3IUSA 4ZA2A 4DVJA 5KJFA 2UV8A 4JBHA 2GUGA 2VTDA 1S6YA 5IG2A 4FS3A 5CPBA 1PS9A 4MKZA 2Y05A 1I32A 3RU9A 2PZLA 1VC2A 4BNNA 3L4SO 1GCOA 1WMAA 3JQFA 4IJVA 5JXWA 5TX7A 1SB8A 4PZCA 2EJVA 2O3QA 4LSMA 1ZEMA 4DBVO 4MIOA 6ADHA 1ZH8A 5KVQA 3EYWA 3AJRA 5HM8A 4MP3A 4AL4A 1N9GA 4D3DA 1CWUA 1E0DA 4CL3A 3GMSA 1RWBA 3ICCA 3B20A 1HEUA 2WM3A 4FJ1A 3LT1A 5K9ZA 5FF9A 4M87A 3FR7A 4FQ8A 3ZWNA 1GV1A 3U4HA 5JYDA 3C24A 4ND1A 4CPDA 3OHSX 3ZWAA 5T5QA 4N54A 1IYZA 1MC5A 1NQTA 3LT0A 1Y8QA 3GR6A 3HNPA 3BTVA 4B79A 1Y6JA 1N8KA 4S3MA 1U7TA 4HV4A 1P1FA 3JCZA 4MDHA 3OJLA 4RVHA 1DIGA 4E12A 2DPHA 3BMQB 1Z75A 1BVRA 5JPIA 2RHRA 1GDHA 1NFRA 2AMFA 2O7SA 3ROMA 4L4SA 3DAGA 4A7PA 4TVOA 2VNAA 1Y9AA 5L4LA 3GZNA 3E9QA 4D7AA 4WUVA 2HDHA 3FHLA 1ULUA 2NSDA 2X1HA 1DOHA 1XIVA 3LVFO 4IMRA 2Q4EA 2FPPA 4LW8A 1D1TA 1V3TA 4MVJI 1DBVO 5I7FA 1GU7A 3LU1A 4OYRA 1GADO 4Q39A 3KXDA 1X7HA 1Z7BA 4DIOA 1PS8A 4GX2A 4J7UA 1PJBA 2X8LA 3KEQA 4E2XA 1YH3A 5COBA 3PHJA 5JCJD 4JGBA 3V1UA 3SXPA 3W8FA 3TSCA 1LQTA 1J49A 1GYQA 3DBRB 4Y8VA 4A27A 3NUGA 3U49A 2UAGA 3FCOA 3HDJA 4EDFA 1IZ9A 1BG6A 2V6BA 5G4LA 3PHLA 4IDEA 4OGWA 1OC2A 1XELA 3VPHA 4E0BA 1T1SA 1FDTA 1ISMA 1Y5MA 2O7QA 4BB6A 4BNMA 3ANLA 1EUCA 1U9JA 3OICA 3BMOB 2PGLA 2G0TA 5JS6A 4AFNA 2JD1A 1BW9B 5JBIA 3NDIA 1TT5B 3RFTA 1DRUA 1LDNA 3AUTA 3L4BA 4BO7A 1LDGA 4E5KA 2GASA 3EZLA 3ZNOA 1P3DA 5JC8A 5KCZA 2BLLA 4FJ2A 1DRWA 3VZSA 4BNFA 2OUIA 5L95A 1UXHA 1YQDA 2E49A 2WE7A 4CMGA 1X0XA 4EW6A 2X23A 1UXKA 3MTJA 1KS9A 4OXYA 4ZRMA 1LSSA 3DL2A 2YFQA 3GN1A 4DYDA 5L4SA 2HSDA 4EUFA 3I3OA 3LLVA 4YEDA 4BQRA 1VSUA 3VZQA 1T2AA 3I6QA 3M6IA 2Y0DA 1KEUA 2JAHA 3F1KA 2R2GA 2Q99A 1K6JA 1VM6A 4WCFC 5AXAA 3D5TA 3QW2A 1EBFA 3U62A 1ZO8A 4GLLA 3NT5A 4F45A 2PH5A 4JQCA 4ND5A 2VTEA 3DC2A 4I5EA 5F5NA 3JD2A 4QQRA 3QA9A 4GLOA 1MLDA 3PK0A 1E3JA 3NT4A 5JAQA 1I24A 3GRKA 3RSHA 1H2BA 3WNQA 1ZJZA 1ONNA 2IYOA 4RQTA 2X9VA 2G1UA 2DBZA 5DDIP 1B0AA 5JFOA 2VYNA 1QP8A 5U1PA 3TFOA 5EPOA 5I8ZA 2FMUA 1DLIA 3CUKA 4XGIA 4AJJA 4DBZA 4F6CA 1C3VA 1X14A 4AJNA 5JYAA 1ISJA 2GZ2A 3R3SA 5G0SA 3PIIA 3H2ZA 3RFVA 4H3VA 5CDTA 4MO2A 2O2YA 3S1LA 1XCBA 3QWBA 2OZPA 2PD3A 4YJHA 3VH2A 5BSHA 3BYZA 4CMBA 1R4MB 4FN4A 5THQA 4R68A 4C7KA 1RM5A 2DAPA 2B36A 3FI9A 2QX7A 1E7WA 4M89A 1PJSA 1CF2O 1KETA 4PG7A 4PLGA 4GMFA 1Y1PA 4E32A 4ZQHA 3BMCB 4NBRA 4NQZA 4MINA 1N1EA 4E2YA 5DP2A 2PWZA 5KKAA 3Q3CA 2CY0A 2ZJ1A 4R54A 4WNCA 1HDOA 2O50A 3QVTA 1UZNA 2A9FA 1GEEA 3AUUA 4L4RA 3RROA 4EYEA 1JDJA 3ENNA 4MVJA 1SCUA 4PRLA 1F06A 1HTBA 4BO3A 4R41A 4YJGA 3I6IA 3CMMA 3AUSA 3DONA 3DTTA 4AJLA 5DN9A 2ZK7A 4E2ZA 1B26A 3ZWOA 1LDMA 1TEHA 1VJTA 1UJMA 2D0IA 2V7PA 4IQGA 1YO6A 2HAEA 1YONA 4XD2A 3CZRA 4BS9A 5JDIC 1A4IA 2QZ9A 4CR6A 1U7HA 1E5LA 5GZ6A 1E6WA 1LEHA 1I2ZA 4ZICA 1MUUA 1T2FA 4JLWA 1YQXA 4IJWA 1KC1A 1PWZA 4IDBA 3IP1A 1DHTA 2X0NA 1ZSVA 1AN9A 3O26A 3ABIA 4B3HA 2BRUA 2EP5A 1GUZA 3TL3A 3K96A 5MGBA 5FI3A 1Y8RB 1ENZA 4GKBA 1E6EA 1KVTA 2Q2WA 2Y67A 5A9RA 5J23A 3U4IA 1XQ6A 3GT0A 4PRKA 3SLKA 3VTFA 4I8XA 4B7XA 1HDCA 3U4CA 1NASA 5EJ2A 2PKQP 4WLNA 1RM3A 3WYEA 1HZZA 2WD7A 4XA8A 3VDQA 4IUYA 1ONPA 3KYCA 3LK7A 3HN2A 3U0BA 4WASA 4ITUA 5T8KA 1DC5A 4KTTE 1ZK2A 3WJAA 4CMIB 2VHZA 1JW9B 2GO1A 4CQLA 4M1QA 1YJQA 4H7PA 3NTQA 2BD0A 4PLYA 3OM9A 2B4QA 3TZCA 5KJCA 3KZVA 3FN4A 4YA6A 3TN7A 3VDRA 2DUUA 1Z45A 4R3NA 3ZHBA 2PTGA 1ZZEA 1H6CA 2ZATA 4DQUA 2P9EA 4YTEA 3ON5A 3LT4A 2PZKA 2I3GA 4NJMA 3KM0A 3HADA 1ML3A 4U7WA 3E6AA 4JNKA 4KUGA 4P4GA 2FPIA 1E1LA 2NU6A 1E3IA 2DFDA 2H5LA 3PLRA 4IJKA 5CEJA 4U6SA 4UVHA 3W1VA 4CJXA 1ZK4A 5KIAA 2W8ZA 2IODA 4TZTA 1JVSA 1OAAA 4AJ1A 3VKUA 4W7HA 4HWKA 2Q45A 1XLTA 4II3A 2ZYDA 1MB4A 3CMCO 1I10A 2Q1WA 3NTRA 1TXGA 5L9AA 1DFHA 4L9RA 3JYNA 1NBOA 1PEDA 1H9AA 2D5CA 1C1XA 4GGPA 3C7AA 1XKQA 2CDBA 3K2BA 1EK5A 3VVCA 5EERA 4U6QA 3QIVA 2IZ0A 4FFRA 2JFGA 1HE2A 3AOEA 3PWZA 4BOYA 3PLNA 4R01A 4TROA 4EBFA 2DTEA 3ZWVA 2GZ1A 4PVDA 1NXQA 1C1DA 5I8WA 3ZCXA 3ZWYA 3KTDA 3ITKA 3RFXA 5IN4A 3K9QO 3V1TC 5CG1A 4YVFA 4BB5A 4CM8B 3H9EO 5DZSA 1E7RA 1RJWA 4UUOA 3RBZA 2ZB7A 3JQBC 1N5DA 2WWRA 2EKQA 4FDAA 1X13A 3NRCA 3IAHA 3INGA 2EGHA 3ZWBA 2BFMA 2FHSA 3M2PA 2NQTA 2QQ5A 3WXBA 4A26A 1YDWA 3VZPA 3WTBA 5A9TA 1BSVA 4IGEA 3JYQA 4OOEA 1J6UA 4MIYA 1GV0A 3IKVA 3V1YA 2IZ1A 1IULA 1O6ZA 4B4WA 1MFZA 1AUPA 3GFBA 4QEDA 1XYGA 4TMFA 3OA0A 1NPDA 1E3LA 4XGNA 3BMNA 3N58A 4XRRA 1JKJA 1T25A 1NWHA 4IDCA 2QZZA 3I9LA 4BNLA 4GSKA 2D3TA 2X58A 3GF4A 3EMKA 4Z6KA 4DUPA 3IJRA 5L7TA 5K6AC 3X2FA 4AJOA 1AHHA 4PLPA 1MC4A 3T4XA 4IBOA 3PXXA 2AQKA 2NQ8A 2DQ4A 1N2SA 1C14A 4D43A 4I08A 2DC1A 1ZVMA 1ISGA 1QG6A 4R69A 4R51A 1Y81A 2POQX 1V3UA 1PL7A 5GZ1A 4L8VA 3FNHA 2UUOA 2Y93A 1PTJA 5HRUA 3WGTA 1VKOA 4PLTA 2Y1DA 2ZCVA 3OP4A 4TRMA 4CV1A 2AA3A 4DLAA 3QP9A 2HU2A 2Z1MA 2JAPA 7ADHA 4EJMA 4LSWA 3QV1A 1LU9A 4XYMA 3PTZA 2X7HA 5G0WA 1NHGA 3ADPA 2X5OA 4ILKA 5B1YA 2O4UX 1P74A 3BTSA 2RIRA 1N7HA 4BNTA 2A94A 1H94A 4B3IA 4QECA 2X0RA 4RCVA 3TZ6A 3UKOA 3D4PA 3ZWXA 9LDBA 2AG8A 2YV1A 3O4RA 3DZHA 2VT3A 3WR5A 1P1IA 1U1IA 4XB1A 4RVUA 1PQWA 2BH9A 1A9ZA 1IB6A 1ZMOA 2C7GA 2EW8A 2I76A 3JD3A 4PLCA 4HY3A 1OMOA 3CKYA 2PKQO 3RC2A 4YBZA 4LVUA 3DMTC 1UH5A 4NK5A 3Q2KA 1N9GB 5A3JA 4J1TA 4F6LA 3PFWO 5I7SA 4KOAA 2YQ5A 4B8ZA 4K6FA 2FN7A 5KNLA 2IE0A 2P68A 2WTBA 1PGJA 3B1KA 5ITVA 4ZN6A 5JO9A 2NACA 1EDOA 3H9JA 1ZMTA 2PZJA 3TL2A 3RI3A 1WDKA 1A7AA 1GL3A 3AK4A 4EEXA 1DAPA 4YDRA 2AW5A 2LDBA 5DOZA 4E30A 5TJHA 4Z3KA 1HWYA 4NBTA 3HQ4O 4ZRNA 2XF8A 3ZV6A 4AJPA 3F3SA 4GGOA 4A03A 1SMKA 1GEGA 2V65A 5KKCA 1UXIA 3C8MA 3ZU5A 2E4AA 3U5TA 2F1KA 3Q2IA 4XR9A 4GVLA 4ZQGA 4QTZA 1DAOA 2OMEA 3P7MA 1WXDA 1YBAA 4P8RA 3E03A 3DAPA 3RASA 4XDYA 1NTOA 2NTJA 4PVCA 1NWCA 3HHPA 4EITA 2NU7A 5TT0A 2RBEA 3ZWWA 4CLOB 1SOWA 2Q1SA 2RAFA 5KJ6A 2BGKA 1SB9A 4WEQA 4UULA 3KSUA 3TZQA 3NEPX 4FFPA 4CM6A 2UUPA 2GN6A 4U0KA 2GERA 3GA0A 4JP3A 1LDBA 4CM9D 2P9GA 3IP3A 3PFFA 1VJ0A 5CP8A 1GPDG 4JN6B 3O8QB 1YBVA 1O8CA 2VZ9A 5A5FA 1PJTA 2EEZA 4GSLA 4RLSA 1D3AA 1WVGA 2FRDA 3O38A 4OSPA 2Q1TA 2DFVA 1L7EA 4LMPA 1XSEA 4BKQA 1EE9A 4MVJH 2AHRA 1AXEA 3RU7A 2A35A 4MVJP 2D8AA 4C4OA 3HWRA 2J3KA 1MFPA 1PZHA 1U28A 1O94A 3PQDA 3RUHA 3NGXA 4CMHA 2P5UA 1B8UA 3OIGA 4CL8A 1Z82A 1DFIA 2O3TA 2GN8A 4Q3EA 4WLOA 1LJ8A 3ZV5A 4BL5A 3DZKA 1BW9A 2J5QA 1KEPA 4PG6A 1KY5A 1ZIDA 4AJ4A 4TRRA 4IPTA 4BMSA 2X9NA 5DT9A 4Z0TA 3UUWA 5CDSA 2X5JO 1C0IA 5THKA 2NADA 5BSEA 4J9UE 3UFXA 1XHLA 2UVDA 3I83A 4XGKA 3WSVA 5J9GA 5ES3A 4E21A 1GY8A 4GQAA 2J3JA 5CEFA 5IF3A 3G0OA 4D3SA 4OM8A 3OJ0A 2FY8A 1F8GA 4Q3NA 4ROSA 3S2GA 2BI8A 1C0KA 1YS4A 4DIBA 3I9KA 2V6GA 4BO5A 4XWYA 1W0CA 4NHEA 1NVTA 4EJ6A 3L9XA 5IN5A 2ZQYA 5A3VA 1EQ2A 4KQXA 1FMCA 3L77A 3R1IA 3QY9A 1W6UA 3DR3A 1MXHA 2IEBA 4CV0A 2D5AA 1GYPA 5F1PA 5TT1A 4CMAA 3UGKA 3RJ9A 4LMRA 2ET6A 5IJZA 1FXSA 2D1YA 1R4MA 4MKRA 1K2WA 3W8DA 4R5MA 3D3WA 4ZQBA 4TVBA 2LDXA 1K0UA 3BMQA 2DBQA 4E31A 4NMHA 3LLSA 4O59O 1F0YA 1TI7A 1NVMB 4XYEA 3O03A 4WGGA 3P19A 2PFGA 1IPFA 2A92A 4WOJA 2H9IA 1E3EA 4AJEA 3H9QA 5IZCA 1QV6A 2W2KA 2CVOA 3CH6A 3G49A 3FD8A 2QRJA 4R1TA 2YHIA 4CR7A 1Y8RA 2FWMX 2HJSA 4TSKA 5L53A 3QLJA 1EVJA 2FP4A 3GN2A 4JK3A 4Z0PA 4I5FA 2PK3A 4MJLA 1EVIA 3QVXA 3FBGA 3ANMA 5JAIA 1KC3A 2ZB3A 3DXFA 4J1QA 1ZNQO 5KJEA 5JAZA 1GTMA 2RCYA 3LC1O 1OC4A 4NPCA 4P4LA 2E6UX 5DOVA 4YRAA 5AQ1A 4IY1A 1RYDA 4P4NA 3ZI0A 4KZPA 5CFZA 3I9NA 2VRBA 4BNVA 4BGVA 2C54A 1RM0A 2IXBA 3AW9A 1BXGA 4CM7A 2VYND 1Y7TA 4K26A 1HZJA 3C1AA 3KOUA 3FSRA 1SEPA 3S8MA 3AI3A 2EGGA 4DYVA 1LRKA 3EAGA 2SCUA 1ID1A 1VI2A 4ZGWA 3W4IA 1GQYA 1ISHA 1VPDA 3ROPA 3DZBA 2WD7B 2HRBA 4BIIA 4CLEA 4UEKA 1E7YA 4YQYA 5BNTA 4ALJA 4OQZA 1P9LA 3W4KA 3Q0EA 1KOLA 1CETA 4G5HA 2GGSA 3UXYA 1I36A 4I5GA 4D0RA 3HDQA 2Q4BA 2PGDA 3SJ7A 4D46A 2I3AA 1DDOA 3F6YA 1R0LA 1XDWA 2CSUA 4RVFA 1GZ4A 5KVCA 4FW8A 4XZ3A 1ADFA 4UEJA 5IDXA 3GY0A 1X1EA 2X4GA 1IE3A 3E1KA 3AM3A 4IGFA 3HE3A 5DBIA 2P4QA 2W90A 4JJIA 1JWBB 1GR0A 3NDJA 2J8ZA 1LBEA 4KWHA 1Q2XA 1HSOA 1UP4A 3DBHB 2IXAA 1W8DA 3F5QA 4IJUA 4UEOA 4YAKA 3TPCA 1PGNA 2DU8A 1HLDA 2YFHA 2DM6A 5F3RA 3BHJA 4EUEA 4XDZA 4BGIA 4OXNA 4BMNA 1E92A 1XU9A 4CM3A 3GPDG 2QRKA 3AM5A 4RL6A 1JKIA 3DO5A 3MWDB 4S1VA 2C07A 3H2SA 5G0VA 2DTDA 5H83A 5DCYA 4ZHSA 3DZFA 3WIEA 4CMKA 4RPKA 5IDQA 2NV6A 3NV9A 1HDZA 1ADBA 3AU9A 4YYZA 4FC6A 4AICA 5EQDA 4F46A 1I2CA 3E5MA 5TSDA 1CQIA 4J0FA 4L74A 1I3KA 4R16A 3VZRA 4OJNA 2OP1A 5A9SA 2AG5A 4OKNA 3QWIA 5EN4A 1Q0LA 4PZEA 1NPYA 3C1OA 2I67A 2DLDA 5EL0A 1P1HA 3UF0A 2JCVA 3V8BA 3AI1A 1RM4A 5DP1A 3RIHA 4CMJA 3OFSA 4NI5A 1VJ1A 1SNYA 2QRLA 5I9LA 5IZCC 1MX3A 1WZEA 4XIYA 4DWVA 4IZHA 2NNLD 3MEQA 4W4TA 2GNAA 3W6UA 1B3RA 3QVWA 4BV9A 4CUKA 2CDAA 2NTVA 4PFJA 4M8SA 2P9CA 1HETA 1UXGA 5CEEA 4XQGA 2HMTA 3DMYA 3OQ6A 2J3IA 2ZTUA 4A73A 4CV2A 2VT2A 5T6BA 3PZRA 2ZKLA 4LK3A 1FDUA 3V2HA 5LDGA 5I9NA 4QXMA 3UW3A 1P45A 1E7QA 1YQGA 1LC3A 2WYWA 1E6UA 3SC6A 1IPEA 1GQQA 2JFHA 1FF9A 3RJ5A 3HDHA 1G0OA 1PL6A 2FR0A 3SBOA 1VL0A 3H3JA 2J5RA 1TB4A 3GVHA 3WGIA 3BXXA 3ZWMA 5T8KC 2GYYA 3R3JA 2VRCD 4FSHA 1AHIA 1DJNA 4NFHA 2VUSA 4KTVE 4BKPA 4FOOA 3BTOA 1WDMA 2X6TA 4E5PA 2EP7A 3OIFA 4YRBA 2J5KA 1P44A 4XYGA 4YAJA 3HUDA 4EGFA 1KEVA 4NR0A 4BHTA 4R9SA 1BXGB 2HMUA 4XJSA 1V35A 3FNEA 1LI4A 3NDRA 2AEFA 3DBRA 4PLZA 4CQLB 3MZ0A 4I5DA 5BNIA 2PH3A 3RWBA 4DMMA 4MVJF 1UZLA 4YCAA 2ZCUA 4TKMA 1XGKA 1G0NA 1OI7A 4JJFA 3MJTA 4DL9A 3D64A 2VRCA 1NPTO 4FOSA 1CYDA 3INTA 4LCEA 2VWGA 3L6OO 5JY1A 4E5MA 1R6DA 4QX6A 5AXDA 1KIFA 1OBFO 1B15A 4BVAA 4NZ9A 1HXHA 1BHSA 4J9VA 5JDCA 4RGBA 1GCUA 1U5AA 2VYVA 3U4DA 3DFUA 2PR2A 4WOKA 1Q0QA 4BO9A 1YDEA 4QUKA 4WECA 1T4DA 3W6ZA 4MKXA 2PD4A 4XYLA 5DBFA 2RHCA 4CM8A 2VOJA 4FC7A 1NR7A 1XR3A 1PIWA 4RVDA 4NNJA 4I9HA 1EDZA 1PX0A 1X0VA 5TGDA 3GFGA 2OO5A 1U3VA 3DB2A 5A9SB 1HE4A 3QSGA 4YWJA 3CE6A 4O5OA 4Q3AA 1Q7CA 1LLQA 2YW9A 4YQZA 3ONFA 1EK6A 5G4KB 2ILTA 1PZFA 4WJZA 3I9OA 4PN3A 4U5QA 3GVIA 4J2OA 1ZXBA 2ZB8A 2X86A 4PLFA 4W9NA 4R4JA 1Y9EA 5TC4A 1A71A 2VUTA 3MJ4A 3NGLA 3G79A 3SC4A 5ADHA 1NVGA 4GKVA 4FBGA 3UCFA 3PIDA 5A06A 3LZ6A 1Z6ZA 3WYBA 2FSVA 4KDFA 3ZHXA 4BNHA 2JD0A 2H63A 4EEZA 2B37A 1MXFA 4I1IA 1UAYA 4D79A 3BMCA 1UP6A 5ENVA 3E9NA 2HKIA 2OOSA 3KUXA 1PJ4A 4OHUA 3TNLA 1ZEJA 2D4AA 2P5YA 3WG9A 2B5VA 4BKRA 3VH4A 1QRRA 4GBJA 4TWRA 3F5SA 2BHLA 2EKPA 3S2IA 2GLXA 3S2FA 1WAMA 3ITDA 3AY3A 1EEHA 1ONOA 3BZUA 2CMDA 4DC0A 4KQWA 4GMGA 3UCEA 1M6WA 4CQMD 2VOEA 5T57A 4AJIA 4DA9A 3AFNA 1MP0A 4UUNA 3GMDA 2J6IA 2R6JA 4JXKA 1UUFA 1A27A 3FWNA 1VL8A 2B35A 3RVDA 1E5QA 2BFAA 3M1AA 4E6PA 1T26A 1ZJYA 1HL3A 3P2OA 2EHDA 1T4BA 2VWQA 4NU5A 3O8QA 4RORA 3ONDA 3E9MA 4AJHA 1EE2A 2JHFA 3GAZA 4ND2A 3OJOA 3AY7A 4BO0A 1IHYA 2EW2A 3I5MA 4IDDA 3K31A 4B4VA 3JD1A 2YYYA 4IDGA 2DVMA 1EZ4A 4ALMA 1JAXA 1E1NA 2YUTA 4HNHA 5A02A 1O5IA 1X15A 4NH4A 4E3ZA 4IDAA 1Q7GA 3C7CB 3DHEA 3SX2A 3G1TA 2B4RO 2GN9A 1FDVA 2WJPA 5B4UA 3EDMA 4ESOA 3V2UA 3F46A 4N18A 3KYCB 4JJGA 2FZEA 3TOZA 4CQMB 2IRWA 1QLHA 4ALKA 1HYGA 4YB8A 5L3ZA 5C7LO 4HXYA 3FPCA 3H6KA 4HUJA 4MVJG 3AFMA 3FWZA 2EJWA 1NNUA 3IOYA 3T4EA 2Y0EA 3VC7A 5K0ZA 1ZK3A 4U0JA 4FCCA 3LQFA 4QO8A 5H82A 4UREA 4G81A 4BO2A 2C5AA 5JYFA 4GI2A 5B4VA 3PVZA 4TQGA 4XEHA 3ASUA 3LC7O 1G6KA 1U2DA 5JYEA 1PQPA 3L0DA 1YKFA 2YZ7A 4BNWA 2DUWA 1I0ZA 2AQIA 2W2LD 5HS4A 4RPJA 4BKUA 3TZHA 4D45A 1M66A 4LISA 1LRJA 2J3HA 5C7IO 2XXJA 4YJFB 3ZHYA 3ZH2A 2QG4A 3ZGYA 2BF7A 1PR9A 3GAFA 3NT2A 3VPFA 1I01A 4E5YA 4YT2A 4PG4A 3S2EA 4GL4A 1B8VA 3DOCA 1H6DA 1OZAA 3CZMA 3DAFA 2DT5A 4OQYA 4PLVA 4G2NA 1ARZA 4IQ0A 1C0LA 1DHRA 1T2EA 3COSA 3F47A 3C3XA 1PGPA 2XPCA 5TRTA 1U5CA 3OECA 4YJGB 1HE5A 4DPKA 2PY6A 3I23A 1HSZA 3RUDA 3WGGA 3WFJA 4HBGA 1HDGO 4ZJUA 3GOHA 1ZXLA 4W9NC 4DTIA 5I7VA 3E18A 1UZMA 5TNXA 2Z5LA 3DZIA 3ZZNA 3OQBA 1CIVA 4J2HA 2BGLA 3PJEA 2HJRA 1M6HA 3WSWA 1LXCA 1E7MA 5GZ3A 2AEMA 5A05A 3NJ8A 1RPNA 2JD2A 4EJ0A 1J0XO 4YAGA 3DBVO 1D7OA 3TDKA 4R1NA 4GH5A 3RUEA 3ZW9A 4J4HA 5T73A 1YE3A 1QKIA 3AOGA 1P1JA 2AE2A 3NYWA 1R4NB 3RUFA 4WCDA 2Q2VA 1RYEA 3H3FA 3GVCA 3ZU4A 4BO4A 3GUYA 4ZD6A 4QSMA 5LDHA 3HFSA 2C82A 3C1TA 3NAQA 3ZU3A 4BO1A 4GPD1 1R12A 1PSDA 3LC2O 1M75A 1PJ2A 3QQPA 1QYDA 3NTOA 3GZ4A 1R0SA 5EESA 1GQ2A 5ENDA 4D41A 2ZTVA 2YHUA 2Q3EA 1JU9A 4EZBA 5IFLA 1A9YA 2Y0CA 4A2CA 3EY4A 5FYDA 1ZKMA 1XEAA 5C7OO 4R5HA 2JHGA 3KVOA 3GGOA 3GZNB 1RKXA 4DLBA 5B4TA 2Y1EA 5BQFA 5F21A 3WQQA 4E5NA 3PQEA 2RH8A 3N74A 5KVVA 1XQ1A 4MP6A 2WYVA 4CLXA 1F14A 3VH1A 2QYSA 2NVWA 1O89A 2JJYA 3JQ8A 3PGXA 3VPXA 4WNIA 2O2SA 4ND4A 3JQFC 4CLRA 3OJEA 5G4KA 4CODB 1QSGA 1AXGA 1F12A 1W4ZA 4CMCA 4KMSA 3JQCA 4H15A 4HFJA 1WW8A 4MPDA 1Q1NA 3A9WA 5F1KA 3ZV3A 4EI2A 1U4SA 4GWKA 3WBBA 3VPSA 1HDYA 5A03A 2HCTA 4CM4B 4MP8A 2ZYAA 4RPGA 1CRWG 3WYCA 1UP7A 1QYVA 4LVCA 3DWFA 3TJRA 3C85A 1SEVA 4YJFA 2Q50A 3QWAA 3ST7A 2EG9A 1QMGA 1YOVA 3QVSA 3LDHA 1HT0A 3TWOA 2DPGA 1DC3A 1X7GA 3EHEA 2YHIB 3DMTA 3KBOA 3X2EA 2O3SA 1NAHA 3AUAA 3FNFA 2FSSA 3WB9A 1A72A 1K3TA 4NBWA 3CIFA 3DFZA 1PJLA 3SLGA 1I33A 3GC6A 1NYTA 1P33A 4JP2A 4W7IA 5L45A 3WDSA 3I9JA 1U3UA 3ULKA 4J91A 3DOJA 5AOVA 5KWEA 4RZIA 2EWMA 2Y68A 1N7GA 3D5QA 3A4VA 4HP8A 3IJPA 2QW8A 3G1UA 5C5IA 1VSVA 3D3WB 3OJFA 4J43A 3FTPA 3ENKA 1NQOA 3GNTA 2WYUA 4Y6RA 1C1XB 5F5LA 3GGPA 1X1TA 1Z7EA 4TRJA 1IUKA 3ANNA 4IIVA 2Q49A 1YXMA 2I6TA 4B4OA 3MOGA 4B7CA 1HYHA 3O9ZA 1M2WA 3E82A 2P91A 4PG5A 3B1FA 2VZ8A 1YB1A 3AI2A 4N5NA 2O3RA 4CR8A 1QXSA 4GVXA 2Y1OA 3DBLB 2Q2QA 1LNQA 2W2KB 2HMWA
chains in the Genus database with same CATH superfamily
5KTYA 3FFXA 3NOQA 4CCYA 2R68A 2BCEA 4LV5B 4IMIB 4C1NA 3BULA 4NOJA 4KXLA 4PYJA 2HJHA 2VKQA 1T3TA 1P3Y1 1RHUA 4NY1A 4YDHB 1KMCA 3QE2A 2E37A 4RWZA 4XM1A 2V6FA 5CPFA 5ALHA 5JAMA 3WAKA 3JD0A 1WQ3A 4FVTA 1W4RA 1J9EA 3C74A 3VC3A 3V5NA 3FJYA 3ML1A 5FOSA 1LRLA 4BJ6A 2E4YA 2VZ0A 4LMBA 3HXTA 3RD5A 4YT8A 3T38A 1NMSA 2FZVA 4I50F 4YX9A 2AX4A 2EBWA 4A0SA 2DERA 2CHUA 3AIIA 2GPWA 1FX1A 4ZCLA 3FZQA 2B1JA 2FCRA 1WSDA 2YTZA 2ZYVX 4YBRA 5CK4A 2VHYA 5DYTA 5JTTA 4H6WA 4M8LA 4WKGA 5AUQA 1IY9A 2H9AA 4PZZA 3G8YA 1OA1A 5CM8B 2TSYB 4CMEA 4EUSA 4YRDA 5IDWA 1JG1A 2PMFA 5JZMA 1XU4A 3F4LA 2XWSA 4NCIA 4OXKA 4XDHA 4A8TA 5JJIA 2JCYA 2JFUA 2ZTSA 3QHAA 1HE3A 4IO1A 4W99A 1FNDA 1I94B 3RTBA 4DOMA 2AF3C 1TT5A 1C80A 1XMPA 3OBBA 3KHKA 4NE9A 1I5RA 1KH1A 4MCIA 1LWNA 1JIUA 5B37A 2NXWA 1JIXA 4ESHA 2SNIE 4EHIA 1EVYA 1HE8B 1NUAA 1V8BA 1YAJA 1YHZA 3LG2A 4EL5A 2WNHA 4KOEC 3CRZA 3W5VA 4IDFA 2J0QA 3OO0A 3TUJC 5JIBA 1KHTA 1BWSA 3I76A 4JC8A 3ZKWA 3WFIA 2XCOA 2PKEA 4JBNA 2B69A 2OAQ1 2C29D 4M9CA 3PZBA 4RJIA 3UG6A 2UVPB 5LYJF 2CNLA 4MGZR 4EO7A 4KYVA 3CB4A 4N8EA 3UWDA 5DRTA 1UKBA 2ZLBA 2A0UA 1FEZA 4J0JA 2ECOA 2QAIA 3IIKA 1PR5A 3RQSA 3UAOA 2R8XA 2A14A 2QDKA 2NAFA 5KSZA 5IJAA 3WTCA 4PBSA 4S04A 3NKVA 3KKZA 1J23A 2CHVA 4J49A 1P2SA 1TJNA 1X8LA 3MG9A 2I1VB 5KTMA 1OX4A 3TD6A 5HWSA 4R7TA 4OI0A 1BEZA 3OPMA 4F1WA 2K2WA 4PZ9A 3AJEA 2VP0A 2VWHA 2DOKA 2JW5A 4KZKA 3SR4A 3E5HA 4S1OA 3WC4A 3LV8A 3BD6A 2FX2A 4M49A 1DS6A 4X90A 5IMBA 3A7EA 1T43A 1ZN9A 5ILQA 1M5RA 4ARAA 4URFA 1KAQA 5DTMA 1J22A 1VPTA 3SQOA 1PQUA 2V55B 3HN7A 3O4FA 5LXTF 2QENA 2WIAA 4TV9F 1YUNA 4PIVA 4TV8A 3M6WA 2BHTA 4X3CA 3ZN2A 1T35A 4J1TC 4QOEA 2ZDHA 3SC2A 3GU3A 4KH1A 3DUFB 4O6VA 4B9AA 1G5FA 3QPAA 1ETHA 1LBTA 2FJ0A 4BFWA 1BH2A 1QO0D 4H4CA 1WSBA 2W2QA 5EI5A 2C9ZA 4KX3A 3UK2A 2BUAA 5DXAA 4LDQA 3EVCA 2A9QA 1JDBC 2Y1FA 1YIDA 1UAGA 1W85A 1XTTA 4J3JA 2F3TA 5ITZA 5JCXA 3F6BX 1P7ZA 4BFVA 2CD7A 2HU5A 1Y42X 1X1BA 1N6KA 3WRXA 3EPHA 1NYLA 4REQA 2O6LA 1YHYA 4Q1VA 3UGTA 3VR4D 1NM5A 3Q3EA 1O9GA 1CUGA 2PX8A 3B1YA 3KYBA 4FDVA 4R2JA 1KDZA 1QG2A 2P67A 3QKSB 4EATA 4F9EA 3RF6A 1AHPA 4JOCA 4XRGA 3BF8A 2CXXA 2ZE5A 2ZRGA 2WHPB 3BMOA 1NHWA 2B78A 3NTLA 5E6SB 2R00A 1UDBA 2IDJA 2J3EA 4IIUA 4NX2A 1MABA 3JWJA 5DH9A 2NV2B 4CM5A 5FLXA 1L4MA 4ZCPA 4BFLA 3TQRA 1YMQA 2O2JA 3BGSA 2PXCA 1E2BA 3TM5A 3PNKA 3RS8A 3T5TA 5C4IA 2Q62A 4D02A 4U3JB 3TE7A 1QKJA 5FOTA 2QQFA 5BW5A 3CLUC 3DPIA 4KIFA 5IRCD 2BPOA 4ITVA 4WK2B 3QYJA 2X1MA 4Q66C 2W71A 3MMNA 1JNXX 2NPFA 3OX4A 2ZSAA 3SI7A 1KQGA 3VR1A 3INRA 1OFGA 3CXRA 1DX6A 5JXGA 1Z47A 1PZXA 2DKNA 1MQ9A 1VIVA 4LRSB 2J0VA 2PHZA 2TRSB 3E7WA 2CLHB 4X0EA 4DQXA 1YOVB 3EOBI 4KQMA 3TLMA 2YDXA 3R3WA 1PDOA 3H2KA 3MWKA 4M6WB 4LXYA 1DELA 2JA2A 2X0JA 5ER6A 4CF7A 2CV2A 4YRIA 1WZ2A 1RHKA 3K1AB 3HUTA 4G0MA 2D7CA 2RJOA 3BFKA 4PM4A 2Q46A 5J47A 3HBLA 3QJ5A 4OHKA 3RBAA 3J80A 1HLFA 4AKIA 2W6CX 1O9BA 3MF4A 1KY3A 2TMDA 3C6XA 3QLUA 5B58T 2CE2X 1JAYA 2HRDA 2IBSA 4KSBA 4AG3A 2DBVO 1E1YA 5EPEA 3N2KA 1R8XA 5IAEA 5TF4A 1Y4SA 5LQAA 4B84A 4XI9A 4DV7B 3IOBA 1YL6A 1Q3HA 1ICEA 4DANA 3GPLA 1HNNA 4JQZA 3EGOA 2X40A 1P39A 3UHPA 2CSXA 4XLTA 2WVHA 7GPBA 2VS1A 1UBNA 4PG8A 2XWQA 2XNJA 3MCWA 3CT4A 5A6SA 4E4RA 1S2IA 2XWPA 1CEEA 2Z43A 1UOEA 2Z98A 1H0RA 3OQMA 2UZIR 1IY0A 3E1GA 3KNZA 4QDJA 3KT8A 2VFAA 3S99A 1EB8A 5HIMA 5BSTA 3VR4A 4BXOA 1ZL2A 4KCGA 3FSJX 3F1LA 4JDPA 2BW0A 2CL7X 4Q1FA 5GGXA 5H70A 3RU2A 3WNCA 4RDHA 3DMRA 2OHOA 4EKNB 4F97A 2NTNA 3CT6A 1JDUA 1V6SA 4TVKA 3TRIA 1NF9A 4ZAXA 4NMXB 3TM4A 2EARA 4EF5A 1VHQA 2BSAA 1ZC4A 2C5GA 2VJMA 1FS5A 3ZW8A 1P2UA 4FT2A 4YR7A 3M9XA 4CL2A 4MEBA 1B3BA 4Y1EA 1CQJA 1P5JA 2LCIA 3H5NA 4H77A 5CUQA 3RO7A 3D3EA 4WA7A 5E6UB 1OBCA 2VDWB 4EP1A 4F85A 1ADJA 1Q44A 3RK4A 2EF1A 4J94A 4B44A 3FI0A 4GP9A 1RLJA 1YC2A 2IYLD 1J5PA 2YVUA 3HU5A 3M4YA 4V03A 5IC6A 5LZ5A 3RSGA 1L1QA 2PLAA 2V7BA 3HPRA 4WCFB 3STUA 3NBMA 3O73A 3WGVA 2F8TA 4X54A 2PD6A 3B1XA 1VRWA 4UPVA 4AS1A 3AVOA 4KIWA 1DBSA 2KLHA 1PD0A 5I9MA 1MIOB 1BYUA 2CUKA 2R97A 3PITA 5JNUA 3OMXA 2C59A 4K9KA 1T2NA 1U9IC 3AVUA 4BNUA 1SCIA 3QM1A 5TMDA 4LJAA 3D7NA 1EP3B 1GA6A 2GUWA 4X1YA 3SM9A 3SPXA 4ZCRA 4IFBA 5EXDA 1G4UR 4C6RA 1P0CA 2GD1O 1JLMA 2HO4A 4Z8YA 3DD5A 2GSDA 1BEEA 2PS3A 3WLSA 4V0RA 2FR1A 5KAMA 1S3FA 2Z09A 3KOXA 3Q40A 4PC1A 4YASA 3SZOA 4YR9A 5KX5F 3U4QA 4KKXB 4D0GA 1GNRA 4GUDA 1Z16A 4KHZA 4DKXA 3TQOA 3JTMA 3GLKA 4LECA 4O4IF 4QYIA 4F6RA 1RI2A 2PQ6A 1TLLA 3NG1A 5H9WA 3COYA 4OQNA 4X91A 1GYRA 3O8DA 3GA5A 3U39A 1CJMA 1I30A 1QLJA 4BQIA 2KM1A 4BCDA 3KS9A 1CY0A 2O20A 3LTEA 4DV6B 1K0FA 2XGMA 2XZPA 1U2ZA 4JB8A 8LDHA 3ORFA 3C6KA 4D44A 1Q6YA 2SKCA 3V3TA 1RPZA 1FYEA 1L1EA 3N0WA 4PFQA 5U4QA 5T67A 1ES9A 3W8EA 4XWWA 3MJVA 4KR2A 2NUAA 1VDZA 1ORHA 2DX7A 1IM8A 1LTHR 3FPLA 4G67A 1XTJA 2CF5A 3IEIA 1GCIA 2BCJQ 3CZ9A 1AO3A 3RKSA 3HVIA 1G3IA 1P1RA 1V39A 5LZ4A 3GFQA 4B17A 4EY3A 2WOJA 2BCGY 5CHEA 1ONSA 2EV9A 2X2PA 3TUXA 3L0IB 1A4UA 3EASA 1UKVY 4OF4A 3B3FA 4DW8A 4JDUA 1UWCA 1W5AA 5CD9A 2QSZA 4WFJA 1ZAYA 3ZY6A 2ORYA 4HDNB 4QPPA 1CPYA 1N3BA 2LRHA 2YXEA 8GPBA 2W0MA 3PD7A 4OOFA 3PEYA 4J2TA 1DEAA 1KRXA 2EZ9A 5J5CA 3HRKA 1T9BA 1QYIA 1AIPA 4EDHA 1ECBA 3Q9LA 5IKXA 4NDNE 3K9WA 1SOUA 3LX5A 3KXKA 1A4XA 2VHVA 1YRBA 1SCNE 3UQYS 3VDNB 4N48A 4JVMA 1I7DA 1ZL0A 3EEIA 2REQA 2XNDD 1G8KA 3O7WA 3TGWA 4WLEA 4HQRA 4PS0A 1PVOA 3R4CA 2IUTA 1NJSA 5TMBA 1KK3A 1H9BA 4CL0A 3WGZA 3TQHA 3NKLA 4LC1A 2YDYA 2Z3VA 4LCJA 1X7DA 5HBRA 3VYSB 4YQFA 3MC1A 4RPHA 2PRYA 1T4MA 2BI7A 3C43A 5TVGA 3FKJA 4ZO8A 4NESA 5IASA 3W5CA 5CB6A 4XJXA 2ZWPA 5A5EA 3DUFA 4AY4A 1F4VA 4FYIA 1PRYA 2ZUWA 4WZAA 4ZALA 4W8GA 4B2PA 2I4MA 1T5HX 2VSQA 4D9NA 5CJJA 4B74A 2OLKA 8OHMA 5IVHA 5FOVA 5LN1A 3UOGA 1NW6A 4DLLA 2PXXA 3I2JA 1UBRS 3FAZA 2BKAA 3CX4A 1QPBA 5JSUA 3E9ZA 1E0JA 4TZKA 4MVWA 3K5PA 4Z4EA 3PF9A 2Q5FA 3H42B 3WGYA 2HCRA 1UDAA 1C7QA 1KFJB 4DN6A 3B1VA 2RG7A 2XECA 4DG5A 5CDGA 5HJ5A 3DLBA 1BRTA 2VA9A 3OZUA 5BSKA 1AKMA 4G86A 2VK8A 4S24A 1F5SA 2CXRA 1EB9A 1DJQA 2GZMA 4D0NA 1L7OA 2PLFA 1LH0A 3PDCA 4ZODA 4UTVA 2NO5A 1D1SA 4EA6A 1J1IA 2XQJA 3MYYA 2P5SA 4I50B 4O8CA 2JGMA 1GDDA 4NK4A 1EFKA 2P8SA 1K1EA 3IMCA 3VO9A 5DNAA 4ALLA 4YV2A 5HRAA 2IP2A 4J90A 5LMZA 4KE9A 1HG1A 5ICEA 5ER9A 5IHXA 1E3WB 1LW7A 1Z6TA 3H5IA 1P7PA 5CFMA 2WK1A 1EA7A 4IFTA 4ND3A 4R9RA 5BUSA 3U09A 4N3CA 3MW8A 5I7UA 5J63A 5JS7A 5B1IA 3IUMA 1I4LD 3K92A 1LSJA 4P4SA 4NU8X 1YRQA 3G2MA 4P33A 4PPYA 4RSGA 4UXIA 4WESB 1VYTA 5AI9A 1I14A 3SEQA 5C8ZA 4BMVA 4YDQA 2NIPA 3W2FA 4KQHA 3PHIA 4WD3A 3U0VA 5LCXA 3CVJA 2OGUA 4QRHA 3ZNQA 2RGDA 3GDFA 4ZTUB 3E9CA 2WTEA 2JEOA 4E07A 1GUYA 5EMLA 4DR3B 1PJ3A 2ZJ0A 5BNFA 2RAVA 3IIMA 1GCGA 1M67A 2ZDGA 3GARA 5I4CA 2FP4B 2HD4A 2XXBA 1WPRA 2HEIA 3H4IA 3K73O 2IYFA 1YGYA 3QBVA 4DRYA 5DGXA 1TVMA 4OKIA 4MRSA 5CHYA 4KIUA 3QXXA 3FVTA 2R8ZA 4KN5A 1YDFA 2L0XA 2E1PA 4S2EA 4QAQA 5EIAA 5JVDF 4J16A 4IDQA 3H9UA 2J9FA 3MUEA 1E5TA 1YMVA 1BDMA 2DFTA 3QPCA 4ILEA 3DCNA 3FWPA 4IF6A 4URXR 4UPDA 1K98A 3H5VA 3KLNA 1YCFA 1Z2EA 3TIXB 1G66A 1TPZA 4N5LA 3U3XA 2F3RA 3DV0B 4QT0A 1UBCA 2EOAA 4HJXA 4HEHA 3QELB 1JG3A 3R2JA 4IMPA 4TKUB 1R5JA 3KSMA 1SD5A 1CJBA 3EC1A 4RLHA 3BFVA 3M49A 1E9SA 2OENG 3FCSB 1D5WA 4C06A 4EELA 4YJ3B 3P71T 2ZJAA 3MBIA 5F9HA 2VNKA 3ICVA 2E3JA 4MLZA 1ODLA 3ZD9A 2G17A 2GX6A 4K9NA 4K9SA 3ZE0B 2R11A 3FRIA 1OTHA 2PBZA 2VNSA 1XROA 2YJZA 2Y1WA 1ISRA 3QLVA 1KMHA 4QO7A 4UNIA 3REFA 4O02B 1JG4A 1ZMRA 5L3QB 2QN9A 2CZCA 4NBKA 4CU2A 3K16A 4DDHA 2UVQA 1LLCA 3EW7A 4IIEA 3JR3A 1GZ6A 2C3MA 3E9DA 1DMSA 2G9NA 5A7FA 3O4HA 1ZK1A 2ZULA 1I7LA 3VNSA 3WYDA 4DKJA 4CFYA 5TV2A 2I4OA 1SO8A 4OH1A 2X8JB 1HUQA 1YB7A 1NV8A 2Y1XA 3ZV4A 5K20A 5EEHA 1G18A 3QU7A 1DBPA 3LRPA 3ONEA 5FPTA 1NR5A 3G2NA 4CKWA 4RF2A 1KJWA 1OT5A 1SU7A 2AH5A 4NFLA 4DSZA 2AFIA 4KGZA 3UC5A 1T2UA 1U28C 4DCGA 1QBKC 3ICPA 4DT1A 4FNMA 2JJ1A 2KMLA 4UNPA 5AVOA 4LI3X 3WGJA 3SXUA 3ZOKA 4ALIA 4EA8A 1L5HB 5B3KA 3KJGA 3RDPA 5TIIA 2A7XA 2F62A 4YV1A 4GZMA 2PIAA 4MS4B 4D3XA 3W5AA 3HEAA 5AKGA 2E82A 4Y2PA 1EPUA 5K3AA 4W5OA 4EKEA 1M76A 4H6XA 1EUCB 1KY4A 2R44A 1C3OB 2ZBVA 1L4LA 1XLTC 4MVCA 4MUJA 4H3SA 3T3DA 4DDKA 4GT1A 4L73A 3T4UA 2UZ1A 4EG5A 3L6EA 3PCRB 2PZGA 2E18A 3RRJA 3S44A 5FWXA 1CIJA 4NP6A 5ALTA 2RHGB 3KLMX 4C6HA 1SKAA 1V0JA 2FSGA 4E1VA 4RL4A 3OI7A 3ABZA 3EXEB 2IP1A 3L8CA 3COWA 3OCYA 3E5NA 3I4LA 5CG2A 1RAFA 2DSNA 4OMUA 5K0FA 1FX0B 2WPDA 3SK0A 1NBMA 2GZ3A 2NN3C 2WVGA 3DZCA 3RKUA 4Z4FA 5ECWA 1OOEA 2AE1A 2CD9A 3L8ZA 3BH7A 4LX0A 1M6VB 4WCFA 4DC1A 2FK8A 1YHNA 5ELLA 5SZJA 1ZGZA 4NU6A 3UV3A 3KV3O 1Z6PA 4Q1DA 2I65A 2MR6A 2OCGA 2B25A 3O0DA 3P96A 2I1WA 2NZVG 4OCZA 5EE0A 1XK6A 4KQ9A 4XIIA 2O2GA 1MG0A 4HDNA 2Q8NA 2AHOA 2WEKA 3HU1A 4NCKA 4WK4B 5I4KA 2HL6A 4ZYLA 2GN4A 1N7JA 1KGSA 4RIFA 3AKZA 1LBHA 1R00A 5ICMA 3CJTA 2P6RA 2W2LA 4JIGA 3U4AA 3WX0A 1FZTA 4UDOA 1IWOA 1OYYA 2BGJA 1XQXA 3SYNA 4KLRA 1Q20A 1HFKA 5L6LB 3MWEB 1TF7A 2LE0A 3HR4A 3I42A 1AZLA 2ZW9A 3CUUA 4Q9NA 1M0EA 2EQAA 3BA1A 2WLTA 1VG9B 3NRJA 4Z9XA 5A2GA 2EJCA 3L93A 3DDNA 3ZHTA 1H1DA 2CMGA 5FR2A 4PN7A 3EFEA 3IIJA 4P3KA 5EZYA 1JZSA 2HA2A 3N28A 5HCNA 4D8WA 1NLMA 3KB1A 4MVJD 3C3WA 4J16C 3HB4X 1BTOA 2G4LA 1QDUA 4NBUA 4BQPA 2HRQA 4HTFB 3WZLA 2IXEA 5BWBA 1T8YA 2VK4A 4DRZA 2XX3A 4PC7A 3P8ZA 1NI4B 1B2LA 1EQUA 1HDRA 2ZAGA 2OORA 1KBQA 3DNFA 3MTDA 4Z3DA 3RKRA 3T7IA 1AM4D 1HOTA 4PGMA 2IZZA 3BB1A 5LNK1 2GM5A 4MQFA 4QGBA 2WKWA 4P83A 3L7CA 5D3QA 2AFIE 1TF2A 4ONEA 3PXGA 4YMHA 3BHNA 3HKBA 1HR0B 2WMYA 3LPMA 1ISIA 2YW2A 4HNQA 3L5KA 2H4FA 3HDGA 4G97A 4PINA 1CRQA 3S0JA 2EQBA 5DF1A 4A10A 3PYXA 4GZLA 4JUAA 3ZBQA 3M89A 3ZVNA 2FPKA 5IM5A 3W5BA 1JAIA 2ZIZA 2Q9CA 3O4JA 5BQ5A 4UUMA 5DULA 1FP4B 1DIHA 2BT4A 3DKKA 1RZVA 1E3MA 3LIIA 5H81A 4AZWA 3FF1A 1XD9A 4YALA 4MKHA 3QYPA 4DLNA 1R0ZA 5KNCA 1HDXA 4BWYA 1ZUIA 2QUHA 1ZUNB 2II6A 3B78A 1J0EA 3LVQE 3KZ1E 3QPDA 2Z8YA 1NN1A 5D86A 1HH4A 5HDBB 1C7FA 4Q6BA 2V3CC 4O4JF 4MS1B 1YASA 1A2OA 1FXWA 2AOVA 3CSDA 3E8MA 3IESA 3QVKA 4JEIA 2D2EA 2ZXUA 1EJ0A 1YB5A 3I45A 1UM8A 2WIBA 2QRNA 3GQBA 1OBOA 1KQPA 4CRWB 1VMKA 1JDNA 1KZ1A 2RHJA 3MMPA 3Q4GA 2ZVQX 1W96A 1P4HA 3K0HA 5IJ9A 1L4FA 1ZKDA 2JJ2A 2WQ6A 1QVVA 4HDCA 2CBXA 5B6PA 3QENA 3JQEA 4II2A 5CNKA 4DSTA 3H8JA 1YC5A 3AG6A 3M6AA 4B75A 5JJCA 5K3EA 3WAGA 1AKEA 1QFZA 5JD6A 2XUQA 4AG6A 4QFCA 1K92A 4O8JA 2D0PB 3F8TA 4HVAA 1BKDR 3PI7A 4POAA 4WAUA 1QE0A 5EQFA 4HD8A 1Q84A 2JB9A 3PUZA 4JLMA 1UJ4A 2AGVA 4OHVA 5KYUA 1CHNA 2BFPA 5DM0A 3USES 4DMGA 2PX0A 2RGUA 1J2RA 3DVAB 3FFTA 3QKTA 5JE8A 3VHRA 3TMAA 3VKWA 4CMEC 4G1CA 3CIOA 2P3OA 3P97A 4J1NA 4QFDA 3PL1A 2ARKA 1LJLA 4JBGA 2DBYA 5A4MS 2HDNB 1DWPA 2JGLA 5DLEA 2Q27A 1Y63A 1MA3A 2CUZA 1BS2A 4ZEOA 3ZYCA 3WQSB 3GAMA 2A7QA 4HDRA 3VOBA 4FPXA 1KEEA 1QH1A 2XY4A 3JQGA 3NBZC 4ENPA 2HO5A 5T64A 4GMHA 3U6BA 1Q1QA 4HAUA 4QBKA 4DMLA 2PGOA 4Q1EA 1RI4A 4XCQA 4ZCQA 3QELA 4TKUA 2YC4C 1E3WA 2RCNA 3LWDA 1V9CA 2JJ8A 1GPWB 3W2IA 4KXNA 1X87A 1OWNA 4TKLA 1MO2A 1U0RA 3OE1A 1E9VA 1WO8A 1CDOA 4OJKA 4PSVA 1ECLA 1MRNA 2BE9A 2VUUA 4LZLA 3F98A 3WV5A 2BF4A 2PLRA 3N7UA 4K9DA 3MXTA 3UB4A 4JBWA 5ENZA 4EFDA 4INOA 4M9QA 5T4HA 1P2DA 2PKWA 3DEKA 4P32A 4ZOEA 4QHYA 4L8WB 4HLUC 4WBXC 5C35A 4MYTA 1RI1A 3A9VA 1CG6A 3D7LA 3N6RA 1IVNA 5DN6A 4C22A 2YVAA 3DJFA 1TTHA 1A82A 2NU9A 1WLYA 1LW6E 2RH4A 5DCUA 5K8IA 4MDEA 1H93A 4P2GA 5KVSA 3BJRA 4AXXA 4HVTA 3LT5A 3LNTA 1EWTA 1ZVKA 3KB8A 4B2IA 3WKAA 4L7VA 4DIMA 5CIYA 3KUCA 1NONA 2OYSA 3IS3A 4RQUA 3ESXA 1KZ4A 4Q34A 2FZCA 5JCJA 1WVIA 4E13A 1T4CB 3IHLA 1R37A 5DHTA 4GI5A 4FT4A 4AJKA 3VFDA 4C29A 4XX1A 3H2HA 1TTPB 2Q1UA 5K0NA 4GOXA 3F78A 3QQ5A 4IXWA 4TWZA 5EMHA 4EB3A 4YRCA 1W7AA 4XFKA 3GGSA 5AKLA 5CTAA 3LFHA 1P1KA 1JHMA 5DWDA 3IB3A 5EKDA 4BGUA 4KH0A 4KQEA 2ANCA 1R15A 2AK3A 5CT4A 1U0GA 3ZNPA 4RIHA 3QVGA 3EIXA 3PJRA 1DJMA 1T8RA 1I0IA 1NVBA 2NYVA 4YRMA 2BHRA 3G88A 4RKFA 4E15A 1RR6A 4CLDA 3NV7A 1I5OA 1Q0RA 3OFKA 4G1VA 3T3EA 1ZNZA 3M4NA 3OTGA 3FOAA 1YUBA 2OKCA 4QJ4A 5JZ9A 1MTZA 3U1VA 2ORVA 1FK8A 1FQWA 1GZ5A 5J1SB 4KXQA 3QRWA 5CW1A 3V8PA 3F5MA 4DHEA 1LDYA 1VKHA 2H3HA 1OYWA 2DR3A 5FBLB 2X5XA 4HS4A 1RQ7A 2DP4E 3GEDA 4CE6A 3JQ9C 1GPMA 1JZTA 1Q11A 5CXXA 5HG0A 4F4UA 4F71A 3FZEA 5D5PA 1XHEA 3D1VA 1A2QA 4IINA 3IUSA 3CF4A 1E62A 2VP4A 1Z18A 3UJBA 3W78A 3IE1A 2DQSA 4ZV7A 2VNHA 3CURA 3IEVA 1KHHA 4FS3A 5CPBA 1PS9A 2Y05A 5EZ5A 3PF8A 2JLSA 1J99A 1JJFA 1OWOA 1YZHA 1Z0UA 2ZT6A 3I92A 5IAGA 3RU9A 4C6SA 5K05A 3L4SO 1B0ZA 1QU2A 2Y9PB 3EWIA 3VYTB 3U7EB 2Q5LA 4IJVA 5JXWA 3DNPA 1IDN1 1IG0A 1Y7PA 1IRXA 4IGIA 4PZCA 2PDAA 3LX4A 1FXUA 1NW7A 2R84A 2X9LA 4KAJA 2O3QA 4M22A 4WZAE 4B35A 4MIOA 3R20A 5LMUB 3QUAA 3E1SA 1GLNA 4UEQA 3CPHA 3E9YA 5IEJA 4RTQA 3HBAA 1N9GA 4D3DA 4PAQA 4DLXA 3GMSA 4Y6LA 1GPKA 1RWBA 2FOXA 2B5OA 1E9EA 2VAPA 4NICA 5AVZA 3DYIA 5H68A 2GYVA 3TW3A 1XNGA 5LL6P 4BVLA 4XPZA 2IUSA 3B20A 3QLUC 3VC2A 4EGQA 4CKEA 3HEMA 5LQKA 3U4QB 1U8CB 4FJ1A 2A1IA 1OR8A 1RQLA 4DM3A 4PBRA 5ICCA 1XRRA 2FN9A 3KQPA 4JLPA 1JSCA 4PAGA 5E7MA 5LIPA 5JYDA 4MYUA 3NBFA 2JVJA 1Z0KA 1W9MA 1Q14A 2D2VA 1ODTC 2R96A 4X1OA 4E7PA 1WZCA 3B2EA 3HA3A 5FI1B 1Q95A 3BTVA 5EPUA 1BCSB 5BV0A 1IHPA 4BKMA 1I80A 3H0CA 5DM2A 3OQOA 1E5DA 3KVVA 3JCZA 2BHNA 4M9ZA 1LTQA 1QAMA 2RGGA 2IJGX 1KYVA 1TKRA 4RVHA 5M3BA 4E12A 3BMQB 1Z75A 3E27A 2VPQA 3SSMA 3QMPA 5AW4A 1DVRA 4M2LA 3DZ3B 1UK7A 1YZKA 4EECA 2Y76A 4GR9A 2ECPA 3OPNA 5L4LA 3DDHA 4XWOA 2CZGA 1AA6A 2CN1A 3UC9A 4HI0E 3EFOA 5BSMA 5FYQA 3NTXA 2FPPA 4XVQA 2QD5A 5AESA 2EX0A 4MVJI 3Q8XB 1NP6A 4LWQA 2IOQA 3TBKA 2HDOA 4XGQA 4KLAA 4Y1RB 1L6IA 1UM9B 3NONA 4OYRA 4YO7A 2ZSBA 4ZOAA 5EZQA 3DLHA 4OAOA 4H1TA 1PJAA 1PWHA 1RIFA 4H3KB 1J2EA 2WIDA 4J75A 4J7UA 4V3CA 1RXIA 2ZVDA 1A7UA 4H7EA 1QTQA 4WESA 5IT0A 1G21A 1DEKA 3PHJA 1RD4A 4JGBA 3W0LB 4QTYA 2I34A 3ROTA 1NVUQ 4K9MA 1GYQA 3DBRB 1N8NA 4AUMA 1J56A 2UAGA 3FCOA 4FFVA 5IH3A 1IZ9A 5AHKA 2CBZA 1BJTA 1TD9A 1ULHA 2EJBA 2O0JA 1FFBA 4HL6A 4M0KA 4MTLA 4WZBE 5FOUA 2AS0A 3L0OA 5IWAB 3M5PA 1RYZA 4OHOA 2OEPA 1ESZA 2R8EA 4IAOA 1XCMA 4RFLA 1ISMA 3T99A 3OQIA 4Q9LA 3JZFA 1V47A 2AB0A 4NZYA 3MWFA 3EFBA 3ANLA 3VC1A 4OBEA 1Z6YA 5EE3A 2PGLA 1JQAA 2GPYA 4CZ2A 1CUDA 1TT5B 2Z5GA 3AH8A 3BJZA 4HDOB 4I2VA 2OOKA 4JAVC 1SXJC 3CLSC 4R8LA 1C7IA 4JR0A 4JD5A 2YJ6A 4RW0A 4LOKA 4PPQA 3Q2OA 4V0OA 1KE1A 4CF5A 2YWGA 3L4BA 2Q0HA 4Z2AA 7REQA 1DCFA 1KZYC 1F2TB 1VHJA 5KYXB 1FNMA 1AF4A 3EZLA 3FX2A 4B4KA 1JJ7A 3ZS9A 1VPEA 3PA8A 5KCZA 1TE2A 3QVGB 3GLHA 3HRHA 3TEMA 2ZS9A 4WDRA 1KZ9A 1NVVR 2FWPA 1HC7A 3VZSA 5BVGA 5HUJA 4Z1MA 1X0XA 2UYQA 3SDBA 1EK1A 4EPVA 3BBPA 4WFIA 2G0NA 1DV1A 1XZCA 3GCDA 3HUEA 3DL2A 3MT9A 4OXYA 5F4ZA 4REOA 4FWTA 3TE6A 1E4OA 5F77A 2HSDA 3O90A 3I3OA 3TVDA 5IANA 5EJGA 4BQRA 1VSUA 3VZQA 2X13A 3I6QA 2LUOA 3MD9A 3DZ4B 2IBTA 2YC2C 2Y0DA 1KEUA 1PQYA 3H5WA 4C0QC 5AXAA 3M83A 4KJZA 3QW2A 4I6JA 4X6XA 1EBFA 2CLDX 3NVKI 4BX3A 3NT5A 1T1GA 2H85A 1TU0A 5EHQA 4DZTA 4EBBA 3KQWA 1JEQB 1G8JA 2JGDB 2VYCA 3L1JA 1E60A 1T8TA 3L7BA 4JQCA 4ND5A 4OK6A 4AYTA 2VTEA 3DC7A 2ZBFA 1ZDMA 1OXMA 3O4IA 4I5EA 4FOPA 5F5NA 1OLSA 3W9YA 3AVQA 3BSFA 3ZHRA 1BC5A 1JSXA 3PK0A 1E3JA 4BQQA 3NT4A 2H59A 4WBNB 5EJEA 2WRZA 3MM4A 4FX5A 3RSHA 3IP5A 2YR0A 4LHZA 1M34E 4MPTA 1NF8A 3GFTA 1QH1B 4AUKA 1E64A 2G1UA 4RTMA 2BE7A 1E2DA 1QP8A 3ACCA 4XFDA 5ARBA 5ESRA 4ANFA 3CRMA 2AR0A 3A6PC 5FBRB 2QXTA 2XMSA 1B6GA 4MW4A 4P53A 4DIEA 1CUVA 2BBOA 2EFDB 1ISJA 5FTJA 1MOQA 3HXLA 2RB5A 2IV3A 5CDTA 3V8QA 4FOTA 1GKUB 3A6EA 1CD5A 2BV3A 4QXPA 3S1LA 4UNRA 4Q00A 3VH2A 4L5IA 5F2EA 1R4MB 4CMBA 4F2HA 1JJAA 5THQA 1QJCA 1T9DA 1RM5A 1P73A 3JASA 1SWVA 4DXAA 5K5EA 1E7WA 2IY9A 2R60A 5ALYA 1PJSA 3T7RA 1QU3A 4Q7KA 5MN5A 3TD9A 4PG7A 1CJSA 2O8VA 1JQEA 4LXGA 3U19A 2BC9A 1DNPA 1PFYA 1ZGCA 4TV8B 2ZAOA 4C76A 5CA1F 2IZOA 5JS1A 2XT9A 5EIWA 3LYHA 4ZCSA 4B0OA 4JKIA 5DBEX 5KKAA 3Q3CA 2CY0A 5KS2A 2ZJ1A 3DPUA 1AZTA 3QKWA 1XPRA 4LJ5A 2A9FA 1GEEA 1I4DD 2H2FA 2XQKA 5K09A 2DH5A 3CVOA 3B6JA 2WFMA 3ENNA 1SCUA 2O2CA 3MUNA 4R98A 5DHSA 2ZFUA 2JH3A 1KSFX 4G1UC 1X3LA 2DULA 5ALFA 3GEHA 4MQLA 1CNFA 3L3BA 4RAOA 1YZLA 4AJLA 1YDMA 2QRQA 1GTZA 3W3ZB 3CR3C 4C4RA 2XADA 3B5IA 2EF0A 3BWBA 4V02A 3ZWOA 5AJTA 5K8TA 2A0XA 2D74A 3DFMA 3PICA 4WV3A 5JXJA 2V7PA 2YWFA 5JNVA 1EAYA 3PQ5A 4IQGA 4QA9A 4M1SA 5MHTA 4MW7A 1YO6A 3BVPA 2LIVA 2IOHA 1UIRA 2P9YA 3UPDA 5C8YB 3G0DA 5F64A 4JJZA 5CLJA 1QTRA 1U7HA 5EKXA 5GTDA 1QQAA 1NUPA 1P8JA 2P1ZA 2PS0A 3FB4A 5GZ6A 3O5AA 1JEJA 1I2ZA 4OK5A 4EW3A 4U7PB 4YMWA 1MUUA 1WCIA 4KQFA 5FORA 1RC1A 1T2FA 2AI1A 4O4JB 2V54A 1EG2A 1Q0PA 1Z6QA 2XDQA 3N39C 5CX1A 1D6JA 4IDBA 3X1MA 4D4IA 2Q28A 3IP1A 2ZPTX 4QQKA 5I7RA 2AWOA 2D0DA 1N2CB 1FE8A 1UMCA 3UT0A 1OI4A 1WHTB 3QMWA 4BQFA 3KOWA 4YROA 2BRUA 4RLFA 3TL3A 2PCLA 2Q3BA 2ZI5A 3CGWA 4WNAB 3MTAA 4PONA 1MAVA 2FUG6 3RVJA 5LDDC 3PR3A 5J23A 2W6OA 2YIJA 3U4IA 1XQ6A 4PRKA 3QBDA 1QFYA 3ORRA 2D1TA 4I8XA 5UKDA 1T8SA 1NSTA 3WKCA 2G08A 2OY0A 1S9HA 5EJ2A 1Y1QA 3IGFA 3U7QA 4KMRA 1KQ3A 4K05A 1RZUA 3U1TA 3ZVKA 3LK7A 4LZAA 2OHJA 1K7SN 2ACVA 4QLOA 4Z0NA 3U0BA 5E0OA 3LRXA 4YMSA 4Q93A 3V1LA 5BNZA 1PLKA 1ZK2A 4DCVA 4CMIB 1TQ4A 5IJWA 2GO1A 4LDRA 4BWVA 3WO0A 4H7PA 1US8A 5E6RB 5J2UB 3NTQA 4EG0A 2BEUB 1ZMXA 2ZQ5A 3E2IA 2H7XA 4X1KA 5KYYA 3KZVA 2C83A 2O8NA 3PC7A 4YA6A 2V4ZA 3E3NA 4JVOA 4R3NA 2RB4A 5BW6B 4ER5A 3LW7A 3G89A 1R10A 4Q24A 2YKGA 4O2LA 1Z5NA 4D2IA 3LT4A 3SHTA 4JMLA 4DQ0A 4DCTA 2WT8A 1ECFA 2BM9A 1RYFA 2BGTA 3OZFA 3O9VA 2H7VA 4K03A 4PYKA 3RPEA 3TLGB 1ML3A 4NLLA 4DQLA 5LQCA 4KUGA 2FPIA 4JJEA 4ESEA 1N3YA 5SZIA 2DFDA 4NTZA 1T5BA 4U6SA 2B4YA 3EVAA 4NONA 4R8MA 3MGBA 3L4KA 1KI6B 5DLDA 4O3MA 4HYQA 3FE2A 3IXQA 4DMRA 4RTOA 1KI8A 3Q10A 3QVVA 2BKXA 3EBPA 5BW4A 1RWPA 3PT5A 5BN3B 1UFRA 1VLHA 4TZTA 1ZR2A 5JG7A 4L6CA 4B3MB 3KV1A 5TARA 4W7HA 3VKUA 2RGEA 4HWKA 2PGIA 1GGKA 4WVLA 1XLTA 1X8KA 5EXTA 3SYKA 2RHTA 5KDLA 3C3BA 4YECA 1H66A 5TEVA 4M9SA 4ZQIA 1DQPA 4UAJA 3G5UA 1PEDA 3EQ2A 3RSSA 3A9TA 3I8SA 3AY0A 2K6GA 5EKTA 1SIBE 1N3IA 1LKZA 4AP6A 2UYHA 3T61A 1AKNA 2OORC 5EERA 1X74A 1M2OA 3OEHD 4FFRA 1VGQA 1OFTA 1ODJA 2JFGA 5ALWA 5B53A 4Q37A 5JCZA 1PQ4A 3AOEA 3DO6A 4UTOA 3PWZA 4TROA 3NRBA 4MQUA 4R01A 3D6UA 3ADDA 1U0SY 2YZGA 1GTG1 3PKIA 4JA2A 4O1HA 4UOQA 4MJXA 3T34A 4RKWA 4AX4A 4QVGA 5I8WA 3ZCXA 3ILSA 2Q0XA 1T6BY 1G60A 1M2KA 3K20A 3KTDA 3TLCA 2QS9A 3V1TC 4BYGA 2NP7A 3ECCA 5FQOA 1SELA 2H3EA 2FVYA 3DJYA 3TCKA 3PGLA 2A84A 2OGWA 5DZSA 2CW5A 5JMTA 1RJWA 3RFFA 3OC6A 4NE2A 4WJKB 3TJMA 1N5DA 2RE8A 4BFYA 2EKQA 2R1VB 1E0KA 4LJLA 1MRSA 3P0RA 5KI6A 1X13A 3NRCA 3IAHA 3INGA 1HI9A 4HZIA 5ADUS 2BFMA 1RMYA 3K9HA 2NQTA 2G9ZA 1YDWA 1Y8ZA 4OTZA 2OHHA 5AJVB 1BSVA 5TEWA 1JLRA 4IGEA 4OOEA 4WY8A 2ZRKA 1ZD1A 3V1YA 4KXYA 3LLCA 4B40A 1O6ZA 5JJLA 4OFXA 3IWDB 1HTTA 1XMJA 3AR3A 1BFDA 3LKBA 3T1QA 4C6TA 3V6LA 1JKJA 3C7KA 3H9BA 1Y80A 3OT4A 2QZZA 3I9LA 4HT3B 1ZJWA 3PI6A 2PT5A 5ALIA 3TRKA 1RNLA 2I7VA 3NXKA 4ZREA 1C8BA 4DUPA 1T91A 2MYPA 3M6MD 1R4ZA 2GTPA 5I47A 4GE0A 2ECQA 4PLPA 3U17A 2HRCA 5CLLA 1SVSA 3D2LA 3RTAA 4IBOA 2JBAB 2OAGA 1RWKA 3GP3A 2AQKA 4PSCA 3VX4A 3AF3A 3E9RA 3BBLA 3JASB 1C14A 3GLIB 4D43A 1TA0A 4I08A 3S29A 1G1MA 3GGDA 4IXNA 1MC8A 1RRFA 4YAWA 3OJWA 1Y81A 4E11A 2POQX 1M2FA 3FA2A 4BVJA 4EJSC 5G1NA 4RETA 4YUZA 2Y93A 3HB0A 5HRUA 1G2QA 2VT7A 1VXRA 3ZJVA 1EDDA 1QONA 1T5IA 3NBXX 4BC0A 2IHNA 3LECA 1N2EA 1A8SA 1CZRA 5C18A 1IPHA 3JVUA 2B1IA 4TRMA 2AA3A 5LYJA 2C8KA 1C81A 4XVHA 4CV1A 4F5WA 5LMCA 3QP9A 1POXA 1E1QA 2PJZA 4FGJA 2J0UA 3EQZA 3TEFA 3V9PA 3K6SA 2PKXA 4FGZA 1Y9ZA 5BVGB 1KO5A 2A0WA 2EWVA 3NM6B 4F56A 5ALQA 1N2IA 1XB2A 3QVLA 1SCUB 3R6GA 2GHTA 3ABOB 5AM5A 5K4HA 1TIBA