1BS0A

Plp-dependent acyl-coa synthase
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
383
structure length
382
Chain Sequence
SWQEKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLLTLTAAHEMQDIDRLLEVLHGNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
publication title The crystal structure of 8-amino-7-oxononanoate synthase: a bacterial PLP-dependent, acyl-CoA-condensing enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 135
structure length 382
sequence length 383
ec nomenclature ec 2.3.1.47: 8-amino-7-oxononanoate synthase.
pdb deposition date 1998-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1bs0A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1bs0A01
1TOIA 3D6KA 3EI7A 4W8IA 3GZDC 1H0CA 4GRXA 1ASDA 3F9TA 2EGYA 4BMKA 2FN6A 2JG2A 3WCOA 1CS1A 4WXFA 5EUDA 2AY2A 2FNIA 2HZPA 4F5LA 2YKUA 1OHWA 4K2IA 4EMYA 4GSAA 2W7HA 4Q31A 1CZEA 2Z9VA 3DU4A 1XI9A 1PFFA 1UU2A 4EB5A 1ELQA 1AJSB 4LNLA 1UU0A 3JWAA 3FTBA 4J5UA 2RFVA 1OHYA 1MDOA 1CQ7A 3QPGA 3FVSA 3NYSA 1H1CA 3USFA 3W1IA 1VJOA 4JE5A 2VMYA 3FDDA 2TPLA 3KKIA 2BIEA 1WKGA 1N8PA 3DC1A 2VMRA 3DR4A 2WK9A 3B1EA 4AH3A 2E7IA 2VGSA 4EFFA 1G4VA 1G7WA 2CSTA 3A2BA 4ZDLA 1BQAA 3BWOA 3BV0A 4A0HA 2O7CA 3CQ4A 1D7RA 1M0PA 3AEOA 2GB3A 3VK4A 1VEFA 4GE4A 1B5PA 4BA4A 3ACZA 3B1CA 4RJYA 1UU1A 2VGZA 3P6KA 2Z9XA 2VGWA 5G4JA 3WX9A 3E6GA 4OC9A 3I4JA 1CJ0A 1CQ6A 1MLZA 1OHVA 3JWBA 1QISA 3HBXA 3HDOA 4XAUA 3GZDA 4JEZA 2BIGA 3LVMA 5HXXA 3FD0A 4RKCA 3RUYA 2HP1A 1B8GA 2HOZA 2Z9UA 1OXOA 3RQ1A 2DGKA 3GWPA 4ATQA 1IX6A 4BA5A 1AKBA 3T32A 2DGMA 1ASMA 1LW4A 3ZRQA 4IX8A 3LVJA 5M46A 1EQBA 5G2PA 4E1OA 4N0BA 3ATHA 5EFSA 4O6ZA 1V2EA 3EI5A 3IF2A 1ASGA 4WYDA 1ZC9A 3N5MA 3FZ8A 1MLYA 1UKJA 2VMNA 3K7YA 3QM2A 3AV7A 2Z1YA 4MSOA 4ZM4A 3ECDA 2VMXA 3FVUA 3ASBA 1RV3A 4WYAA 2G6WA 2JJGA 2YCNA 4XJLA 2QB3A 5JAYA 3NNKA 4OYTA 1CL1A 1BJWA 4LW2A 1AX4A 5E4ZA 3F6TA 1ZOBA 3OKSA 2BI5A 3UE8A 2W8JA 4E3RA 3WZFA 1LKCA 2HP2A 1DJ9A 3ASAA 4W91A 2CJDA 2R2NA 1N2TA 3CBFA 5BJ3A 4ZDPA 3LG0A 3AENB 4E3QA 1I41A 4TMRA 9AATA 4XEWA 3N75A 1U08A 3TFUA 3AENA 2V0YA 1SF2A 1JG8A 1ECXA 3WKSA 2ZY2A 2VMZA 2D7YA 4GE7A 1LC8A 3DXVA 3W1HA 2ZYJA 3GSBA 4RLGA 3MAFB 2OGEA 3K40A 4ISYA 3WLXA 3QN6A 4ADDA 4EU1A 3E77A 2VMSA 3MAFA 2C0RA 4Y0IA 4F5GA 3BCXA 3FFRA 4Q6RA 5DJ1A 3PDBA 2W7DA 1LC7A 3VK3A 5DB5A 4U1TA 3OP7A 3R9AA 3MC6C 4ZWVA 1C7NA 1C7GA 1SFFA 2JJEA 1GEYA 1OXPA 1AY5A 3EI9A 5FT6A 2QA3A 4KYOA 3AEMA 2D7ZA 2VMQA 5E3KA 3TQXA 2ZY3A 1W3UA 2YRRA 2E7JA 1XEYA 3E2YA 4K2BA 3WCNA 2D66A 3K28A 5G09A 5FT4A 3B8XA 3PA9A 4OBVA 1MDXA 1ASFA 2HOXA 4JF0A 2HORA 4F5MA 1YJYA 3PD6B 3R4TA 2BYJA 1QITA 2Z67A 4F5HA 2CFBA 1AIBA 2QBTA 2D64A 3L8AA 5F9SA 3LVKA 1ORDA 3PJ0A 4I8AA 1WYUA 2BI9A 2X8UA 5EAVA 1AICA 2VIAA 3GBXA 2DR1A 4A0GA 4M2JA 1AKCA 2AATA 1MAPA 4ITXA 3MAUA 4XJMA 1SZSA 2CINA 4WLHA 4A6UA 4R5ZA 3AATA 4OT8A 5EUNA 1DGEA 2OQXA 3HT4A 4ZDOA 3AOWA 4ADCA 3WGBA 2X5FA 3JU7A 1ASLA 2EZ1A 3MC6A 2W7IA 3GZCA 3B1DA 3ZZJA 1ELUA 2FQ6A 2WK7A 4JF1A 3KGWA 4RJ0A 3BN1A 4M2KA 3BCBA 2BI1A 2E7UA 3QI6A 2YRIA 3GR9A 5DX5A 2Z9WA 1E5EA 4OTLA 1AIAA 4UHOA 1LK9A 1SVVA 4CXQA 1PMMA 2PB0A 4WYFA 1AY4A 3A9YA 1KMJA 2AY5A 3RI6A 3HMUA 4EB7A 4KAMA 5LHAA 3HVYA 3DZZA 2BYLA 3UAKA 4CBRA 3LVLB 4ZAHA 1DKAA 1LC5A 1G7XA 1KL2A 1X2AA 3DXWA 2BHXA 5F8VA 5TF5A 3VAXA 4W5KA 2R0TA 1YOOA 5LH9A 1G4XA 1N31A 3Q8NA 3GJUA 4ADBA 4DBCA 1E5FA 2R5CA 4R8DA 5HDMA 4N0WA 3GETA 1AAWA 1TARA 2HUFA 3MBBA 1ARIA 2VIBA 1S09A 1B9HA 3AEJC 4OBUA 1AHYA 3E2FA 1IUGA 2DGLA 2W7FA 1O4SA 3II0A 2YOBA 1CL2A 3DR7A 4DGTA 4JEXA 3E9KA 4BQ0A 5EUEA 1C4KA 1KMKA 4WXGA 3HLMA 4E77A 3NUBA 3FSLA 3FZ7A 1P3WA 4RM1A 4UOYA 3FZ6A 1QIRA 2W7EA 3EZ1A 1TATA 1DGDA 4RIZA 5M4BA 1QZ9A 2CB1A 1D7VA 4F5FA 4F5IA 2BIAA 1IAYA 1S07A 1BJNA 1YJZA 5EAAA 3B46A 4RKDA 1B4XA 1EJIA 3BB8A 3NU8A 1YNUA 5G0AA 1TOEA 1J04A 2BWOA 2W7KA 4W1XA 2FM1A 4A00A 4JEYA 3AELA 3NRAA 4XK1A 1BS0A 3WY7A 5BJ4A 1V72A 2FNUA 2QLRA 4K2MA 2YKVA 1ASEA 3DRDA 1YIZA 4LNMA 4ZSYA 5G4IA 4AO9A 1BW0A 1GC0A 4A6RA 2C81A 1SZKA 3A8UX 4TV7A 1ASAA 2CH2A 2YKYA 4NOGA 4LW4A 2QB2A 3TFTA 3LWSA 1MAQA 3G8MA 4ZM3A 5IWQA 2VMVA 2AY9A 3P1TA 1O62A 3AEJA 3BS8A 1I29A 3PDBB 2GQNA 4HF8A 1DTYA 1QJ5A 4WXBA 4J8LA 2ZSLA 4MQRA 1W7MA 1V2DA 1AHEA 1ARGA 1CZCA 2ZUKA 3PPLA 1GDEA 3PIUA 4Y0DA 1GEWA 3VOMA 1GD9A 1O69A 1ARTA 3VK2A 4WP0A 1RVUA 3NYTA 1GEXA 5AX8A 5M49A 1WKHA 4LC3A 3WGCA 1GBNA 2C44A 5D5SA 3LV2A 2VLHA 2JJFA 3FFHA 5K8BA 2AY8A 3VP6A 3E2ZA 1QGNA 2W8WA 4GEBA 1ARHA 4AZKA 4GE9A 1YAAA 2DKBA 3NU7A 4ITGA 4OMAA 4AZJA 3PDXA 1WYUB 4IXOA 3TATA 2GMSA 2W8TA 1S0AA 1X0MA 2VMOA 3AOVA 3FQAA 4MGRA 1M0NA 3QHXA 1MGVA 1RV4A 2F8JA 3KE3A 3ELPA 2VYCA 4CXRA 2CH1A 1D7SA 4KXKA 1T3IA 3RBLA 4WBTA 2HUUA 5DJ9A 4DQ6A 1W7NA 3H7FA 3FCRA 4MKKA 4UHMA 1Z7DA 3IHJA 1AMQA 2CTZA 2AY1A 3MADA 4Q76A 2VGUA 1M4NA 4U2HA 2YCTA 4PFNA 4AOAA 4PVFA 1B5OA 2VMUA 2D63A 1AAMA 4ATPA 1AHFA 3JW9A 4QGRA 4ADEA 8AATA 2XBNA 1OATA 4F5JA 1FC4A 2VGTA 2ORDA 4WLJA 3RCHA 3JZLA 2AEVA 4JE5D 1KKPA 5FT8A 2AY4A 1I48A 1D7UA 4L0OA 1ASCA 1LW5A 1SZUA 1IX8A 1M32A 2AY3A 3EZSA 4Q75A 2HOYA 2JJHA 3QGUA 4F4EA 1I43A 4W1WA 1GC2A 1IX7A 2BWPA 3AEPA 3CQ5A 2Z61A 2ZJGA 2BWNA 3BC8A 3UWCA 3ELEA 4B98A 2D61A 2JGTA 4XQ2A 4OCAA 3TCMA 1IJIA 4UQVA 1TPLA 4CBSA 1V2FA 1AHGA 2W7MA 3HL2A 1AJSA 2VLFA 1S08A 3NTJA 1GC4A 3BWNC 2BI3A 2BI2A 1BQDA 4P7YA 3PGYA 2O0RA 4WYCA 5E5IA 1VP4A 3NX3A 2W8VA 1C7OA 2D5YA 5I92A 3M5UA 4WB0B 2R5CB 3W1JA 2D65A 4B9BA 2OKKA 3COGA 2VMWA 5HHYA 3HQTA 2VMPA 2VMTA 3F0HA 4R5FA 4WB0A 4A0RA 2EH6A 3EI8A 4IXSA 4PFFA 2QMAA 2GMUA 1AJRA 1DFOA 3LY1A 3KGXA 4XJOA 4FFCA 3WKRA 1AMSA 3FRKA 1RVYA 2E54A 2ZP7A 3EUCA 1Y4IA 2PO3A 3NUIA 1DJEA 1FG7A 1SPAA 3A9XA 1ZODA 2EPJA 1IVRA 1BJ4A 1MDZA 1J32A 4MQQA 1ASNA 4JEWA 5J8QA 2WKAA 2C7TA 3FQ7A 1WSTA 1C0NA 3FQ8A 5C6UA 3CQ6A 1TASA 1IAXA 2V1PA 3N0LA 1C9CA 4LNJA 3H14A 1AY8A 4WD2A 4HVKA 3EIBA 2YKXA 2Q7WA 3I5TA 3NDNA 4MY5A 2BKWA 2Z1ZA 4P3MA 4RITA 4ZASA 2W7LA 1M6SA 1W23A 4IW7A 2YCPA 3I16A 3A9ZA 3ZRRA 2PB2A 2CY8A 2EO5A 2X5DA 2ZY4A 1AMRA 1TOKA 2DKJA 4ZWMA 4GDYA 4UHNA 3BWNA 4ZLVA 1KL1A 1W7LA 2W8UA 4XJPA 2OGAA 2EZ2A 3JTXA 1GCKA 5M4DA 2VGVA 2X3LA 2GSAA 3L44A 3AEMC 3QBOA 1Z3ZA 4A72A 2AY6A 4TN4A 1M0QA 4AO4A 1WYVB 2ZY5A 4CVQA 1X28A 4Y0HA 2OATA 1BKGA 1JS6A 2CJGA 4BHDA 1BJOB 7AATA 1WYVA 2CANA 1AHXA 1FG3A 1IBJA 3PAAA 2AY7A 3EIAA 3FVXA 1BJOA 2DOUA 4A6TA 1LS3A 4IXZA 3ZZKA 2HUIA 2VI8A 1PMOA 2Z20A 2ZSMA 1YJSA 4M2MA 1KKJA 4F5KA 2CJHA 4W1VA 5D95A 4IYOB 3DODA 4MQPA 2XH1A 4MKJA 2O1BA 4FL0A 3E2ZB 2WK8A 1QJ3A 3NYUA 4IYOA 1ASBA 2FYFA 2W7GA 1PG8A 1AKAA 4ZSWA 1O61A 3EI6A 3DYDA 1AMAA 1B9IA 1TOJA 2YHKA 4WYGA 1M0OA 2R5EA 4IY7A 3CAIA 2OKJA 1X29A 5EIGB 1JF9A 3MKJA 1WYTB 4RAEA 2VI9A 1DJUA 4WYEA 3ZRPA 2JISA 3FKDA 4R2NA 5EIGA 1WYTA 4JEVA 4A0FA 3BCAA 3G7QA 2NMPA 2W7JA 5FT5A 1BT4A 1D2FA 5EQCA 1GC3A 3G0TA 1S06A 1CQ8A 4PIWA 3RBFA 1YIYA 1TOGA 5G2QA 3ISLA 1EG5A 3FDBA 3PD6A 3MEBA 3RCHB 2AEUA 2ZC0A 4H51A 1ARSA 1JS3A 1M7YA
chains in the Genus database with same CATH superfamily
1TOIA 3D6KA 3EI7A 4W8IA 3GZDC 1H0CA 4GRXA 1ASDA 3F9TA 2EGYA 4BMKA 2FN6A 2JG2A 3WCOA 1CS1A 4WXFA 5EUDA 4H63Q 2AY2A 2FNIA 2HZPA 4F5LA 2YKUA 1OHWA 4K2IA 4EMYA 4GSAA 2W7HA 4Q31A 1CZEA 2Z9VA 3DU4A 1XI9A 1PFFA 1UU2A 4EB5A 1ELQA 1AJSB 4LNLA 1UU0A 3JWAA 3FTBA 4J5UA 2RFVA 1OHYA 1MDOA 1CQ7A 3QPGA 3FVSA 3NYSA 1H1CA 3USFA 3W1IA 1VJOA 4JE5A 2VMYA 3FDDA 2TPLA 3KKIA 2BIEA 1WKGA 1N8PA 3DC1A 2VMRA 1KAFA 3DR4A 2WK9A 3B1EA 4AH3A 2E7IA 2VGSA 4EFFA 1G4VA 1G7WA 2CSTA 3A2BA 4ZDLA 1BQAA 3BWOA 3BV0A 4A0HA 2O7CA 3CQ4A 1D7RA 1M0PA 3AEOA 2GB3A 3VK4A 1VEFA 4GE4A 1B5PA 4BA4A 3ACZA 3B1CA 4RJYA 1UU1A 2VGZA 3P6KA 2Z9XA 2VGWA 5G4JA 3WX9A 2FKIA 3E6GA 4OC9A 3I4JA 1CJ0A 1CQ6A 1MLZA 1OHVA 3JWBA 1QISA 3HBXA 3HDOA 4XAUA 3GZDA 4JEZA 2BIGA 3LVMA 5HXXA 3FD0A 4RKCA 3RUYA 3N4SA 2HP1A 1B8GA 2HOZA 2Z9UA 2G7JA 1OXOA 3RQ1A 2DGKA 3GWPA 4ATQA 1IX6A 4BA5A 1AKBA 3T32A 2DGMA 1ASMA 1LW4A 3ZRQA 4IX8A 3LVJA 5M46A 1EQBA 5G2PA 4E1OA 4N0BA 3ATHA 5EFSA 4O6ZA 1V2EA 3EI5A 3IF2A 1ASGA 4WYDA 1ZC9A 3N5MA 3FZ8A 1MLYA 1UKJA 2VMNA 3K7YA 3QM2A 3AV7A 2Z1YA 4MSOA 4ZM4A 3ECDA 2VMXA 3FVUA 3ASBA 1RV3A 2WB6A 4WYAA 2G6WA 2JJGA 2YCNA 4XJLA 2QB3A 5JAYA 3NNKA 4OYTA 1CL1A 1BJWA 4LW2A 1AX4A 5E4ZA 3F6TA 1ZOBA 3OKSA 2BI5A 3UE8A 2W8JA 4E3RA 3WZFA 1LKCA 2HP2A 1DJ9A 3ASAA 4W91A 2CJDA 2R2NA 1N2TA 3CBFA 5BJ3A 4ZDPA 3LG0A 3AENB 4E3QA 1I41A 4TMRA 9AATA 4XEWA 3N75A 1U08A 3TFUA 3AENA 2V0YA 1SF2A 1JG8A 1ECXA 3WKSA 2ZY2A 2VMZA 2D7YA 4GE7A 1LC8A 3DXVA 3W1HA 2ZYJA 3GSBA 4RLGA 3MAFB 2OGEA 3K40A 4ISYA 3WLXA 3QN6A 4ADDA 4EU1A 3E77A 2VMSA 3MAFA 2C0RA 4Y0IA 4F5GA 3BCXA 3FFRA 4Q6RA 5DJ1A 3PDBA 2W7DA 1LC7A 3VK3A 5DB5A 4U1TA 3OP7A 3R9AA 3MC6C 4ZWVA 1C7NA 2KFPA 1C7GA 1SFFA 2JJEA 1GEYA 1OXPA 1AY5A 3EI9A 5FT6A 2QA3A 4KYOA 3AEMA 2D7ZA 2VMQA 5E3KA 3TQXA 3N7NA 2ZY3A 1W3UA 2YRRA 2E7JA 1XEYA 3E2YA 4K2BA 3WCNA 2D66A 3K28A 5G09A 5FT4A 3B8XA 3PA9A 4OBVA 1MDXA 1ASFA 2HOXA 4JF0A 2HORA 4F5MA 1YJYA 3PD6B 3R4TA 2BYJA 1QITA 2Z67A 2A1VA 4F5HA 2CFBA 1AIBA 2QBTA 2D64A 3L8AA 5F9SA 3LVKA 1ORDA 3PJ0A 4I8AA 1WYUA 2BI9A 2X8UA 5EAVA 1AICA 2VIAA 3GBXA 2DR1A 4A0GA 4M2JA 1AKCA 2AATA 1MAPA 4ITXA 3MAUA 4XJMA 1SZSA 2CINA 4WLHA 4A6UA 4R5ZA 3AATA 4OT8A 5EUNA 1DGEA 2OQXA 3HT4A 4ZDOA 3AOWA 4ADCA 3WGBA 2X5FA 3JU7A 1ASLA 2EZ1A 3MC6A 2W7IA 3GZCA 3B1DA 3N4XA 3ZZJA 1ELUA 2FQ6A 2WK7A 4JF1A 3KGWA 4RJ0A 3BN1A 4M2KA 3BCBA 2BI1A 2E7UA 3QI6A 2YRIA 3GR9A 5DX5A 2Z9WA 1E5EA 4OTLA 1AIAA 4UHOA 1LK9A 1SVVA 4CXQA 1PMMA 2PB0A 4WYFA 1AY4A 3A9YA 1KMJA 2AY5A 3RI6A 3HMUA 4EB7A 4KAMA 5LHAA 3HVYA 3DZZA 2BYLA 3UAKA 4CBRA 3LVLB 4ZAHA 1DKAA 1LC5A 1G7XA 1KL2A 1X2AA 3DXWA 2BHXA 5F8VA 5TF5A 3VAXA 4W5KA 2R0TA 1YOOA 5LH9A 1G4XA 1N31A 3Q8NA 3GJUA 4ADBA 4DBCA 1E5FA 2R5CA 4R8DA 5HDMA 4N0WA 3GETA 1AAWA 1TARA 2HUFA 3MBBA 1ARIA 2VIBA 1S09A 1B9HA 3AEJC 4OBUA 1AHYA 3E2FA 1IUGA 2DGLA 2W7FA 1O4SA 3II0A 2YOBA 1CL2A 3DR7A 4DGTA 4JEXA 3E9KA 4BQ0A 5EUEA 1C4KA 1KMKA 4WXGA 3HLMA 4E77A 3NUBA 3FSLA 3FZ7A 1P3WA 4RM1A 4UOYA 3FZ6A 1QIRA 2W7EA 3EZ1A 1TATA 1DGDA 4RIZA 5M4BA 1QZ9A 2CB1A 1D7VA 4F5FA 4F5IA 2BIAA 1IAYA 1S07A 1BJNA 1YJZA 5EAAA 3B46A 4RKDA 1B4XA 1EJIA 3BB8A 3NU8A 1YNUA 5G0AA 1TOEA 1J04A 2BWOA 2W7KA 4W1XA 2FM1A 4A00A 4JEYA 3AELA 3NRAA 4XK1A 1BS0A 3WY7A 5BJ4A 1V72A 2FNUA 2QLRA 4K2MA 2YKVA 1ASEA 3DRDA 1YIZA 4LNMA 4ZSYA 5G4IA 4AO9A 1BW0A 1GC0A 4A6RA 2C81A 1SZKA 3A8UX 4TV7A 1ASAA 2CH2A 2YKYA 4NOGA 4LW4A 2QB2A 3TFTA 3LWSA 1MAQA 3G8MA 4ZM3A 5IWQA 2VMVA 2AY9A 3P1TA 1O62A 3AEJA 3BS8A 1I29A 3PDBB 2GQNA 4HF8A 1DTYA 1QJ5A 4WXBA 4J8LA 2ZSLA 4MQRA 1W7MA 1V2DA 1AHEA 1ARGA 1CZCA 2ZUKA 3PPLA 1GDEA 3PIUA 4Y0DA 1GEWA 3VOMA 1GD9A 1O69A 1ARTA 3VK2A 4WP0A 1RVUA 3NYTA 1GEXA 5AX8A 5M49A 5KTBA 1WKHA 4LC3A 3WGCA 1GBNA 2C44A 5D5SA 3LV2A 2VLHA 2JJFA 3FFHA 5K8BA 2AY8A 3VP6A 3E2ZA 1QGNA 2W8WA 4GEBA 1ARHA 4AZKA 4GE9A 1YAAA 2DKBA 3NU7A 4ITGA 4OMAA 4AZJA 3PDXA 1WYUB 4IXOA 3TATA 2GMSA 2W8TA 1S0AA 1X0MA 2VMOA 3AOVA 3FQAA 4MGRA 1M0NA 3QHXA 1MGVA 1RV4A 2F8JA 3KE3A 3ELPA 2VYCA 4CXRA 2CH1A 1D7SA 4KXKA 1T3IA 3RBLA 4WBTA 2HUUA 5DJ9A 4DQ6A 1W7NA 3H7FA 3FCRA 4MKKA 4UHMA 1Z7DA 3IHJA 1AMQA 2CTZA 2AY1A 3MADA 4Q76A 2VGUA 1M4NA 4U2HA 2YCTA 4PFNA 4AOAA 4PVFA 1B5OA 2VMUA 2EYQA 2D63A 1AAMA 4ATPA 1AHFA 3JW9A 4QGRA 4ADEA 8AATA 2XBNA 1OATA 4F5JA 1FC4A 2VGTA 2ORDA 4WLJA 3RCHA 3JZLA 2AEVA 4JE5D 1KKPA 5FT8A 2AY4A 3H9XA 1I48A 1D7UA 4L0OA 1ASCA 1LW5A 1SZUA 1IX8A 1M32A 2AY3A 3EZSA 4Q75A 2HOYA 2JJHA 3QGUA 4F4EA 1I43A 4W1WA 1GC2A 1IX7A 2BWPA 3AEPA 3CQ5A 2Z61A 2ZJGA 2BWNA 3BC8A 3UWCA 3ELEA 4B98A 2D61A 2JGTA 4XQ2A 4OCAA 3TCMA 1IJIA 4UQVA 1TPLA 4CBSA 1V2FA 1AHGA 2W7MA 3HL2A 1AJSA 2VLFA 1S08A 3NTJA 1GC4A 3BWNC 2BI3A 2BI2A 1BQDA 4P7YA 3PGYA 2O0RA 4WYCA 5E5IA 1VP4A 3NX3A 2W8VA 1C7OA 2D5YA 5I92A 3M5UA 4WB0B 2R5CB 3W1JA 2D65A 4B9BA 2OKKA 3COGA 2VMWA 5HHYA 3HQTA 2VMPA 2VMTA 3F0HA 4R5FA 4WB0A 4A0RA 2EH6A 3EI8A 4IXSA 4PFFA 2QMAA 2GMUA 1AJRA 1DFOA 3LY1A 3KGXA 3N4RA 4XJOA 4FFCA 3WKRA 1AMSA 3FRKA 1RVYA 2E54A 2ZP7A 3EUCA 1Y4IA 2PO3A 3NUIA 1DJEA 1FG7A 1SPAA 3A9XA 1ZODA 2EPJA 1IVRA 1BJ4A 1MDZA 1J32A 4MQQA 1ASNA 4JEWA 5J8QA 2WKAA 2C7TA 3FQ7A 1WSTA 1C0NA 3FQ8A 5C6UA 3CQ6A 1TASA 1IAXA 2V1PA 3N0LA 1C9CA 4LNJA 3H14A 1AY8A 4WD2A 4HVKA 3EIBA 2YKXA 2Q7WA 3I5TA 3NDNA 4MY5A 2BKWA 2Z1ZA 4P3MA 4RITA 4ZASA 2W7LA 1M6SA 1W23A 4IW7A 2YCPA 3I16A 3A9ZA 3ZRRA 2PB2A 2CY8A 2EO5A 2X5DA 2ZY4A 1AMRA 1TOKA 2DKJA 4ZWMA 4GDYA 4UHNA 3BWNA 4ZLVA 1KL1A 1W7LA 2W8UA 4XJPA 2OGAA 2EZ2A 3JTXA 1GCKA 5M4DA 2VGVA 2X3LA 2GSAA 3L44A 3AEMC 3QBOA 1Z3ZA 4A72A 2AY6A 4TN4A 1M0QA 4AO4A 1WYVB 2ZY5A 4CVQA 1X28A 4Y0HA 2OATA 1BKGA 1JS6A 2CJGA 4BHDA 1BJOB 7AATA 1WYVA 2CANA 1AHXA 1FG3A 1IBJA 3PAAA 2AY7A 3EIAA 3FVXA 1BJOA 2DOUA 4A6TA 1LS3A 4IXZA 3ZZKA 2HUIA 2VI8A 1PMOA 2Z20A 2ZSMA 1YJSA 4M2MA 1KKJA 4F5KA 2CJHA 4W1VA 5D95A 4IYOB 3DODA 4MQPA 2XH1A 4MKJA 2O1BA 4FL0A 3E2ZB 2WK8A 1QJ3A 3NYUA 4IYOA 1ASBA 2FYFA 2W7GA 1PG8A 1AKAA 4ZSWA 1O61A 3EI6A 3DYDA 1AMAA 1B9IA 1TOJA 2YHKA 4WYGA 1M0OA 2R5EA 4IY7A 3CAIA 2OKJA 1X29A 5EIGB 1JF9A 3MKJA 1WYTB 4RAEA 2VI9A 1DJUA 4WYEA 4K05A 3ZRPA 2JISA 3FKDA 4R2NA 5EIGA 1WYTA 4JEVA 4A0FA 3BCAA 3G7QA 2NMPA 2W7JA 5FT5A 1BT4A 1D2FA 5EQCA 1GC3A 3G0TA 1S06A 1CQ8A 4PIWA 3RBFA 1YIYA 1TOGA 5G2QA 3ISLA 2QSRA 1EG5A 3FDBA 3PD6A 3MEBA 3RCHB 2AEUA 2ZC0A 4H51A 1ARSA 1JS3A 1M7YA
chains in the Genus database with same CATH topology
1TOIA 3D6KA 3EI7A 4W8IA 3GZDC 1H0CA 4GRXA 1ASDA 3F9TA 2EGYA 4BMKA 2FN6A 2JG2A 3WCOA 1CS1A 4WXFA 5EUDA 4H63Q 2AY2A 2FNIA 2HZPA 4F5LA 2YKUA 1OHWA 4K2IA 4EMYA 4GSAA 2W7HA 4Q31A 1CZEA 2Z9VA 3DU4A 1XI9A 1PFFA 1UU2A 4EB5A 1ELQA 1AJSB 4LNLA 1UU0A 3JWAA 3FTBA 4J5UA 2RFVA 1OHYA 1MDOA 1CQ7A 3QPGA 3FVSA 3NYSA 1H1CA 3USFA 3W1IA 1VJOA 4JE5A 2VMYA 3FDDA 2TPLA 3KKIA 2BIEA 1WKGA 1N8PA 3DC1A 2VMRA 3DR4A 2WK9A 3B1EA 4AH3A 2E7IA 2VGSA 4EFFA 1G4VA 1G7WA 2CSTA 3A2BA 4ZDLA 1BQAA 3BWOA 3BV0A 4A0HA 2O7CA 3CQ4A 1D7RA 1M0PA 3AEOA 2GB3A 3VK4A 1VEFA 4GE4A 1B5PA 4BA4A 3ACZA 3B1CA 4RJYA 1UU1A 2VGZA 3P6KA 2Z9XA 2VGWA 5G4JA 3WX9A 2FKIA 3E6GA 4OC9A 3I4JA 1CJ0A 1CQ6A 1MLZA 1OHVA 3JWBA 1QISA 3HBXA 3HDOA 4XAUA 3GZDA 4JEZA 2BIGA 3LVMA 5HXXA 3FD0A 4RKCA 3RUYA 3N4SA 2HP1A 1B8GA 2HOZA 2Z9UA 2G7JA 1OXOA 3RQ1A 2DGKA 3GWPA 4ATQA 1IX6A 4BA5A 1AKBA 3T32A 2DGMA 1ASMA 1LW4A 3ZRQA 4IX8A 3LVJA 5M46A 1EQBA 5G2PA 4E1OA 4N0BA 3ATHA 5EFSA 4O6ZA 1V2EA 3EI5A 3IF2A 1ASGA 4WYDA 1ZC9A 3N5MA 3FZ8A 1MLYA 1UKJA 2VMNA 3K7YA 3QM2A 3AV7A 2Z1YA 4MSOA 4ZM4A 3ECDA 2VMXA 3FVUA 3ASBA 1RV3A 2WB6A 4WYAA 2G6WA 2JJGA 2YCNA 4XJLA 2QB3A 5JAYA 3NNKA 4OYTA 1CL1A 1BJWA 4LW2A 1AX4A 5E4ZA 3F6TA 1ZOBA 3OKSA 2BI5A 3UE8A 2W8JA 4E3RA 3WZFA 1LKCA 2HP2A 1DJ9A 3ASAA 4W91A 2CJDA 2R2NA 1N2TA 3CBFA 5BJ3A 4ZDPA 3LG0A 3AENB 4E3QA 1I41A 4TMRA 9AATA 4XEWA 3N75A 1U08A 3TFUA 3AENA 2V0YA 1SF2A 1JG8A 1ECXA 3WKSA 2ZY2A 2VMZA 2D7YA 4GE7A 1LC8A 3DXVA 3W1HA 2ZYJA 3GSBA 4RLGA 3MAFB 2OGEA 3K40A 4ISYA 3WLXA 3QN6A 4ADDA 4EU1A 3E77A 2VMSA 3MAFA 2C0RA 4Y0IA 4F5GA 3BCXA 3FFRA 4Q6RA 5DJ1A 3PDBA 2W7DA 1LC7A 3VK3A 5DB5A 4U1TA 3OP7A 3R9AA 3MC6C 4ZWVA 1C7NA 2KFPA 1C7GA 1SFFA 2JJEA 1GEYA 1OXPA 1AY5A 3EI9A 5FT6A 2QA3A 4KYOA 3AEMA 2D7ZA 2VMQA 5E3KA 3TQXA 3N7NA 2ZY3A 1W3UA 2YRRA 2E7JA 1XEYA 3E2YA 4K2BA 3WCNA 2D66A 3K28A 5G09A 5FT4A 3B8XA 3PA9A 4OBVA 1MDXA 1ASFA 2HOXA 4JF0A 2HORA 4F5MA 1YJYA 3PD6B 3R4TA 2BYJA 1QITA 2Z67A 2A1VA 4F5HA 2CFBA 1AIBA 2QBTA 2D64A 3L8AA 5F9SA 3LVKA 1ORDA 3PJ0A 4I8AA 1WYUA 2BI9A 2X8UA 5EAVA 1AICA 2VIAA 3GBXA 2DR1A 4A0GA 4M2JA 1AKCA 2AATA 1MAPA 4ITXA 3MAUA 4XJMA 1SZSA 2CINA 4WLHA 4A6UA 4R5ZA 3AATA 4OT8A 5EUNA 1DGEA 2OQXA 3HT4A 4ZDOA 3AOWA 4ADCA 3WGBA 2X5FA 3JU7A 1ASLA 2EZ1A 3MC6A 2W7IA 3GZCA 3B1DA 3N4XA 3ZZJA 1ELUA 2FQ6A 2WK7A 4JF1A 3KGWA 4RJ0A 3BN1A 4M2KA 3BCBA 2BI1A 2E7UA 3QI6A 2YRIA 3GR9A 5DX5A 2Z9WA 1E5EA 4OTLA 1AIAA 4UHOA 1LK9A 1SVVA 4CXQA 1PMMA 2PB0A 4WYFA 1AY4A 3A9YA 1KMJA 2AY5A 3RI6A 3HMUA 4EB7A 4KAMA 5LHAA 3HVYA 3DZZA 2BYLA 3UAKA 4CBRA 3LVLB 4ZAHA 1DKAA 1LC5A 1G7XA 1KL2A 1X2AA 3DXWA 2BHXA 5F8VA 5TF5A 3VAXA 4W5KA 2R0TA 1YOOA 5LH9A 1G4XA 1N31A 3Q8NA 3GJUA 4ADBA 4DBCA 1E5FA 2R5CA 4R8DA 5HDMA 4N0WA 3GETA 1AAWA 1TARA 2HUFA 3MBBA 1ARIA 2VIBA 1S09A 1B9HA 3AEJC 4OBUA 1AHYA 3E2FA 1IUGA 2DGLA 2W7FA 1O4SA 3II0A 2YOBA 1CL2A 3DR7A 4DGTA 4JEXA 3E9KA 4BQ0A 5EUEA 1C4KA 1KMKA 4WXGA 3HLMA 4E77A 3NUBA 3FSLA 3FZ7A 1P3WA 4RM1A 4UOYA 3FZ6A 1QIRA 2W7EA 3EZ1A 1TATA 1DGDA 4RIZA 5M4BA 1QZ9A 2CB1A 1D7VA 4F5FA 4F5IA 2BIAA 1IAYA 1S07A 1BJNA 1YJZA 5EAAA 3B46A 4RKDA 1B4XA 1EJIA 3BB8A 3NU8A 1YNUA 5G0AA 1TOEA 1J04A 2BWOA 2W7KA 4W1XA 2FM1A 4A00A 4JEYA 3AELA 3NRAA 4XK1A 1BS0A 3WY7A 5BJ4A 1V72A 2FNUA 2QLRA 4K2MA 2YKVA 1ASEA 3DRDA 1YIZA 4LNMA 4ZSYA 5G4IA 4AO9A 1BW0A 1GC0A 4A6RA 2C81A 1SZKA 3A8UX 4TV7A 1ASAA 2CH2A 2YKYA 4NOGA 4LW4A 2QB2A 3TFTA 3LWSA 1MAQA 3G8MA 4ZM3A 5IWQA 2VMVA 2AY9A 3P1TA 1O62A 3AEJA 3BS8A 1I29A 3PDBB 2GQNA 4HF8A 1DTYA 1QJ5A 4WXBA 4J8LA 2ZSLA 4MQRA 1W7MA 1V2DA 1AHEA 1ARGA 1CZCA 2ZUKA 3PPLA 1GDEA 3PIUA 4Y0DA 1GEWA 3VOMA 1GD9A 1O69A 1ARTA 3VK2A 4WP0A 1RVUA 3NYTA 1GEXA 5AX8A 5M49A 5KTBA 1WKHA 4LC3A 3WGCA 1GBNA 2C44A 5D5SA 3LV2A 2VLHA 2JJFA 3FFHA 5K8BA 2AY8A 3VP6A 3E2ZA 1QGNA 2W8WA 4GEBA 1ARHA 4AZKA 4GE9A 1YAAA 2DKBA 3NU7A 4ITGA 4OMAA 4AZJA 3PDXA 1WYUB 4IXOA 3TATA 2GMSA 2W8TA 1S0AA 1X0MA 2VMOA 3AOVA 3FQAA 4MGRA 1M0NA 3QHXA 1MGVA 1RV4A 2F8JA 3KE3A 3ELPA 2VYCA 4CXRA 2CH1A 1D7SA 4KXKA 1T3IA 3RBLA 4WBTA 2HUUA 5DJ9A 4DQ6A 1W7NA 3H7FA 3FCRA 4MKKA 4UHMA 1Z7DA 3IHJA 1AMQA 2CTZA 2AY1A 3MADA 4Q76A 2VGUA 1M4NA 4U2HA 2YCTA 4PFNA 4AOAA 4PVFA 1B5OA 2VMUA 2EYQA 2D63A 1AAMA 4ATPA 1AHFA 3JW9A 4QGRA 4ADEA 8AATA 2XBNA 1OATA 4F5JA 1FC4A 2VGTA 2ORDA 4WLJA 3RCHA 3JZLA 2AEVA 4JE5D 1KKPA 5FT8A 2AY4A 3H9XA 1I48A 1D7UA 4L0OA 1ASCA 1LW5A 1SZUA 1IX8A 1M32A 2AY3A 3EZSA 4Q75A 2HOYA 2JJHA 3QGUA 4F4EA 1I43A 4W1WA 1GC2A 1IX7A 2BWPA 3AEPA 3CQ5A 2Z61A 2ZJGA 2BWNA 3BC8A 3UWCA 3ELEA 4B98A 2D61A 2JGTA 4XQ2A 4OCAA 3TCMA 1IJIA 4UQVA 1TPLA 4CBSA 1V2FA 1AHGA 2W7MA 3HL2A 1AJSA 2VLFA 1S08A 3NTJA 1GC4A 3BWNC 2BI3A 2BI2A 1BQDA 4P7YA 3PGYA 2O0RA 4WYCA 5E5IA 1VP4A 3NX3A 2W8VA 1C7OA 2D5YA 5I92A 3M5UA 4WB0B 2R5CB 3W1JA 2D65A 4B9BA 2OKKA 3COGA 2VMWA 5HHYA 3HQTA 2VMPA 2VMTA 3F0HA 4R5FA 4WB0A 4A0RA 2EH6A 3EI8A 4IXSA 4PFFA 2QMAA 2GMUA 1AJRA 1DFOA 3LY1A 3KGXA 3N4RA 4XJOA 4FFCA 3WKRA 1AMSA 3FRKA 1RVYA 2E54A 2ZP7A 3EUCA 1Y4IA 2PO3A 3NUIA 1DJEA 1FG7A 1SPAA 3A9XA 1ZODA 2EPJA 1IVRA 1BJ4A 1MDZA 1J32A 4MQQA 1ASNA 4JEWA 5J8QA 2WKAA 2C7TA 3FQ7A 1WSTA 1C0NA 3FQ8A 5C6UA 3CQ6A 1TASA 1IAXA 2V1PA 3N0LA 1C9CA 4LNJA 3H14A 1AY8A 4WD2A 4HVKA 3EIBA 2YKXA 2Q7WA 3I5TA 3NDNA 4MY5A 2BKWA 2Z1ZA 4P3MA 4RITA 4ZASA 2W7LA 1M6SA 1W23A 4IW7A 2YCPA 3I16A 3A9ZA 3ZRRA 2PB2A 2CY8A 2EO5A 2X5DA 2ZY4A 1AMRA 1TOKA 2DKJA 4ZWMA 4GDYA 4UHNA 3BWNA 4ZLVA 1KL1A 1W7LA 2W8UA 4XJPA 2OGAA 2EZ2A 3JTXA 1GCKA 5M4DA 2VGVA 2X3LA 2GSAA 3L44A 3AEMC 3QBOA 1Z3ZA 4A72A 2AY6A 4TN4A 1M0QA 4AO4A 1WYVB 2ZY5A 4CVQA 1X28A 4Y0HA 2OATA 1BKGA 1JS6A 2CJGA 4BHDA 1BJOB 7AATA 1WYVA 2CANA 1AHXA 1FG3A 1IBJA 3PAAA 2AY7A 3EIAA 3FVXA 1BJOA 2DOUA 4A6TA 1LS3A 4IXZA 3ZZKA 2HUIA 2VI8A 1PMOA 2Z20A 2ZSMA 1YJSA 4M2MA 1KKJA 4F5KA 2CJHA 4W1VA 5D95A 4IYOB 3DODA 4MQPA 2XH1A 4MKJA 2O1BA 4FL0A 3E2ZB 2WK8A 1QJ3A 3NYUA 4IYOA 1ASBA 2FYFA 2W7GA 1PG8A 1AKAA 4ZSWA 1O61A 3EI6A 3DYDA 1AMAA 1B9IA 1TOJA 2YHKA 4WYGA 1M0OA 2R5EA 4IY7A 3CAIA 2OKJA 1X29A 5EIGB 1JF9A 3MKJA 1WYTB 4RAEA 2VI9A 1DJUA 4WYEA 4K05A 3ZRPA 2JISA 3FKDA 4R2NA 5EIGA 1WYTA 4JEVA 4A0FA 3BCAA 3G7QA 2NMPA 2W7JA 5FT5A 1BT4A 1D2FA 5EQCA 1GC3A 3G0TA 1S06A 1CQ8A 4PIWA 3RBFA 1YIYA 1TOGA 5G2QA 3ISLA 2QSRA 1EG5A 3FDBA 3PD6A 3MEBA 3RCHB 2AEUA 2ZC0A 4H51A 1ARSA 1JS3A 1M7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOI A;  3D6K A;  3EI7 A;  4W8I A;  3GZD C;  1H0C A;  4GRX A;  1ASD A;  3F9T A;  2EGY A;  4BMK A;  2FN6 A;  2JG2 A;  3WCO A;  1CS1 A;  4WXF A;  5EUD A;  2AY2 A;  2FNI A;  2HZP A;  4F5L A;  2YKU A;  1OHW A;  4K2I A;  4EMY A;  4GSA A;  2W7H A;  4Q31 A;  1CZE A;  2Z9V A;  3DU4 A;  1XI9 A;  1PFF A;  1UU2 A;  4EB5 A;  1ELQ A;  1AJS B;  4LNL A;  1UU0 A;  3JWA A;  3FTB A;  4J5U A;  2RFV A;  1OHY A;  1MDO A;  1CQ7 A;  3QPG A;  3FVS A;  3NYS A;  1H1C A;  3USF A;  3W1I A;  1VJO A;  4JE5 A;  2VMY A;  3FDD A;  2TPL A;  3KKI A;  2BIE A;  1WKG A;  1N8P A;  3DC1 A;  2VMR A;  3DR4 A;  2WK9 A;  3B1E A;  4AH3 A;  2E7I A;  2VGS A;  4EFF A;  1G4V A;  1G7W A;  2CST A;  3A2B A;  4ZDL A;  1BQA A;  3BWO A;  3BV0 A;  4A0H A;  2O7C A;  3CQ4 A;  1D7R A;  1M0P A;  3AEO A;  2GB3 A;  3VK4 A;  1VEF A;  4GE4 A;  1B5P A;  4BA4 A;  3ACZ A;  3B1C A;  4RJY A;  1UU1 A;  2VGZ A;  3P6K A;  2Z9X A;  2VGW A;  5G4J A;  3WX9 A;  3E6G A;  4OC9 A;  3I4J A;  1CJ0 A;  1CQ6 A;  1MLZ A;  1OHV A;  3JWB A;  1QIS A;  3HBX A;  3HDO A;  4XAU A;  3GZD A;  4JEZ A;  2BIG A;  3LVM A;  5HXX A;  3FD0 A;  4RKC A;  3RUY A;  2HP1 A;  1B8G A;  2HOZ A;  2Z9U A;  1OXO A;  3RQ1 A;  2DGK A;  3GWP A;  4ATQ A;  1IX6 A;  4BA5 A;  1AKB A;  3T32 A;  2DGM A;  1ASM A;  1LW4 A;  3ZRQ A;  4IX8 A;  3LVJ A;  5M46 A;  1EQB A;  5G2P A;  4E1O A;  4N0B A;  3ATH A;  5EFS A;  4O6Z A;  1V2E A;  3EI5 A;  3IF2 A;  1ASG A;  4WYD A;  1ZC9 A;  3N5M A;  3FZ8 A;  1MLY A;  1UKJ A;  2VMN A;  3K7Y A;  3QM2 A;  3AV7 A;  2Z1Y A;  4MSO A;  4ZM4 A;  3ECD A;  2VMX A;  3FVU A;  3ASB A;  1RV3 A;  4WYA A;  2G6W A;  2JJG A;  2YCN A;  4XJL A;  2QB3 A;  5JAY A;  3NNK A;  4OYT A;  1CL1 A;  1BJW A;  4LW2 A;  1AX4 A;  5E4Z A;  3F6T A;  1ZOB A;  3OKS A;  2BI5 A;  3UE8 A;  2W8J A;  4E3R A;  3WZF A;  1LKC A;  2HP2 A;  1DJ9 A;  3ASA A;  4W91 A;  2CJD A;  2R2N A;  1N2T A;  3CBF A;  5BJ3 A;  4ZDP A;  3LG0 A;  3AEN B;  4E3Q A;  1I41 A;  4TMR A;  9AAT A;  4XEW A;  3N75 A;  1U08 A;  3TFU A;  3AEN A;  2V0Y A;  1SF2 A;  1JG8 A;  1ECX A;  3WKS A;  2ZY2 A;  2VMZ A;  2D7Y A;  4GE7 A;  1LC8 A;  3DXV A;  3W1H A;  2ZYJ A;  3GSB A;  4RLG A;  3MAF B;  2OGE A;  3K40 A;  4ISY A;  3WLX A;  3QN6 A;  4ADD A;  4EU1 A;  3E77 A;  2VMS A;  3MAF A;  2C0R A;  4Y0I A;  4F5G A;  3BCX A;  3FFR A;  4Q6R A;  5DJ1 A;  3PDB A;  2W7D A;  1LC7 A;  3VK3 A;  5DB5 A;  4U1T A;  3OP7 A;  3R9A A;  3MC6 C;  4ZWV A;  1C7N A;  1C7G A;  1SFF A;  2JJE A;  1GEY A;  1OXP A;  1AY5 A;  3EI9 A;  5FT6 A;  2QA3 A;  4KYO A;  3AEM A;  2D7Z A;  2VMQ A;  5E3K A;  3TQX A;  2ZY3 A;  1W3U A;  2YRR A;  2E7J A;  1XEY A;  3E2Y A;  4K2B A;  3WCN A;  2D66 A;  3K28 A;  5G09 A;  5FT4 A;  3B8X A;  3PA9 A;  4OBV A;  1MDX A;  1ASF A;  2HOX A;  4JF0 A;  2HOR A;  4F5M A;  1YJY A;  3PD6 B;  3R4T A;  2BYJ A;  1QIT A;  2Z67 A;  4F5H A;  2CFB A;  1AIB A;  2QBT A;  2D64 A;  3L8A A;  5F9S A;  3LVK A;  1ORD A;  3PJ0 A;  4I8A A;  1WYU A;  2BI9 A;  2X8U A;  5EAV A;  1AIC A;  2VIA A;  3GBX A;  2DR1 A;  4A0G A;  4M2J A;  1AKC A;  2AAT A;  1MAP A;  4ITX A;  3MAU A;  4XJM A;  1SZS A;  2CIN A;  4WLH A;  4A6U A;  4R5Z A;  3AAT A;  4OT8 A;  5EUN A;  1DGE A;  2OQX A;  3HT4 A;  4ZDO A;  3AOW A;  4ADC A;  3WGB A;  2X5F A;  3JU7 A;  1ASL A;  2EZ1 A;  3MC6 A;  2W7I A;  3GZC A;  3B1D A;  3ZZJ A;  1ELU A;  2FQ6 A;  2WK7 A;  4JF1 A;  3KGW A;  4RJ0 A;  3BN1 A;  4M2K A;  3BCB A;  2BI1 A;  2E7U A;  3QI6 A;  2YRI A;  3GR9 A;  5DX5 A;  2Z9W A;  1E5E A;  4OTL A;  1AIA A;  4UHO A;  1LK9 A;  1SVV A;  4CXQ A;  1PMM A;  2PB0 A;  4WYF A;  1AY4 A;  3A9Y A;  1KMJ A;  2AY5 A;  3RI6 A;  3HMU A;  4EB7 A;  4KAM A;  5LHA A;  3HVY A;  3DZZ A;  2BYL A;  3UAK A;  4CBR A;  3LVL B;  4ZAH A;  1DKA A;  1LC5 A;  1G7X A;  1KL2 A;  1X2A A;  3DXW A;  2BHX A;  5F8V A;  5TF5 A;  3VAX A;  4W5K A;  2R0T A;  1YOO A;  5LH9 A;  1G4X A;  1N31 A;  3Q8N A;  3GJU A;  4ADB A;  4DBC A;  1E5F A;  2R5C A;  4R8D A;  5HDM A;  4N0W A;  3GET A;  1AAW A;  1TAR A;  2HUF A;  3MBB A;  1ARI A;  2VIB A;  1S09 A;  1B9H A;  3AEJ C;  4OBU A;  1AHY A;  3E2F A;  1IUG A;  2DGL A;  2W7F A;  1O4S A;  3II0 A;  2YOB A;  1CL2 A;  3DR7 A;  4DGT A;  4JEX A;  3E9K A;  4BQ0 A;  5EUE A;  1C4K A;  1KMK A;  4WXG A;  3HLM A;  4E77 A;  3NUB A;  3FSL A;  3FZ7 A;  1P3W A;  4RM1 A;  4UOY A;  3FZ6 A;  1QIR A;  2W7E A;  3EZ1 A;  1TAT A;  1DGD A;  4RIZ A;  5M4B A;  1QZ9 A;  2CB1 A;  1D7V A;  4F5F A;  4F5I A;  2BIA A;  1IAY A;  1S07 A;  1BJN A;  1YJZ A;  5EAA A;  3B46 A;  4RKD A;  1B4X A;  1EJI A;  3BB8 A;  3NU8 A;  1YNU A;  5G0A A;  1TOE A;  1J04 A;  2BWO A;  2W7K A;  4W1X A;  2FM1 A;  4A00 A;  4JEY A;  3AEL A;  3NRA A;  4XK1 A;  1BS0 A;  3WY7 A;  5BJ4 A;  1V72 A;  2FNU A;  2QLR A;  4K2M A;  2YKV A;  1ASE A;  3DRD A;  1YIZ A;  4LNM A;  4ZSY A;  5G4I A;  4AO9 A;  1BW0 A;  1GC0 A;  4A6R A;  2C81 A;  1SZK A;  3A8U X;  4TV7 A;  1ASA A;  2CH2 A;  2YKY A;  4NOG A;  4LW4 A;  2QB2 A;  3TFT A;  3LWS A;  1MAQ A;  3G8M A;  4ZM3 A;  5IWQ A;  2VMV A;  2AY9 A;  3P1T A;  1O62 A;  3AEJ A;  3BS8 A;  1I29 A;  3PDB B;  2GQN A;  4HF8 A;  1DTY A;  1QJ5 A;  4WXB A;  4J8L A;  2ZSL A;  4MQR A;  1W7M A;  1V2D A;  1AHE A;  1ARG A;  1CZC A;  2ZUK A;  3PPL A;  1GDE A;  3PIU A;  4Y0D A;  1GEW A;  3VOM A;  1GD9 A;  1O69 A;  1ART A;  3VK2 A;  4WP0 A;  1RVU A;  3NYT A;  1GEX A;  5AX8 A;  5M49 A;  1WKH A;  4LC3 A;  3WGC A;  1GBN A;  2C44 A;  5D5S A;  3LV2 A;  2VLH A;  2JJF A;  3FFH A;  5K8B A;  2AY8 A;  3VP6 A;  3E2Z A;  1QGN A;  2W8W A;  4GEB A;  1ARH A;  4AZK A;  4GE9 A;  1YAA A;  2DKB A;  3NU7 A;  4ITG A;  4OMA A;  4AZJ A;  3PDX A;  1WYU B;  4IXO A;  3TAT A;  2GMS A;  2W8T A;  1S0A A;  1X0M A;  2VMO A;  3AOV A;  3FQA A;  4MGR A;  1M0N A;  3QHX A;  1MGV A;  1RV4 A;  2F8J A;  3KE3 A;  3ELP A;  2VYC A;  4CXR A;  2CH1 A;  1D7S A;  4KXK A;  1T3I A;  3RBL A;  4WBT A;  2HUU A;  5DJ9 A;  4DQ6 A;  1W7N A;  3H7F A;  3FCR A;  4MKK A;  4UHM A;  1Z7D A;  3IHJ A;  1AMQ A;  2CTZ A;  2AY1 A;  3MAD A;  4Q76 A;  2VGU A;  1M4N A;  4U2H A;  2YCT A;  4PFN A;  4AOA A;  4PVF A;  1B5O A;  2VMU A;  2D63 A;  1AAM A;  4ATP A;  1AHF A;  3JW9 A;  4QGR A;  4ADE A;  8AAT A;  2XBN A;  1OAT A;  4F5J A;  1FC4 A;  2VGT A;  2ORD A;  4WLJ A;  3RCH A;  3JZL A;  2AEV A;  4JE5 D;  1KKP A;  5FT8 A;  2AY4 A;  1I48 A;  1D7U A;  4L0O A;  1ASC A;  1LW5 A;  1SZU A;  1IX8 A;  1M32 A;  2AY3 A;  3EZS A;  4Q75 A;  2HOY A;  2JJH A;  3QGU A;  4F4E A;  1I43 A;  4W1W A;  1GC2 A;  1IX7 A;  2BWP A;  3AEP A;  3CQ5 A;  2Z61 A;  2ZJG A;  2BWN A;  3BC8 A;  3UWC A;  3ELE A;  4B98 A;  2D61 A;  2JGT A;  4XQ2 A;  4OCA A;  3TCM A;  1IJI A;  4UQV A;  1TPL A;  4CBS A;  1V2F A;  1AHG A;  2W7M A;  3HL2 A;  1AJS A;  2VLF A;  1S08 A;  3NTJ A;  1GC4 A;  3BWN C;  2BI3 A;  2BI2 A;  1BQD A;  4P7Y A;  3PGY A;  2O0R A;  4WYC A;  5E5I A;  1VP4 A;  3NX3 A;  2W8V A;  1C7O A;  2D5Y A;  5I92 A;  3M5U A;  4WB0 B;  2R5C B;  3W1J A;  2D65 A;  4B9B A;  2OKK A;  3COG A;  2VMW A;  5HHY A;  3HQT A;  2VMP A;  2VMT A;  3F0H A;  4R5F A;  4WB0 A;  4A0R A;  2EH6 A;  3EI8 A;  4IXS A;  4PFF A;  2QMA A;  2GMU A;  1AJR A;  1DFO A;  3LY1 A;  3KGX A;  4XJO A;  4FFC A;  3WKR A;  1AMS A;  3FRK A;  1RVY A;  2E54 A;  2ZP7 A;  3EUC A;  1Y4I A;  2PO3 A;  3NUI A;  1DJE A;  1FG7 A;  1SPA A;  3A9X A;  1ZOD A;  2EPJ A;  1IVR A;  1BJ4 A;  1MDZ A;  1J32 A;  4MQQ A;  1ASN A;  4JEW A;  5J8Q A;  2WKA A;  2C7T A;  3FQ7 A;  1WST A;  1C0N A;  3FQ8 A;  5C6U A;  3CQ6 A;  1TAS A;  1IAX A;  2V1P A;  3N0L A;  1C9C A;  4LNJ A;  3H14 A;  1AY8 A;  4WD2 A;  4HVK A;  3EIB A;  2YKX A;  2Q7W A;  3I5T A;  3NDN A;  4MY5 A;  2BKW A;  2Z1Z A;  4P3M A;  4RIT A;  4ZAS A;  2W7L A;  1M6S A;  1W23 A;  4IW7 A;  2YCP A;  3I16 A;  3A9Z A;  3ZRR A;  2PB2 A;  2CY8 A;  2EO5 A;  2X5D A;  2ZY4 A;  1AMR A;  1TOK A;  2DKJ A;  4ZWM A;  4GDY A;  4UHN A;  3BWN A;  4ZLV A;  1KL1 A;  1W7L A;  2W8U A;  4XJP A;  2OGA A;  2EZ2 A;  3JTX A;  1GCK A;  5M4D A;  2VGV A;  2X3L A;  2GSA A;  3L44 A;  3AEM C;  3QBO A;  1Z3Z A;  4A72 A;  2AY6 A;  4TN4 A;  1M0Q A;  4AO4 A;  1WYV B;  2ZY5 A;  4CVQ A;  1X28 A;  4Y0H A;  2OAT A;  1BKG A;  1JS6 A;  2CJG A;  4BHD A;  1BJO B;  7AAT A;  1WYV A;  2CAN A;  1AHX A;  1FG3 A;  1IBJ A;  3PAA A;  2AY7 A;  3EIA A;  3FVX A;  1BJO A;  2DOU A;  4A6T A;  1LS3 A;  4IXZ A;  3ZZK A;  2HUI A;  2VI8 A;  1PMO A;  2Z20 A;  2ZSM A;  1YJS A;  4M2M A;  1KKJ A;  4F5K A;  2CJH A;  4W1V A;  5D95 A;  4IYO B;  3DOD A;  4MQP A;  2XH1 A;  4MKJ A;  2O1B A;  4FL0 A;  3E2Z B;  2WK8 A;  1QJ3 A;  3NYU A;  4IYO A;  1ASB A;  2FYF A;  2W7G A;  1PG8 A;  1AKA A;  4ZSW A;  1O61 A;  3EI6 A;  3DYD A;  1AMA A;  1B9I A;  1TOJ A;  2YHK A;  4WYG A;  1M0O A;  2R5E A;  4IY7 A;  3CAI A;  2OKJ A;  1X29 A;  5EIG B;  1JF9 A;  3MKJ A;  1WYT B;  4RAE A;  2VI9 A;  1DJU A;  4WYE A;  3ZRP A;  2JIS A;  3FKD A;  4R2N A;  5EIG A;  1WYT A;  4JEV A;  4A0F A;  3BCA A;  3G7Q A;  2NMP A;  2W7J A;  5FT5 A;  1BT4 A;  1D2F A;  5EQC A;  1GC3 A;  3G0T A;  1S06 A;  1CQ8 A;  4PIW A;  3RBF A;  1YIY A;  1TOG A;  5G2Q A;  3ISL A;  1EG5 A;  3FDB A;  3PD6 A;  3MEB A;  3RCH B;  2AEU A;  2ZC0 A;  4H51 A;  1ARS A;  1JS3 A;  1M7Y A; 
#chains in the Genus database with same CATH topology
 1TOI A;  3D6K A;  3EI7 A;  4W8I A;  3GZD C;  1H0C A;  4GRX A;  1ASD A;  3F9T A;  2EGY A;  4BMK A;  2FN6 A;  2JG2 A;  3WCO A;  1CS1 A;  4WXF A;  5EUD A;  4H63 Q;  2AY2 A;  2FNI A;  2HZP A;  4F5L A;  2YKU A;  1OHW A;  4K2I A;  4EMY A;  4GSA A;  2W7H A;  4Q31 A;  1CZE A;  2Z9V A;  3DU4 A;  1XI9 A;  1PFF A;  1UU2 A;  4EB5 A;  1ELQ A;  1AJS B;  4LNL A;  1UU0 A;  3JWA A;  3FTB A;  4J5U A;  2RFV A;  1OHY A;  1MDO A;  1CQ7 A;  3QPG A;  3FVS A;  3NYS A;  1H1C A;  3USF A;  3W1I A;  1VJO A;  4JE5 A;  2VMY A;  3FDD A;  2TPL A;  3KKI A;  2BIE A;  1WKG A;  1N8P A;  3DC1 A;  2VMR A;  1KAF A;  3DR4 A;  2WK9 A;  3B1E A;  4AH3 A;  2E7I A;  2VGS A;  4EFF A;  1G4V A;  1G7W A;  2CST A;  3A2B A;  4ZDL A;  1BQA A;  3BWO A;  3BV0 A;  4A0H A;  2O7C A;  3CQ4 A;  1D7R A;  1M0P A;  3AEO A;  2GB3 A;  3VK4 A;  1VEF A;  4GE4 A;  1B5P A;  4BA4 A;  3ACZ A;  3B1C A;  4RJY A;  1UU1 A;  2VGZ A;  3P6K A;  2Z9X A;  2VGW A;  5G4J A;  3WX9 A;  2FKI A;  3E6G A;  4OC9 A;  3I4J A;  1CJ0 A;  1CQ6 A;  1MLZ A;  1OHV A;  3JWB A;  1QIS A;  3HBX A;  3HDO A;  4XAU A;  3GZD A;  4JEZ A;  2BIG A;  3LVM A;  5HXX A;  3FD0 A;  4RKC A;  3RUY A;  3N4S A;  2HP1 A;  1B8G A;  2HOZ A;  2Z9U A;  2G7J A;  1OXO A;  3RQ1 A;  2DGK A;  3GWP A;  4ATQ A;  1IX6 A;  4BA5 A;  1AKB A;  3T32 A;  2DGM A;  1ASM A;  1LW4 A;  3ZRQ A;  4IX8 A;  3LVJ A;  5M46 A;  1EQB A;  5G2P A;  4E1O A;  4N0B A;  3ATH A;  5EFS A;  4O6Z A;  1V2E A;  3EI5 A;  3IF2 A;  1ASG A;  4WYD A;  1ZC9 A;  3N5M A;  3FZ8 A;  1MLY A;  1UKJ A;  2VMN A;  3K7Y A;  3QM2 A;  3AV7 A;  2Z1Y A;  4MSO A;  4ZM4 A;  3ECD A;  2VMX A;  3FVU A;  3ASB A;  1RV3 A;  2WB6 A;  4WYA A;  2G6W A;  2JJG A;  2YCN A;  4XJL A;  2QB3 A;  5JAY A;  3NNK A;  4OYT A;  1CL1 A;  1BJW A;  4LW2 A;  1AX4 A;  5E4Z A;  3F6T A;  1ZOB A;  3OKS A;  2BI5 A;  3UE8 A;  2W8J A;  4E3R A;  3WZF A;  1LKC A;  2HP2 A;  1DJ9 A;  3ASA A;  4W91 A;  2CJD A;  2R2N A;  1N2T A;  3CBF A;  5BJ3 A;  4ZDP A;  3LG0 A;  3AEN B;  4E3Q A;  1I41 A;  4TMR A;  9AAT A;  4XEW A;  3N75 A;  1U08 A;  3TFU A;  3AEN A;  2V0Y A;  1SF2 A;  1JG8 A;  1ECX A;  3WKS A;  2ZY2 A;  2VMZ A;  2D7Y A;  4GE7 A;  1LC8 A;  3DXV A;  3W1H A;  2ZYJ A;  3GSB A;  4RLG A;  3MAF B;  2OGE A;  3K40 A;  4ISY A;  3WLX A;  3QN6 A;  4ADD A;  4EU1 A;  3E77 A;  2VMS A;  3MAF A;  2C0R A;  4Y0I A;  4F5G A;  3BCX A;  3FFR A;  4Q6R A;  5DJ1 A;  3PDB A;  2W7D A;  1LC7 A;  3VK3 A;  5DB5 A;  4U1T A;  3OP7 A;  3R9A A;  3MC6 C;  4ZWV A;  1C7N A;  2KFP A;  1C7G A;  1SFF A;  2JJE A;  1GEY A;  1OXP A;  1AY5 A;  3EI9 A;  5FT6 A;  2QA3 A;  4KYO A;  3AEM A;  2D7Z A;  2VMQ A;  5E3K A;  3TQX A;  3N7N A;  2ZY3 A;  1W3U A;  2YRR A;  2E7J A;  1XEY A;  3E2Y A;  4K2B A;  3WCN A;  2D66 A;  3K28 A;  5G09 A;  5FT4 A;  3B8X A;  3PA9 A;  4OBV A;  1MDX A;  1ASF A;  2HOX A;  4JF0 A;  2HOR A;  4F5M A;  1YJY A;  3PD6 B;  3R4T A;  2BYJ A;  1QIT A;  2Z67 A;  2A1V A;  4F5H A;  2CFB A;  1AIB A;  2QBT A;  2D64 A;  3L8A A;  5F9S A;  3LVK A;  1ORD A;  3PJ0 A;  4I8A A;  1WYU A;  2BI9 A;  2X8U A;  5EAV A;  1AIC A;  2VIA A;  3GBX A;  2DR1 A;  4A0G A;  4M2J A;  1AKC A;  2AAT A;  1MAP A;  4ITX A;  3MAU A;  4XJM A;  1SZS A;  2CIN A;  4WLH A;  4A6U A;  4R5Z A;  3AAT A;  4OT8 A;  5EUN A;  1DGE A;  2OQX A;  3HT4 A;  4ZDO A;  3AOW A;  4ADC A;  3WGB A;  2X5F A;  3JU7 A;  1ASL A;  2EZ1 A;  3MC6 A;  2W7I A;  3GZC A;  3B1D A;  3N4X A;  3ZZJ A;  1ELU A;  2FQ6 A;  2WK7 A;  4JF1 A;  3KGW A;  4RJ0 A;  3BN1 A;  4M2K A;  3BCB A;  2BI1 A;  2E7U A;  3QI6 A;  2YRI A;  3GR9 A;  5DX5 A;  2Z9W A;  1E5E A;  4OTL A;  1AIA A;  4UHO A;  1LK9 A;  1SVV A;  4CXQ A;  1PMM A;  2PB0 A;  4WYF A;  1AY4 A;  3A9Y A;  1KMJ A;  2AY5 A;  3RI6 A;  3HMU A;  4EB7 A;  4KAM A;  5LHA A;  3HVY A;  3DZZ A;  2BYL A;  3UAK A;  4CBR A;  3LVL B;  4ZAH A;  1DKA A;  1LC5 A;  1G7X A;  1KL2 A;  1X2A A;  3DXW A;  2BHX A;  5F8V A;  5TF5 A;  3VAX A;  4W5K A;  2R0T A;  1YOO A;  5LH9 A;  1G4X A;  1N31 A;  3Q8N A;  3GJU A;  4ADB A;  4DBC A;  1E5F A;  2R5C A;  4R8D A;  5HDM A;  4N0W A;  3GET A;  1AAW A;  1TAR A;  2HUF A;  3MBB A;  1ARI A;  2VIB A;  1S09 A;  1B9H A;  3AEJ C;  4OBU A;  1AHY A;  3E2F A;  1IUG A;  2DGL A;  2W7F A;  1O4S A;  3II0 A;  2YOB A;  1CL2 A;  3DR7 A;  4DGT A;  4JEX A;  3E9K A;  4BQ0 A;  5EUE A;  1C4K A;  1KMK A;  4WXG A;  3HLM A;  4E77 A;  3NUB A;  3FSL A;  3FZ7 A;  1P3W A;  4RM1 A;  4UOY A;  3FZ6 A;  1QIR A;  2W7E A;  3EZ1 A;  1TAT A;  1DGD A;  4RIZ A;  5M4B A;  1QZ9 A;  2CB1 A;  1D7V A;  4F5F A;  4F5I A;  2BIA A;  1IAY A;  1S07 A;  1BJN A;  1YJZ A;  5EAA A;  3B46 A;  4RKD A;  1B4X A;  1EJI A;  3BB8 A;  3NU8 A;  1YNU A;  5G0A A;  1TOE A;  1J04 A;  2BWO A;  2W7K A;  4W1X A;  2FM1 A;  4A00 A;  4JEY A;  3AEL A;  3NRA A;  4XK1 A;  1BS0 A;  3WY7 A;  5BJ4 A;  1V72 A;  2FNU A;  2QLR A;  4K2M A;  2YKV A;  1ASE A;  3DRD A;  1YIZ A;  4LNM A;  4ZSY A;  5G4I A;  4AO9 A;  1BW0 A;  1GC0 A;  4A6R A;  2C81 A;  1SZK A;  3A8U X;  4TV7 A;  1ASA A;  2CH2 A;  2YKY A;  4NOG A;  4LW4 A;  2QB2 A;  3TFT A;  3LWS A;  1MAQ A;  3G8M A;  4ZM3 A;  5IWQ A;  2VMV A;  2AY9 A;  3P1T A;  1O62 A;  3AEJ A;  3BS8 A;  1I29 A;  3PDB B;  2GQN A;  4HF8 A;  1DTY A;  1QJ5 A;  4WXB A;  4J8L A;  2ZSL A;  4MQR A;  1W7M A;  1V2D A;  1AHE A;  1ARG A;  1CZC A;  2ZUK A;  3PPL A;  1GDE A;  3PIU A;  4Y0D A;  1GEW A;  3VOM A;  1GD9 A;  1O69 A;  1ART A;  3VK2 A;  4WP0 A;  1RVU A;  3NYT A;  1GEX A;  5AX8 A;  5M49 A;  5KTB A;  1WKH A;  4LC3 A;  3WGC A;  1GBN A;  2C44 A;  5D5S A;  3LV2 A;  2VLH A;  2JJF A;  3FFH A;  5K8B A;  2AY8 A;  3VP6 A;  3E2Z A;  1QGN A;  2W8W A;  4GEB A;  1ARH A;  4AZK A;  4GE9 A;  1YAA A;  2DKB A;  3NU7 A;  4ITG A;  4OMA A;  4AZJ A;  3PDX A;  1WYU B;  4IXO A;  3TAT A;  2GMS A;  2W8T A;  1S0A A;  1X0M A;  2VMO A;  3AOV A;  3FQA A;  4MGR A;  1M0N A;  3QHX A;  1MGV A;  1RV4 A;  2F8J A;  3KE3 A;  3ELP A;  2VYC A;  4CXR A;  2CH1 A;  1D7S A;  4KXK A;  1T3I A;  3RBL A;  4WBT A;  2HUU A;  5DJ9 A;  4DQ6 A;  1W7N A;  3H7F A;  3FCR A;  4MKK A;  4UHM A;  1Z7D A;  3IHJ A;  1AMQ A;  2CTZ A;  2AY1 A;  3MAD A;  4Q76 A;  2VGU A;  1M4N A;  4U2H A;  2YCT A;  4PFN A;  4AOA A;  4PVF A;  1B5O A;  2VMU A;  2EYQ A;  2D63 A;  1AAM A;  4ATP A;  1AHF A;  3JW9 A;  4QGR A;  4ADE A;  8AAT A;  2XBN A;  1OAT A;  4F5J A;  1FC4 A;  2VGT A;  2ORD A;  4WLJ A;  3RCH A;  3JZL A;  2AEV A;  4JE5 D;  1KKP A;  5FT8 A;  2AY4 A;  3H9X A;  1I48 A;  1D7U A;  4L0O A;  1ASC A;  1LW5 A;  1SZU A;  1IX8 A;  1M32 A;  2AY3 A;  3EZS A;  4Q75 A;  2HOY A;  2JJH A;  3QGU A;  4F4E A;  1I43 A;  4W1W A;  1GC2 A;  1IX7 A;  2BWP A;  3AEP A;  3CQ5 A;  2Z61 A;  2ZJG A;  2BWN A;  3BC8 A;  3UWC A;  3ELE A;  4B98 A;  2D61 A;  2JGT A;  4XQ2 A;  4OCA A;  3TCM A;  1IJI A;  4UQV A;  1TPL A;  4CBS A;  1V2F A;  1AHG A;  2W7M A;  3HL2 A;  1AJS A;  2VLF A;  1S08 A;  3NTJ A;  1GC4 A;  3BWN C;  2BI3 A;  2BI2 A;  1BQD A;  4P7Y A;  3PGY A;  2O0R A;  4WYC A;  5E5I A;  1VP4 A;  3NX3 A;  2W8V A;  1C7O A;  2D5Y A;  5I92 A;  3M5U A;  4WB0 B;  2R5C B;  3W1J A;  2D65 A;  4B9B A;  2OKK A;  3COG A;  2VMW A;  5HHY A;  3HQT A;  2VMP A;  2VMT A;  3F0H A;  4R5F A;  4WB0 A;  4A0R A;  2EH6 A;  3EI8 A;  4IXS A;  4PFF A;  2QMA A;  2GMU A;  1AJR A;  1DFO A;  3LY1 A;  3KGX A;  3N4R A;  4XJO A;  4FFC A;  3WKR A;  1AMS A;  3FRK A;  1RVY A;  2E54 A;  2ZP7 A;  3EUC A;  1Y4I A;  2PO3 A;  3NUI A;  1DJE A;  1FG7 A;  1SPA A;  3A9X A;  1ZOD A;  2EPJ A;  1IVR A;  1BJ4 A;  1MDZ A;  1J32 A;  4MQQ A;  1ASN A;  4JEW A;  5J8Q A;  2WKA A;  2C7T A;  3FQ7 A;  1WST A;  1C0N A;  3FQ8 A;  5C6U A;  3CQ6 A;  1TAS A;  1IAX A;  2V1P A;  3N0L A;  1C9C A;  4LNJ A;  3H14 A;  1AY8 A;  4WD2 A;  4HVK A;  3EIB A;  2YKX A;  2Q7W A;  3I5T A;  3NDN A;  4MY5 A;  2BKW A;  2Z1Z A;  4P3M A;  4RIT A;  4ZAS A;  2W7L A;  1M6S A;  1W23 A;  4IW7 A;  2YCP A;  3I16 A;  3A9Z A;  3ZRR A;  2PB2 A;  2CY8 A;  2EO5 A;  2X5D A;  2ZY4 A;  1AMR A;  1TOK A;  2DKJ A;  4ZWM A;  4GDY A;  4UHN A;  3BWN A;  4ZLV A;  1KL1 A;  1W7L A;  2W8U A;  4XJP A;  2OGA A;  2EZ2 A;  3JTX A;  1GCK A;  5M4D A;  2VGV A;  2X3L A;  2GSA A;  3L44 A;  3AEM C;  3QBO A;  1Z3Z A;  4A72 A;  2AY6 A;  4TN4 A;  1M0Q A;  4AO4 A;  1WYV B;  2ZY5 A;  4CVQ A;  1X28 A;  4Y0H A;  2OAT A;  1BKG A;  1JS6 A;  2CJG A;  4BHD A;  1BJO B;  7AAT A;  1WYV A;  2CAN A;  1AHX A;  1FG3 A;  1IBJ A;  3PAA A;  2AY7 A;  3EIA A;  3FVX A;  1BJO A;  2DOU A;  4A6T A;  1LS3 A;  4IXZ A;  3ZZK A;  2HUI A;  2VI8 A;  1PMO A;  2Z20 A;  2ZSM A;  1YJS A;  4M2M A;  1KKJ A;  4F5K A;  2CJH A;  4W1V A;  5D95 A;  4IYO B;  3DOD A;  4MQP A;  2XH1 A;  4MKJ A;  2O1B A;  4FL0 A;  3E2Z B;  2WK8 A;  1QJ3 A;  3NYU A;  4IYO A;  1ASB A;  2FYF A;  2W7G A;  1PG8 A;  1AKA A;  4ZSW A;  1O61 A;  3EI6 A;  3DYD A;  1AMA A;  1B9I A;  1TOJ A;  2YHK A;  4WYG A;  1M0O A;  2R5E A;  4IY7 A;  3CAI A;  2OKJ A;  1X29 A;  5EIG B;  1JF9 A;  3MKJ A;  1WYT B;  4RAE A;  2VI9 A;  1DJU A;  4WYE A;  4K05 A;  3ZRP A;  2JIS A;  3FKD A;  4R2N A;  5EIG A;  1WYT A;  4JEV A;  4A0F A;  3BCA A;  3G7Q A;  2NMP A;  2W7J A;  5FT5 A;  1BT4 A;  1D2F A;  5EQC A;  1GC3 A;  3G0T A;  1S06 A;  1CQ8 A;  4PIW A;  3RBF A;  1YIY A;  1TOG A;  5G2Q A;  3ISL A;  2QSR A;  1EG5 A;  3FDB A;  3PD6 A;  3MEB A;  3RCH B;  2AEU A;  2ZC0 A;  4H51 A;  1ARS A;  1JS3 A;  1M7Y A; 
#chains in the Genus database with same CATH homology
 1TOI A;  3D6K A;  3EI7 A;  4W8I A;  3GZD C;  1H0C A;  4GRX A;  1ASD A;  3F9T A;  2EGY A;  4BMK A;  2FN6 A;  2JG2 A;  3WCO A;  1CS1 A;  4WXF A;  5EUD A;  4H63 Q;  2AY2 A;  2FNI A;  2HZP A;  4F5L A;  2YKU A;  1OHW A;  4K2I A;  4EMY A;  4GSA A;  2W7H A;  4Q31 A;  1CZE A;  2Z9V A;  3DU4 A;  1XI9 A;  1PFF A;  1UU2 A;  4EB5 A;  1ELQ A;  1AJS B;  4LNL A;  1UU0 A;  3JWA A;  3FTB A;  4J5U A;  2RFV A;  1OHY A;  1MDO A;  1CQ7 A;  3QPG A;  3FVS A;  3NYS A;  1H1C A;  3USF A;  3W1I A;  1VJO A;  4JE5 A;  2VMY A;  3FDD A;  2TPL A;  3KKI A;  2BIE A;  1WKG A;  1N8P A;  3DC1 A;  2VMR A;  3DR4 A;  2WK9 A;  3B1E A;  4AH3 A;  2E7I A;  2VGS A;  4EFF A;  1G4V A;  1G7W A;  2CST A;  3A2B A;  4ZDL A;  1BQA A;  3BWO A;  3BV0 A;  4A0H A;  2O7C A;  3CQ4 A;  1D7R A;  1M0P A;  3AEO A;  2GB3 A;  3VK4 A;  1VEF A;  4GE4 A;  1B5P A;  4BA4 A;  3ACZ A;  3B1C A;  4RJY A;  1UU1 A;  2VGZ A;  3P6K A;  2Z9X A;  2VGW A;  5G4J A;  3WX9 A;  2FKI A;  3E6G A;  4OC9 A;  3I4J A;  1CJ0 A;  1CQ6 A;  1MLZ A;  1OHV A;  3JWB A;  1QIS A;  3HBX A;  3HDO A;  4XAU A;  3GZD A;  4JEZ A;  2BIG A;  3LVM A;  5HXX A;  3FD0 A;  4RKC A;  3RUY A;  3N4S A;  2HP1 A;  1B8G A;  2HOZ A;  2Z9U A;  2G7J A;  1OXO A;  3RQ1 A;  2DGK A;  3GWP A;  4ATQ A;  1IX6 A;  4BA5 A;  1AKB A;  3T32 A;  2DGM A;  1ASM A;  1LW4 A;  3ZRQ A;  4IX8 A;  3LVJ A;  5M46 A;  1EQB A;  5G2P A;  4E1O A;  4N0B A;  3ATH A;  5EFS A;  4O6Z A;  1V2E A;  3EI5 A;  3IF2 A;  1ASG A;  4WYD A;  1ZC9 A;  3N5M A;  3FZ8 A;  1MLY A;  1UKJ A;  2VMN A;  3K7Y A;  3QM2 A;  3AV7 A;  2Z1Y A;  4MSO A;  4ZM4 A;  3ECD A;  2VMX A;  3FVU A;  3ASB A;  1RV3 A;  2WB6 A;  4WYA A;  2G6W A;  2JJG A;  2YCN A;  4XJL A;  2QB3 A;  5JAY A;  3NNK A;  4OYT A;  1CL1 A;  1BJW A;  4LW2 A;  1AX4 A;  5E4Z A;  3F6T A;  1ZOB A;  3OKS A;  2BI5 A;  3UE8 A;  2W8J A;  4E3R A;  3WZF A;  1LKC A;  2HP2 A;  1DJ9 A;  3ASA A;  4W91 A;  2CJD A;  2R2N A;  1N2T A;  3CBF A;  5BJ3 A;  4ZDP A;  3LG0 A;  3AEN B;  4E3Q A;  1I41 A;  4TMR A;  9AAT A;  4XEW A;  3N75 A;  1U08 A;  3TFU A;  3AEN A;  2V0Y A;  1SF2 A;  1JG8 A;  1ECX A;  3WKS A;  2ZY2 A;  2VMZ A;  2D7Y A;  4GE7 A;  1LC8 A;  3DXV A;  3W1H A;  2ZYJ A;  3GSB A;  4RLG A;  3MAF B;  2OGE A;  3K40 A;  4ISY A;  3WLX A;  3QN6 A;  4ADD A;  4EU1 A;  3E77 A;  2VMS A;  3MAF A;  2C0R A;  4Y0I A;  4F5G A;  3BCX A;  3FFR A;  4Q6R A;  5DJ1 A;  3PDB A;  2W7D A;  1LC7 A;  3VK3 A;  5DB5 A;  4U1T A;  3OP7 A;  3R9A A;  3MC6 C;  4ZWV A;  1C7N A;  2KFP A;  1C7G A;  1SFF A;  2JJE A;  1GEY A;  1OXP A;  1AY5 A;  3EI9 A;  5FT6 A;  2QA3 A;  4KYO A;  3AEM A;  2D7Z A;  2VMQ A;  5E3K A;  3TQX A;  3N7N A;  2ZY3 A;  1W3U A;  2YRR A;  2E7J A;  1XEY A;  3E2Y A;  4K2B A;  3WCN A;  2D66 A;  3K28 A;  5G09 A;  5FT4 A;  3B8X A;  3PA9 A;  4OBV A;  1MDX A;  1ASF A;  2HOX A;  4JF0 A;  2HOR A;  4F5M A;  1YJY A;  3PD6 B;  3R4T A;  2BYJ A;  1QIT A;  2Z67 A;  2A1V A;  4F5H A;  2CFB A;  1AIB A;  2QBT A;  2D64 A;  3L8A A;  5F9S A;  3LVK A;  1ORD A;  3PJ0 A;  4I8A A;  1WYU A;  2BI9 A;  2X8U A;  5EAV A;  1AIC A;  2VIA A;  3GBX A;  2DR1 A;  4A0G A;  4M2J A;  1AKC A;  2AAT A;  1MAP A;  4ITX A;  3MAU A;  4XJM A;  1SZS A;  2CIN A;  4WLH A;  4A6U A;  4R5Z A;  3AAT A;  4OT8 A;  5EUN A;  1DGE A;  2OQX A;  3HT4 A;  4ZDO A;  3AOW A;  4ADC A;  3WGB A;  2X5F A;  3JU7 A;  1ASL A;  2EZ1 A;  3MC6 A;  2W7I A;  3GZC A;  3B1D A;  3N4X A;  3ZZJ A;  1ELU A;  2FQ6 A;  2WK7 A;  4JF1 A;  3KGW A;  4RJ0 A;  3BN1 A;  4M2K A;  3BCB A;  2BI1 A;  2E7U A;  3QI6 A;  2YRI A;  3GR9 A;  5DX5 A;  2Z9W A;  1E5E A;  4OTL A;  1AIA A;  4UHO A;  1LK9 A;  1SVV A;  4CXQ A;  1PMM A;  2PB0 A;  4WYF A;  1AY4 A;  3A9Y A;  1KMJ A;  2AY5 A;  3RI6 A;  3HMU A;  4EB7 A;  4KAM A;  5LHA A;  3HVY A;  3DZZ A;  2BYL A;  3UAK A;  4CBR A;  3LVL B;  4ZAH A;  1DKA A;  1LC5 A;  1G7X A;  1KL2 A;  1X2A A;  3DXW A;  2BHX A;  5F8V A;  5TF5 A;  3VAX A;  4W5K A;  2R0T A;  1YOO A;  5LH9 A;  1G4X A;  1N31 A;  3Q8N A;  3GJU A;  4ADB A;  4DBC A;  1E5F A;  2R5C A;  4R8D A;  5HDM A;  4N0W A;  3GET A;  1AAW A;  1TAR A;  2HUF A;  3MBB A;  1ARI A;  2VIB A;  1S09 A;  1B9H A;  3AEJ C;  4OBU A;  1AHY A;  3E2F A;  1IUG A;  2DGL A;  2W7F A;  1O4S A;  3II0 A;  2YOB A;  1CL2 A;  3DR7 A;  4DGT A;  4JEX A;  3E9K A;  4BQ0 A;  5EUE A;  1C4K A;  1KMK A;  4WXG A;  3HLM A;  4E77 A;  3NUB A;  3FSL A;  3FZ7 A;  1P3W A;  4RM1 A;  4UOY A;  3FZ6 A;  1QIR A;  2W7E A;  3EZ1 A;  1TAT A;  1DGD A;  4RIZ A;  5M4B A;  1QZ9 A;  2CB1 A;  1D7V A;  4F5F A;  4F5I A;  2BIA A;  1IAY A;  1S07 A;  1BJN A;  1YJZ A;  5EAA A;  3B46 A;  4RKD A;  1B4X A;  1EJI A;  3BB8 A;  3NU8 A;  1YNU A;  5G0A A;  1TOE A;  1J04 A;  2BWO A;  2W7K A;  4W1X A;  2FM1 A;  4A00 A;  4JEY A;  3AEL A;  3NRA A;  4XK1 A;  1BS0 A;  3WY7 A;  5BJ4 A;  1V72 A;  2FNU A;  2QLR A;  4K2M A;  2YKV A;  1ASE A;  3DRD A;  1YIZ A;  4LNM A;  4ZSY A;  5G4I A;  4AO9 A;  1BW0 A;  1GC0 A;  4A6R A;  2C81 A;  1SZK A;  3A8U X;  4TV7 A;  1ASA A;  2CH2 A;  2YKY A;  4NOG A;  4LW4 A;  2QB2 A;  3TFT A;  3LWS A;  1MAQ A;  3G8M A;  4ZM3 A;  5IWQ A;  2VMV A;  2AY9 A;  3P1T A;  1O62 A;  3AEJ A;  3BS8 A;  1I29 A;  3PDB B;  2GQN A;  4HF8 A;  1DTY A;  1QJ5 A;  4WXB A;  4J8L A;  2ZSL A;  4MQR A;  1W7M A;  1V2D A;  1AHE A;  1ARG A;  1CZC A;  2ZUK A;  3PPL A;  1GDE A;  3PIU A;  4Y0D A;  1GEW A;  3VOM A;  1GD9 A;  1O69 A;  1ART A;  3VK2 A;  4WP0 A;  1RVU A;  3NYT A;  1GEX A;  5AX8 A;  5M49 A;  5KTB A;  1WKH A;  4LC3 A;  3WGC A;  1GBN A;  2C44 A;  5D5S A;  3LV2 A;  2VLH A;  2JJF A;  3FFH A;  5K8B A;  2AY8 A;  3VP6 A;  3E2Z A;  1QGN A;  2W8W A;  4GEB A;  1ARH A;  4AZK A;  4GE9 A;  1YAA A;  2DKB A;  3NU7 A;  4ITG A;  4OMA A;  4AZJ A;  3PDX A;  1WYU B;  4IXO A;  3TAT A;  2GMS A;  2W8T A;  1S0A A;  1X0M A;  2VMO A;  3AOV A;  3FQA A;  4MGR A;  1M0N A;  3QHX A;  1MGV A;  1RV4 A;  2F8J A;  3KE3 A;  3ELP A;  2VYC A;  4CXR A;  2CH1 A;  1D7S A;  4KXK A;  1T3I A;  3RBL A;  4WBT A;  2HUU A;  5DJ9 A;  4DQ6 A;  1W7N A;  3H7F A;  3FCR A;  4MKK A;  4UHM A;  1Z7D A;  3IHJ A;  1AMQ A;  2CTZ A;  2AY1 A;  3MAD A;  4Q76 A;  2VGU A;  1M4N A;  4U2H A;  2YCT A;  4PFN A;  4AOA A;  4PVF A;  1B5O A;  2VMU A;  2EYQ A;  2D63 A;  1AAM A;  4ATP A;  1AHF A;  3JW9 A;  4QGR A;  4ADE A;  8AAT A;  2XBN A;  1OAT A;  4F5J A;  1FC4 A;  2VGT A;  2ORD A;  4WLJ A;  3RCH A;  3JZL A;  2AEV A;  4JE5 D;  1KKP A;  5FT8 A;  2AY4 A;  3H9X A;  1I48 A;  1D7U A;  4L0O A;  1ASC A;  1LW5 A;  1SZU A;  1IX8 A;  1M32 A;  2AY3 A;  3EZS A;  4Q75 A;  2HOY A;  2JJH A;  3QGU A;  4F4E A;  1I43 A;  4W1W A;  1GC2 A;  1IX7 A;  2BWP A;  3AEP A;  3CQ5 A;  2Z61 A;  2ZJG A;  2BWN A;  3BC8 A;  3UWC A;  3ELE A;  4B98 A;  2D61 A;  2JGT A;  4XQ2 A;  4OCA A;  3TCM A;  1IJI A;  4UQV A;  1TPL A;  4CBS A;  1V2F A;  1AHG A;  2W7M A;  3HL2 A;  1AJS A;  2VLF A;  1S08 A;  3NTJ A;  1GC4 A;  3BWN C;  2BI3 A;  2BI2 A;  1BQD A;  4P7Y A;  3PGY A;  2O0R A;  4WYC A;  5E5I A;  1VP4 A;  3NX3 A;  2W8V A;  1C7O A;  2D5Y A;  5I92 A;  3M5U A;  4WB0 B;  2R5C B;  3W1J A;  2D65 A;  4B9B A;  2OKK A;  3COG A;  2VMW A;  5HHY A;  3HQT A;  2VMP A;  2VMT A;  3F0H A;  4R5F A;  4WB0 A;  4A0R A;  2EH6 A;  3EI8 A;  4IXS A;  4PFF A;  2QMA A;  2GMU A;  1AJR A;  1DFO A;  3LY1 A;  3KGX A;  3N4R A;  4XJO A;  4FFC A;  3WKR A;  1AMS A;  3FRK A;  1RVY A;  2E54 A;  2ZP7 A;  3EUC A;  1Y4I A;  2PO3 A;  3NUI A;  1DJE A;  1FG7 A;  1SPA A;  3A9X A;  1ZOD A;  2EPJ A;  1IVR A;  1BJ4 A;  1MDZ A;  1J32 A;  4MQQ A;  1ASN A;  4JEW A;  5J8Q A;  2WKA A;  2C7T A;  3FQ7 A;  1WST A;  1C0N A;  3FQ8 A;  5C6U A;  3CQ6 A;  1TAS A;  1IAX A;  2V1P A;  3N0L A;  1C9C A;  4LNJ A;  3H14 A;  1AY8 A;  4WD2 A;  4HVK A;  3EIB A;  2YKX A;  2Q7W A;  3I5T A;  3NDN A;  4MY5 A;  2BKW A;  2Z1Z A;  4P3M A;  4RIT A;  4ZAS A;  2W7L A;  1M6S A;  1W23 A;  4IW7 A;  2YCP A;  3I16 A;  3A9Z A;  3ZRR A;  2PB2 A;  2CY8 A;  2EO5 A;  2X5D A;  2ZY4 A;  1AMR A;  1TOK A;  2DKJ A;  4ZWM A;  4GDY A;  4UHN A;  3BWN A;  4ZLV A;  1KL1 A;  1W7L A;  2W8U A;  4XJP A;  2OGA A;  2EZ2 A;  3JTX A;  1GCK A;  5M4D A;  2VGV A;  2X3L A;  2GSA A;  3L44 A;  3AEM C;  3QBO A;  1Z3Z A;  4A72 A;  2AY6 A;  4TN4 A;  1M0Q A;  4AO4 A;  1WYV B;  2ZY5 A;  4CVQ A;  1X28 A;  4Y0H A;  2OAT A;  1BKG A;  1JS6 A;  2CJG A;  4BHD A;  1BJO B;  7AAT A;  1WYV A;  2CAN A;  1AHX A;  1FG3 A;  1IBJ A;  3PAA A;  2AY7 A;  3EIA A;  3FVX A;  1BJO A;  2DOU A;  4A6T A;  1LS3 A;  4IXZ A;  3ZZK A;  2HUI A;  2VI8 A;  1PMO A;  2Z20 A;  2ZSM A;  1YJS A;  4M2M A;  1KKJ A;  4F5K A;  2CJH A;  4W1V A;  5D95 A;  4IYO B;  3DOD A;  4MQP A;  2XH1 A;  4MKJ A;  2O1B A;  4FL0 A;  3E2Z B;  2WK8 A;  1QJ3 A;  3NYU A;  4IYO A;  1ASB A;  2FYF A;  2W7G A;  1PG8 A;  1AKA A;  4ZSW A;  1O61 A;  3EI6 A;  3DYD A;  1AMA A;  1B9I A;  1TOJ A;  2YHK A;  4WYG A;  1M0O A;  2R5E A;  4IY7 A;  3CAI A;  2OKJ A;  1X29 A;  5EIG B;  1JF9 A;  3MKJ A;  1WYT B;  4RAE A;  2VI9 A;  1DJU A;  4WYE A;  4K05 A;  3ZRP A;  2JIS A;  3FKD A;  4R2N A;  5EIG A;  1WYT A;  4JEV A;  4A0F A;  3BCA A;  3G7Q A;  2NMP A;  2W7J A;  5FT5 A;  1BT4 A;  1D2F A;  5EQC A;  1GC3 A;  3G0T A;  1S06 A;  1CQ8 A;  4PIW A;  3RBF A;  1YIY A;  1TOG A;  5G2Q A;  3ISL A;  2QSR A;  1EG5 A;  3FDB A;  3PD6 A;  3MEB A;  3RCH B;  2AEU A;  2ZC0 A;  4H51 A;  1ARS A;  1JS3 A;  1M7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...