1BSBA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADVNYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 29
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bsbA00
1B27A 1GSPA 1RLSA 1B20A 1UCKA 1X1XA 1FYSA 1RGKA 4J5GA 1IYYA 1RGFA 7GSPA 1I0VA 1BRGA 2KAAA 1BNRA 1I70A 1BUJA 2BU4A 5RNTA 2AADA 1BNIA 3URPA 7RNTA 1DE3A 1LOWA 5BU4A 2RNTA 1LNIA 1BVIA 1RHLA 1TRQA 1BSDA 2KF4A 2F56A 1RNTA 1RGLA 2F4YA 3SYUA 1UCIA 1BU4A 3BU4A 3DH2A 2ZA4A 1TRPA 1BNEA 1RN4A 1BNFA 4RNTA 4GHOA 9RNTA 1RDSA 2GSPA 2KF3A 1GOUA 3A5EA 3AHWA 1BRNL 1HYFA 1B2ZA 1AQZA 1X1YA 1PYLA 1FW7A 1SARA 2F5WA 1UCJA 1BAOA 1FUTA 1BRIA 1RGHA 1MGWA 2HOHA 2BIRA 2RBIA 1I8VA 1GMPA 1I2FA 1RGAA 3HOHA 1JBRA 1A2PA 1TTOA 1BOXA 1GOYA 1GMRA 5GSPA 1MGRA 3RNTA 4HAAA 1I0XA 1FZUA 2KF5A 1GOVA 1PY3A 4GSPA 1B2UA 1BRKA 3AHSA 1YGWA 1LOVA 1BNJA 1B2SA 1T2HA 4BU4A 1YVSA 1BRHA 1RTUA 3Q3FA 1RMSA 1RN1A 1GMQA 1B21A 1BRSA 1YNVX 1X1WA 1BNGA 1B3SA 1I3IA 3BIRA 1C54A 1RCLA 3AGOA 1BNSA 4BIRA 1LOYA 1FUSA 1BSCA 1CH0A 1T2IA 5HOHA 1UCLA 3KCHA 5BIRA 1AY7A 1DETA 1RCKA 2KF6A 4HOHA 1HZ1A 1RGEA 6RNTA 1X1UA 1BSAA 1Q9EA 1I2EA 1I3FA 1B2MA 4J5KA 3WR2A 1BANA 1JBSA 3GSPA 3WHOA 1B2XA 1BRJA 2SARA 1RGGA 1ZGXA 6GSPA 2AAEA 1G02A 2C4BA 1RGCA 1BIRA 1R4YA 3AGNA 1BSEA 3DGYA 1BSBA 1BGSA 2F5MA 1RNBA 1LRAA 3D4AA 3D5GA 1RSNA 3D5IA 8RNTA 1I2GA 1JBTA
chains in the Genus database with same CATH superfamily
1B27A 1MWUA 3EN8A 3SOYA 1JJ22 1GY6A 2UX0A 4NPBA 1U5OA 3FZWA 1K28A 1RGKA 3NHXA 1RGFA 3T8UA 2CFDA 4AKZA 1BRGA 3BNBA 3FF2A 2Z77A 1BNRA 1WMOA 1DVCA 3MWZA 1BUJA 4XBYA 5RNTA 2AADA 3UL6A 3S28A 4N3VA 2JQ5A 8CHOA 2FNQA 1ZX2A 3OWYA 4JRFA 2KCDA 1SJWA 1RHLA 1O7WB 2BT3A 3IMAB 3NV0A 1VQ43 4R9LA 5M19A 3EHCA 1RNTA 1FA3A 1TIJA 4MMXB 2XGNA 5AIHA 3CCM3 3SYUA 1JKGA 2Y74A 3BU4A 3DUKA 3DH2A 3K0ZA 2GEYA 1QJGA 1TRPA 2IUKA 3FF0A 1K8A4 4OK0A 4LMIA 1HYFA 1B2ZA 5G1LA 3TDGA 1PYLA 3MYTA 1JN5A 1JNQA 3G16A 5DREA 2CC3A 3GZRA 1ISKA 1BAOA 1G96A 1BRIA 1LXEA 1MGWA 2HMJB 5AIGA 3H3HA 3DY5A 3GWRA 3LMLA 3MG2A 1I8VA 1GMPA 3G6E3 2O3OA 3SLUA 2W6JH 1CEWI 2BNGA 3EX9A 1EEJA 1GOYA 3X3XA 2XSOB 5GSPA 4HAAA 1VQK3 1FZUA 3RDEA 1JB4A 1GOVA 1B2UA 1BRKA 3KSPA 4HM6B 2CG1A 1ULJB 3G0KA 1YGWA 1IVVA 4QWTA 3PCRA 1RTUA 1OHSA 3NX0A 1RMSA 1RN1A 3B7CA 2I9WA 2B24B 3CCE3 1JN5B 5BXQA 3SVAA 1BRSA 1YNVX 1Q40A 4DKIA 1NB5I 1Q864 1A90A 5I97A 1M1XB 3BIRA 5JBSA 4N6TA 1S5AA 3OX9A 3B4OA 1D6ZA 1LQMB 2RGQA 4JF8A 5IEPA 4U13A 2CWVA 1T2IA 1FGQA 3EE1A 1NWWA 4HM3B 5IG4A 3CMA3 3FSDA 3G4S3 2H0GA 1DETA 3RGAA 2KF6A 2XR8B 2FGTA 5CF1A 1CYUA 1RGEA 7STDA 1X1UA 2IUJA 2BMRB 1Q9EA 3G8ZA 1I2EA 4ORLA 1ZO2A 3VGNA 1B2MA 3ZG0A 1SIHA 3LYGA 3NM7A 5IG0A 1KWIA 3F40A 3GSPA 1E97A 2ZL8A 4RZMA 5G2GA 5A0OB 3MSOA 3PYJA 1RGGA 2JDIH 3OV4A 3UJMA 3MG1A 4EBGA 2WOFA 1RGCA 2ML6A 3V92A 1OF5A 2M7OA 5CF2A 3D4AA 1Q7Y4 2E2VA 1WTHA 3DZLA 1LOXA 1NJI4 4HM5B 1I2GA 1JBTA 3Q2PA 5CK6A 1GSPA 1RLSA 3FKAA 1RN7A 3JUQA 4O3VA 1UCKA 2HMLB 3N8BA 3D3LA 1K41A 2CK3H 1TUHA 1O7PB 5TGNA 2CFWA 1IYYA 2E2TA 2XFSA 7GSPA 1W00A 1I0VA 1KQS2 4HYZA 4LYLB 1N9EA 3DGMA 1CQSA 4R1KA 1W6GA 2Y73A 5CXOA 4AKYA 1U8CB 1OHPA 2BU4A 4EXRA 4HM0B 3FCSB 1QVF2 3NQYA 4HM8B 1DE3A 5BU4A 2W2CA 5ELUA 2GU1A 3PZWA 4PEJA 5AIIA 2Z7AA 2F86B 3FG1A 1JZDA 3QK9A 4EV5A 5IERA 2XF3A 3Q1CA 1TRQA 3KSED 5M1AA 1AVLA 1R4CA 3L0RA 4I4KA 1W4NA 4N6V0 3WOEB 1VQN3 3EBYA 4STDA 1BNEA 3B8LA 3EB8A 4LEHA 4RNTA 4GHOA 1V74A 4WWUC 9RNTA 3HK4A 1GOUA 3U1WA 4OUQA 1YVBI 2F99A 2INXA 2KRTA 3CU3A 3MG3A 1S723 5LC6A 1DVDA 1TFKA 2GBWB 2CW9A 1LNHA 1FW7A 2Z6BA 2F5WA 2FXTA 3SEDA 1PU4A 1N9JA 3SX1A 1NB3I 4X2OA 1FUWA 2BIRA 1JBRA 1VZZA 1Q42A 4KFEA 3RGRA 2C10A 4EW5A 3BNDA 1BOXA 3FH1A 1GMRA 4WP5A 3OW22 4CCVA 1PY3A 3F7XA 1ZS7A 4XBTA 1SQWA 1OACA 2CFLA 1IT7A 3NXJA 2R41A 4BU4A 4CDLA 2GU3A 2XH9A 1BRHA 1PFPA 3CC73 1DYUA 1GMQA 1W6CA 5JPUA 4L8OA 1IK3A 2LYXA 1STFI 3LOYA 3S5CA 4KZ1A 1TJDA 3GZXB 1C54A 5EQLA 5AEUB 1O7HB 1OGZA 2IY2A 3AGOA 3EF8A 4IPBA 4HZ9B 1UDII 3FLJA 1V57A 1JKGB 4BIRA 1BSCA 4KVHA 3CCV3 1ASKA 2WGQA 2K3DA 5HOHA 5BIRA 2GEXA 3DGOA 4ILFA 6STDA 2YFIB 1JRQA 3HI7A 2W56A 2QEX3 1UUGB 4Q53A 3PXMA 1UW1A 2Q07A 3WR2A 1ULIB 4WHAA 2RCDA 4KFDA 1JV2B 2MF7A 2Z76A 4OVMA 3CCU3 4FCJA 4HM7B 1IT8A 5KP4A 1K9M4 3F14A 3OWUA 3ECFA 3K5TA 2HMKB 1FGOA 2IA7A 3LXUX 4R9KA 3CCJ3 1GD3A 1OCVA 4NREA 1G02A 1IVXA 4AEQA 1IV9A 3DMCA 5G1KA 2CG0A 2D42A 1OUNA 1E3VA 1QAKA 3NBJA 4FCZA 2CHCA 4RBNA 1BSEA 1US1A 3CD63 5AIFA 3U97A 1BGSA 4K1VA 4KT3B 1LRAA 1VQ53 1NU3A 1DMMA 3D5GA 3D5IA 1F8NA 3HIGA 4MEIA 2IYJA 2LQVA 2B1XB 3JUPA 1AVKA 3CCQ3 1B20A 2K54A 1JZOA 3I0YA 3X3YA 1X1XA 1FGRA 1IV7A 1FYSA 1OHOA 3ER7A 3FG3A 2CKFB 3JUMA 3CNMA 1D6YA 3OWSA 4J5GA 3DGLA 5IEOA 2QGUA 1YJ93 2UUGC 1TP6A 2PZVA 4MMYB 1W7CA 5EVHA 2W04A 3ALAA 3O8YA 2KAAA 1I70A 1VQ73 4FMBA 1QMAA 4O8SA 3S29A 3MHEA 7RNTA 1LOWA 2W9QA 2P38A 2OQEC 4H61A 1VQP3 1LNIA 2UGIA 1BVIA 3X40A 3AMOB 1TU5A 4HBRA 5M18A 2XFTA 1MWRA 1RGLA 1EKMA 4GL6A 1NO3A 4K1UA 2XRXB 3QRDA 2F4YA 1O7NB 2HMNB 1OGXA 2GXFA 2K0MA 2V1LA 1UCIA 1BU4A 3EC9A 3JUNA 3LTDA 5ELJA 2ZA4A 1RN4A 2CX0A 2YFJB 2ZHXB 1AV4A 4N6UA 3CPW2 1RDSA 2GSPA 5KP3A 2KF3A 3JUOA 3A5EA 3AHWA 3F7SA 3X3ZA 1BRNL 3FG4A 1UUWB 1W01A 1X1YA 1KD14 4XB5A 1EG9B 4IIAA 1SARA 3HX8A 1UI7A 1UCJA 4FCMA 3VF1A 1JB2A 1NDOB 1RGHA 3V99A 1O7GB 1C7HA 1DMQA 3CNXA 4N6OB 3OXAA 1I2FA 3FGYA 3M8CA 2OTJ3 1A2PA 4J8TA 2O9UX 4BTWA 1MNLA 3BLZA 2QIYA 3ZFZA 2WGOA 1MGRA 3RNTA 2BMQB 1A67A 3KN4A 2P0XA 1EUIC 1IVUA 1CYVA 1OF5B 3EJVA 4IT7A 3CXC2 3BNCA 3KE7A 4WYKB 1EA2A 1YGEA 3STDA 2W9PA 1QVG2 1YVSA 1WMPA 1IVWA 3NBBA 2HMOB 1IQYA 3Q3FA 4FMCA 2F98A 4FMDA 2C11A 1MWTA 3VSYA 2J8XB 1K734 2A15A 1GY5A 4XDVA 4BTXA 3B4PA 3K7CA 1B21A 1ROVA 3K63A 4N6MA 1QAFA 3MKIA 1VQQA 1X1WA 3NM2A 4MMZB 3J7Yd 1I3IA 2W0QA 3BB9A 4EC6A 3CCL3 1VQO3 1RCLA 1IQXA 2CFKA 3EBTA 1MOLA 1ROAA 3PCSA 4N6NB 4O2HA 1T3BA 1FUSA 3A76A 1YIJ3 5KP1A 1VQ93 3CC43 1IDPA 2OWPA 3SOAA 1AY7A 5HGRA 2QA43 1O7MB 1RCKA 3CPOA 4HOHA 4GB5A 3LTBA 2WO0A 3NQZA 1HZ1A 1BSAA 1STDA 4EV2A 5AYSC 1I3FA 4FR9A 4BL2A 4J5KA 2CX1A 2ZDJA 1BANA 1GS3A 2E2UA 4I5QA 1FGMA 5AI1A 2CFGA 3AMOA 1JBSA 1G0TA 2CWTA 4EYCA 5CLKA 3X42A 1W02A 3D9RA 2OOVA 1B2XA 1BRJA 1Q40B 2CWUA 4HVNA 4CJNA 1ZGXA 1TFOA 3LTCA 5FGOA 3CCS3 3EQQB 2AAEA 3SXXA 4BTYA 1YIT3 1N8QA 1M1K4 2C4BA 4RNYA 1UGIA 4RNZA 1OH0A 3AGNA 4NHFA 3DXOA 3I563 1BSBA 1E3RA 1UUVB 2L4VA 2F5MA 1Q824 1N8R4 3KZTA 5D82A 1VQL3 1RSNA 1W2ZA 4HM4B 2YX9A 5STDA 1Y4KA 8RNTA 1Q7HA 1MWSA 1D6UA 4H3UA 3Q90A 3HIIA 4XBXA 3K9MC 2BMOB 4R4KA 2XSHB 2SBLA 1A2VA 2R4IA 2RSXA 2L1SA 2P09A 3LT8A 2CIUA 1FGTA 4MJDA 2STDA 4TX4A 4HZBB 1W2B2 3PS8A 3T8NA 4K61A 1BNIA 2OCTA 1IQ8A 3URPA 2RNTA 3IPTA 1KSIA 3S67A 5BVBA 4R80A 4G1MB 1VQM3 3CCR3 1BSDA 3PGBA 3JVCA 1NNVA 3NV0B 2KF4A 2F56A 1L5GB 3X41A 1T5YA 1QALA 3KKGA 2IMJA 3GZYB 4XM4A 5LC7A 4HJLB 1BNFA 3CME3 4HM2B 3WA3A 5D83A 5AYRB 2OOVC 3BNEA 1AQZA 4FMAA 4O02B 4BL3A 1V58A 5IF6A 1J2BA 3WMDA 1RKYA 1YJW3 1GY7A 1A2KA 1FUTA 4X2HA 3KFQC 3DM8A 3F8HA 1UI8A 1WQLB 3EN1B 2HOHA 2WOHA 2RBIA 2GBXB 1RGAA 3HOHA 1IU7A 1N5HA 1W6YA 4L7KA 4HKVB 3I553 2ML5A 1GYBA 1TTOA 1VQ83 3LZAA 3MPHA 4CPKA 2HMMB 1DMNA 1M904 1GD4A 3NBRA 1YJN3 1HU9A 1I0XA 4ZM8A 2KF5A 3KIIA 4GSPA 4LGQA 3AHSA 3F9SA 3GAXA 2P0MA 1LOVA 1BNJA 1LQGC 1B2SA 1HKXA 1T2HA 3LTAA 3N9HA 2W56B 3WA2X 2BO9B 4L8PA 2OQEA 1Q814 3NUVA 4LZIA 2MC8A 3UL5A 4HM1B 3UNLA 3ZG5A 5IW9A 1LVNA 1VQ63 1BNGA 1B3SA 1WNHA 3ROBA 3CC23 1WMNA 5IG5A 3WODG 3LT9A 1M9GA 3IJEB 1BNSA 1LOYA 1N5PA 1YHQ3 2YFLB 1CH0A 2CH9A 3H51A 3S27A 1UCLA 3KCHA 4WFOA 5IG3A 5IENA 3E99A 3G713 2XEPA 1W5ZA 2D1WA 2W03A 3GRDA 6RNTA 4K90B 4J9AA 2P05A 5FW5A 4LSOA 1RRHA 1RJOA 1SIIA 5EEOA 1KC84 2PNCA 2XGLA 3WHOA 3D79A 1AR0A 1OPYA 2SARA 3GZBA 4XDWA 2OTL3 1Z1SA 1UGHI 3V98A 6GSPA 2H0IA 5AEWB 5JPPA 1JB5A 3WOFB 2RFRA 1BIRA 1R4YA 4N6LA 5DRVA 3DGYA 3LH4A 2BHMA 2KXGA 1RRLA 3WDGB 3DGNA 3F8XA 1RNBA 1BUQA 3UB1A 3N54B 2H0HA 1EQKA 3HZPA 1SPUA 5D81A 1YI23 4KFFA 4WYKA 3T0UA
chains in the Genus database with same CATH topology
1B27A 1GSPA 1RLSA 1B20A 1UCKA 1X1XA 1FYSA 1RGKA 4J5GA 1IYYA 1RGFA 7GSPA 1I0VA 1BRGA 2KAAA 1BNRA 1I70A 1BUJA 2BU4A 5RNTA 2AADA 1BNIA 3URPA 7RNTA 1DE3A 1LOWA 5BU4A 2RNTA 1LNIA 1BVIA 1RHLA 1TRQA 1BSDA 2KF4A 2F56A 1RNTA 1RGLA 2F4YA 3SYUA 1UCIA 1BU4A 3BU4A 3DH2A 2ZA4A 1TRPA 1BNEA 1RN4A 1BNFA 4RNTA 4GHOA 9RNTA 1RDSA 2GSPA 2KF3A 1GOUA 3A5EA 3AHWA 1BRNL 1HYFA 1B2ZA 1AQZA 1X1YA 1PYLA 1FW7A 1SARA 2F5WA 1UCJA 1BAOA 1FUTA 1BRIA 1RGHA 1MGWA 2HOHA 2BIRA 2RBIA 1I8VA 1GMPA 1I2FA 1RGAA 3HOHA 1JBRA 1A2PA 1TTOA 1BOXA 1GOYA 1GMRA 5GSPA 1MGRA 3RNTA 4HAAA 1I0XA 1FZUA 2KF5A 1GOVA 1PY3A 4GSPA 1B2UA 1BRKA 3AHSA 1YGWA 1LOVA 1BNJA 1B2SA 1T2HA 4BU4A 1YVSA 1BRHA 1RTUA 3Q3FA 1RMSA 1RN1A 1GMQA 1B21A 1BRSA 1YNVX 1X1WA 1BNGA 1B3SA 1I3IA 3BIRA 1C54A 1RCLA 3AGOA 1BNSA 4BIRA 1LOYA 1FUSA 1BSCA 1CH0A 1T2IA 5HOHA 1UCLA 3KCHA 5BIRA 1AY7A 1DETA 1RCKA 2KF6A 4HOHA 1HZ1A 1RGEA 6RNTA 1X1UA 1BSAA 1Q9EA 1I2EA 1I3FA 1B2MA 4J5KA 3WR2A 1BANA 1JBSA 3GSPA 3WHOA 1B2XA 1BRJA 2SARA 1RGGA 1ZGXA 6GSPA 2AAEA 1G02A 2C4BA 1RGCA 1BIRA 1R4YA 3AGNA 1BSEA 3DGYA 1BSBA 1BGSA 2F5MA 1RNBA 1LRAA 3D4AA 3D5GA 1RSNA 3D5IA 8RNTA 1I2GA 1JBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B27 A;  1GSP A;  1RLS A;  1B20 A;  1UCK A;  1X1X A;  1FYS A;  1RGK A;  4J5G A;  1IYY A;  1RGF A;  7GSP A;  1I0V A;  1BRG A;  2KAA A;  1BNR A;  1I70 A;  1BUJ A;  2BU4 A;  5RNT A;  2AAD A;  1BNI A;  3URP A;  7RNT A;  1DE3 A;  1LOW A;  5BU4 A;  2RNT A;  1LNI A;  1BVI A;  1RHL A;  1TRQ A;  1BSD A;  2KF4 A;  2F56 A;  1RNT A;  1RGL A;  2F4Y A;  3SYU A;  1UCI A;  1BU4 A;  3BU4 A;  3DH2 A;  2ZA4 A;  1TRP A;  1BNE A;  1RN4 A;  1BNF A;  4RNT A;  4GHO A;  9RNT A;  1RDS A;  2GSP A;  2KF3 A;  1GOU A;  3A5E A;  3AHW A;  1BRN L;  1HYF A;  1B2Z A;  1AQZ A;  1X1Y A;  1PYL A;  1FW7 A;  1SAR A;  2F5W A;  1UCJ A;  1BAO A;  1FUT A;  1BRI A;  1RGH A;  1MGW A;  2HOH A;  2BIR A;  2RBI A;  1I8V A;  1GMP A;  1I2F A;  1RGA A;  3HOH A;  1JBR A;  1A2P A;  1TTO A;  1BOX A;  1GOY A;  1GMR A;  5GSP A;  1MGR A;  3RNT A;  4HAA A;  1I0X A;  1FZU A;  2KF5 A;  1GOV A;  1PY3 A;  4GSP A;  1B2U A;  1BRK A;  3AHS A;  1YGW A;  1LOV A;  1BNJ A;  1B2S A;  1T2H A;  4BU4 A;  1YVS A;  1BRH A;  1RTU A;  3Q3F A;  1RMS A;  1RN1 A;  1GMQ A;  1B21 A;  1BRS A;  1YNV X;  1X1W A;  1BNG A;  1B3S A;  1I3I A;  3BIR A;  1C54 A;  1RCL A;  3AGO A;  1BNS A;  4BIR A;  1LOY A;  1FUS A;  1BSC A;  1CH0 A;  1T2I A;  5HOH A;  1UCL A;  3KCH A;  5BIR A;  1AY7 A;  1DET A;  1RCK A;  2KF6 A;  4HOH A;  1HZ1 A;  1RGE A;  6RNT A;  1X1U A;  1BSA A;  1Q9E A;  1I2E A;  1I3F A;  1B2M A;  4J5K A;  3WR2 A;  1BAN A;  1JBS A;  3GSP A;  3WHO A;  1B2X A;  1BRJ A;  2SAR A;  1RGG A;  1ZGX A;  6GSP A;  2AAE A;  1G02 A;  2C4B A;  1RGC A;  1BIR A;  1R4Y A;  3AGN A;  1BSE A;  3DGY A;  1BSB A;  1BGS A;  2F5M A;  1RNB A;  1LRA A;  3D4A A;  3D5G A;  1RSN A;  3D5I A;  8RNT A;  1I2G A;  1JBT A; 
#chains in the Genus database with same CATH topology
 1B27 A;  1MWU A;  3EN8 A;  3SOY A;  1JJ2 2;  1GY6 A;  2UX0 A;  4NPB A;  1U5O A;  3FZW A;  1K28 A;  1RGK A;  3NHX A;  1RGF A;  3T8U A;  2CFD A;  4AKZ A;  1BRG A;  3BNB A;  3FF2 A;  2Z77 A;  1BNR A;  1WMO A;  1DVC A;  3MWZ A;  1BUJ A;  4XBY A;  5RNT A;  2AAD A;  3UL6 A;  3S28 A;  4N3V A;  2JQ5 A;  8CHO A;  2FNQ A;  1ZX2 A;  3OWY A;  4JRF A;  2KCD A;  1SJW A;  1RHL A;  1O7W B;  2BT3 A;  3IMA B;  3NV0 A;  1VQ4 3;  4R9L A;  5M19 A;  3EHC A;  1RNT A;  1FA3 A;  1TIJ A;  4MMX B;  2XGN A;  5AIH A;  3CCM 3;  3SYU A;  1JKG A;  2Y74 A;  3BU4 A;  3DUK A;  3DH2 A;  3K0Z A;  2GEY A;  1QJG A;  1TRP A;  2IUK A;  3FF0 A;  1K8A 4;  4OK0 A;  4LMI A;  1HYF A;  1B2Z A;  5G1L A;  3TDG A;  1PYL A;  3MYT A;  1JN5 A;  1JNQ A;  3G16 A;  5DRE A;  2CC3 A;  3GZR A;  1ISK A;  1BAO A;  1G96 A;  1BRI A;  1LXE A;  1MGW A;  2HMJ B;  5AIG A;  3H3H A;  3DY5 A;  3GWR A;  3LML A;  3MG2 A;  1I8V A;  1GMP A;  3G6E 3;  2O3O A;  3SLU A;  2W6J H;  1CEW I;  2BNG A;  3EX9 A;  1EEJ A;  1GOY A;  3X3X A;  2XSO B;  5GSP A;  4HAA A;  1VQK 3;  1FZU A;  3RDE A;  1JB4 A;  1GOV A;  1B2U A;  1BRK A;  3KSP A;  4HM6 B;  2CG1 A;  1ULJ B;  3G0K A;  1YGW A;  1IVV A;  4QWT A;  3PCR A;  1RTU A;  1OHS A;  3NX0 A;  1RMS A;  1RN1 A;  3B7C A;  2I9W A;  2B24 B;  3CCE 3;  1JN5 B;  5BXQ A;  3SVA A;  1BRS A;  1YNV X;  1Q40 A;  4DKI A;  1NB5 I;  1Q86 4;  1A90 A;  5I97 A;  1M1X B;  3BIR A;  5JBS A;  4N6T A;  1S5A A;  3OX9 A;  3B4O A;  1D6Z A;  1LQM B;  2RGQ A;  4JF8 A;  5IEP A;  4U13 A;  2CWV A;  1T2I A;  1FGQ A;  3EE1 A;  1NWW A;  4HM3 B;  5IG4 A;  3CMA 3;  3FSD A;  3G4S 3;  2H0G A;  1DET A;  3RGA A;  2KF6 A;  2XR8 B;  2FGT A;  5CF1 A;  1CYU A;  1RGE A;  7STD A;  1X1U A;  2IUJ A;  2BMR B;  1Q9E A;  3G8Z A;  1I2E A;  4ORL A;  1ZO2 A;  3VGN A;  1B2M A;  3ZG0 A;  1SIH A;  3LYG A;  3NM7 A;  5IG0 A;  1KWI A;  3F40 A;  3GSP A;  1E97 A;  2ZL8 A;  4RZM A;  5G2G A;  5A0O B;  3MSO A;  3PYJ A;  1RGG A;  2JDI H;  3OV4 A;  3UJM A;  3MG1 A;  4EBG A;  2WOF A;  1RGC A;  2ML6 A;  3V92 A;  1OF5 A;  2M7O A;  5CF2 A;  3D4A A;  1Q7Y 4;  2E2V A;  1WTH A;  3DZL A;  1LOX A;  1NJI 4;  4HM5 B;  1I2G A;  1JBT A;  3Q2P A;  5CK6 A;  1GSP A;  1RLS A;  3FKA A;  1RN7 A;  3JUQ A;  4O3V A;  1UCK A;  2HML B;  3N8B A;  3D3L A;  1K41 A;  2CK3 H;  1TUH A;  1O7P B;  5TGN A;  2CFW A;  1IYY A;  2E2T A;  2XFS A;  7GSP A;  1W00 A;  1I0V A;  1KQS 2;  4HYZ A;  4LYL B;  1N9E A;  3DGM A;  1CQS A;  4R1K A;  1W6G A;  2Y73 A;  5CXO A;  4AKY A;  1U8C B;  1OHP A;  2BU4 A;  4EXR A;  4HM0 B;  3FCS B;  1QVF 2;  3NQY A;  4HM8 B;  1DE3 A;  5BU4 A;  2W2C A;  5ELU A;  2GU1 A;  3PZW A;  4PEJ A;  5AII A;  2Z7A A;  2F86 B;  3FG1 A;  1JZD A;  3QK9 A;  4EV5 A;  5IER A;  2XF3 A;  3Q1C A;  1TRQ A;  3KSE D;  5M1A A;  1AVL A;  1R4C A;  3L0R A;  4I4K A;  1W4N A;  4N6V 0;  3WOE B;  1VQN 3;  3EBY A;  4STD A;  1BNE A;  3B8L A;  3EB8 A;  4LEH A;  4RNT A;  4GHO A;  1V74 A;  4WWU C;  9RNT A;  3HK4 A;  1GOU A;  3U1W A;  4OUQ A;  1YVB I;  2F99 A;  2INX A;  2KRT A;  3CU3 A;  3MG3 A;  1S72 3;  5LC6 A;  1DVD A;  1TFK A;  2GBW B;  2CW9 A;  1LNH A;  1FW7 A;  2Z6B A;  2F5W A;  2FXT A;  3SED A;  1PU4 A;  1N9J A;  3SX1 A;  1NB3 I;  4X2O A;  1FUW A;  2BIR A;  1JBR A;  1VZZ A;  1Q42 A;  4KFE A;  3RGR A;  2C10 A;  4EW5 A;  3BND A;  1BOX A;  3FH1 A;  1GMR A;  4WP5 A;  3OW2 2;  4CCV A;  1PY3 A;  3F7X A;  1ZS7 A;  4XBT A;  1SQW A;  1OAC A;  2CFL A;  1IT7 A;  3NXJ A;  2R41 A;  4BU4 A;  4CDL A;  2GU3 A;  2XH9 A;  1BRH A;  1PFP A;  3CC7 3;  1DYU A;  1GMQ A;  1W6C A;  5JPU A;  4L8O A;  1IK3 A;  2LYX A;  1STF I;  3LOY A;  3S5C A;  4KZ1 A;  1TJD A;  3GZX B;  1C54 A;  5EQL A;  5AEU B;  1O7H B;  1OGZ A;  2IY2 A;  3AGO A;  3EF8 A;  4IPB A;  4HZ9 B;  1UDI I;  3FLJ A;  1V57 A;  1JKG B;  4BIR A;  1BSC A;  4KVH A;  3CCV 3;  1ASK A;  2WGQ A;  2K3D A;  5HOH A;  5BIR A;  2GEX A;  3DGO A;  4ILF A;  6STD A;  2YFI B;  1JRQ A;  3HI7 A;  2W56 A;  2QEX 3;  1UUG B;  4Q53 A;  3PXM A;  1UW1 A;  2Q07 A;  3WR2 A;  1ULI B;  4WHA A;  2RCD A;  4KFD A;  1JV2 B;  2MF7 A;  2Z76 A;  4OVM A;  3CCU 3;  4FCJ A;  4HM7 B;  1IT8 A;  5KP4 A;  1K9M 4;  3F14 A;  3OWU A;  3ECF A;  3K5T A;  2HMK B;  1FGO A;  2IA7 A;  3LXU X;  4R9K A;  3CCJ 3;  1GD3 A;  1OCV A;  4NRE A;  1G02 A;  1IVX A;  4AEQ A;  1IV9 A;  3DMC A;  5G1K A;  2CG0 A;  2D42 A;  1OUN A;  1E3V A;  1QAK A;  3NBJ A;  4FCZ A;  2CHC A;  4RBN A;  1BSE A;  1US1 A;  3CD6 3;  5AIF A;  3U97 A;  1BGS A;  4K1V A;  4KT3 B;  1LRA A;  1VQ5 3;  1NU3 A;  1DMM A;  3D5G A;  3D5I A;  1F8N A;  3HIG A;  4MEI A;  2IYJ A;  2LQV A;  2B1X B;  3JUP A;  1AVK A;  3CCQ 3;  1B20 A;  2K54 A;  1JZO A;  3I0Y A;  3X3Y A;  1X1X A;  1FGR A;  1IV7 A;  1FYS A;  1OHO A;  3ER7 A;  3FG3 A;  2CKF B;  3JUM A;  3CNM A;  1D6Y A;  3OWS A;  4J5G A;  3DGL A;  5IEO A;  2QGU A;  1YJ9 3;  2UUG C;  1TP6 A;  2PZV A;  4MMY B;  1W7C A;  5EVH A;  2W04 A;  3ALA A;  3O8Y A;  2KAA A;  1I70 A;  1VQ7 3;  4FMB A;  1QMA A;  4O8S A;  3S29 A;  3MHE A;  7RNT A;  1LOW A;  2W9Q A;  2P38 A;  2OQE C;  4H61 A;  1VQP 3;  1LNI A;  2UGI A;  1BVI A;  3X40 A;  3AMO B;  1TU5 A;  4HBR A;  5M18 A;  2XFT A;  1MWR A;  1RGL A;  1EKM A;  4GL6 A;  1NO3 A;  4K1U A;  2XRX B;  3QRD A;  2F4Y A;  1O7N B;  2HMN B;  1OGX A;  2GXF A;  2K0M A;  2V1L A;  1UCI A;  1BU4 A;  3EC9 A;  3JUN A;  3LTD A;  5ELJ A;  2ZA4 A;  1RN4 A;  2CX0 A;  2YFJ B;  2ZHX B;  1AV4 A;  4N6U A;  3CPW 2;  1RDS A;  2GSP A;  5KP3 A;  2KF3 A;  3JUO A;  3A5E A;  3AHW A;  3F7S A;  3X3Z A;  1BRN L;  3FG4 A;  1UUW B;  1W01 A;  1X1Y A;  1KD1 4;  4XB5 A;  1EG9 B;  4IIA A;  1SAR A;  3HX8 A;  1UI7 A;  1UCJ A;  4FCM A;  3VF1 A;  1JB2 A;  1NDO B;  1RGH A;  3V99 A;  1O7G B;  1C7H A;  1DMQ A;  3CNX A;  4N6O B;  3OXA A;  1I2F A;  3FGY A;  3M8C A;  2OTJ 3;  1A2P A;  4J8T A;  2O9U X;  4BTW A;  1MNL A;  3BLZ A;  2QIY A;  3ZFZ A;  2WGO A;  1MGR A;  3RNT A;  2BMQ B;  1A67 A;  3KN4 A;  2P0X A;  1EUI C;  1IVU A;  1CYV A;  1OF5 B;  3EJV A;  4IT7 A;  3CXC 2;  3BNC A;  3KE7 A;  4WYK B;  1EA2 A;  1YGE A;  3STD A;  2W9P A;  1QVG 2;  1YVS A;  1WMP A;  1IVW A;  3NBB A;  2HMO B;  1IQY A;  3Q3F A;  4FMC A;  2F98 A;  4FMD A;  2C11 A;  1MWT A;  3VSY A;  2J8X B;  1K73 4;  2A15 A;  1GY5 A;  4XDV A;  4BTX A;  3B4P A;  3K7C A;  1B21 A;  1ROV A;  3K63 A;  4N6M A;  1QAF A;  3MKI A;  1VQQ A;  1X1W A;  3NM2 A;  4MMZ B;  3J7Y d;  1I3I A;  2W0Q A;  3BB9 A;  4EC6 A;  3CCL 3;  1VQO 3;  1RCL A;  1IQX A;  2CFK A;  3EBT A;  1MOL A;  1ROA A;  3PCS A;  4N6N B;  4O2H A;  1T3B A;  1FUS A;  3A76 A;  1YIJ 3;  5KP1 A;  1VQ9 3;  3CC4 3;  1IDP A;  2OWP A;  3SOA A;  1AY7 A;  5HGR A;  2QA4 3;  1O7M B;  1RCK A;  3CPO A;  4HOH A;  4GB5 A;  3LTB A;  2WO0 A;  3NQZ A;  1HZ1 A;  1BSA A;  1STD A;  4EV2 A;  5AYS C;  1I3F A;  4FR9 A;  4BL2 A;  4J5K A;  2CX1 A;  2ZDJ A;  1BAN A;  1GS3 A;  2E2U A;  4I5Q A;  1FGM A;  5AI1 A;  2CFG A;  3AMO A;  1JBS A;  1G0T A;  2CWT A;  4EYC A;  5CLK A;  3X42 A;  1W02 A;  3D9R A;  2OOV A;  1B2X A;  1BRJ A;  1Q40 B;  2CWU A;  4HVN A;  4CJN A;  1ZGX A;  1TFO A;  3LTC A;  5FGO A;  3CCS 3;  3EQQ B;  2AAE A;  3SXX A;  4BTY A;  1YIT 3;  1N8Q A;  1M1K 4;  2C4B A;  4RNY A;  1UGI A;  4RNZ A;  1OH0 A;  3AGN A;  4NHF A;  3DXO A;  3I56 3;  1BSB A;  1E3R A;  1UUV B;  2L4V A;  2F5M A;  1Q82 4;  1N8R 4;  3KZT A;  5D82 A;  1VQL 3;  1RSN A;  1W2Z A;  4HM4 B;  2YX9 A;  5STD A;  1Y4K A;  8RNT A;  1Q7H A;  1MWS A;  1D6U A;  4H3U A;  3Q90 A;  3HII A;  4XBX A;  3K9M C;  2BMO B;  4R4K A;  2XSH B;  2SBL A;  1A2V A;  2R4I A;  2RSX A;  2L1S A;  2P09 A;  3LT8 A;  2CIU A;  1FGT A;  4MJD A;  2STD A;  4TX4 A;  4HZB B;  1W2B 2;  3PS8 A;  3T8N A;  4K61 A;  1BNI A;  2OCT A;  1IQ8 A;  3URP A;  2RNT A;  3IPT A;  1KSI A;  3S67 A;  5BVB A;  4R80 A;  4G1M B;  1VQM 3;  3CCR 3;  1BSD A;  3PGB A;  3JVC A;  1NNV A;  3NV0 B;  2KF4 A;  2F56 A;  1L5G B;  3X41 A;  1T5Y A;  1QAL A;  3KKG A;  2IMJ A;  3GZY B;  4XM4 A;  5LC7 A;  4HJL B;  1BNF A;  3CME 3;  4HM2 B;  3WA3 A;  5D83 A;  5AYR B;  2OOV C;  3BNE A;  1AQZ A;  4FMA A;  4O02 B;  4BL3 A;  1V58 A;  5IF6 A;  1J2B A;  3WMD A;  1RKY A;  1YJW 3;  1GY7 A;  1A2K A;  1FUT A;  4X2H A;  3KFQ C;  3DM8 A;  3F8H A;  1UI8 A;  1WQL B;  3EN1 B;  2HOH A;  2WOH A;  2RBI A;  2GBX B;  1RGA A;  3HOH A;  1IU7 A;  1N5H A;  1W6Y A;  4L7K A;  4HKV B;  3I55 3;  2ML5 A;  1GYB A;  1TTO A;  1VQ8 3;  3LZA A;  3MPH A;  4CPK A;  2HMM B;  1DMN A;  1M90 4;  1GD4 A;  3NBR A;  1YJN 3;  1HU9 A;  1I0X A;  4ZM8 A;  2KF5 A;  3KII A;  4GSP A;  4LGQ A;  3AHS A;  3F9S A;  3GAX A;  2P0M A;  1LOV A;  1BNJ A;  1LQG C;  1B2S A;  1HKX A;  1T2H A;  3LTA A;  3N9H A;  2W56 B;  3WA2 X;  2BO9 B;  4L8P A;  2OQE A;  1Q81 4;  3NUV A;  4LZI A;  2MC8 A;  3UL5 A;  4HM1 B;  3UNL A;  3ZG5 A;  5IW9 A;  1LVN A;  1VQ6 3;  1BNG A;  1B3S A;  1WNH A;  3ROB A;  3CC2 3;  1WMN A;  5IG5 A;  3WOD G;  3LT9 A;  1M9G A;  3IJE B;  1BNS A;  1LOY A;  1N5P A;  1YHQ 3;  2YFL B;  1CH0 A;  2CH9 A;  3H51 A;  3S27 A;  1UCL A;  3KCH A;  4WFO A;  5IG3 A;  5IEN A;  3E99 A;  3G71 3;  2XEP A;  1W5Z A;  2D1W A;  2W03 A;  3GRD A;  6RNT A;  4K90 B;  4J9A A;  2P05 A;  5FW5 A;  4LSO A;  1RRH A;  1RJO A;  1SII A;  5EEO A;  1KC8 4;  2PNC A;  2XGL A;  3WHO A;  3D79 A;  1AR0 A;  1OPY A;  2SAR A;  3GZB A;  4XDW A;  2OTL 3;  1Z1S A;  1UGH I;  3V98 A;  6GSP A;  2H0I A;  5AEW B;  5JPP A;  1JB5 A;  3WOF B;  2RFR A;  1BIR A;  1R4Y A;  4N6L A;  5DRV A;  3DGY A;  3LH4 A;  2BHM A;  2KXG A;  1RRL A;  3WDG B;  3DGN A;  3F8X A;  1RNB A;  1BUQ A;  3UB1 A;  3N54 B;  2H0H A;  1EQK A;  3HZP A;  1SPU A;  5D81 A;  1YI2 3;  4KFF A;  4WYK A;  3T0U A; 
#chains in the Genus database with same CATH homology
 1B27 A;  1GSP A;  1RLS A;  1B20 A;  1UCK A;  1X1X A;  1FYS A;  1RGK A;  4J5G A;  1IYY A;  1RGF A;  7GSP A;  1I0V A;  1BRG A;  2KAA A;  1BNR A;  1I70 A;  1BUJ A;  2BU4 A;  5RNT A;  2AAD A;  1BNI A;  3URP A;  7RNT A;  1DE3 A;  1LOW A;  5BU4 A;  2RNT A;  1LNI A;  1BVI A;  1RHL A;  1TRQ A;  1BSD A;  2KF4 A;  2F56 A;  1RNT A;  1RGL A;  2F4Y A;  3SYU A;  1UCI A;  1BU4 A;  3BU4 A;  3DH2 A;  2ZA4 A;  1TRP A;  1BNE A;  1RN4 A;  1BNF A;  4RNT A;  4GHO A;  9RNT A;  1RDS A;  2GSP A;  2KF3 A;  1GOU A;  3A5E A;  3AHW A;  1BRN L;  1HYF A;  1B2Z A;  1AQZ A;  1X1Y A;  1PYL A;  1FW7 A;  1SAR A;  2F5W A;  1UCJ A;  1BAO A;  1FUT A;  1BRI A;  1RGH A;  1MGW A;  2HOH A;  2BIR A;  2RBI A;  1I8V A;  1GMP A;  1I2F A;  1RGA A;  3HOH A;  1JBR A;  1A2P A;  1TTO A;  1BOX A;  1GOY A;  1GMR A;  5GSP A;  1MGR A;  3RNT A;  4HAA A;  1I0X A;  1FZU A;  2KF5 A;  1GOV A;  1PY3 A;  4GSP A;  1B2U A;  1BRK A;  3AHS A;  1YGW A;  1LOV A;  1BNJ A;  1B2S A;  1T2H A;  4BU4 A;  1YVS A;  1BRH A;  1RTU A;  3Q3F A;  1RMS A;  1RN1 A;  1GMQ A;  1B21 A;  1BRS A;  1YNV X;  1X1W A;  1BNG A;  1B3S A;  1I3I A;  3BIR A;  1C54 A;  1RCL A;  3AGO A;  1BNS A;  4BIR A;  1LOY A;  1FUS A;  1BSC A;  1CH0 A;  1T2I A;  5HOH A;  1UCL A;  3KCH A;  5BIR A;  1AY7 A;  1DET A;  1RCK A;  2KF6 A;  4HOH A;  1HZ1 A;  1RGE A;  6RNT A;  1X1U A;  1BSA A;  1Q9E A;  1I2E A;  1I3F A;  1B2M A;  4J5K A;  3WR2 A;  1BAN A;  1JBS A;  3GSP A;  3WHO A;  1B2X A;  1BRJ A;  2SAR A;  1RGG A;  1ZGX A;  6GSP A;  2AAE A;  1G02 A;  2C4B A;  1RGC A;  1BIR A;  1R4Y A;  3AGN A;  1BSE A;  3DGY A;  1BSB A;  1BGS A;  2F5M A;  1RNB A;  1LRA A;  3D4A A;  3D5G A;  1RSN A;  3D5I A;  8RNT A;  1I2G A;  1JBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...