1BSBA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADVNYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 29
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bsbA00
9RNTA 2SARA 5GSPA 1G02A 1B21A 2RBIA 1CH0A 1X1WA 1RLSA 1A2PA 1RN4A 1FUTA 1LOVA 1Q9EA 5RNTA 1RGHA 2KAAA 6RNTA 1TTOA 1T2IA 2HOHA 2RNTA 1B2MA 1BNIA 1SARA 3KCHA 1BU4A 1BNSA 1BNJA 1I3FA 1RGAA 5BIRA 1C54A 1BOXA 4GSPA 1RGKA 1LRAA 8RNTA 1BRSA 1GMPA 1JBRA 1I70A 1AQZA 6GSPA 3URPA 2BIRA 1DE3A 1I8VA 1PY3A 2GSPA 1RGCA 3WR2A 1RHLA 1JBTA 1R4YA 1GMQA 4HAAA 1YVSA 3DGYA 1RGGA 1BSCA 1RCLA 1X1XA 1UCIA 1RGEA 4HOHA 1BRJA 2F56A 5BU4A 3AGNA 1B2SA 1B3SA 2KF3A 1BRNL 1BSBA 1RNBA 1B2ZA 1AY7A 1BSEA 1I0VA 1YGWA 2KF6A 3BU4A 1MGRA 5HOHA 1BGSA 2BU4A 1TRQA 1B2XA 1LOWA 4BU4A 7RNTA 1BUJA 1I2EA 2ZA4A 1BANA 1B27A 1RCKA 1TRPA 1RMSA 2C4BA 3D5GA 3Q3FA 1RGLA 2KF5A 1FW7A 3BIRA 1FZUA 1BRHA 1LOYA 1ZGXA 3AHWA 1MGWA 1BNEA 1UCJA 1GOYA 3AGOA 3D5IA 3HOHA 2KF4A 4RNTA 2AAEA 4J5KA 2F5WA 1GOUA 1T2HA 1HYFA 4GHOA 1BSAA 1JBSA 3DH2A 2AADA 1BIRA 1BNFA 1BRIA 1I3IA 1BNGA 1BRGA 1RTUA 1HZ1A 1FYSA 1BVIA 2F5MA 1FUSA 1BAOA 1RSNA 1UCKA 2F4YA 4BIRA 1I2FA 7GSPA 3RNTA 1RN1A 3GSPA 1RGFA 1B20A 1GOVA 3SYUA 3A5EA 1IYYA 1X1UA 1RNTA 1I2GA 1RDSA 3WHOA 1GMRA 1BSDA 1PYLA 4J5GA 1UCLA 1B2UA 1GSPA 1LNIA 3AHSA 3D4AA 1DETA 1BNRA 1I0XA 1YNVX 1X1YA 1BRKA
chains in the Genus database with same CATH superfamily
1K28A 1DMNA 1O7MB 1OGXA 2QIYA 1G02A 3EB8A 3L0RA 1N5PA 2FXTA 2OTL3 1ZS7A 4OUQA 1EQKA 3K63A 1OCVA 1JNQA 3CD63 2GXFA 4U13A 5IEOA 1FUTA 5TGNA 1MWUA 1LOVA 5IERA 2E2VA 3DGOA 2KAAA 3G713 3UJMA 1WQLB 1TTOA 4MMZB 2GEYA 4QWTA 1K8A4 3RGRA 4EV2A 3CU3A 3UNLA 2O3OA 1SARA 1BUQA 3Q90A 1VQ73 2QA43 1WMOA 1N5HA 5BIRA 1C54A 4XBXA 1Q824 3OWSA 4XDWA 4FMCA 4X2OA 8RNTA 1U8CB 4FMDA 3URPA 1JKGA 3LH4A 4HM8B 1YGEA 4FCZA 5IG5A 2F98A 1E3VA 4LSOA 2H0HA 3PXMA 4ILFA 1K734 3I0YA 1W6YA 4J9AA 1VQN3 5ELUA 1RHLA 1DYUA 1VQ53 1YVSA 3DGYA 1RGGA 1G96A 2YFIB 4EC6A 1QVF2 4RNYA 2A15A 4L7KA 5LC6A 1FGRA 1OHPA 1TJDA 2Z76A 1B2SA 1BRNL 4TX4A 1LXEA 2RGQA 3OV4A 5IG3A 2CC3A 5EEOA 1YGWA 2UUGC 3GRDA 4BTYA 2Z6BA 1BGSA 1UUWB 2BU4A 1B2XA 1HU9A 1LOWA 2XH9A 3D79A 3KIIA 3NBJA 4NHFA 1D6YA 1I2EA 2PZVA 2YFLB 5KP3A 1Z1SA 1BANA 1W00A 2C4BA 1TRPA 4HM5B 1A2VA 1RMSA 2MC8A 4CDLA 3FZWA 1VQK3 3T8NA 1IV9A 1OHOA 2CWUA 3HK4A 1RGLA 4HBRA 3DUKA 3MG1A 3LTAA 5ELJA 3ZG0A 2D1WA 1LOYA 3AHWA 3EQQB 1BNEA 3CC23 5IF6A 1GOYA 2HMJB 3AGOA 5M19A 3ZFZA 1UI7A 5AIFA 3GWRA 2KF4A 1RRLA 2OWPA 2W56A 1HKXA 3F8XA 1CQSA 1T2HA 4JF8A 1OHSA 3F14A 3MG3A 3S27A 1TFOA 3MSOA 8CHOA 1VQM3 2AADA 1BIRA 2ZDJA 3EX9A 3CNMA 1O7PB 1UUVB 3K9MC 2CFDA 4HM3B 1QAFA 2IMJA 4O8SA 4FMBA 5G1KA 2W2CA 1HZ1A 5STDA 1GY7A 3X40A 1FYSA 2H0GA 4AEQA 1BVIA 1JN5B 3K7CA 2OCTA 4STDA 3NM2A 3NX0A 5CF1A 1FUSA 1UCKA 1I2FA 2INXA 2HMMB 3FG1A 4H61A 2Y73A 2LQVA 2QGUA 1A90A 1DMMA 3CC43 3WOFB 3K0ZA 5M1AA 5CK6A 2XRXB 2CHCA 2KCDA 4KVHA 1W2B2 2PNCA 3A5EA 3NBRA 5DREA 4K61A 5FGOA 4N6TA 3F7XA 4JRFA 2SBLA 2GU1A 1SIHA 1RDSA 1TUHA 3STDA 1IT8A 1EA2A 2CX1A 1GD3A 1PYLA 2F86B 3F7SA 1UCLA 4XDVA 1GSPA 2BMRB 1KSIA 5D82A 1I0XA 3N9HA 1YNVX 3HIIA 4HM0B 4CPKA 1BRKA 3N54B 4WYKB 5AEWB 3WODG 1B21A 5A0OB 3CCU3 1DMQA 1T3BA 1RLSA 1IVVA 1FUWA 1A2PA 2P38A 1VQ83 1Q9EA 1RN7A 3WOEB 3TDGA 1IVXA 2CK3H 1W7CA 1TP6A 5CLKA 5IG4A 3KCHA 1W4NA 4RZMA 1K9M4 1NDOB 3M8CA 4OVMA 1I3FA 1RGAA 2GBXB 3DZLA 1AR0A 3S29A 3OW22 3DY5A 2XSHB 2XSOB 1R4CA 3ER7A 1BRSA 2IA7A 1I70A 3DGLA 1IU7A 1ULJB 5AYRB 5BVBA 1VQ63 1JKGB 1CYVA 1DE3A 1MWSA 5IEPA 1SIIA 2CWTA 3HIGA 4L8OA 3X3ZA 2GSPA 3CCQ3 2Q07A 1NWWA 2K0MA 1SPUA 2BT3A 3T0UA 4O3VA 3VF1A 3CCR3 1VQP3 4HAAA 3E99A 1MNLA 1BSCA 2BHMA 1RCLA 1X1XA 2RCDA 4XB5A 4HOHA 2IUKA 1US1A 3RGAA 1KWIA 1N8R4 4R9KA 4PEJA 1ULIB 1YIT3 3AGNA 4FR9A 1B3SA 1FGTA 2KF3A 3IJEB 3LZAA 4R80A 1B2ZA 2ML6A 1ZX2A 1Y4KA 1MGRA 3CCV3 4CJNA 5EQLA 2GEXA 4BU4A 3X42A 2J8XB 2BNGA 1RCKA 5D83A 1S723 1CYUA 4NREA 5DRVA 3D5GA 3Q3FA 3SEDA 2RSXA 5G1LA 1UI8A 5AYSC 2OOVA 1YIJ3 1FZUA 1BRHA 3SXXA 1FA3A 4K1VA 1IQYA 2WOFA 1MGWA 3DGNA 3VSYA 4BL3A 1MOLA 4EYCA 2WO0A 1W6GA 4RNZA 1D6UA 3V92A 2M7OA 3HOHA 1GD4A 3GZYB 2K54A 1M1K4 1Q40A 1UUGB 3CCL3 1GOUA 2P0XA 1J2BA 2GU3A 3CCE3 1N9EA 1BSAA 4GHOA 5BXQA 1JBSA 1O7GB 2QEX3 1BNFA 1BRIA 5HGRA 3UL5A 1EUIC 1GY6A 1V74A 5JPPA 4FCMA 3MHEA 1MWRA 1RTUA 1STFI 2CKFB 1NO3A 3SOAA 2F5MA 1JZDA 2IUJA 3G16A 3WA3A 4WHAA 3N8BA 3QK9A 1RRHA 3KE7A 4N6OB 1N9JA 7GSPA 1F8NA 1GYBA 4HM7B 4L8PA 3GZBA 1RN1A 3RNTA 1JB2A 4J8TA 2BMOB 1FGQA 1B20A 2LYXA 3HZPA 1YHQ3 1OPYA 1RNTA 3O8YA 3QRDA 2O9UX 3RDEA 3VGNA 3F8HA 1OUNA 3CME3 3LTDA 1VZZA 3Q1CA 1GMRA 2W6JH 1W6CA 4MJDA 3X3XA 4J5GA 3G6E3 2W03A 1CEWI 1E3RA 3V99A 3HI7A 1DETA 3EJVA 3JUNA 2OTJ3 3WDGB 2GBWB 1NNVA 1KQS2 2E2UA 1A67A 1TFKA 5GSPA 1WMNA 2R41A 3KSPA 2UX0A 2YFJB 3NUVA 1YJ93 4Q53A 1WTHA 4HJLB 1GY5A 4HVNA 1FGOA 3EBTA 1JV2B 1RN4A 3DXOA 3FF2A 3CCJ3 1RGHA 2HMNB 3GZXB 4XBYA 1DVDA 2H0IA 2XR8B 1JJ22 1OGZA 1MWTA 4WYKA 2HOHA 1B2MA 1BNIA 1O7NB 2CH9A 1ZO2A 1BU4A 1BNSA 2P09A 2P0MA 1IK3A 2WGOA 1BNJA 2XEPA 3NXJA 4KFFA 1BOXA 2STDA 3LXUX 4GSPA 1RGKA 2W0QA 4FCJA 3MYTA 1GMPA 3OWYA 4IT7A 2I9WA 1IV7A 3CPW2 2Y74A 1W2ZA 1LOXA 5M18A 4FMAA 3PZWA 2W9QA 4IPBA 2CFLA 3EHCA 4N6NB 3WR2A 2IYJA 2HMLB 4GB5A 1JBTA 2CFWA 1ROAA 1R4YA 4G1MB 2BO9B 1GMQA 2KXGA 2XF3A 1JB4A 1E97A 1EEJA 3FKAA 3H3HA 2MF7A 1BRJA 2F56A 2RFRA 5IG0A 3MPHA 4LEHA 5IW9A 1BSBA 3OXAA 4OK0A 3K5TA 5G2GA 3NQZA 3FF0A 3LTBA 1AY7A 1BSEA 3BU4A 4HM6B 5HOHA 3LT9A 1VQL3 4X2HA 5FW5A 1UDII 3KN4A 1TRQA 1ASKA 1M9GA 1QMAA 7RNTA 3IMAB 1IQ8A 1OF5B 2ZA4A 1TU5A 2OOVC 1B27A 3DMCA 4EW5A 1M1XB 3LT8A 4DKIA 4N6MA 1VQ43 4XM4A 3BIRA 3U97A 3FGYA 4LYLB 4HZ9B 3FH1A 4BTXA 4CCVA 1UGIA 1ZGXA 3PCRA 2L1SA 3A76A 3KKGA 3B8LA 1D6ZA 2K3DA 4BTWA 4LZIA 2W9PA 4RNTA 2AAEA 4J5KA 4EV5A 2F5WA 4N6UA 1Q40B 2IY2A 4KFDA 5CF2A 1NB3I 2CFKA 4XBTA 1YJW3 2ZHXB 3KFQC 3CCS3 2XGNA 1I3IA 1ISKA 3FSDA 1BNGA 1BRGA 3EN8A 3FG3A 3WA2X 5KP4A 4HM4B 3S28A 2F4YA 2FGTA 1STDA 1Q7HA 1V58A 3KZTA 1UGHI 1LVNA 1LNHA 5JBSA 4RBNA 2W04A 1AVLA 1FGMA 5IENA 2D42A 1OF5A 3BNBA 3NQYA 1VQO3 1JN5A 5AI1A 4WWUC 3SLUA 3JUPA 1IVWA 4LGQA 1JRQA 1QAKA 3JUQA 3NHXA 1JB5A 1X1UA 2Z77A 3J7Yd 1RJOA 3X3YA 3F9SA 2OQEA 1SQWA 2KRTA 1N8QA 1IQXA 1S5AA 3SOYA 3EBYA 1SJWA 1B2UA 3AHSA 2UGIA 4AKYA 3LTCA 1RNBA 4AKZA 3X41A 1NJI4 1AV4A 1T5YA 2Z7AA 2SARA 2CX0A 2BMQB 3BNEA 3JUOA 9RNTA 5I97A 2OQEC 2RBIA 2W56B 1CH0A 1DVCA 1UW1A 1X1WA 4R9LA 3GZRA 3HX8A 3JUMA 1IT7A 1PU4A 1A2KA 5RNTA 3D3LA 1W5ZA 3CC73 1U5OA 4ORLA 5EVHA 6RNTA 6STDA 1KC84 3PYJA 1T2IA 1NU3A 1GS3A 3H51A 3T8UA 1Q814 1C7HA 2RNTA 4KZ1A 4O2HA 4ZM8A 3G4S3 1OH0A 3SVAA 2CWVA 5D81A 4WP5A 3NV0A 1LRAA 1W02A 3JVCA 1L5GB 3UB1A 4EXRA 1JBRA 1IVUA 1LQMB 3LMLA 6GSPA 2XGLA 3AMOA 3FCSB 3CXC2 1QJGA 2BIRA 1I8VA 7STDA 5AEUB 1PY3A 1G0TA 2HMOB 3D9RA 3NBBA 1RGCA 3S67A 3I553 4GL6A 4K90B 2E2TA 2WOHA 1YVBI 1LQGC 2F99A 4K1UA 5JPUA 1WMPA 3CNXA 2JDIH 1UCIA 4NPBA 1RGEA 5AIHA 2CG1A 3S5CA 3KSED 5BU4A 3WMDA 4MMYB 5LC7A 3F40A 4I5QA 3EN1B 3U1WA 3EF8A 4BL2A 1K41A 2R4IA 1I0VA 4EBGA 2KF6A 3NM7A 3BLZA 3BNDA 4KFEA 1Q864 2XFTA 1AVKA 3ECFA 1Q7Y4 1BUJA 2P05A 1VQQA 3ALAA 3B7CA 3SX1A 2XFSA 5AIGA 3B4OA 3BNCA 1V57A 2YX9A 2KF5A 4O02B 1FW7A 4WFOA 2C10A 1Q42A 1O7HB 3NV0B 1UCJA 2ML5A 4HYZA 3DM8A 4HZBB 3D5IA 3FLJA 1JZOA 3MWZA 4HM1B 4N6V0 1W01A 2JQ5A 3ZG5A 3CCM3 1NB5I 3AMOB 3PCSA 2WGQA 3Q2PA 2CG0A 5CXOA 1HYFA 1RKYA 3PS8A 3V98A 1YI23 1PFPA 3B4PA 3DH2A 3CPOA 3BB9A 3LOYA 2HMKB 4R1KA 2B24B 5AIIA 1QVG2 3OWUA 1WNHA 2B1XB 3G0KA 2C11A 2L4VA 4MMXB 3G8ZA 3LYGA 1ROVA 1BAOA 1RSNA 1TIJA 2CW9A 3GAXA 3MG2A 4BIRA 3EE1A 3MKIA 3OX9A 1KD14 2CFGA 3I563 4IIAA 3EC9A 1M904 1O7WB 3GSPA 5KP1A 4R4KA 4LMIA 1RGFA 4N6LA 3PGBA 1GOVA 3SYUA 3DGMA 1IYYA 4MEIA 1YJN3 1I2GA 4HKVB 2ZL8A 4N3VA 3CMA3 3ROBA 3WHOA 1BSDA 1IDPA 4HM2B 3UL6A 1QALA 4KT3B 2CIUA 1LNIA 3D4AA 4H3UA 3IPTA 4I4KA 1EG9B 3FG4A 1BNRA 1EKMA 2V1LA 1VQ93 2FNQA 1X1YA 1OACA 1AQZA
chains in the Genus database with same CATH topology
9RNTA 2SARA 5GSPA 1G02A 1B21A 2RBIA 1CH0A 1X1WA 1RLSA 1A2PA 1RN4A 1FUTA 1LOVA 1Q9EA 5RNTA 1RGHA 2KAAA 6RNTA 1TTOA 1T2IA 2HOHA 2RNTA 1B2MA 1BNIA 1SARA 3KCHA 1BU4A 1BNSA 1BNJA 1I3FA 1RGAA 5BIRA 1C54A 1BOXA 4GSPA 1RGKA 1LRAA 8RNTA 1BRSA 1GMPA 1JBRA 1I70A 1AQZA 6GSPA 3URPA 2BIRA 1DE3A 1I8VA 1PY3A 2GSPA 1RGCA 3WR2A 1RHLA 1JBTA 1R4YA 1GMQA 4HAAA 1YVSA 3DGYA 1RGGA 1BSCA 1RCLA 1X1XA 1UCIA 1RGEA 4HOHA 1BRJA 2F56A 5BU4A 3AGNA 1B2SA 1B3SA 2KF3A 1BRNL 1BSBA 1RNBA 1B2ZA 1AY7A 1BSEA 1I0VA 1YGWA 2KF6A 3BU4A 1MGRA 5HOHA 1BGSA 2BU4A 1TRQA 1B2XA 1LOWA 4BU4A 7RNTA 1BUJA 1I2EA 2ZA4A 1BANA 1B27A 1RCKA 1TRPA 1RMSA 2C4BA 3D5GA 3Q3FA 1RGLA 2KF5A 1FW7A 3BIRA 1FZUA 1BRHA 1LOYA 1ZGXA 3AHWA 1MGWA 1BNEA 1UCJA 1GOYA 3AGOA 3D5IA 3HOHA 2KF4A 4RNTA 2AAEA 4J5KA 2F5WA 1GOUA 1T2HA 1HYFA 4GHOA 1BSAA 1JBSA 3DH2A 2AADA 1BIRA 1BNFA 1BRIA 1I3IA 1BNGA 1BRGA 1RTUA 1HZ1A 1FYSA 1BVIA 2F5MA 1FUSA 1BAOA 1RSNA 1UCKA 2F4YA 4BIRA 1I2FA 7GSPA 3RNTA 1RN1A 3GSPA 1RGFA 1B20A 1GOVA 3SYUA 3A5EA 1IYYA 1X1UA 1RNTA 1I2GA 1RDSA 3WHOA 1GMRA 1BSDA 1PYLA 4J5GA 1UCLA 1B2UA 1GSPA 1LNIA 3AHSA 3D4AA 1DETA 1BNRA 1I0XA 1YNVX 1X1YA 1BRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9RNT A;  2SAR A;  5GSP A;  1G02 A;  1B21 A;  2RBI A;  1CH0 A;  1X1W A;  1RLS A;  1A2P A;  1RN4 A;  1FUT A;  1LOV A;  1Q9E A;  5RNT A;  1RGH A;  2KAA A;  6RNT A;  1TTO A;  1T2I A;  2HOH A;  2RNT A;  1B2M A;  1BNI A;  1SAR A;  3KCH A;  1BU4 A;  1BNS A;  1BNJ A;  1I3F A;  1RGA A;  5BIR A;  1C54 A;  1BOX A;  4GSP A;  1RGK A;  1LRA A;  8RNT A;  1BRS A;  1GMP A;  1JBR A;  1I70 A;  1AQZ A;  6GSP A;  3URP A;  2BIR A;  1DE3 A;  1I8V A;  1PY3 A;  2GSP A;  1RGC A;  3WR2 A;  1RHL A;  1JBT A;  1R4Y A;  1GMQ A;  4HAA A;  1YVS A;  3DGY A;  1RGG A;  1BSC A;  1RCL A;  1X1X A;  1UCI A;  1RGE A;  4HOH A;  1BRJ A;  2F56 A;  5BU4 A;  3AGN A;  1B2S A;  1B3S A;  2KF3 A;  1BRN L;  1BSB A;  1RNB A;  1B2Z A;  1AY7 A;  1BSE A;  1I0V A;  1YGW A;  2KF6 A;  3BU4 A;  1MGR A;  5HOH A;  1BGS A;  2BU4 A;  1TRQ A;  1B2X A;  1LOW A;  4BU4 A;  7RNT A;  1BUJ A;  1I2E A;  2ZA4 A;  1BAN A;  1B27 A;  1RCK A;  1TRP A;  1RMS A;  2C4B A;  3D5G A;  3Q3F A;  1RGL A;  2KF5 A;  1FW7 A;  3BIR A;  1FZU A;  1BRH A;  1LOY A;  1ZGX A;  3AHW A;  1MGW A;  1BNE A;  1UCJ A;  1GOY A;  3AGO A;  3D5I A;  3HOH A;  2KF4 A;  4RNT A;  2AAE A;  4J5K A;  2F5W A;  1GOU A;  1T2H A;  1HYF A;  4GHO A;  1BSA A;  1JBS A;  3DH2 A;  2AAD A;  1BIR A;  1BNF A;  1BRI A;  1I3I A;  1BNG A;  1BRG A;  1RTU A;  1HZ1 A;  1FYS A;  1BVI A;  2F5M A;  1FUS A;  1BAO A;  1RSN A;  1UCK A;  2F4Y A;  4BIR A;  1I2F A;  7GSP A;  3RNT A;  1RN1 A;  3GSP A;  1RGF A;  1B20 A;  1GOV A;  3SYU A;  3A5E A;  1IYY A;  1X1U A;  1RNT A;  1I2G A;  1RDS A;  3WHO A;  1GMR A;  1BSD A;  1PYL A;  4J5G A;  1UCL A;  1B2U A;  1GSP A;  1LNI A;  3AHS A;  3D4A A;  1DET A;  1BNR A;  1I0X A;  1YNV X;  1X1Y A;  1BRK A; 
#chains in the Genus database with same CATH topology
 1K28 A;  1DMN A;  1O7M B;  1OGX A;  2QIY A;  1G02 A;  3EB8 A;  3L0R A;  1N5P A;  2FXT A;  2OTL 3;  1ZS7 A;  4OUQ A;  1EQK A;  3K63 A;  1OCV A;  1JNQ A;  3CD6 3;  2GXF A;  4U13 A;  5IEO A;  1FUT A;  5TGN A;  1MWU A;  1LOV A;  5IER A;  2E2V A;  3DGO A;  2KAA A;  3G71 3;  3UJM A;  1WQL B;  1TTO A;  4MMZ B;  2GEY A;  4QWT A;  1K8A 4;  3RGR A;  4EV2 A;  3CU3 A;  3UNL A;  2O3O A;  1SAR A;  1BUQ A;  3Q90 A;  1VQ7 3;  2QA4 3;  1WMO A;  1N5H A;  5BIR A;  1C54 A;  4XBX A;  1Q82 4;  3OWS A;  4XDW A;  4FMC A;  4X2O A;  8RNT A;  1U8C B;  4FMD A;  3URP A;  1JKG A;  3LH4 A;  4HM8 B;  1YGE A;  4FCZ A;  5IG5 A;  2F98 A;  1E3V A;  4LSO A;  2H0H A;  3PXM A;  4ILF A;  1K73 4;  3I0Y A;  1W6Y A;  4J9A A;  1VQN 3;  5ELU A;  1RHL A;  1DYU A;  1VQ5 3;  1YVS A;  3DGY A;  1RGG A;  1G96 A;  2YFI B;  4EC6 A;  1QVF 2;  4RNY A;  2A15 A;  4L7K A;  5LC6 A;  1FGR A;  1OHP A;  1TJD A;  2Z76 A;  1B2S A;  1BRN L;  4TX4 A;  1LXE A;  2RGQ A;  3OV4 A;  5IG3 A;  2CC3 A;  5EEO A;  1YGW A;  2UUG C;  3GRD A;  4BTY A;  2Z6B A;  1BGS A;  1UUW B;  2BU4 A;  1B2X A;  1HU9 A;  1LOW A;  2XH9 A;  3D79 A;  3KII A;  3NBJ A;  4NHF A;  1D6Y A;  1I2E A;  2PZV A;  2YFL B;  5KP3 A;  1Z1S A;  1BAN A;  1W00 A;  2C4B A;  1TRP A;  4HM5 B;  1A2V A;  1RMS A;  2MC8 A;  4CDL A;  3FZW A;  1VQK 3;  3T8N A;  1IV9 A;  1OHO A;  2CWU A;  3HK4 A;  1RGL A;  4HBR A;  3DUK A;  3MG1 A;  3LTA A;  5ELJ A;  3ZG0 A;  2D1W A;  1LOY A;  3AHW A;  3EQQ B;  1BNE A;  3CC2 3;  5IF6 A;  1GOY A;  2HMJ B;  3AGO A;  5M19 A;  3ZFZ A;  1UI7 A;  5AIF A;  3GWR A;  2KF4 A;  1RRL A;  2OWP A;  2W56 A;  1HKX A;  3F8X A;  1CQS A;  1T2H A;  4JF8 A;  1OHS A;  3F14 A;  3MG3 A;  3S27 A;  1TFO A;  3MSO A;  8CHO A;  1VQM 3;  2AAD A;  1BIR A;  2ZDJ A;  3EX9 A;  3CNM A;  1O7P B;  1UUV B;  3K9M C;  2CFD A;  4HM3 B;  1QAF A;  2IMJ A;  4O8S A;  4FMB A;  5G1K A;  2W2C A;  1HZ1 A;  5STD A;  1GY7 A;  3X40 A;  1FYS A;  2H0G A;  4AEQ A;  1BVI A;  1JN5 B;  3K7C A;  2OCT A;  4STD A;  3NM2 A;  3NX0 A;  5CF1 A;  1FUS A;  1UCK A;  1I2F A;  2INX A;  2HMM B;  3FG1 A;  4H61 A;  2Y73 A;  2LQV A;  2QGU A;  1A90 A;  1DMM A;  3CC4 3;  3WOF B;  3K0Z A;  5M1A A;  5CK6 A;  2XRX B;  2CHC A;  2KCD A;  4KVH A;  1W2B 2;  2PNC A;  3A5E A;  3NBR A;  5DRE A;  4K61 A;  5FGO A;  4N6T A;  3F7X A;  4JRF A;  2SBL A;  2GU1 A;  1SIH A;  1RDS A;  1TUH A;  3STD A;  1IT8 A;  1EA2 A;  2CX1 A;  1GD3 A;  1PYL A;  2F86 B;  3F7S A;  1UCL A;  4XDV A;  1GSP A;  2BMR B;  1KSI A;  5D82 A;  1I0X A;  3N9H A;  1YNV X;  3HII A;  4HM0 B;  4CPK A;  1BRK A;  3N54 B;  4WYK B;  5AEW B;  3WOD G;  1B21 A;  5A0O B;  3CCU 3;  1DMQ A;  1T3B A;  1RLS A;  1IVV A;  1FUW A;  1A2P A;  2P38 A;  1VQ8 3;  1Q9E A;  1RN7 A;  3WOE B;  3TDG A;  1IVX A;  2CK3 H;  1W7C A;  1TP6 A;  5CLK A;  5IG4 A;  3KCH A;  1W4N A;  4RZM A;  1K9M 4;  1NDO B;  3M8C A;  4OVM A;  1I3F A;  1RGA A;  2GBX B;  3DZL A;  1AR0 A;  3S29 A;  3OW2 2;  3DY5 A;  2XSH B;  2XSO B;  1R4C A;  3ER7 A;  1BRS A;  2IA7 A;  1I70 A;  3DGL A;  1IU7 A;  1ULJ B;  5AYR B;  5BVB A;  1VQ6 3;  1JKG B;  1CYV A;  1DE3 A;  1MWS A;  5IEP A;  1SII A;  2CWT A;  3HIG A;  4L8O A;  3X3Z A;  2GSP A;  3CCQ 3;  2Q07 A;  1NWW A;  2K0M A;  1SPU A;  2BT3 A;  3T0U A;  4O3V A;  3VF1 A;  3CCR 3;  1VQP 3;  4HAA A;  3E99 A;  1MNL A;  1BSC A;  2BHM A;  1RCL A;  1X1X A;  2RCD A;  4XB5 A;  4HOH A;  2IUK A;  1US1 A;  3RGA A;  1KWI A;  1N8R 4;  4R9K A;  4PEJ A;  1ULI B;  1YIT 3;  3AGN A;  4FR9 A;  1B3S A;  1FGT A;  2KF3 A;  3IJE B;  3LZA A;  4R80 A;  1B2Z A;  2ML6 A;  1ZX2 A;  1Y4K A;  1MGR A;  3CCV 3;  4CJN A;  5EQL A;  2GEX A;  4BU4 A;  3X42 A;  2J8X B;  2BNG A;  1RCK A;  5D83 A;  1S72 3;  1CYU A;  4NRE A;  5DRV A;  3D5G A;  3Q3F A;  3SED A;  2RSX A;  5G1L A;  1UI8 A;  5AYS C;  2OOV A;  1YIJ 3;  1FZU A;  1BRH A;  3SXX A;  1FA3 A;  4K1V A;  1IQY A;  2WOF A;  1MGW A;  3DGN A;  3VSY A;  4BL3 A;  1MOL A;  4EYC A;  2WO0 A;  1W6G A;  4RNZ A;  1D6U A;  3V92 A;  2M7O A;  3HOH A;  1GD4 A;  3GZY B;  2K54 A;  1M1K 4;  1Q40 A;  1UUG B;  3CCL 3;  1GOU A;  2P0X A;  1J2B A;  2GU3 A;  3CCE 3;  1N9E A;  1BSA A;  4GHO A;  5BXQ A;  1JBS A;  1O7G B;  2QEX 3;  1BNF A;  1BRI A;  5HGR A;  3UL5 A;  1EUI C;  1GY6 A;  1V74 A;  5JPP A;  4FCM A;  3MHE A;  1MWR A;  1RTU A;  1STF I;  2CKF B;  1NO3 A;  3SOA A;  2F5M A;  1JZD A;  2IUJ A;  3G16 A;  3WA3 A;  4WHA A;  3N8B A;  3QK9 A;  1RRH A;  3KE7 A;  4N6O B;  1N9J A;  7GSP A;  1F8N A;  1GYB A;  4HM7 B;  4L8P A;  3GZB A;  1RN1 A;  3RNT A;  1JB2 A;  4J8T A;  2BMO B;  1FGQ A;  1B20 A;  2LYX A;  3HZP A;  1YHQ 3;  1OPY A;  1RNT A;  3O8Y A;  3QRD A;  2O9U X;  3RDE A;  3VGN A;  3F8H A;  1OUN A;  3CME 3;  3LTD A;  1VZZ A;  3Q1C A;  1GMR A;  2W6J H;  1W6C A;  4MJD A;  3X3X A;  4J5G A;  3G6E 3;  2W03 A;  1CEW I;  1E3R A;  3V99 A;  3HI7 A;  1DET A;  3EJV A;  3JUN A;  2OTJ 3;  3WDG B;  2GBW B;  1NNV A;  1KQS 2;  2E2U A;  1A67 A;  1TFK A;  5GSP A;  1WMN A;  2R41 A;  3KSP A;  2UX0 A;  2YFJ B;  3NUV A;  1YJ9 3;  4Q53 A;  1WTH A;  4HJL B;  1GY5 A;  4HVN A;  1FGO A;  3EBT A;  1JV2 B;  1RN4 A;  3DXO A;  3FF2 A;  3CCJ 3;  1RGH A;  2HMN B;  3GZX B;  4XBY A;  1DVD A;  2H0I A;  2XR8 B;  1JJ2 2;  1OGZ A;  1MWT A;  4WYK A;  2HOH A;  1B2M A;  1BNI A;  1O7N B;  2CH9 A;  1ZO2 A;  1BU4 A;  1BNS A;  2P09 A;  2P0M A;  1IK3 A;  2WGO A;  1BNJ A;  2XEP A;  3NXJ A;  4KFF A;  1BOX A;  2STD A;  3LXU X;  4GSP A;  1RGK A;  2W0Q A;  4FCJ A;  3MYT A;  1GMP A;  3OWY A;  4IT7 A;  2I9W A;  1IV7 A;  3CPW 2;  2Y74 A;  1W2Z A;  1LOX A;  5M18 A;  4FMA A;  3PZW A;  2W9Q A;  4IPB A;  2CFL A;  3EHC A;  4N6N B;  3WR2 A;  2IYJ A;  2HML B;  4GB5 A;  1JBT A;  2CFW A;  1ROA A;  1R4Y A;  4G1M B;  2BO9 B;  1GMQ A;  2KXG A;  2XF3 A;  1JB4 A;  1E97 A;  1EEJ A;  3FKA A;  3H3H A;  2MF7 A;  1BRJ A;  2F56 A;  2RFR A;  5IG0 A;  3MPH A;  4LEH A;  5IW9 A;  1BSB A;  3OXA A;  4OK0 A;  3K5T A;  5G2G A;  3NQZ A;  3FF0 A;  3LTB A;  1AY7 A;  1BSE A;  3BU4 A;  4HM6 B;  5HOH A;  3LT9 A;  1VQL 3;  4X2H A;  5FW5 A;  1UDI I;  3KN4 A;  1TRQ A;  1ASK A;  1M9G A;  1QMA A;  7RNT A;  3IMA B;  1IQ8 A;  1OF5 B;  2ZA4 A;  1TU5 A;  2OOV C;  1B27 A;  3DMC A;  4EW5 A;  1M1X B;  3LT8 A;  4DKI A;  4N6M A;  1VQ4 3;  4XM4 A;  3BIR A;  3U97 A;  3FGY A;  4LYL B;  4HZ9 B;  3FH1 A;  4BTX A;  4CCV A;  1UGI A;  1ZGX A;  3PCR A;  2L1S A;  3A76 A;  3KKG A;  3B8L A;  1D6Z A;  2K3D A;  4BTW A;  4LZI A;  2W9P A;  4RNT A;  2AAE A;  4J5K A;  4EV5 A;  2F5W A;  4N6U A;  1Q40 B;  2IY2 A;  4KFD A;  5CF2 A;  1NB3 I;  2CFK A;  4XBT A;  1YJW 3;  2ZHX B;  3KFQ C;  3CCS 3;  2XGN A;  1I3I A;  1ISK A;  3FSD A;  1BNG A;  1BRG A;  3EN8 A;  3FG3 A;  3WA2 X;  5KP4 A;  4HM4 B;  3S28 A;  2F4Y A;  2FGT A;  1STD A;  1Q7H A;  1V58 A;  3KZT A;  1UGH I;  1LVN A;  1LNH A;  5JBS A;  4RBN A;  2W04 A;  1AVL A;  1FGM A;  5IEN A;  2D42 A;  1OF5 A;  3BNB A;  3NQY A;  1VQO 3;  1JN5 A;  5AI1 A;  4WWU C;  3SLU A;  3JUP A;  1IVW A;  4LGQ A;  1JRQ A;  1QAK A;  3JUQ A;  3NHX A;  1JB5 A;  1X1U A;  2Z77 A;  3J7Y d;  1RJO A;  3X3Y A;  3F9S A;  2OQE A;  1SQW A;  2KRT A;  1N8Q A;  1IQX A;  1S5A A;  3SOY A;  3EBY A;  1SJW A;  1B2U A;  3AHS A;  2UGI A;  4AKY A;  3LTC A;  1RNB A;  4AKZ A;  3X41 A;  1NJI 4;  1AV4 A;  1T5Y A;  2Z7A A;  2SAR A;  2CX0 A;  2BMQ B;  3BNE A;  3JUO A;  9RNT A;  5I97 A;  2OQE C;  2RBI A;  2W56 B;  1CH0 A;  1DVC A;  1UW1 A;  1X1W A;  4R9L A;  3GZR A;  3HX8 A;  3JUM A;  1IT7 A;  1PU4 A;  1A2K A;  5RNT A;  3D3L A;  1W5Z A;  3CC7 3;  1U5O A;  4ORL A;  5EVH A;  6RNT A;  6STD A;  1KC8 4;  3PYJ A;  1T2I A;  1NU3 A;  1GS3 A;  3H51 A;  3T8U A;  1Q81 4;  1C7H A;  2RNT A;  4KZ1 A;  4O2H A;  4ZM8 A;  3G4S 3;  1OH0 A;  3SVA A;  2CWV A;  5D81 A;  4WP5 A;  3NV0 A;  1LRA A;  1W02 A;  3JVC A;  1L5G B;  3UB1 A;  4EXR A;  1JBR A;  1IVU A;  1LQM B;  3LML A;  6GSP A;  2XGL A;  3AMO A;  3FCS B;  3CXC 2;  1QJG A;  2BIR A;  1I8V A;  7STD A;  5AEU B;  1PY3 A;  1G0T A;  2HMO B;  3D9R A;  3NBB A;  1RGC A;  3S67 A;  3I55 3;  4GL6 A;  4K90 B;  2E2T A;  2WOH A;  1YVB I;  1LQG C;  2F99 A;  4K1U A;  5JPU A;  1WMP A;  3CNX A;  2JDI H;  1UCI A;  4NPB A;  1RGE A;  5AIH A;  2CG1 A;  3S5C A;  3KSE D;  5BU4 A;  3WMD A;  4MMY B;  5LC7 A;  3F40 A;  4I5Q A;  3EN1 B;  3U1W A;  3EF8 A;  4BL2 A;  1K41 A;  2R4I A;  1I0V A;  4EBG A;  2KF6 A;  3NM7 A;  3BLZ A;  3BND A;  4KFE A;  1Q86 4;  2XFT A;  1AVK A;  3ECF A;  1Q7Y 4;  1BUJ A;  2P05 A;  1VQQ A;  3ALA A;  3B7C A;  3SX1 A;  2XFS A;  5AIG A;  3B4O A;  3BNC A;  1V57 A;  2YX9 A;  2KF5 A;  4O02 B;  1FW7 A;  4WFO A;  2C10 A;  1Q42 A;  1O7H B;  3NV0 B;  1UCJ A;  2ML5 A;  4HYZ A;  3DM8 A;  4HZB B;  3D5I A;  3FLJ A;  1JZO A;  3MWZ A;  4HM1 B;  4N6V 0;  1W01 A;  2JQ5 A;  3ZG5 A;  3CCM 3;  1NB5 I;  3AMO B;  3PCS A;  2WGQ A;  3Q2P A;  2CG0 A;  5CXO A;  1HYF A;  1RKY A;  3PS8 A;  3V98 A;  1YI2 3;  1PFP A;  3B4P A;  3DH2 A;  3CPO A;  3BB9 A;  3LOY A;  2HMK B;  4R1K A;  2B24 B;  5AII A;  1QVG 2;  3OWU A;  1WNH A;  2B1X B;  3G0K A;  2C11 A;  2L4V A;  4MMX B;  3G8Z A;  3LYG A;  1ROV A;  1BAO A;  1RSN A;  1TIJ A;  2CW9 A;  3GAX A;  3MG2 A;  4BIR A;  3EE1 A;  3MKI A;  3OX9 A;  1KD1 4;  2CFG A;  3I56 3;  4IIA A;  3EC9 A;  1M90 4;  1O7W B;  3GSP A;  5KP1 A;  4R4K A;  4LMI A;  1RGF A;  4N6L A;  3PGB A;  1GOV A;  3SYU A;  3DGM A;  1IYY A;  4MEI A;  1YJN 3;  1I2G A;  4HKV B;  2ZL8 A;  4N3V A;  3CMA 3;  3ROB A;  3WHO A;  1BSD A;  1IDP A;  4HM2 B;  3UL6 A;  1QAL A;  4KT3 B;  2CIU A;  1LNI A;  3D4A A;  4H3U A;  3IPT A;  4I4K A;  1EG9 B;  3FG4 A;  1BNR A;  1EKM A;  2V1L A;  1VQ9 3;  2FNQ A;  1X1Y A;  1OAC A;  1AQZ A; 
#chains in the Genus database with same CATH homology
 9RNT A;  2SAR A;  5GSP A;  1G02 A;  1B21 A;  2RBI A;  1CH0 A;  1X1W A;  1RLS A;  1A2P A;  1RN4 A;  1FUT A;  1LOV A;  1Q9E A;  5RNT A;  1RGH A;  2KAA A;  6RNT A;  1TTO A;  1T2I A;  2HOH A;  2RNT A;  1B2M A;  1BNI A;  1SAR A;  3KCH A;  1BU4 A;  1BNS A;  1BNJ A;  1I3F A;  1RGA A;  5BIR A;  1C54 A;  1BOX A;  4GSP A;  1RGK A;  1LRA A;  8RNT A;  1BRS A;  1GMP A;  1JBR A;  1I70 A;  1AQZ A;  6GSP A;  3URP A;  2BIR A;  1DE3 A;  1I8V A;  1PY3 A;  2GSP A;  1RGC A;  3WR2 A;  1RHL A;  1JBT A;  1R4Y A;  1GMQ A;  4HAA A;  1YVS A;  3DGY A;  1RGG A;  1BSC A;  1RCL A;  1X1X A;  1UCI A;  1RGE A;  4HOH A;  1BRJ A;  2F56 A;  5BU4 A;  3AGN A;  1B2S A;  1B3S A;  2KF3 A;  1BRN L;  1BSB A;  1RNB A;  1B2Z A;  1AY7 A;  1BSE A;  1I0V A;  1YGW A;  2KF6 A;  3BU4 A;  1MGR A;  5HOH A;  1BGS A;  2BU4 A;  1TRQ A;  1B2X A;  1LOW A;  4BU4 A;  7RNT A;  1BUJ A;  1I2E A;  2ZA4 A;  1BAN A;  1B27 A;  1RCK A;  1TRP A;  1RMS A;  2C4B A;  3D5G A;  3Q3F A;  1RGL A;  2KF5 A;  1FW7 A;  3BIR A;  1FZU A;  1BRH A;  1LOY A;  1ZGX A;  3AHW A;  1MGW A;  1BNE A;  1UCJ A;  1GOY A;  3AGO A;  3D5I A;  3HOH A;  2KF4 A;  4RNT A;  2AAE A;  4J5K A;  2F5W A;  1GOU A;  1T2H A;  1HYF A;  4GHO A;  1BSA A;  1JBS A;  3DH2 A;  2AAD A;  1BIR A;  1BNF A;  1BRI A;  1I3I A;  1BNG A;  1BRG A;  1RTU A;  1HZ1 A;  1FYS A;  1BVI A;  2F5M A;  1FUS A;  1BAO A;  1RSN A;  1UCK A;  2F4Y A;  4BIR A;  1I2F A;  7GSP A;  3RNT A;  1RN1 A;  3GSP A;  1RGF A;  1B20 A;  1GOV A;  3SYU A;  3A5E A;  1IYY A;  1X1U A;  1RNT A;  1I2G A;  1RDS A;  3WHO A;  1GMR A;  1BSD A;  1PYL A;  4J5G A;  1UCL A;  1B2U A;  1GSP A;  1LNI A;  3AHS A;  3D4A A;  1DET A;  1BNR A;  1I0X A;  1YNV X;  1X1Y A;  1BRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...