1BSBA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADVNYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 29
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bsbA00
1BVIA 1FZUA 1B27A 1FUTA 1G02A 1RCKA 1BOXA 3A5EA 2AAEA 1RSNA 1GMPA 1UCIA 1UCKA 1RGGA 1I0VA 3URPA 1LOYA 3GSPA 4RNTA 1LOWA 1BNFA 1JBRA 1BNGA 1CH0A 1LRAA 3AGNA 1I3IA 1C54A 5BU4A 5GSPA 1R4YA 1BRSA 1B2XA 1BRHA 1YVSA 1JBTA 1RN1A 1B2MA 1IYYA 1RN4A 1T2IA 1MGRA 3KCHA 1I2FA 1X1WA 1I2GA 2C4BA 3D4AA 2SARA 1RGFA 1RGHA 1TTOA 2KAAA 2KF3A 8RNTA 1B20A 2RNTA 2F56A 7GSPA 1T2HA 1BAOA 1RNTA 1BNIA 3RNTA 2HOHA 5RNTA 1BSAA 3DGYA 3SYUA 1AY7A 3BIRA 4GHOA 2KF6A 1PY3A 2F5WA 1RDSA 1JBSA 1GOUA 4BU4A 1HYFA 3AHWA 2AADA 1B2ZA 1GMRA 1B21A 6GSPA 5HOHA 2F5MA 1DETA 1FW7A 1B2UA 1I0XA 1BSCA 3BU4A 3WR2A 2F4YA 1AQZA 7RNTA 1A2PA 1B3SA 6RNTA 1BRIA 1RTUA 3WHOA 1BRGA 3HOHA 1UCJA 4BIRA 1RGKA 1MGWA 2BIRA 1RNBA 1RGAA 2BU4A 3Q3FA 1BU4A 4HAAA 1Q9EA 4J5GA 1RLSA 1BANA 2ZA4A 1FYSA 1I8VA 2RBIA 1RGLA 1BNEA 1YNVX 1PYLA 5BIRA 1LOVA 2KF5A 1TRPA 2KF4A 1RGCA 1RMSA 3AGOA 4GSPA 1BRKA 1BSEA 1BIRA 1BNRA 1DE3A 9RNTA 1BSDA 1X1UA 1X1YA 1B2SA 1GOVA 1I70A 1HZ1A 1GMQA 1BUJA 1TRQA 1I3FA 1BRNL 1RHLA 3AHSA 1BNJA 3D5IA 4HOHA 1LNIA 1RGEA 3D5GA 1GSPA 1GOYA 1UCLA 1SARA 1BRJA 1X1XA 1BNSA 1FUSA 4J5KA 1I2EA 1YGWA 1BGSA 1BSBA 3DH2A 1RCLA 2GSPA 1ZGXA
chains in the Genus database with same CATH superfamily
2P0MA 3KZTA 1FUTA 2D1WA 5AEUB 4BL3A 1BOXA 5AYSC 3KIIA 3ROBA 1RSNA 2KXGA 1QVG2 1UCIA 1EA2A 2RFRA 2ZL8A 3MG3A 1UCKA 1K9M4 1I0VA 1Q42A 2STDA 3JUMA 1V74A 4RNTA 1LOWA 1JBRA 3NBBA 2A15A 2OCTA 1QVF2 3JVCA 1W2ZA 2GU3A 3SOAA 3G4S3 1CYUA 5GSPA 1D6ZA 1R4YA 1OCVA 3EX9A 3FKAA 1RN4A 1Q864 5STDA 5LC6A 1I2FA 2QEX3 4XB5A 1X1WA 2C4BA 2HMJB 4EV2A 1RGFA 2RCDA 1TTOA 2K0MA 2KAAA 2BHMA 8RNTA 3GRDA 2BMOB 1N9JA 1WMOA 4HM5B 1M1K4 1GYBA 1GS3A 2F56A 3GZYB 1MOLA 1T2HA 3AMOA 1BAOA 1RNTA 3RNTA 5HGRA 2XF3A 3X40A 8CHOA 5IENA 1IV9A 4R80A 1TU5A 1IQXA 1BSAA 2FNQA 3JUNA 3SYUA 1AY7A 2KF6A 2QGUA 1QAKA 1DMQA 3B7CA 1JBSA 3UNLA 1WQLB 1AVKA 3MKIA 4X2OA 1YJW3 1NB5I 5FW5A 2CG1A 1EEJA 4IIAA 5KP4A 5JBSA 1K28A 3G16A 1GMRA 4L8OA 2BT3A 3ALAA 2F5MA 3LMLA 1VQ83 1I0XA 4AEQA 1KWIA 3H51A 6RNTA 1BRIA 4WYKB 1PU4A 1BRGA 3MWZA 1YI23 4BIRA 1RGKA 3WA2X 1RNBA 4OK0A 2KRTA 1AR0A 1O7MB 3DXOA 2BU4A 2XGLA 1LXEA 4ILFA 4MEIA 3FG4A 3VGNA 3CCQ3 4N3VA 1CYVA 3RDEA 4K90B 4DKIA 5AIFA 1OPYA 2HMKB 1OGXA 3L0RA 3PXMA 1S723 4KZ1A 1JKGA 1OUNA 3PCSA 1MWRA 1SJWA 3DGMA 2XSOB 3LZAA 1US1A 1TFOA 5CLKA 2RSXA 2W0QA 1PFPA 2F86B 1OF5B 3NM7A 4LEHA 2OQEA 5BIRA 1GD4A 1LVNA 1RGCA 2CWUA 2O3OA 3G8ZA 4KFEA 4LZIA 4RBNA 1BUQA 4MMZB 5CXOA 1EQKA 2UGIA 4N6UA 4XBXA 2E2UA 3DGOA 1Q40B 1M904 2B1XB 3DMCA 3KSED 4RNYA 1JN5B 1M1XB 1VQQA 5IF6A 1UUWB 1GMQA 1GY5A 1ROVA 3H3HA 4ZM8A 4O8SA 1BNJA 2HMMB 3BNEA 3FF0A 4I5QA 1VQN3 2F99A 5ELJA 4AKYA 3K5TA 3D5GA 4BL2A 2Y74A 1UCLA 3OXAA 3PS8A 4J8TA 2FXTA 1BRJA 1X1XA 4LSOA 2OWPA 3GWRA 1VQK3 3DUKA 1F8NA 1YGWA 3WOFB 5LC7A 1E3VA 1EG9B 4J9AA 1VQ63 3DH2A 1RCLA 2KF4A 2K54A 1TIJA 1BVIA 1FZUA 4L8PA 1B27A 1UGIA 3MSOA 3BNDA 1YIJ3 1G0TA 1G02A 1RCKA 2CX0A 3SOYA 5IEPA 5KP1A 1N5PA 1G96A 1VQ93 3X41A 3GZBA 4HKVB 2GBWB 2C10A 1IVWA 5G1KA 1WMPA 4WWUC 2H0IA 4PEJA 3X3XA 2XH9A 3URPA 3CC73 1WMNA 3EBTA 3FCSB 4I4KA 5AEWB 1MWSA 3GSPA 3JUOA 3NM2A 1M9GA 1CH0A 3CCJ3 3F7SA 1LRAA 1IQ8A 3A76A 3AGNA 3PGBA 4XDWA 1K8A4 2MF7A 1Q824 2KCDA 2GEYA 3NQYA 1E97A 2O9UX 1B2XA 1BRHA 4WHAA 4XM4A 1RN1A 3V98A 2W9QA 1MNLA 1ROAA 3OWSA 3BNCA 5A0OB 5BVBA 1T2IA 1YVBI 3U97A 1MGRA 3DM8A 3KCHA 3D4AA 1UUVB 1DMMA 2ML6A 2SARA 1SIIA 3OW22 1RGHA 4GB5A 2SBLA 3G6E3 1W6YA 4HZ9B 3EC9A 5AIGA 2RNTA 3CCS3 3CCU3 1OACA 3Q90A 1STFI 4R9KA 3JUQA 1BNIA 4MMYB 2HOHA 1IVUA 5AI1A 4HM0B 1VQ43 5AIIA 2IY2A 4GHOA 4JF8A 1WTHA 1PY3A 2F5WA 3Q2PA 3JUPA 3G0KA 5EVHA 1VQP3 2CFKA 1GOUA 3CNMA 3F8HA 4WYKA 2XFSA 3F14A 1KQS2 3I553 1B2ZA 1B21A 3TDGA 4FCJA 1O7GB 1JJ22 1OGZA 3SEDA 1B2UA 3WR2A 1O7PB 2CFGA 1NWWA 7RNTA 1FA3A 5FGOA 4K1UA 1STDA 5AYRB 2W56A 1UCJA 3CXC2 1RGAA 2W6JH 4XDVA 5I97A 3CC43 1NO3A 1GY7A 1Q9EA 4CPKA 1FGOA 1LQGC 1NNVA 3E99A 2W2CA 1J2BA 3LTCA 3SVAA 1I8VA 4FMCA 2ZDJA 2OQEC 4GL6A 1IT7A 3FGYA 4Q53A 5D81A 3CNXA 3NUVA 4KVHA 1W7CA 1N9EA 3RGRA 1Q7Y4 1LOVA 1LOXA 3CPOA 3Q1CA 4WFOA 3AGOA 4GSPA 1BRKA 1BSEA 5DRVA 5IW9A 2XGNA 1BSDA 3D9RA 1FGTA 1GD3A 3CC23 2Y73A 1OHSA 1X1YA 3K63A 1KC84 2OTJ3 3FG1A 2CW9A 1W4NA 2FGTA 3OX9A 1JB5A 1LQMB 3VSYA 2XFTA 1BRNL 3AHSA 4HJLB 1O7NB 3S28A 2CFLA 1RGEA 2CX1A 1GOYA 5CK6A 3NXJA 3OWUA 1ZX2A 3X3YA 7STDA 1W02A 2D42A 5BXQA 3KE7A 2PZVA 3N9HA 4HYZA 1DYUA 2GSPA 3ZG0A 1OHPA 1GY6A 2H0HA 3BNBA 3NV0A 2P38A 1L5GB 4KT3B 4IT7A 3T0UA 2R4IA 4TX4A 4FCMA 2JQ5A 2CHCA 3CCM3 4N6LA 4EW5A 4EBGA 2AAEA 2WOHA 1VQM3 3CCE3 2GBXB 1GMPA 4BTWA 2IYJA 3EB8A 5IG3A 1FGQA 4NREA 3IMAB 3N54B 2Z6BA 3B8LA 2BO9B 3EN8A 1LOYA 1VQ73 4MJDA 1UUGB 1YJN3 4KFFA 3X3ZA 3D79A 1CQSA 2CG0A 3AMOB 1IV7A 1C54A 5BU4A 3DY5A 2P05A 2OOVA 1IK3A 1ZO2A 1BRSA 2WGOA 1YVSA 2Z77A 4K61A 1CEWI 1JBTA 3O8YA 1HU9A 3UL5A 4U13A 3F7XA 2CKFB 4FMBA 1D6YA 1JZOA 4FR9A 4NPBA 3WA3A 2IMJA 3K0ZA 2OTL3 1FGRA 3IPTA 3NBJA 4CDLA 3CPW2 4HM6B 1RN7A 2KF3A 3MG1A 1B20A 1U5OA 1JRQA 2BMQB 5D83A 7GSPA 4N6TA 2LQVA 3V99A 4FMAA 1VQL3 5RNTA 1W6GA 1Q7HA 1RKYA 4G1MB 4LYLB 2F98A 2CH9A 1IT8A 2R41A 2UUGC 3HIGA 4ORLA 1S5AA 1ISKA 4WP5A 1A90A 3B4OA 3EN1B 1Y4KA 4EXRA 2I9WA 1HYFA 4HM1B 1JB4A 1AV4A 2AADA 1R4CA 1ULIB 3HK4A 1N5HA 6GSPA 1AVLA 5HOHA 6STDA 2P0XA 3GAXA 1FW7A 2CIUA 1JKGB 3BU4A 1JV2B 5CF2A 1OH0A 4QWTA 1YGEA 2YFJB 1W6CA 1YJ93 1QJGA 1B3SA 2YFIB 3WHOA 1RTUA 2E2TA 2RGQA 1IQYA 1MGWA 2INXA 3LTBA 4HM7B 1O7WB 5ELUA 3T8UA 1A2VA 2Q07A 3KN4A 4H3UA 2CWVA 3STDA 3LH4A 4N6OB 4STDA 3I0YA 1K41A 3V92A 2ZA4A 2M7OA 3ZG5A 2XEPA 4NHFA 2J8XB 1TFKA 4H61A 1RGLA 3MYTA 4X2HA 3G713 3GZRA 2CK3H 2GU1A 4LGQA 3EQQB 5G2GA 1D6UA 1PYLA 1T3BA 4HVNA 1N8R4 2WOFA 1UI8A 3HX8A 3MPHA 1TRPA 3PYJA 3EHCA 4HBRA 1SQWA 1RMSA 4R9LA 1UGHI 3FSDA 1W2B2 3EF8A 1X1UA 1NDOB 4JRFA 1V57A 1B2SA 1N8QA 3FG3A 1ULJB 2WO0A 1I70A 1HZ1A 3U1WA 2UX0A 5IG0A 3FLJA 4MMXB 1KD14 1NB3I 4HOHA 2QA43 1YIT3 1UW1A 3DGLA 5M18A 2IUKA 4HZBB 2W03A 2ZHXB 4IPBA 1OF5A 3T8NA 5CF1A 3CU3A 1GSPA 2CWTA 3KSPA 3BB9A 3LT9A 3KKGA 1TJDA 3B4PA 4O2HA 1SIHA 2JDIH 2W9PA 4XBYA 3EBYA 1HKXA 1I2EA 1Q40A 4HM2B 4J5KA 4AKZA 1W01A 1BSBA 3LTAA 1JN5A 2XR8B 1ZGXA 4O3VA 1T5YA 1SPUA 3SXXA 3DZLA 3LT8A 2CFWA 3LYGA 2HMOB 4O02B 4OVMA 3EE1A 4EV5A 2ML5A 4L7KA 3EJVA 3F40A 1K734 3A5EA 1LNHA 3MG2A 5EQLA 2IUJA 3DGNA 2Z76A 3X42A 3LXUX 1NU3A 2XRXB 3N8BA 1A2KA 3J7Yd 3PCRA 1RGGA 2OOVC 3KFQC 1RRHA 2XSHB 1BNFA 4R4KA 1BNGA 5JPUA 5AIHA 1I3IA 3S29A 3K7CA 1V58A 3HZPA 2P09A 2CFDA 3FH1A 2WGQA 3PZWA 1IYYA 3ER7A 3WMDA 1OHOA 3CD63 4BTXA 2GEXA 3CCV3 1I2GA 2LYXA 1UDII 2V1LA 3NX0A 1JNQA 3HIIA 1U8CB 4RNZA 3K9MC 3UB1A 1QALA 3WOEB 1QMAA 5IG5A 3OWYA 1RJOA 4OUQA 3F8XA 3CME3 1IDPA 1EUIC 4CJNA 3QRDA 5G1LA 5EEOA 4RZMA 4XBTA 1WNHA 2YFLB 3DGYA 3BIRA 2W56B 1JB2A 3NBRA 2C11A 3SLUA 3CCR3 2BNGA 3F9SA 2HMLB 3NHXA 1B2MA 1DVCA 1RDSA 5KP3A 1JZDA 4BU4A 4BTYA 2E2VA 3AHWA 3D3LA 2QIYA 3BLZA 1A67A 3WDGB 3LTDA 1DETA 1DVDA 1RRLA 1BSCA 2H0GA 2F4YA 4K1VA 4KFDA 1AQZA 4N6MA 2BMRB 3M8CA 3MHEA 4R1KA 3S27A 1A2PA 5JPPA 1QAFA 1Q814 3UL6A 1ZS7A 3SX1A 3VF1A 3QK9A 3HOHA 3I563 3FZWA 4HM3B 1EKMA 3FF2A 2BIRA 4FCZA 5M19A 2Z7AA 1ASKA 1E3RA 3Q3FA 1BU4A 2L4VA 4HAAA 4J5GA 4N6V0 1RLSA 5IG4A 1TUHA 1BANA 4EC6A 5M1AA 1FYSA 2K3DA 2L1SA 1W00A 3LOYA 3S5CA 2MC8A 1YHQ3 1IU7A 1NJI4 2RBIA 2HMNB 2IA7A 3IJEB 2CC3A 2YX9A 4FMDA 3WODG 1UI7A 4CCVA 3UJMA 1BNEA 1YNVX 3GZXB 3HI7A 1TP6A 2KF5A 1IVVA 1DE3A 1BIRA 3RGAA 5DREA 9RNTA 1BNRA 1MWUA 1Z1SA 5IERA 4HM8B 2GXFA 1IVXA 1GOVA 4HM4B 3S67A 4EYCA 3CCL3 3OV4A 3NV0B 4N6NB 5D82A 3CMA3 1BUJA 1TRQA 1I3FA 1VQO3 1RHLA 1VZZA 3D5IA 4LMIA 5TGNA 2W04A 1LNIA 3NQZA 1DMNA 1FUWA 1W5ZA 1MWTA 1SARA 1FGMA 1BNSA 1KSIA 2B24B 1FUSA 2PNCA 1BGSA 3ZFZA 3ECFA 1VQ53 5IEOA 1O7HB 1C7HA
chains in the Genus database with same CATH topology
1BVIA 1FZUA 1B27A 1FUTA 1G02A 1RCKA 1BOXA 3A5EA 2AAEA 1RSNA 1GMPA 1UCIA 1UCKA 1RGGA 1I0VA 3URPA 1LOYA 3GSPA 4RNTA 1LOWA 1BNFA 1JBRA 1BNGA 1CH0A 1LRAA 3AGNA 1I3IA 1C54A 5BU4A 5GSPA 1R4YA 1BRSA 1B2XA 1BRHA 1YVSA 1JBTA 1RN1A 1B2MA 1IYYA 1RN4A 1T2IA 1MGRA 3KCHA 1I2FA 1X1WA 1I2GA 2C4BA 3D4AA 2SARA 1RGFA 1RGHA 1TTOA 2KAAA 2KF3A 8RNTA 1B20A 2RNTA 2F56A 7GSPA 1T2HA 1BAOA 1RNTA 1BNIA 3RNTA 2HOHA 5RNTA 1BSAA 3DGYA 3SYUA 1AY7A 3BIRA 4GHOA 2KF6A 1PY3A 2F5WA 1RDSA 1JBSA 1GOUA 4BU4A 1HYFA 3AHWA 2AADA 1B2ZA 1GMRA 1B21A 6GSPA 5HOHA 2F5MA 1DETA 1FW7A 1B2UA 1I0XA 1BSCA 3BU4A 3WR2A 2F4YA 1AQZA 7RNTA 1A2PA 1B3SA 6RNTA 1BRIA 1RTUA 3WHOA 1BRGA 3HOHA 1UCJA 4BIRA 1RGKA 1MGWA 2BIRA 1RNBA 1RGAA 2BU4A 3Q3FA 1BU4A 4HAAA 1Q9EA 4J5GA 1RLSA 1BANA 2ZA4A 1FYSA 1I8VA 2RBIA 1RGLA 1BNEA 1YNVX 1PYLA 5BIRA 1LOVA 2KF5A 1TRPA 2KF4A 1RGCA 1RMSA 3AGOA 4GSPA 1BRKA 1BSEA 1BIRA 1BNRA 1DE3A 9RNTA 1BSDA 1X1UA 1X1YA 1B2SA 1GOVA 1I70A 1HZ1A 1GMQA 1BUJA 1TRQA 1I3FA 1BRNL 1RHLA 3AHSA 1BNJA 3D5IA 4HOHA 1LNIA 1RGEA 3D5GA 1GSPA 1GOYA 1UCLA 1SARA 1BRJA 1X1XA 1BNSA 1FUSA 4J5KA 1I2EA 1YGWA 1BGSA 1BSBA 3DH2A 1RCLA 2GSPA 1ZGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BVI A;  1FZU A;  1B27 A;  1FUT A;  1G02 A;  1RCK A;  1BOX A;  3A5E A;  2AAE A;  1RSN A;  1GMP A;  1UCI A;  1UCK A;  1RGG A;  1I0V A;  3URP A;  1LOY A;  3GSP A;  4RNT A;  1LOW A;  1BNF A;  1JBR A;  1BNG A;  1CH0 A;  1LRA A;  3AGN A;  1I3I A;  1C54 A;  5BU4 A;  5GSP A;  1R4Y A;  1BRS A;  1B2X A;  1BRH A;  1YVS A;  1JBT A;  1RN1 A;  1B2M A;  1IYY A;  1RN4 A;  1T2I A;  1MGR A;  3KCH A;  1I2F A;  1X1W A;  1I2G A;  2C4B A;  3D4A A;  2SAR A;  1RGF A;  1RGH A;  1TTO A;  2KAA A;  2KF3 A;  8RNT A;  1B20 A;  2RNT A;  2F56 A;  7GSP A;  1T2H A;  1BAO A;  1RNT A;  1BNI A;  3RNT A;  2HOH A;  5RNT A;  1BSA A;  3DGY A;  3SYU A;  1AY7 A;  3BIR A;  4GHO A;  2KF6 A;  1PY3 A;  2F5W A;  1RDS A;  1JBS A;  1GOU A;  4BU4 A;  1HYF A;  3AHW A;  2AAD A;  1B2Z A;  1GMR A;  1B21 A;  6GSP A;  5HOH A;  2F5M A;  1DET A;  1FW7 A;  1B2U A;  1I0X A;  1BSC A;  3BU4 A;  3WR2 A;  2F4Y A;  1AQZ A;  7RNT A;  1A2P A;  1B3S A;  6RNT A;  1BRI A;  1RTU A;  3WHO A;  1BRG A;  3HOH A;  1UCJ A;  4BIR A;  1RGK A;  1MGW A;  2BIR A;  1RNB A;  1RGA A;  2BU4 A;  3Q3F A;  1BU4 A;  4HAA A;  1Q9E A;  4J5G A;  1RLS A;  1BAN A;  2ZA4 A;  1FYS A;  1I8V A;  2RBI A;  1RGL A;  1BNE A;  1YNV X;  1PYL A;  5BIR A;  1LOV A;  2KF5 A;  1TRP A;  2KF4 A;  1RGC A;  1RMS A;  3AGO A;  4GSP A;  1BRK A;  1BSE A;  1BIR A;  1BNR A;  1DE3 A;  9RNT A;  1BSD A;  1X1U A;  1X1Y A;  1B2S A;  1GOV A;  1I70 A;  1HZ1 A;  1GMQ A;  1BUJ A;  1TRQ A;  1I3F A;  1BRN L;  1RHL A;  3AHS A;  1BNJ A;  3D5I A;  4HOH A;  1LNI A;  1RGE A;  3D5G A;  1GSP A;  1GOY A;  1UCL A;  1SAR A;  1BRJ A;  1X1X A;  1BNS A;  1FUS A;  4J5K A;  1I2E A;  1YGW A;  1BGS A;  1BSB A;  3DH2 A;  1RCL A;  2GSP A;  1ZGX A; 
#chains in the Genus database with same CATH topology
 2P0M A;  3KZT A;  1FUT A;  2D1W A;  5AEU B;  4BL3 A;  1BOX A;  5AYS C;  3KII A;  3ROB A;  1RSN A;  2KXG A;  1QVG 2;  1UCI A;  1EA2 A;  2RFR A;  2ZL8 A;  3MG3 A;  1UCK A;  1K9M 4;  1I0V A;  1Q42 A;  2STD A;  3JUM A;  1V74 A;  4RNT A;  1LOW A;  1JBR A;  3NBB A;  2A15 A;  2OCT A;  1QVF 2;  3JVC A;  1W2Z A;  2GU3 A;  3SOA A;  3G4S 3;  1CYU A;  5GSP A;  1D6Z A;  1R4Y A;  1OCV A;  3EX9 A;  3FKA A;  1RN4 A;  1Q86 4;  5STD A;  5LC6 A;  1I2F A;  2QEX 3;  4XB5 A;  1X1W A;  2C4B A;  2HMJ B;  4EV2 A;  1RGF A;  2RCD A;  1TTO A;  2K0M A;  2KAA A;  2BHM A;  8RNT A;  3GRD A;  2BMO B;  1N9J A;  1WMO A;  4HM5 B;  1M1K 4;  1GYB A;  1GS3 A;  2F56 A;  3GZY B;  1MOL A;  1T2H A;  3AMO A;  1BAO A;  1RNT A;  3RNT A;  5HGR A;  2XF3 A;  3X40 A;  8CHO A;  5IEN A;  1IV9 A;  4R80 A;  1TU5 A;  1IQX A;  1BSA A;  2FNQ A;  3JUN A;  3SYU A;  1AY7 A;  2KF6 A;  2QGU A;  1QAK A;  1DMQ A;  3B7C A;  1JBS A;  3UNL A;  1WQL B;  1AVK A;  3MKI A;  4X2O A;  1YJW 3;  1NB5 I;  5FW5 A;  2CG1 A;  1EEJ A;  4IIA A;  5KP4 A;  5JBS A;  1K28 A;  3G16 A;  1GMR A;  4L8O A;  2BT3 A;  3ALA A;  2F5M A;  3LML A;  1VQ8 3;  1I0X A;  4AEQ A;  1KWI A;  3H51 A;  6RNT A;  1BRI A;  4WYK B;  1PU4 A;  1BRG A;  3MWZ A;  1YI2 3;  4BIR A;  1RGK A;  3WA2 X;  1RNB A;  4OK0 A;  2KRT A;  1AR0 A;  1O7M B;  3DXO A;  2BU4 A;  2XGL A;  1LXE A;  4ILF A;  4MEI A;  3FG4 A;  3VGN A;  3CCQ 3;  4N3V A;  1CYV A;  3RDE A;  4K90 B;  4DKI A;  5AIF A;  1OPY A;  2HMK B;  1OGX A;  3L0R A;  3PXM A;  1S72 3;  4KZ1 A;  1JKG A;  1OUN A;  3PCS A;  1MWR A;  1SJW A;  3DGM A;  2XSO B;  3LZA A;  1US1 A;  1TFO A;  5CLK A;  2RSX A;  2W0Q A;  1PFP A;  2F86 B;  1OF5 B;  3NM7 A;  4LEH A;  2OQE A;  5BIR A;  1GD4 A;  1LVN A;  1RGC A;  2CWU A;  2O3O A;  3G8Z A;  4KFE A;  4LZI A;  4RBN A;  1BUQ A;  4MMZ B;  5CXO A;  1EQK A;  2UGI A;  4N6U A;  4XBX A;  2E2U A;  3DGO A;  1Q40 B;  1M90 4;  2B1X B;  3DMC A;  3KSE D;  4RNY A;  1JN5 B;  1M1X B;  1VQQ A;  5IF6 A;  1UUW B;  1GMQ A;  1GY5 A;  1ROV A;  3H3H A;  4ZM8 A;  4O8S A;  1BNJ A;  2HMM B;  3BNE A;  3FF0 A;  4I5Q A;  1VQN 3;  2F99 A;  5ELJ A;  4AKY A;  3K5T A;  3D5G A;  4BL2 A;  2Y74 A;  1UCL A;  3OXA A;  3PS8 A;  4J8T A;  2FXT A;  1BRJ A;  1X1X A;  4LSO A;  2OWP A;  3GWR A;  1VQK 3;  3DUK A;  1F8N A;  1YGW A;  3WOF B;  5LC7 A;  1E3V A;  1EG9 B;  4J9A A;  1VQ6 3;  3DH2 A;  1RCL A;  2KF4 A;  2K54 A;  1TIJ A;  1BVI A;  1FZU A;  4L8P A;  1B27 A;  1UGI A;  3MSO A;  3BND A;  1YIJ 3;  1G0T A;  1G02 A;  1RCK A;  2CX0 A;  3SOY A;  5IEP A;  5KP1 A;  1N5P A;  1G96 A;  1VQ9 3;  3X41 A;  3GZB A;  4HKV B;  2GBW B;  2C10 A;  1IVW A;  5G1K A;  1WMP A;  4WWU C;  2H0I A;  4PEJ A;  3X3X A;  2XH9 A;  3URP A;  3CC7 3;  1WMN A;  3EBT A;  3FCS B;  4I4K A;  5AEW B;  1MWS A;  3GSP A;  3JUO A;  3NM2 A;  1M9G A;  1CH0 A;  3CCJ 3;  3F7S A;  1LRA A;  1IQ8 A;  3A76 A;  3AGN A;  3PGB A;  4XDW A;  1K8A 4;  2MF7 A;  1Q82 4;  2KCD A;  2GEY A;  3NQY A;  1E97 A;  2O9U X;  1B2X A;  1BRH A;  4WHA A;  4XM4 A;  1RN1 A;  3V98 A;  2W9Q A;  1MNL A;  1ROA A;  3OWS A;  3BNC A;  5A0O B;  5BVB A;  1T2I A;  1YVB I;  3U97 A;  1MGR A;  3DM8 A;  3KCH A;  3D4A A;  1UUV B;  1DMM A;  2ML6 A;  2SAR A;  1SII A;  3OW2 2;  1RGH A;  4GB5 A;  2SBL A;  3G6E 3;  1W6Y A;  4HZ9 B;  3EC9 A;  5AIG A;  2RNT A;  3CCS 3;  3CCU 3;  1OAC A;  3Q90 A;  1STF I;  4R9K A;  3JUQ A;  1BNI A;  4MMY B;  2HOH A;  1IVU A;  5AI1 A;  4HM0 B;  1VQ4 3;  5AII A;  2IY2 A;  4GHO A;  4JF8 A;  1WTH A;  1PY3 A;  2F5W A;  3Q2P A;  3JUP A;  3G0K A;  5EVH A;  1VQP 3;  2CFK A;  1GOU A;  3CNM A;  3F8H A;  4WYK A;  2XFS A;  3F14 A;  1KQS 2;  3I55 3;  1B2Z A;  1B21 A;  3TDG A;  4FCJ A;  1O7G B;  1JJ2 2;  1OGZ A;  3SED A;  1B2U A;  3WR2 A;  1O7P B;  2CFG A;  1NWW A;  7RNT A;  1FA3 A;  5FGO A;  4K1U A;  1STD A;  5AYR B;  2W56 A;  1UCJ A;  3CXC 2;  1RGA A;  2W6J H;  4XDV A;  5I97 A;  3CC4 3;  1NO3 A;  1GY7 A;  1Q9E A;  4CPK A;  1FGO A;  1LQG C;  1NNV A;  3E99 A;  2W2C A;  1J2B A;  3LTC A;  3SVA A;  1I8V A;  4FMC A;  2ZDJ A;  2OQE C;  4GL6 A;  1IT7 A;  3FGY A;  4Q53 A;  5D81 A;  3CNX A;  3NUV A;  4KVH A;  1W7C A;  1N9E A;  3RGR A;  1Q7Y 4;  1LOV A;  1LOX A;  3CPO A;  3Q1C A;  4WFO A;  3AGO A;  4GSP A;  1BRK A;  1BSE A;  5DRV A;  5IW9 A;  2XGN A;  1BSD A;  3D9R A;  1FGT A;  1GD3 A;  3CC2 3;  2Y73 A;  1OHS A;  1X1Y A;  3K63 A;  1KC8 4;  2OTJ 3;  3FG1 A;  2CW9 A;  1W4N A;  2FGT A;  3OX9 A;  1JB5 A;  1LQM B;  3VSY A;  2XFT A;  1BRN L;  3AHS A;  4HJL B;  1O7N B;  3S28 A;  2CFL A;  1RGE A;  2CX1 A;  1GOY A;  5CK6 A;  3NXJ A;  3OWU A;  1ZX2 A;  3X3Y A;  7STD A;  1W02 A;  2D42 A;  5BXQ A;  3KE7 A;  2PZV A;  3N9H A;  4HYZ A;  1DYU A;  2GSP A;  3ZG0 A;  1OHP A;  1GY6 A;  2H0H A;  3BNB A;  3NV0 A;  2P38 A;  1L5G B;  4KT3 B;  4IT7 A;  3T0U A;  2R4I A;  4TX4 A;  4FCM A;  2JQ5 A;  2CHC A;  3CCM 3;  4N6L A;  4EW5 A;  4EBG A;  2AAE A;  2WOH A;  1VQM 3;  3CCE 3;  2GBX B;  1GMP A;  4BTW A;  2IYJ A;  3EB8 A;  5IG3 A;  1FGQ A;  4NRE A;  3IMA B;  3N54 B;  2Z6B A;  3B8L A;  2BO9 B;  3EN8 A;  1LOY A;  1VQ7 3;  4MJD A;  1UUG B;  1YJN 3;  4KFF A;  3X3Z A;  3D79 A;  1CQS A;  2CG0 A;  3AMO B;  1IV7 A;  1C54 A;  5BU4 A;  3DY5 A;  2P05 A;  2OOV A;  1IK3 A;  1ZO2 A;  1BRS A;  2WGO A;  1YVS A;  2Z77 A;  4K61 A;  1CEW I;  1JBT A;  3O8Y A;  1HU9 A;  3UL5 A;  4U13 A;  3F7X A;  2CKF B;  4FMB A;  1D6Y A;  1JZO A;  4FR9 A;  4NPB A;  3WA3 A;  2IMJ A;  3K0Z A;  2OTL 3;  1FGR A;  3IPT A;  3NBJ A;  4CDL A;  3CPW 2;  4HM6 B;  1RN7 A;  2KF3 A;  3MG1 A;  1B20 A;  1U5O A;  1JRQ A;  2BMQ B;  5D83 A;  7GSP A;  4N6T A;  2LQV A;  3V99 A;  4FMA A;  1VQL 3;  5RNT A;  1W6G A;  1Q7H A;  1RKY A;  4G1M B;  4LYL B;  2F98 A;  2CH9 A;  1IT8 A;  2R41 A;  2UUG C;  3HIG A;  4ORL A;  1S5A A;  1ISK A;  4WP5 A;  1A90 A;  3B4O A;  3EN1 B;  1Y4K A;  4EXR A;  2I9W A;  1HYF A;  4HM1 B;  1JB4 A;  1AV4 A;  2AAD A;  1R4C A;  1ULI B;  3HK4 A;  1N5H A;  6GSP A;  1AVL A;  5HOH A;  6STD A;  2P0X A;  3GAX A;  1FW7 A;  2CIU A;  1JKG B;  3BU4 A;  1JV2 B;  5CF2 A;  1OH0 A;  4QWT A;  1YGE A;  2YFJ B;  1W6C A;  1YJ9 3;  1QJG A;  1B3S A;  2YFI B;  3WHO A;  1RTU A;  2E2T A;  2RGQ A;  1IQY A;  1MGW A;  2INX A;  3LTB A;  4HM7 B;  1O7W B;  5ELU A;  3T8U A;  1A2V A;  2Q07 A;  3KN4 A;  4H3U A;  2CWV A;  3STD A;  3LH4 A;  4N6O B;  4STD A;  3I0Y A;  1K41 A;  3V92 A;  2ZA4 A;  2M7O A;  3ZG5 A;  2XEP A;  4NHF A;  2J8X B;  1TFK A;  4H61 A;  1RGL A;  3MYT A;  4X2H A;  3G71 3;  3GZR A;  2CK3 H;  2GU1 A;  4LGQ A;  3EQQ B;  5G2G A;  1D6U A;  1PYL A;  1T3B A;  4HVN A;  1N8R 4;  2WOF A;  1UI8 A;  3HX8 A;  3MPH A;  1TRP A;  3PYJ A;  3EHC A;  4HBR A;  1SQW A;  1RMS A;  4R9L A;  1UGH I;  3FSD A;  1W2B 2;  3EF8 A;  1X1U A;  1NDO B;  4JRF A;  1V57 A;  1B2S A;  1N8Q A;  3FG3 A;  1ULJ B;  2WO0 A;  1I70 A;  1HZ1 A;  3U1W A;  2UX0 A;  5IG0 A;  3FLJ A;  4MMX B;  1KD1 4;  1NB3 I;  4HOH A;  2QA4 3;  1YIT 3;  1UW1 A;  3DGL A;  5M18 A;  2IUK A;  4HZB B;  2W03 A;  2ZHX B;  4IPB A;  1OF5 A;  3T8N A;  5CF1 A;  3CU3 A;  1GSP A;  2CWT A;  3KSP A;  3BB9 A;  3LT9 A;  3KKG A;  1TJD A;  3B4P A;  4O2H A;  1SIH A;  2JDI H;  2W9P A;  4XBY A;  3EBY A;  1HKX A;  1I2E A;  1Q40 A;  4HM2 B;  4J5K A;  4AKZ A;  1W01 A;  1BSB A;  3LTA A;  1JN5 A;  2XR8 B;  1ZGX A;  4O3V A;  1T5Y A;  1SPU A;  3SXX A;  3DZL A;  3LT8 A;  2CFW A;  3LYG A;  2HMO B;  4O02 B;  4OVM A;  3EE1 A;  4EV5 A;  2ML5 A;  4L7K A;  3EJV A;  3F40 A;  1K73 4;  3A5E A;  1LNH A;  3MG2 A;  5EQL A;  2IUJ A;  3DGN A;  2Z76 A;  3X42 A;  3LXU X;  1NU3 A;  2XRX B;  3N8B A;  1A2K A;  3J7Y d;  3PCR A;  1RGG A;  2OOV C;  3KFQ C;  1RRH A;  2XSH B;  1BNF A;  4R4K A;  1BNG A;  5JPU A;  5AIH A;  1I3I A;  3S29 A;  3K7C A;  1V58 A;  3HZP A;  2P09 A;  2CFD A;  3FH1 A;  2WGQ A;  3PZW A;  1IYY A;  3ER7 A;  3WMD A;  1OHO A;  3CD6 3;  4BTX A;  2GEX A;  3CCV 3;  1I2G A;  2LYX A;  1UDI I;  2V1L A;  3NX0 A;  1JNQ A;  3HII A;  1U8C B;  4RNZ A;  3K9M C;  3UB1 A;  1QAL A;  3WOE B;  1QMA A;  5IG5 A;  3OWY A;  1RJO A;  4OUQ A;  3F8X A;  3CME 3;  1IDP A;  1EUI C;  4CJN A;  3QRD A;  5G1L A;  5EEO A;  4RZM A;  4XBT A;  1WNH A;  2YFL B;  3DGY A;  3BIR A;  2W56 B;  1JB2 A;  3NBR A;  2C11 A;  3SLU A;  3CCR 3;  2BNG A;  3F9S A;  2HML B;  3NHX A;  1B2M A;  1DVC A;  1RDS A;  5KP3 A;  1JZD A;  4BU4 A;  4BTY A;  2E2V A;  3AHW A;  3D3L A;  2QIY A;  3BLZ A;  1A67 A;  3WDG B;  3LTD A;  1DET A;  1DVD A;  1RRL A;  1BSC A;  2H0G A;  2F4Y A;  4K1V A;  4KFD A;  1AQZ A;  4N6M A;  2BMR B;  3M8C A;  3MHE A;  4R1K A;  3S27 A;  1A2P A;  5JPP A;  1QAF A;  1Q81 4;  3UL6 A;  1ZS7 A;  3SX1 A;  3VF1 A;  3QK9 A;  3HOH A;  3I56 3;  3FZW A;  4HM3 B;  1EKM A;  3FF2 A;  2BIR A;  4FCZ A;  5M19 A;  2Z7A A;  1ASK A;  1E3R A;  3Q3F A;  1BU4 A;  2L4V A;  4HAA A;  4J5G A;  4N6V 0;  1RLS A;  5IG4 A;  1TUH A;  1BAN A;  4EC6 A;  5M1A A;  1FYS A;  2K3D A;  2L1S A;  1W00 A;  3LOY A;  3S5C A;  2MC8 A;  1YHQ 3;  1IU7 A;  1NJI 4;  2RBI A;  2HMN B;  2IA7 A;  3IJE B;  2CC3 A;  2YX9 A;  4FMD A;  3WOD G;  1UI7 A;  4CCV A;  3UJM A;  1BNE A;  1YNV X;  3GZX B;  3HI7 A;  1TP6 A;  2KF5 A;  1IVV A;  1DE3 A;  1BIR A;  3RGA A;  5DRE A;  9RNT A;  1BNR A;  1MWU A;  1Z1S A;  5IER A;  4HM8 B;  2GXF A;  1IVX A;  1GOV A;  4HM4 B;  3S67 A;  4EYC A;  3CCL 3;  3OV4 A;  3NV0 B;  4N6N B;  5D82 A;  3CMA 3;  1BUJ A;  1TRQ A;  1I3F A;  1VQO 3;  1RHL A;  1VZZ A;  3D5I A;  4LMI A;  5TGN A;  2W04 A;  1LNI A;  3NQZ A;  1DMN A;  1FUW A;  1W5Z A;  1MWT A;  1SAR A;  1FGM A;  1BNS A;  1KSI A;  2B24 B;  1FUS A;  2PNC A;  1BGS A;  3ZFZ A;  3ECF A;  1VQ5 3;  5IEO A;  1O7H B;  1C7H A; 
#chains in the Genus database with same CATH homology
 1BVI A;  1FZU A;  1B27 A;  1FUT A;  1G02 A;  1RCK A;  1BOX A;  3A5E A;  2AAE A;  1RSN A;  1GMP A;  1UCI A;  1UCK A;  1RGG A;  1I0V A;  3URP A;  1LOY A;  3GSP A;  4RNT A;  1LOW A;  1BNF A;  1JBR A;  1BNG A;  1CH0 A;  1LRA A;  3AGN A;  1I3I A;  1C54 A;  5BU4 A;  5GSP A;  1R4Y A;  1BRS A;  1B2X A;  1BRH A;  1YVS A;  1JBT A;  1RN1 A;  1B2M A;  1IYY A;  1RN4 A;  1T2I A;  1MGR A;  3KCH A;  1I2F A;  1X1W A;  1I2G A;  2C4B A;  3D4A A;  2SAR A;  1RGF A;  1RGH A;  1TTO A;  2KAA A;  2KF3 A;  8RNT A;  1B20 A;  2RNT A;  2F56 A;  7GSP A;  1T2H A;  1BAO A;  1RNT A;  1BNI A;  3RNT A;  2HOH A;  5RNT A;  1BSA A;  3DGY A;  3SYU A;  1AY7 A;  3BIR A;  4GHO A;  2KF6 A;  1PY3 A;  2F5W A;  1RDS A;  1JBS A;  1GOU A;  4BU4 A;  1HYF A;  3AHW A;  2AAD A;  1B2Z A;  1GMR A;  1B21 A;  6GSP A;  5HOH A;  2F5M A;  1DET A;  1FW7 A;  1B2U A;  1I0X A;  1BSC A;  3BU4 A;  3WR2 A;  2F4Y A;  1AQZ A;  7RNT A;  1A2P A;  1B3S A;  6RNT A;  1BRI A;  1RTU A;  3WHO A;  1BRG A;  3HOH A;  1UCJ A;  4BIR A;  1RGK A;  1MGW A;  2BIR A;  1RNB A;  1RGA A;  2BU4 A;  3Q3F A;  1BU4 A;  4HAA A;  1Q9E A;  4J5G A;  1RLS A;  1BAN A;  2ZA4 A;  1FYS A;  1I8V A;  2RBI A;  1RGL A;  1BNE A;  1YNV X;  1PYL A;  5BIR A;  1LOV A;  2KF5 A;  1TRP A;  2KF4 A;  1RGC A;  1RMS A;  3AGO A;  4GSP A;  1BRK A;  1BSE A;  1BIR A;  1BNR A;  1DE3 A;  9RNT A;  1BSD A;  1X1U A;  1X1Y A;  1B2S A;  1GOV A;  1I70 A;  1HZ1 A;  1GMQ A;  1BUJ A;  1TRQ A;  1I3F A;  1BRN L;  1RHL A;  3AHS A;  1BNJ A;  3D5I A;  4HOH A;  1LNI A;  1RGE A;  3D5G A;  1GSP A;  1GOY A;  1UCL A;  1SAR A;  1BRJ A;  1X1X A;  1BNS A;  1FUS A;  4J5K A;  1I2E A;  1YGW A;  1BGS A;  1BSB A;  3DH2 A;  1RCL A;  2GSP A;  1ZGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...