1BSBA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADVNYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 29
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bsbA00
1BSDA 4BU4A 1LOYA 1I0VA 2KF4A 1GMRA 4GSPA 3RNTA 1I3FA 2KAAA 1B27A 1FUTA 1GOYA 7RNTA 1BRGA 1Q9EA 4J5GA 4BIRA 5HOHA 1BSCA 1B2MA 1FZUA 5BU4A 3BIRA 1X1UA 2SARA 1GOVA 1RGEA 3DH2A 1FYSA 1PY3A 1RSNA 8RNTA 2C4BA 1A2PA 1HZ1A 2KF6A 1RCKA 1X1XA 1YVSA 3Q3FA 4HAAA 1SARA 2KF3A 1RGLA 1RGKA 1MGWA 1RHLA 1UCLA 3A5EA 1BOXA 1BNIA 1I8VA 1LRAA 1BUJA 5BIRA 1T2IA 1RGHA 1RTUA 1X1YA 1BANA 1RNTA 1G02A 1JBSA 1B20A 1I2FA 1TTOA 1RMSA 3DGYA 1TRPA 1BGSA 3HOHA 1BRKA 1BSEA 1BNJA 6RNTA 4GHOA 1YGWA 1B2XA 1BNEA 3D4AA 1BRIA 1RDSA 1YNVX 4HOHA 1B2UA 1I0XA 1LNIA 1DETA 1BNGA 3AGOA 1DE3A 1JBRA 1UCJA 3AHSA 2BU4A 1IYYA 3AHWA 3D5GA 1BRSA 1RCLA 1RGCA 3AGNA 1AQZA 4J5KA 2F56A 3BU4A 3URPA 3WHOA 9RNTA 1BAOA 1GSPA 2ZA4A 6GSPA 1ZGXA 1BIRA 1RLSA 1MGRA 2BIRA 7GSPA 1I2EA 1B2SA 1I70A 3WR2A 1BSBA 1BNSA 1BNFA 1HYFA 1R4YA 2F5WA 1BRHA 1RGGA 1TRQA 1UCKA 2RBIA 1T2HA 2AADA 2KF5A 3SYUA 1BRNL 2HOHA 1CH0A 1BSAA 3KCHA 1RN1A 1BU4A 4RNTA 1X1WA 1I2GA 1RGFA 3D5IA 2F4YA 1B21A 2F5MA 1FW7A 1RGAA 1JBTA 1C54A 5GSPA 1GMQA 2GSPA 1RNBA 1UCIA 1GOUA 3GSPA 1BRJA 2RNTA 1B2ZA 1AY7A 1I3IA 1RN4A 1GMPA 2AAEA 1B3SA 1BVIA 1LOVA 5RNTA 1LOWA 1BNRA 1PYLA 1FUSA
chains in the Genus database with same CATH superfamily
1LOYA 1QJGA 3DM8A 1VQO3 4FMAA 2KF4A 4GSPA 2OWPA 1OCVA 1CYVA 2XGNA 3PYJA 1STDA 2XEPA 2O3OA 1GOYA 3ZG5A 1BRGA 4R4KA 3GRDA 1O7WB 4WHAA 1JRQA 3EJVA 1EA2A 3BIRA 1E3VA 1EUIC 4N6V0 4U13A 4BL3A 1NNVA 4LYLB 3FG3A 1ULJB 4CJNA 4LGQA 4CCVA 2C4BA 2KCDA 1RCKA 1W6CA 1JKGB 2F98A 3CPOA 4HAAA 5G1KA 3BNCA 1US1A 1TFKA 3F9SA 3DUKA 1BNIA 1SJWA 1SIIA 5BIRA 1T2IA 3JUNA 4IT7A 3EBTA 1X1YA 3RDEA 1TTOA 2W6JH 1KC84 1GD3A 2WGOA 3DGYA 2LYXA 2CHCA 3HOHA 5EEOA 3MG1A 2INXA 3BNBA 3A76A 4H3UA 1NB3I 2E2UA 1B2XA 2GXFA 4L7KA 2QIYA 3D4AA 3O8YA 2IUJA 2W9QA 1W4NA 1YNVX 2SBLA 3EBYA 3CCV3 3NQYA 3ZG0A 1M9GA 1I0XA 1JZDA 1NU3A 2GBXB 3F8HA 1BNGA 3GZYB 3IMAB 5IG5A 4HM0B 4ORLA 5G2GA 2OCTA 1IVWA 2XSHB 1UCJA 3RGRA 1VQ73 2BU4A 1LQGC 1K9M4 1N9EA 1W2ZA 1O7HB 3AHWA 3CCM3 3NM7A 1MWRA 9RNTA 4J5KA 2FXTA 3ECFA 3LTAA 4J9AA 4NPBA 2MC8A 2H0GA 1D6ZA 2Q07A 3EX9A 1ZGXA 1BIRA 4GL6A 3UL6A 3J7Yd 1YVBI 3EQQB 1Q40A 2K0MA 1MGRA 2BIRA 7GSPA 3KZTA 3OWYA 1I70A 1Z1SA 2WO0A 1G0TA 1BNSA 2HMJB 3HX8A 1OF5A 5IG3A 4L8PA 5BVBA 1MWSA 1IDPA 1DMQA 5DRVA 2E2VA 3LZAA 5CF1A 2FNQA 3NV0B 1T2HA 3UB1A 2AADA 1DMMA 3LOYA 4OUQA 1AVLA 1NDOB 3BNEA 1BSAA 3PCSA 1Q824 4K1UA 3KCHA 4K61A 4RNYA 4XDVA 3UNLA 2GEYA 3EB8A 3LT9A 3AMOA 3UJMA 2OTJ3 2Z6BA 2CX1A 1EG9B 3GZBA 2CFWA 2F4YA 3HI7A 1B21A 3CPW2 4O8SA 5KP3A 1N5HA 4EYCA 3ALAA 5HGRA 2V1LA 1W6GA 3WA2X 2ZDJA 3FSDA 3IPTA 3X40A 2MF7A 4DKIA 1JNQA 1Q814 1KD14 2GSPA 3MPHA 1CYUA 4KFEA 3ZFZA 1RNBA 1AVKA 3CME3 4XBXA 4X2HA 3X41A 4N6LA 1B2ZA 5CF2A 3NM2A 1Q42A 2I9WA 4K90B 2W0QA 1DMNA 4HM5B 3X3XA 5D83A 1V58A 1EQKA 2CFDA 3JUQA 2XFSA 4ILFA 3FCSB 4X2OA 3SVAA 2B1XB 1MWUA 1OH0A 3NBBA 1JV2B 5I97A 1BNRA 5IENA 2OQEC 2YFJB 2Z76A 1GMRA 1RRHA 3DZLA 3G0KA 3RNTA 1I3FA 1EEJA 3F8XA 2HMNB 3DGOA 2KAAA 1B27A 1E3RA 1FUTA 3Q90A 2HMLB 3HK4A 4J5GA 4MEIA 4WP5A 1C54A 2R4IA 3LTCA 4BIRA 1YJN3 1A2KA 2XGLA 2K3DA 3G6E3 2SARA 3M8CA 1GY7A 2P09A 3D9RA 4HVNA 4XBYA 3WODG 4EV2A 3Q2PA 4MMZB 1FYSA 1RSNA 1IVVA 5AIFA 1TUHA 2LQVA 1IT8A 1A2PA 1HZ1A 1ULIB 2GU3A 4STDA 1FGRA 3F7XA 3STDA 1NO3A 4NHFA 4CPKA 3Q3FA 1SARA 1ROVA 3EN1B 1IK3A 1RHLA 4HKVB 1LRAA 3JUPA 4FMCA 3X3ZA 3SXXA 1OHOA 1RJOA 1RTUA 5LC6A 1O7GB 5AIGA 1JBSA 3CCL3 1WMOA 2CFLA 3IJEB 5M18A 3WOFB 5M1AA 4RBNA 3TDGA 1BRKA 1OUNA 1S723 1OHPA 4GHOA 2YFIB 1TU5A 4WYKB 1FUWA 1YGWA 4HM3B 4K1VA 1BNEA 1UUGB 5BXQA 4EC6A 4HOHA 1D6YA 2XRXB 1B2UA 1UUVB 5CXOA 1LNIA 1SIHA 4RZMA 4LSOA 1UW1A 2PZVA 2CK3H 3AGOA 1CEWI 2H0HA 4MMXB 3T0UA 1DE3A 2UUGC 1IT7A 3AHSA 1VQN3 1NJI4 2OTL3 1IYYA 3D5GA 1BRSA 2ZL8A 1SQWA 5M19A 2RCDA 1RCLA 8CHOA 5JBSA 3WA3A 1QALA 1RGCA 1WMPA 1OACA 3BU4A 4HM1B 3URPA 1V74A 4TX4A 1FA3A 3MKIA 5IW9A 4EBGA 1RLSA 2CFGA 3GAXA 4AKZA 1KQS2 1Q7HA 1M904 1IV7A 1FGMA 1T3BA 2F99A 1UI8A 1M1K4 3H51A 2ZHXB 3FF0A 1R4YA 1HYFA 2XH9A 6STDA 1IQ8A 1BRHA 1IU7A 1TRQA 3PXMA 5AI1A 4G1MB 2GEXA 3DGMA 2BO9B 1GD4A 2RBIA 3E99A 3F7SA 5IG4A 2IUKA 4O3VA 3Q1CA 2HOHA 1BRNL 5AIHA 1CH0A 3FG4A 3D3LA 1W01A 3GWRA 3KFQC 4HM4B 2CFKA 3X3YA 1OGXA 5TGNA 3VSYA 1Q7Y4 2BT3A 1OF5B 2E2TA 4IPBA 3D5IA 3LTBA 2KXGA 1RGAA 3EHCA 3CCS3 5LC7A 1VQ83 1R4CA 5GSPA 4KVHA 2YX9A 1GY6A 3BNDA 3FF2A 1GMQA 4KFDA 4RNZA 2YFLB 4ZM8A 3B4PA 4HM6B 2W56A 5FW5A 3AMOB 1OHSA 3GSPA 1VQ63 3MSOA 1F8NA 3NQZA 5AYSC 3QK9A 3NBRA 3NBJA 1GMPA 3L0RA 4BTXA 2RSXA 1WQLB 2QGUA 3V99A 3NX0A 2QA43 2KRTA 3CU3A 5IG0A 3CCE3 2B24B 3OWUA 2CIUA 3PS8A 5JPPA 1GYBA 1LVNA 3UL5A 3K9MC 1BSDA 5EQLA 3RGAA 1RKYA 1I0VA 2L1SA 1UI7A 1WTHA 2CG0A 3FZWA 7RNTA 5IF6A 4HZ9B 1V57A 2Z7AA 1Q9EA 4H61A 3OW22 5HOHA 1BSCA 1B2MA 1JB5A 5IERA 3OXAA 1RGEA 1VQM3 5KP4A 3MG2A 1TJDA 5A0OB 1K41A 7STDA 4I4KA 1PY3A 5IEOA 8RNTA 4EW5A 5AYRB 2BNGA 1X1XA 3CD63 1YVSA 1N8R4 2KF3A 2P05A 1RGKA 1MGWA 3MYTA 5ELUA 2W04A 1UGHI 1BOXA 3A5EA 1LQMB 3NV0A 1YI23 4R1KA 3CC43 2WOHA 4BTWA 1BUJA 4N3VA 1BANA 1Y4KA 1B20A 3KSPA 3LT8A 5AEWB 1RMSA 2QEX3 1U5OA 2GU1A 2OOVC 1N9JA 1BGSA 5EVHA 3WMDA 2WOFA 1BSEA 1GS3A 3SX1A 2CX0A 1TP6A 3GZXB 3K0ZA 4AKYA 4HM2B 1IQXA 1LNHA 1BRIA 3B7CA 2K54A 2O9UX 3NXJA 4FMDA 3G4S3 1QVF2 1YJW3 1YIJ3 3KIIA 1U8CB 1DETA 3OWSA 4EXRA 1MWTA 1IV9A 2BHMA 3S29A 1JBRA 2CW9A 1VQL3 1VQP3 1S5AA 4FCJA 3LH4A 2XFTA 1WNHA 1VQ93 1KWIA 1T5YA 1AQZA 3NUVA 4N6MA 4HZBB 1BAOA 3X42A 2XF3A 1QVG2 1EKMA 3JUOA 6GSPA 4I5QA 2W2CA 4QWTA 3H3HA 2UX0A 1OGZA 1VQ43 1JB4A 1JB2A 1B2SA 3MHEA 1AR0A 1VZZA 3SEDA 3WR2A 1BSBA 1FGTA 2M7OA 1BNFA 3CC23 1UDII 4LMIA 2HMKB 4HM8B 1MNLA 1A2VA 3HZPA 4OK0A 5STDA 3D79A 3I553 1UGIA 1W00A 2OQEA 3CCQ3 3V98A 3S67A 1J2BA 2W9PA 4HM7B 1BU4A 3EN8A 2CC3A 1TFOA 4O2HA 1M1XB 4RNTA 2GBWB 1X1WA 3FLJA 3CC73 2P38A 1RGFA 4WFOA 2F5MA 4MJDA 3DXOA 1HU9A 1FW7A 1WMNA 1QAKA 2IA7A 1G96A 5G1LA 1JN5A 1LOXA 1SPUA 3V92A 4N6UA 3LYGA 2CWTA 3G16A 3QRDA 3S27A 1ZS7A 1RN7A 1GOUA 3CCJ3 1BRJA 2ML6A 2RNTA 1GY5A 3PZWA 1ZX2A 5CK6A 1RN4A 2BMOB 3PGBA 2C10A 4J8TA 1N5PA 4FMBA 2JDIH 2AAEA 2Z77A 1B3SA 1BVIA 4FCZA 3WOEB 4WYKA 1C7HA 2CH9A 1Q40B 4Q53A 1LOVA 3MG3A 3FH1A 1OPYA 2W56B 5AEUB 2HMOB 1DVCA 2WGQA 1FUSA 3DGNA 4BU4A 2XSOB 2D42A 4FCMA 4KT3B 2JQ5A 2CKFB 3EC9A 3MWZA 4HBRA 2STDA 4N6NB 2CWUA 4N6TA 1JKGA 1RRLA 5KP1A 2RGQA 3G713 4HJLB 1JZOA 1YGEA 1FZUA 4KFFA 5BU4A 3LTDA 1A90A 4XM4A 1X1UA 1IVUA 2RFRA 4LEHA 1GOVA 3VF1A 1O7NB 3DH2A 3N54B 3LXUX 2P0XA 4JF8A 2KF6A 3ER7A 3FKAA 3B8LA 2IYJA 1D6UA 2P0MA 1QAFA 1RGLA 3KN4A 4NREA 3U1WA 2XR8B 1E97A 1UCLA 1ASKA 3CMA3 1I8VA 2ML5A 1HKXA 3LMLA 1RGHA 3KE7A 1RNTA 1G02A 3CXC2 1I2FA 4LZIA 4CDLA 1TRPA 1BNJA 5D81A 1FGQA 1UUWB 4N6OB 4PEJA 4JRFA 6RNTA 2L4VA 3DMCA 5JPUA 4O02B 2A15A 4WWUC 1PU4A 1LXEA 1RDSA 1L5GB 3KSED 1Q864 2FGTA 1AV4A 3DY5A 1W02A 3HIGA 3NHXA 1O7MB 1JJ22 1TIJA 3F14A 4R80A 3HIIA 2D1WA 4XBTA 3GZRA 3PCRA 2W03A 1K8A4 4R9LA 3WHOA 2F56A 3S28A 3SOYA 2IMJA 2HMMB 2BMQB 3K5TA 3SLUA 1GSPA 4GB5A 2ZA4A 2CG1A 3S5CA 3OX9A 3T8NA 5AIIA 4HYZA 3G8ZA 4MMYB 2F86B 2Y74A 3KKGA 1I2EA 2PNCA 5IEPA 4BTYA 3BB9A 1PFPA 3CNMA 4OVMA 1VQK3 3EE1A 2H0IA 3N8BA 2F5WA 1VQ53 4XDWA 1ISKA 1RGGA 1W5ZA 1NB5I 1UCKA 4AEQA 1O7PB 4XB5A 4BL2A 2IY2A 2C11A 2KF5A 3K63A 3SYUA 1W2B2 4EV5A 5DREA 1KSIA 1ROAA 4KZ1A 1RN1A 2R41A 4R9KA 1MOLA 1DVDA 4FR9A 3I0YA 3SOAA 3U97A 3FG1A 1FGOA 3CNXA 1BUQA 1W6YA 1I2GA 2J8XB 1QMAA 5FGOA 1DYUA 1IQYA 1K734 3BLZA 3I563 1JBTA 3K7CA 1YIT3 1K28A 1IVXA 3FGYA 3VGNA 1A67A 1NWWA 2Y73A 3T8UA 1N8QA 3OV4A 3WDGB 1UCIA 4L8OA 3ROBA 1YJ93 2CWVA 1AY7A 3B4OA 1I3IA 3CCR3 3DGLA 3EF8A 3F40A 3N9HA 1VQQA 5ELJA 1JN5B 2UGIA 1YHQ3 4IIAA 1ZO2A 5D82A 2OOVA 1STFI 1W7CA 2BMRB 3JUMA 5RNTA 1LOWA 5CLKA 3JVCA 1CQSA 1PYLA 3CCU3 3AGNA
chains in the Genus database with same CATH topology
1BSDA 4BU4A 1LOYA 1I0VA 2KF4A 1GMRA 4GSPA 3RNTA 1I3FA 2KAAA 1B27A 1FUTA 1GOYA 7RNTA 1BRGA 1Q9EA 4J5GA 4BIRA 5HOHA 1BSCA 1B2MA 1FZUA 5BU4A 3BIRA 1X1UA 2SARA 1GOVA 1RGEA 3DH2A 1FYSA 1PY3A 1RSNA 8RNTA 2C4BA 1A2PA 1HZ1A 2KF6A 1RCKA 1X1XA 1YVSA 3Q3FA 4HAAA 1SARA 2KF3A 1RGLA 1RGKA 1MGWA 1RHLA 1UCLA 3A5EA 1BOXA 1BNIA 1I8VA 1LRAA 1BUJA 5BIRA 1T2IA 1RGHA 1RTUA 1X1YA 1BANA 1RNTA 1G02A 1JBSA 1B20A 1I2FA 1TTOA 1RMSA 3DGYA 1TRPA 1BGSA 3HOHA 1BRKA 1BSEA 1BNJA 6RNTA 4GHOA 1YGWA 1B2XA 1BNEA 3D4AA 1BRIA 1RDSA 1YNVX 4HOHA 1B2UA 1I0XA 1LNIA 1DETA 1BNGA 3AGOA 1DE3A 1JBRA 1UCJA 3AHSA 2BU4A 1IYYA 3AHWA 3D5GA 1BRSA 1RCLA 1RGCA 3AGNA 1AQZA 4J5KA 2F56A 3BU4A 3URPA 3WHOA 9RNTA 1BAOA 1GSPA 2ZA4A 6GSPA 1ZGXA 1BIRA 1RLSA 1MGRA 2BIRA 7GSPA 1I2EA 1B2SA 1I70A 3WR2A 1BSBA 1BNSA 1BNFA 1HYFA 1R4YA 2F5WA 1BRHA 1RGGA 1TRQA 1UCKA 2RBIA 1T2HA 2AADA 2KF5A 3SYUA 1BRNL 2HOHA 1CH0A 1BSAA 3KCHA 1RN1A 1BU4A 4RNTA 1X1WA 1I2GA 1RGFA 3D5IA 2F4YA 1B21A 2F5MA 1FW7A 1RGAA 1JBTA 1C54A 5GSPA 1GMQA 2GSPA 1RNBA 1UCIA 1GOUA 3GSPA 1BRJA 2RNTA 1B2ZA 1AY7A 1I3IA 1RN4A 1GMPA 2AAEA 1B3SA 1BVIA 1LOVA 5RNTA 1LOWA 1BNRA 1PYLA 1FUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSD A;  4BU4 A;  1LOY A;  1I0V A;  2KF4 A;  1GMR A;  4GSP A;  3RNT A;  1I3F A;  2KAA A;  1B27 A;  1FUT A;  1GOY A;  7RNT A;  1BRG A;  1Q9E A;  4J5G A;  4BIR A;  5HOH A;  1BSC A;  1B2M A;  1FZU A;  5BU4 A;  3BIR A;  1X1U A;  2SAR A;  1GOV A;  1RGE A;  3DH2 A;  1FYS A;  1PY3 A;  1RSN A;  8RNT A;  2C4B A;  1A2P A;  1HZ1 A;  2KF6 A;  1RCK A;  1X1X A;  1YVS A;  3Q3F A;  4HAA A;  1SAR A;  2KF3 A;  1RGL A;  1RGK A;  1MGW A;  1RHL A;  1UCL A;  3A5E A;  1BOX A;  1BNI A;  1I8V A;  1LRA A;  1BUJ A;  5BIR A;  1T2I A;  1RGH A;  1RTU A;  1X1Y A;  1BAN A;  1RNT A;  1G02 A;  1JBS A;  1B20 A;  1I2F A;  1TTO A;  1RMS A;  3DGY A;  1TRP A;  1BGS A;  3HOH A;  1BRK A;  1BSE A;  1BNJ A;  6RNT A;  4GHO A;  1YGW A;  1B2X A;  1BNE A;  3D4A A;  1BRI A;  1RDS A;  1YNV X;  4HOH A;  1B2U A;  1I0X A;  1LNI A;  1DET A;  1BNG A;  3AGO A;  1DE3 A;  1JBR A;  1UCJ A;  3AHS A;  2BU4 A;  1IYY A;  3AHW A;  3D5G A;  1BRS A;  1RCL A;  1RGC A;  3AGN A;  1AQZ A;  4J5K A;  2F56 A;  3BU4 A;  3URP A;  3WHO A;  9RNT A;  1BAO A;  1GSP A;  2ZA4 A;  6GSP A;  1ZGX A;  1BIR A;  1RLS A;  1MGR A;  2BIR A;  7GSP A;  1I2E A;  1B2S A;  1I70 A;  3WR2 A;  1BSB A;  1BNS A;  1BNF A;  1HYF A;  1R4Y A;  2F5W A;  1BRH A;  1RGG A;  1TRQ A;  1UCK A;  2RBI A;  1T2H A;  2AAD A;  2KF5 A;  3SYU A;  1BRN L;  2HOH A;  1CH0 A;  1BSA A;  3KCH A;  1RN1 A;  1BU4 A;  4RNT A;  1X1W A;  1I2G A;  1RGF A;  3D5I A;  2F4Y A;  1B21 A;  2F5M A;  1FW7 A;  1RGA A;  1JBT A;  1C54 A;  5GSP A;  1GMQ A;  2GSP A;  1RNB A;  1UCI A;  1GOU A;  3GSP A;  1BRJ A;  2RNT A;  1B2Z A;  1AY7 A;  1I3I A;  1RN4 A;  1GMP A;  2AAE A;  1B3S A;  1BVI A;  1LOV A;  5RNT A;  1LOW A;  1BNR A;  1PYL A;  1FUS A; 
#chains in the Genus database with same CATH topology
 1LOY A;  1QJG A;  3DM8 A;  1VQO 3;  4FMA A;  2KF4 A;  4GSP A;  2OWP A;  1OCV A;  1CYV A;  2XGN A;  3PYJ A;  1STD A;  2XEP A;  2O3O A;  1GOY A;  3ZG5 A;  1BRG A;  4R4K A;  3GRD A;  1O7W B;  4WHA A;  1JRQ A;  3EJV A;  1EA2 A;  3BIR A;  1E3V A;  1EUI C;  4N6V 0;  4U13 A;  4BL3 A;  1NNV A;  4LYL B;  3FG3 A;  1ULJ B;  4CJN A;  4LGQ A;  4CCV A;  2C4B A;  2KCD A;  1RCK A;  1W6C A;  1JKG B;  2F98 A;  3CPO A;  4HAA A;  5G1K A;  3BNC A;  1US1 A;  1TFK A;  3F9S A;  3DUK A;  1BNI A;  1SJW A;  1SII A;  5BIR A;  1T2I A;  3JUN A;  4IT7 A;  3EBT A;  1X1Y A;  3RDE A;  1TTO A;  2W6J H;  1KC8 4;  1GD3 A;  2WGO A;  3DGY A;  2LYX A;  2CHC A;  3HOH A;  5EEO A;  3MG1 A;  2INX A;  3BNB A;  3A76 A;  4H3U A;  1NB3 I;  2E2U A;  1B2X A;  2GXF A;  4L7K A;  2QIY A;  3D4A A;  3O8Y A;  2IUJ A;  2W9Q A;  1W4N A;  1YNV X;  2SBL A;  3EBY A;  3CCV 3;  3NQY A;  3ZG0 A;  1M9G A;  1I0X A;  1JZD A;  1NU3 A;  2GBX B;  3F8H A;  1BNG A;  3GZY B;  3IMA B;  5IG5 A;  4HM0 B;  4ORL A;  5G2G A;  2OCT A;  1IVW A;  2XSH B;  1UCJ A;  3RGR A;  1VQ7 3;  2BU4 A;  1LQG C;  1K9M 4;  1N9E A;  1W2Z A;  1O7H B;  3AHW A;  3CCM 3;  3NM7 A;  1MWR A;  9RNT A;  4J5K A;  2FXT A;  3ECF A;  3LTA A;  4J9A A;  4NPB A;  2MC8 A;  2H0G A;  1D6Z A;  2Q07 A;  3EX9 A;  1ZGX A;  1BIR A;  4GL6 A;  3UL6 A;  3J7Y d;  1YVB I;  3EQQ B;  1Q40 A;  2K0M A;  1MGR A;  2BIR A;  7GSP A;  3KZT A;  3OWY A;  1I70 A;  1Z1S A;  2WO0 A;  1G0T A;  1BNS A;  2HMJ B;  3HX8 A;  1OF5 A;  5IG3 A;  4L8P A;  5BVB A;  1MWS A;  1IDP A;  1DMQ A;  5DRV A;  2E2V A;  3LZA A;  5CF1 A;  2FNQ A;  3NV0 B;  1T2H A;  3UB1 A;  2AAD A;  1DMM A;  3LOY A;  4OUQ A;  1AVL A;  1NDO B;  3BNE A;  1BSA A;  3PCS A;  1Q82 4;  4K1U A;  3KCH A;  4K61 A;  4RNY A;  4XDV A;  3UNL A;  2GEY A;  3EB8 A;  3LT9 A;  3AMO A;  3UJM A;  2OTJ 3;  2Z6B A;  2CX1 A;  1EG9 B;  3GZB A;  2CFW A;  2F4Y A;  3HI7 A;  1B21 A;  3CPW 2;  4O8S A;  5KP3 A;  1N5H A;  4EYC A;  3ALA A;  5HGR A;  2V1L A;  1W6G A;  3WA2 X;  2ZDJ A;  3FSD A;  3IPT A;  3X40 A;  2MF7 A;  4DKI A;  1JNQ A;  1Q81 4;  1KD1 4;  2GSP A;  3MPH A;  1CYU A;  4KFE A;  3ZFZ A;  1RNB A;  1AVK A;  3CME 3;  4XBX A;  4X2H A;  3X41 A;  4N6L A;  1B2Z A;  5CF2 A;  3NM2 A;  1Q42 A;  2I9W A;  4K90 B;  2W0Q A;  1DMN A;  4HM5 B;  3X3X A;  5D83 A;  1V58 A;  1EQK A;  2CFD A;  3JUQ A;  2XFS A;  4ILF A;  3FCS B;  4X2O A;  3SVA A;  2B1X B;  1MWU A;  1OH0 A;  3NBB A;  1JV2 B;  5I97 A;  1BNR A;  5IEN A;  2OQE C;  2YFJ B;  2Z76 A;  1GMR A;  1RRH A;  3DZL A;  3G0K A;  3RNT A;  1I3F A;  1EEJ A;  3F8X A;  2HMN B;  3DGO A;  2KAA A;  1B27 A;  1E3R A;  1FUT A;  3Q90 A;  2HML B;  3HK4 A;  4J5G A;  4MEI A;  4WP5 A;  1C54 A;  2R4I A;  3LTC A;  4BIR A;  1YJN 3;  1A2K A;  2XGL A;  2K3D A;  3G6E 3;  2SAR A;  3M8C A;  1GY7 A;  2P09 A;  3D9R A;  4HVN A;  4XBY A;  3WOD G;  4EV2 A;  3Q2P A;  4MMZ B;  1FYS A;  1RSN A;  1IVV A;  5AIF A;  1TUH A;  2LQV A;  1IT8 A;  1A2P A;  1HZ1 A;  1ULI B;  2GU3 A;  4STD A;  1FGR A;  3F7X A;  3STD A;  1NO3 A;  4NHF A;  4CPK A;  3Q3F A;  1SAR A;  1ROV A;  3EN1 B;  1IK3 A;  1RHL A;  4HKV B;  1LRA A;  3JUP A;  4FMC A;  3X3Z A;  3SXX A;  1OHO A;  1RJO A;  1RTU A;  5LC6 A;  1O7G B;  5AIG A;  1JBS A;  3CCL 3;  1WMO A;  2CFL A;  3IJE B;  5M18 A;  3WOF B;  5M1A A;  4RBN A;  3TDG A;  1BRK A;  1OUN A;  1S72 3;  1OHP A;  4GHO A;  2YFI B;  1TU5 A;  4WYK B;  1FUW A;  1YGW A;  4HM3 B;  4K1V A;  1BNE A;  1UUG B;  5BXQ A;  4EC6 A;  4HOH A;  1D6Y A;  2XRX B;  1B2U A;  1UUV B;  5CXO A;  1LNI A;  1SIH A;  4RZM A;  4LSO A;  1UW1 A;  2PZV A;  2CK3 H;  3AGO A;  1CEW I;  2H0H A;  4MMX B;  3T0U A;  1DE3 A;  2UUG C;  1IT7 A;  3AHS A;  1VQN 3;  1NJI 4;  2OTL 3;  1IYY A;  3D5G A;  1BRS A;  2ZL8 A;  1SQW A;  5M19 A;  2RCD A;  1RCL A;  8CHO A;  5JBS A;  3WA3 A;  1QAL A;  1RGC A;  1WMP A;  1OAC A;  3BU4 A;  4HM1 B;  3URP A;  1V74 A;  4TX4 A;  1FA3 A;  3MKI A;  5IW9 A;  4EBG A;  1RLS A;  2CFG A;  3GAX A;  4AKZ A;  1KQS 2;  1Q7H A;  1M90 4;  1IV7 A;  1FGM A;  1T3B A;  2F99 A;  1UI8 A;  1M1K 4;  3H51 A;  2ZHX B;  3FF0 A;  1R4Y A;  1HYF A;  2XH9 A;  6STD A;  1IQ8 A;  1BRH A;  1IU7 A;  1TRQ A;  3PXM A;  5AI1 A;  4G1M B;  2GEX A;  3DGM A;  2BO9 B;  1GD4 A;  2RBI A;  3E99 A;  3F7S A;  5IG4 A;  2IUK A;  4O3V A;  3Q1C A;  2HOH A;  1BRN L;  5AIH A;  1CH0 A;  3FG4 A;  3D3L A;  1W01 A;  3GWR A;  3KFQ C;  4HM4 B;  2CFK A;  3X3Y A;  1OGX A;  5TGN A;  3VSY A;  1Q7Y 4;  2BT3 A;  1OF5 B;  2E2T A;  4IPB A;  3D5I A;  3LTB A;  2KXG A;  1RGA A;  3EHC A;  3CCS 3;  5LC7 A;  1VQ8 3;  1R4C A;  5GSP A;  4KVH A;  2YX9 A;  1GY6 A;  3BND A;  3FF2 A;  1GMQ A;  4KFD A;  4RNZ A;  2YFL B;  4ZM8 A;  3B4P A;  4HM6 B;  2W56 A;  5FW5 A;  3AMO B;  1OHS A;  3GSP A;  1VQ6 3;  3MSO A;  1F8N A;  3NQZ A;  5AYS C;  3QK9 A;  3NBR A;  3NBJ A;  1GMP A;  3L0R A;  4BTX A;  2RSX A;  1WQL B;  2QGU A;  3V99 A;  3NX0 A;  2QA4 3;  2KRT A;  3CU3 A;  5IG0 A;  3CCE 3;  2B24 B;  3OWU A;  2CIU A;  3PS8 A;  5JPP A;  1GYB A;  1LVN A;  3UL5 A;  3K9M C;  1BSD A;  5EQL A;  3RGA A;  1RKY A;  1I0V A;  2L1S A;  1UI7 A;  1WTH A;  2CG0 A;  3FZW A;  7RNT A;  5IF6 A;  4HZ9 B;  1V57 A;  2Z7A A;  1Q9E A;  4H61 A;  3OW2 2;  5HOH A;  1BSC A;  1B2M A;  1JB5 A;  5IER A;  3OXA A;  1RGE A;  1VQM 3;  5KP4 A;  3MG2 A;  1TJD A;  5A0O B;  1K41 A;  7STD A;  4I4K A;  1PY3 A;  5IEO A;  8RNT A;  4EW5 A;  5AYR B;  2BNG A;  1X1X A;  3CD6 3;  1YVS A;  1N8R 4;  2KF3 A;  2P05 A;  1RGK A;  1MGW A;  3MYT A;  5ELU A;  2W04 A;  1UGH I;  1BOX A;  3A5E A;  1LQM B;  3NV0 A;  1YI2 3;  4R1K A;  3CC4 3;  2WOH A;  4BTW A;  1BUJ A;  4N3V A;  1BAN A;  1Y4K A;  1B20 A;  3KSP A;  3LT8 A;  5AEW B;  1RMS A;  2QEX 3;  1U5O A;  2GU1 A;  2OOV C;  1N9J A;  1BGS A;  5EVH A;  3WMD A;  2WOF A;  1BSE A;  1GS3 A;  3SX1 A;  2CX0 A;  1TP6 A;  3GZX B;  3K0Z A;  4AKY A;  4HM2 B;  1IQX A;  1LNH A;  1BRI A;  3B7C A;  2K54 A;  2O9U X;  3NXJ A;  4FMD A;  3G4S 3;  1QVF 2;  1YJW 3;  1YIJ 3;  3KII A;  1U8C B;  1DET A;  3OWS A;  4EXR A;  1MWT A;  1IV9 A;  2BHM A;  3S29 A;  1JBR A;  2CW9 A;  1VQL 3;  1VQP 3;  1S5A A;  4FCJ A;  3LH4 A;  2XFT A;  1WNH A;  1VQ9 3;  1KWI A;  1T5Y A;  1AQZ A;  3NUV A;  4N6M A;  4HZB B;  1BAO A;  3X42 A;  2XF3 A;  1QVG 2;  1EKM A;  3JUO A;  6GSP A;  4I5Q A;  2W2C A;  4QWT A;  3H3H A;  2UX0 A;  1OGZ A;  1VQ4 3;  1JB4 A;  1JB2 A;  1B2S A;  3MHE A;  1AR0 A;  1VZZ A;  3SED A;  3WR2 A;  1BSB A;  1FGT A;  2M7O A;  1BNF A;  3CC2 3;  1UDI I;  4LMI A;  2HMK B;  4HM8 B;  1MNL A;  1A2V A;  3HZP A;  4OK0 A;  5STD A;  3D79 A;  3I55 3;  1UGI A;  1W00 A;  2OQE A;  3CCQ 3;  3V98 A;  3S67 A;  1J2B A;  2W9P A;  4HM7 B;  1BU4 A;  3EN8 A;  2CC3 A;  1TFO A;  4O2H A;  1M1X B;  4RNT A;  2GBW B;  1X1W A;  3FLJ A;  3CC7 3;  2P38 A;  1RGF A;  4WFO A;  2F5M A;  4MJD A;  3DXO A;  1HU9 A;  1FW7 A;  1WMN A;  1QAK A;  2IA7 A;  1G96 A;  5G1L A;  1JN5 A;  1LOX A;  1SPU A;  3V92 A;  4N6U A;  3LYG A;  2CWT A;  3G16 A;  3QRD A;  3S27 A;  1ZS7 A;  1RN7 A;  1GOU A;  3CCJ 3;  1BRJ A;  2ML6 A;  2RNT A;  1GY5 A;  3PZW A;  1ZX2 A;  5CK6 A;  1RN4 A;  2BMO B;  3PGB A;  2C10 A;  4J8T A;  1N5P A;  4FMB A;  2JDI H;  2AAE A;  2Z77 A;  1B3S A;  1BVI A;  4FCZ A;  3WOE B;  4WYK A;  1C7H A;  2CH9 A;  1Q40 B;  4Q53 A;  1LOV A;  3MG3 A;  3FH1 A;  1OPY A;  2W56 B;  5AEU B;  2HMO B;  1DVC A;  2WGQ A;  1FUS A;  3DGN A;  4BU4 A;  2XSO B;  2D42 A;  4FCM A;  4KT3 B;  2JQ5 A;  2CKF B;  3EC9 A;  3MWZ A;  4HBR A;  2STD A;  4N6N B;  2CWU A;  4N6T A;  1JKG A;  1RRL A;  5KP1 A;  2RGQ A;  3G71 3;  4HJL B;  1JZO A;  1YGE A;  1FZU A;  4KFF A;  5BU4 A;  3LTD A;  1A90 A;  4XM4 A;  1X1U A;  1IVU A;  2RFR A;  4LEH A;  1GOV A;  3VF1 A;  1O7N B;  3DH2 A;  3N54 B;  3LXU X;  2P0X A;  4JF8 A;  2KF6 A;  3ER7 A;  3FKA A;  3B8L A;  2IYJ A;  1D6U A;  2P0M A;  1QAF A;  1RGL A;  3KN4 A;  4NRE A;  3U1W A;  2XR8 B;  1E97 A;  1UCL A;  1ASK A;  3CMA 3;  1I8V A;  2ML5 A;  1HKX A;  3LML A;  1RGH A;  3KE7 A;  1RNT A;  1G02 A;  3CXC 2;  1I2F A;  4LZI A;  4CDL A;  1TRP A;  1BNJ A;  5D81 A;  1FGQ A;  1UUW B;  4N6O B;  4PEJ A;  4JRF A;  6RNT A;  2L4V A;  3DMC A;  5JPU A;  4O02 B;  2A15 A;  4WWU C;  1PU4 A;  1LXE A;  1RDS A;  1L5G B;  3KSE D;  1Q86 4;  2FGT A;  1AV4 A;  3DY5 A;  1W02 A;  3HIG A;  3NHX A;  1O7M B;  1JJ2 2;  1TIJ A;  3F14 A;  4R80 A;  3HII A;  2D1W A;  4XBT A;  3GZR A;  3PCR A;  2W03 A;  1K8A 4;  4R9L A;  3WHO A;  2F56 A;  3S28 A;  3SOY A;  2IMJ A;  2HMM B;  2BMQ B;  3K5T A;  3SLU A;  1GSP A;  4GB5 A;  2ZA4 A;  2CG1 A;  3S5C A;  3OX9 A;  3T8N A;  5AII A;  4HYZ A;  3G8Z A;  4MMY B;  2F86 B;  2Y74 A;  3KKG A;  1I2E A;  2PNC A;  5IEP A;  4BTY A;  3BB9 A;  1PFP A;  3CNM A;  4OVM A;  1VQK 3;  3EE1 A;  2H0I A;  3N8B A;  2F5W A;  1VQ5 3;  4XDW A;  1ISK A;  1RGG A;  1W5Z A;  1NB5 I;  1UCK A;  4AEQ A;  1O7P B;  4XB5 A;  4BL2 A;  2IY2 A;  2C11 A;  2KF5 A;  3K63 A;  3SYU A;  1W2B 2;  4EV5 A;  5DRE A;  1KSI A;  1ROA A;  4KZ1 A;  1RN1 A;  2R41 A;  4R9K A;  1MOL A;  1DVD A;  4FR9 A;  3I0Y A;  3SOA A;  3U97 A;  3FG1 A;  1FGO A;  3CNX A;  1BUQ A;  1W6Y A;  1I2G A;  2J8X B;  1QMA A;  5FGO A;  1DYU A;  1IQY A;  1K73 4;  3BLZ A;  3I56 3;  1JBT A;  3K7C A;  1YIT 3;  1K28 A;  1IVX A;  3FGY A;  3VGN A;  1A67 A;  1NWW A;  2Y73 A;  3T8U A;  1N8Q A;  3OV4 A;  3WDG B;  1UCI A;  4L8O A;  3ROB A;  1YJ9 3;  2CWV A;  1AY7 A;  3B4O A;  1I3I A;  3CCR 3;  3DGL A;  3EF8 A;  3F40 A;  3N9H A;  1VQQ A;  5ELJ A;  1JN5 B;  2UGI A;  1YHQ 3;  4IIA A;  1ZO2 A;  5D82 A;  2OOV A;  1STF I;  1W7C A;  2BMR B;  3JUM A;  5RNT A;  1LOW A;  5CLK A;  3JVC A;  1CQS A;  1PYL A;  3CCU 3;  3AGN A; 
#chains in the Genus database with same CATH homology
 1BSD A;  4BU4 A;  1LOY A;  1I0V A;  2KF4 A;  1GMR A;  4GSP A;  3RNT A;  1I3F A;  2KAA A;  1B27 A;  1FUT A;  1GOY A;  7RNT A;  1BRG A;  1Q9E A;  4J5G A;  4BIR A;  5HOH A;  1BSC A;  1B2M A;  1FZU A;  5BU4 A;  3BIR A;  1X1U A;  2SAR A;  1GOV A;  1RGE A;  3DH2 A;  1FYS A;  1PY3 A;  1RSN A;  8RNT A;  2C4B A;  1A2P A;  1HZ1 A;  2KF6 A;  1RCK A;  1X1X A;  1YVS A;  3Q3F A;  4HAA A;  1SAR A;  2KF3 A;  1RGL A;  1RGK A;  1MGW A;  1RHL A;  1UCL A;  3A5E A;  1BOX A;  1BNI A;  1I8V A;  1LRA A;  1BUJ A;  5BIR A;  1T2I A;  1RGH A;  1RTU A;  1X1Y A;  1BAN A;  1RNT A;  1G02 A;  1JBS A;  1B20 A;  1I2F A;  1TTO A;  1RMS A;  3DGY A;  1TRP A;  1BGS A;  3HOH A;  1BRK A;  1BSE A;  1BNJ A;  6RNT A;  4GHO A;  1YGW A;  1B2X A;  1BNE A;  3D4A A;  1BRI A;  1RDS A;  1YNV X;  4HOH A;  1B2U A;  1I0X A;  1LNI A;  1DET A;  1BNG A;  3AGO A;  1DE3 A;  1JBR A;  1UCJ A;  3AHS A;  2BU4 A;  1IYY A;  3AHW A;  3D5G A;  1BRS A;  1RCL A;  1RGC A;  3AGN A;  1AQZ A;  4J5K A;  2F56 A;  3BU4 A;  3URP A;  3WHO A;  9RNT A;  1BAO A;  1GSP A;  2ZA4 A;  6GSP A;  1ZGX A;  1BIR A;  1RLS A;  1MGR A;  2BIR A;  7GSP A;  1I2E A;  1B2S A;  1I70 A;  3WR2 A;  1BSB A;  1BNS A;  1BNF A;  1HYF A;  1R4Y A;  2F5W A;  1BRH A;  1RGG A;  1TRQ A;  1UCK A;  2RBI A;  1T2H A;  2AAD A;  2KF5 A;  3SYU A;  1BRN L;  2HOH A;  1CH0 A;  1BSA A;  3KCH A;  1RN1 A;  1BU4 A;  4RNT A;  1X1W A;  1I2G A;  1RGF A;  3D5I A;  2F4Y A;  1B21 A;  2F5M A;  1FW7 A;  1RGA A;  1JBT A;  1C54 A;  5GSP A;  1GMQ A;  2GSP A;  1RNB A;  1UCI A;  1GOU A;  3GSP A;  1BRJ A;  2RNT A;  1B2Z A;  1AY7 A;  1I3I A;  1RN4 A;  1GMP A;  2AAE A;  1B3S A;  1BVI A;  1LOV A;  5RNT A;  1LOW A;  1BNR A;  1PYL A;  1FUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...