1BSDA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
INTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLVYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 33
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bsdA00
1FUTA 1FW7A 1DE3A 1BUJA 1I70A 9RNTA 1BANA 1RGGA 1TRQA 3WR2A 1BNJA 1YGWA 2BU4A 1UCIA 1LNIA 4BIRA 7RNTA 1G02A 1I3IA 1HZ1A 1BVIA 6GSPA 1RCKA 1UCJA 4J5GA 1LOYA 5HOHA 2KF5A 1RNTA 1BNGA 2F4YA 1BRSA 1I8VA 1BU4A 1UCLA 1YVSA 1JBRA 1AQZA 2ZA4A 4HAAA 3AHWA 2KF4A 1B21A 1I2EA 1UCKA 2RNTA 3SYUA 4BU4A 1RDSA 1CH0A 1X1UA 1BRJA 3KCHA 1RN1A 7GSPA 1IYYA 4GHOA 1BOXA 1BRNL 3D4AA 3AHSA 1BIRA 2RBIA 3RNTA 2F5WA 1I3FA 1RGKA 1PY3A 1MGRA 1I2FA 2AAEA 1BRIA 1T2IA 1X1WA 3WHOA 1MGWA 3DH2A 6RNTA 5BU4A 1BNSA 1RCLA 1BNIA 1RGHA 1I0XA 1T2HA 1BSBA 1RNBA 3GSPA 4HOHA 1Q9EA 1RGFA 1PYLA 1FUSA 1I2GA 2SARA 1BRGA 3AGOA 3D5GA 1FYSA 1RGCA 1TTOA 1GOUA 2GSPA 3BIRA 1GMRA 3URPA 1B3SA 1BGSA 1LOWA 2F5MA 5BIRA 3D5IA 1GOYA 1LOVA 1BRHA 4J5KA 3BU4A 1X1YA 1BSCA 1RN4A 1RMSA 1B2ZA 1R4YA 1RGEA 3Q3FA 1GOVA 1AY7A 1BNEA 2AADA 4RNTA 5RNTA 1B27A 1JBTA 1RGAA 1DETA 1TRPA 1B2SA 2BIRA 1HYFA 4GSPA 1GMQA 1I0VA 3DGYA 5GSPA 2KF3A 1C54A 1RHLA 1BRKA 3A5EA 1X1XA 1GMPA 1BNFA 1YNVX 1BSEA 2C4BA 1SARA 3AGNA 1BNRA 1B20A 2F56A 1A2PA 1FZUA 1ZGXA 1GSPA 1RSNA 2KF6A 1B2XA 2HOHA 1JBSA 1RGLA 1B2MA 1BSDA 1BSAA 3HOHA 1RLSA 1LRAA 1BAOA 1RTUA 8RNTA 2KAAA 1B2UA
chains in the Genus database with same CATH superfamily
3NQYA 1PU4A 2HMNB 2CHCA 4NREA 5M19A 1STDA 2OWPA 1FGMA 1G96A 2CFWA 1FW7A 1DE3A 2CFGA 3UL6A 2BO9B 1RGGA 1EEJA 3X42A 5EVHA 1TRQA 2CW9A 2OTL3 3DGLA 1ROVA 3ALAA 5AEUB 1YGWA 1DYUA 1FGQA 1Q814 1UCIA 3EBYA 3G713 3B7CA 1LNIA 2STDA 4XM4A 7RNTA 1JN5B 4N6NB 3NQZA 3VF1A 6GSPA 1E97A 3FF0A 3NV0A 4J5GA 4QWTA 3K0ZA 5HOHA 2KF5A 1RNTA 2OOVA 1LVNA 3D3LA 1ULJB 5DRVA 4EC6A 3GZRA 1MOLA 3V92A 4KFDA 1BRSA 1I8VA 1QAFA 2QIYA 5CLKA 1GD4A 1YVSA 1ZX2A 2CFDA 1D6ZA 4HAAA 2ZA4A 1JZDA 1Q864 4AEQA 1QJGA 2KF4A 3LZAA 1M1K4 1IVVA 2IUKA 1HKXA 1NDOB 2K3DA 2WOFA 3FKAA 1VQQA 3K5TA 4K90B 4R80A 5FGOA 4BU4A 4O3VA 5JPPA 1W5ZA 1IQYA 2ZDJA 1BRJA 1W6CA 1RN1A 3HI7A 4LYLB 4NPBA 2YFJB 4GHOA 3S29A 4BTWA 1EQKA 3DGNA 3FH1A 1BRNL 2Z76A 3AHSA 3CC23 5IG5A 1SQWA 4JRFA 1QMAA 3O8YA 1VQ83 4J8TA 1M9GA 1MGRA 1I2FA 2AAEA 4XBTA 3CCV3 1T2IA 3WHOA 3JUPA 2PNCA 2B1XB 3SVAA 3VSYA 1I0XA 3EB8A 1BSBA 1RNBA 1V74A 1CQSA 3CCS3 3T0UA 1C7HA 3WA3A 1E3RA 2KCDA 4HYZA 3ECFA 2P09A 3WODG 2JDIH 1FUSA 4U13A 4Q53A 3KZTA 1VQ53 1ZO2A 1OGXA 2O9UX 1SIIA 1RKYA 3I563 1W01A 3N54B 3WMDA 5BVBA 1EG9B 3AGOA 3NV0B 5IEPA 3FG4A 1IK3A 1RGCA 2XFSA 1ROAA 1VQ63 2V1LA 1GOUA 2CH9A 5FW5A 1DMMA 1G0TA 3X3XA 1LQGC 3F7XA 2RSXA 4HBRA 4LSOA 5IERA 4HM8B 2F5MA 1RRHA 2CFLA 5BIRA 3UB1A 1LOVA 1MNLA 3MHEA 3WA2X 1BRHA 5I97A 2RGQA 1TUHA 1V57A 3EF8A 2OCTA 2CWTA 3HIIA 4N6TA 3CPOA 5M18A 4RNTA 1BNEA 2CX0A 3I553 1AV4A 1DETA 3T8NA 1N8R4 1M904 1YJ93 4R1KA 2IY2A 3DZLA 1OHSA 2BHMA 2CIUA 3A5EA 3JUOA 1YNVX 4K61A 1BSEA 2E2TA 4HKVB 3MSOA 4CJNA 3AGNA 1YJN3 2GU3A 5IG4A 1EA2A 2GU1A 1B20A 5KP3A 1UUWB 1GY7A 1GS3A 3DUKA 1A2VA 3WDGB 3GZYB 3BB9A 3KIIA 4FMDA 1BSDA 1BSAA 2Z6BA 4L8OA 1QAKA 3BNCA 1LQMB 5JPUA 1KSIA 1BAOA 1AVKA 2HMLB 2JQ5A 4J9AA 1IQXA 2CWUA 5EQLA 3HIGA 2D42A 4O8SA 1FUTA 2OQEC 1IVUA 2R4IA 3PCRA 1UUVB 1W6YA 2XRXB 4MMYB 4XB5A 1A67A 1BANA 3WOFB 2CX1A 1Q7Y4 1IVWA 3K7CA 3DMCA 3WR2A 1UI8A 4L7KA 4R4KA 2C11A 2J8XB 2XH9A 1FGTA 1NB3I 2BU4A 1UGIA 2GBXB 3U97A 5LC7A 1YJW3 1W7CA 1QVF2 4FR9A 1HZ1A 3OXAA 2FNQA 1UCJA 4STDA 1BNGA 1GD3A 4AKZA 1PFPA 1VQM3 3MKIA 5IEOA 1O7PB 2F4YA 3PGBA 1NO3A 1UCLA 3SEDA 4HM2B 1DMNA 2W9PA 4H3UA 3KSPA 3S5CA 3K9MC 2XEPA 4MEIA 1TFKA 2ZL8A 3G16A 1B21A 3FSDA 3BLZA 2RNTA 3SYUA 1IDPA 1OHPA 1RDSA 3OWYA 1S5AA 1X1UA 1SPUA 3G6E3 3CCQ3 1CYUA 2XFTA 5CF1A 1IYYA 3S28A 1IVXA 5D81A 1BOXA 3CCM3 1W00A 5DREA 3F8HA 5IF6A 2HMJB 2P38A 2RBIA 4BTXA 4CCVA 4N6UA 1Z1SA 1RGKA 4ORLA 1PY3A 4RNYA 3LTAA 3OWUA 1JKGA 2W03A 1QVG2 3DH2A 1W2B2 1OCVA 5BU4A 1BNSA 1BNIA 1IV9A 1DMQA 5KP1A 1TIJA 1A2KA 2CG1A 3GSPA 5G2GA 4FMCA 3F8XA 2Q07A 1GY6A 1O7WB 3PCSA 1MWUA 2O3OA 1HU9A 2QA43 2UGIA 4TX4A 5JBSA 3CCL3 4NHFA 2F98A 1BRGA 3DXOA 4WYKA 2BMOB 1FUWA 2XR8B 1FYSA 3OV4A 2K0MA 3FLJA 3PZWA 1UDII 3MG2A 2GSPA 1S723 1BUQA 2I9WA 3JUMA 4WHAA 2Z77A 3I0YA 4JF8A 1B3SA 1BGSA 1LOWA 2P05A 3FGYA 1AR0A 2KRTA 3NBJA 3NM7A 3X3YA 3T8UA 2L1SA 5LC6A 2MC8A 1W02A 2H0HA 1KWIA 1X1YA 2KXGA 1RN4A 1RMSA 5CXOA 2BMQB 3BNDA 4I4KA 1AY7A 1IU7A 2AADA 4HM6B 4EXRA 1VQ43 1TRPA 2Y73A 3CCU3 3DGYA 1OF5A 4AKYA 1EUIC 1K8A4 3MG1A 5AIFA 1RHLA 3H51A 1JRQA 5HGRA 1BNFA 1L5GB 3G4S3 1JB4A 4N6OB 3X3ZA 2C4BA 1IT7A 1UGHI 7STDA 1JB5A 1NB5I 2E2VA 3QRDA 4LEHA 3AMOA 4XDVA 3OW22 2CFKA 1A2PA 1O7GB 1FZUA 2C10A 1N5HA 2ML5A 1TP6A 3ER7A 3G0KA 3M8CA 3KKGA 5IG0A 1B2MA 1RGLA 2LYXA 4WFOA 1D6UA 3HOHA 5D82A 1VQK3 1RLSA 3SLUA 5TGNA 4LMIA 4G1MB 6STDA 5IG3A 1O7HB 8RNTA 1KC84 1B2UA 1OGZA 4KVHA 3NM2A 3X40A 2CWVA 2W2CA 3AMOB 3LYGA 2CG0A 4GL6A 2W04A 1I70A 2B24B 5AIIA 2OOVC 3D79A 3PYJA 4IPBA 3CCR3 2BT3A 5M1AA 1WNHA 3GRDA 3GZXB 3ZG0A 5IENA 3BNEA 3LTDA 4LGQA 1TJDA 1UI7A 3UL5A 3MWZA 1I3IA 4LZIA 1JJ22 1BVIA 1LOYA 1WMPA 1JKGB 4MMXB 4HM1B 4HZ9B 4HM7B 1MWRA 2XF3A 3JVCA 1US1A 3H3HA 3IJEB 4X2OA 1JBRA 3CCJ3 1AQZA 4EBGA 3EX9A 1JN5A 1QALA 4MJDA 3ROBA 2GEXA 3KE7A 2M7OA 4EYCA 1I2EA 1UCKA 2E2UA 3A76A 3OX9A 4EV2A 1YVBI 3CNMA 4WYKB 5AYRB 7GSPA 1OUNA 4RNZA 3CU3A 2K54A 3DY5A 2CK3H 1OH0A 4GB5A 4KT3B 5EEOA 3STDA 1Q42A 1TFOA 3MG3A 1YIT3 2F5WA 3B8LA 1YGEA 3LH4A 3CCE3 2A15A 1EKMA 1BRIA 1X1WA 2SBLA 1OF5B 2QEX3 1Q824 1RCLA 1O7NB 1SJWA 4FCJA 5ELUA 4HOHA 2WGOA 4HM0B 3IMAB 4ZM8A 3NHXA 3SX1A 2UX0A 3EJVA 1RGFA 2QGUA 4N3VA 4N6MA 1R4CA 2GXFA 4WP5A 1PYLA 3HZPA 1GYBA 1N8QA 3F9SA 2RFRA 1T3BA 1I2GA 3FG1A 1RRLA 2SARA 4H61A 2HMOB 1Q40B 1K41A 2CKFB 4O2HA 1VQN3 1TTOA 2YX9A 1K9M4 4KFEA 4HZBB 4IT7A 1JB2A 2PZVA 1GMRA 3BIRA 3N9HA 1DVCA 4IIAA 1CEWI 1J2BA 4CDLA 1OPYA 1NJI4 2FGTA 1N9EA 3D5IA 3TDGA 5AEWB 3V98A 1NWWA 2XGLA 3S27A 4J5KA 2W6JH 3CD63 1BSCA 4KFFA 1B2ZA 2GEYA 2ZHXB 1RGEA 3Q3FA 4FCMA 4RZMA 4R9LA 1STFI 4OUQA 1OHOA 3Q1CA 3RGRA 3EHCA 5BXQA 2WGQA 4EW5A 3CME3 3DGOA 1B2SA 4FMBA 4MMZB 4XBXA 5CK6A 4GSPA 3NBRA 1I0VA 3CNXA 4OK0A 2OQEA 2IYJA 1C54A 1BRKA 3S67A 1RN7A 1X1XA 4K1UA 4K1VA 1WMOA 1VQ73 2H0IA 2L4VA 3QK9A 1Y4KA 3LMLA 1CYVA 1GSPA 1RSNA 3N8BA 2IUJA 3UNLA 3V99A 1E3VA 1JBSA 3MPHA 1TU5A 2BMRB 3EBTA 3KFQC 2W9QA 4ILFA 3X41A 1GY5A 2W56A 3L0RA 5AYSC 3RGAA 4BTYA 1KD14 4R9KA 4N6V0 4BL2A 1RTUA 3VGNA 3NBBA 1YHQ3 3NX0A 1U8CB 1VQP3 4L8PA 1JNQA 1N5PA 3FZWA 2ML6A 1NU3A 1LNHA 3JUQA 9RNTA 3HK4A 3LT8A 3SOYA 5IW9A 1BUJA 2H0GA 1Q7HA 2WO0A 4EV5A 1RJOA 3B4OA 2F86B 3K63A 1BNJA 2RCDA 1W4NA 3EN8A 4BIRA 1G02A 5CF2A 3GZBA 4HM5B 1NNVA 2HMMB 1RCKA 3FG3A 3WOEB 1F8NA 4X2HA 1UUGB 1MWTA 1UW1A 3FCSB 3U1WA 1VQO3 1M1XB 3KSED 1BU4A 3OWSA 1FGRA 2R41A 1OACA 3LTBA 1N9JA 3AHWA 5KP4A 3CPW2 1KQS2 3PXMA 3DM8A 1T5YA 2IA7A 5A0OB 3IPTA 3LXUX 1CH0A 1VQL3 3KCHA 3HX8A 2CC3A 3Q2PA 3CMA3 5ELJA 2UUGC 3D4AA 2XSOB 3Q90A 1BIRA 3EQQB 1WMNA 3RNTA 2W0QA 1VZZA 3SOAA 2XGNA 1I3FA 3F14A 1WTHA 4FCZA 4WWUC 1MGWA 3JUNA 1ASKA 6RNTA 2W56B 1SIHA 1RGHA 1T2HA 3G8ZA 3F40A 1IQ8A 4HM4B 3CC73 1A90A 1DVDA 5G1LA 4N6LA 3UJMA 2BNGA 1W2ZA 3NUVA 1LOXA 3PS8A 4HJLB 1WQLB 3ZG5A 4BL3A 3FF2A 2MF7A 3EN1B 1VQ93 3D5GA 3LTCA 1FA3A 1IT8A 2D1WA 3SXXA 2IMJA 2OTJ3 3URPA 5G1KA 3NXJA 4OVMA 4HM3B 2P0MA 3BNBA 1W6GA 1ULIB 3LT9A 1GOYA 5AIHA 1K734 2HMKB 4FMAA 2Z7AA 3BU4A 1K28A 3CC43 5STDA 1U5OA 1R4YA 1YIJ3 1ZS7A 2LQVA 1GOVA 5D83A 1V58A 3DGMA 3EE1A 8CHOA 5RNTA 1O7MB 1B27A 1JBTA 1D6YA 1RGAA 3ZFZA 2BIRA 1FGOA 1HYFA 2WOHA 2FXTA 1GMQA 2XSHB 3GWRA 3LOYA 2Y74A 4KZ1A 5GSPA 2KF3A 4XDWA 3RDEA 3J7Yd 1JV2B 2P0XA 3MYTA 1GMPA 1Q40A 4HVNA 4RBNA 4I5QA 4XBYA 4DKIA 3E99A 2INXA 1SARA 1ISKA 1IV7A 3EC9A 1BNRA 3F7SA 2F99A 2YFLB 5AIGA 1MWSA 2F56A 3GAXA 4CPKA 1ZGXA 3D9RA 5AI1A 1AVLA 2YFIB 3B4PA 2KF6A 1B2XA 2HOHA 1JZOA 3CXC2 1YI23 1LXEA 4O02B 4PEJA 1LRAA 3KN4A 2KAAA 2GBWB 1Q9EA
chains in the Genus database with same CATH topology
1FUTA 1FW7A 1DE3A 1BUJA 1I70A 9RNTA 1BANA 1RGGA 1TRQA 3WR2A 1BNJA 1YGWA 2BU4A 1UCIA 1LNIA 4BIRA 7RNTA 1G02A 1I3IA 1HZ1A 1BVIA 6GSPA 1RCKA 1UCJA 4J5GA 1LOYA 5HOHA 2KF5A 1RNTA 1BNGA 2F4YA 1BRSA 1I8VA 1BU4A 1UCLA 1YVSA 1JBRA 1AQZA 2ZA4A 4HAAA 3AHWA 2KF4A 1B21A 1I2EA 1UCKA 2RNTA 3SYUA 4BU4A 1RDSA 1CH0A 1X1UA 1BRJA 3KCHA 1RN1A 7GSPA 1IYYA 4GHOA 1BOXA 1BRNL 3D4AA 3AHSA 1BIRA 2RBIA 3RNTA 2F5WA 1I3FA 1RGKA 1PY3A 1MGRA 1I2FA 2AAEA 1BRIA 1T2IA 1X1WA 3WHOA 1MGWA 3DH2A 6RNTA 5BU4A 1BNSA 1RCLA 1BNIA 1RGHA 1I0XA 1T2HA 1BSBA 1RNBA 3GSPA 4HOHA 1Q9EA 1RGFA 1PYLA 1FUSA 1I2GA 2SARA 1BRGA 3AGOA 3D5GA 1FYSA 1RGCA 1TTOA 1GOUA 2GSPA 3BIRA 1GMRA 3URPA 1B3SA 1BGSA 1LOWA 2F5MA 5BIRA 3D5IA 1GOYA 1LOVA 1BRHA 4J5KA 3BU4A 1X1YA 1BSCA 1RN4A 1RMSA 1B2ZA 1R4YA 1RGEA 3Q3FA 1GOVA 1AY7A 1BNEA 2AADA 4RNTA 5RNTA 1B27A 1JBTA 1RGAA 1DETA 1TRPA 1B2SA 2BIRA 1HYFA 4GSPA 1GMQA 1I0VA 3DGYA 5GSPA 2KF3A 1C54A 1RHLA 1BRKA 3A5EA 1X1XA 1GMPA 1BNFA 1YNVX 1BSEA 2C4BA 1SARA 3AGNA 1BNRA 1B20A 2F56A 1A2PA 1FZUA 1ZGXA 1GSPA 1RSNA 2KF6A 1B2XA 2HOHA 1JBSA 1RGLA 1B2MA 1BSDA 1BSAA 3HOHA 1RLSA 1LRAA 1BAOA 1RTUA 8RNTA 2KAAA 1B2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FUT A;  1FW7 A;  1DE3 A;  1BUJ A;  1I70 A;  9RNT A;  1BAN A;  1RGG A;  1TRQ A;  3WR2 A;  1BNJ A;  1YGW A;  2BU4 A;  1UCI A;  1LNI A;  4BIR A;  7RNT A;  1G02 A;  1I3I A;  1HZ1 A;  1BVI A;  6GSP A;  1RCK A;  1UCJ A;  4J5G A;  1LOY A;  5HOH A;  2KF5 A;  1RNT A;  1BNG A;  2F4Y A;  1BRS A;  1I8V A;  1BU4 A;  1UCL A;  1YVS A;  1JBR A;  1AQZ A;  2ZA4 A;  4HAA A;  3AHW A;  2KF4 A;  1B21 A;  1I2E A;  1UCK A;  2RNT A;  3SYU A;  4BU4 A;  1RDS A;  1CH0 A;  1X1U A;  1BRJ A;  3KCH A;  1RN1 A;  7GSP A;  1IYY A;  4GHO A;  1BOX A;  1BRN L;  3D4A A;  3AHS A;  1BIR A;  2RBI A;  3RNT A;  2F5W A;  1I3F A;  1RGK A;  1PY3 A;  1MGR A;  1I2F A;  2AAE A;  1BRI A;  1T2I A;  1X1W A;  3WHO A;  1MGW A;  3DH2 A;  6RNT A;  5BU4 A;  1BNS A;  1RCL A;  1BNI A;  1RGH A;  1I0X A;  1T2H A;  1BSB A;  1RNB A;  3GSP A;  4HOH A;  1Q9E A;  1RGF A;  1PYL A;  1FUS A;  1I2G A;  2SAR A;  1BRG A;  3AGO A;  3D5G A;  1FYS A;  1RGC A;  1TTO A;  1GOU A;  2GSP A;  3BIR A;  1GMR A;  3URP A;  1B3S A;  1BGS A;  1LOW A;  2F5M A;  5BIR A;  3D5I A;  1GOY A;  1LOV A;  1BRH A;  4J5K A;  3BU4 A;  1X1Y A;  1BSC A;  1RN4 A;  1RMS A;  1B2Z A;  1R4Y A;  1RGE A;  3Q3F A;  1GOV A;  1AY7 A;  1BNE A;  2AAD A;  4RNT A;  5RNT A;  1B27 A;  1JBT A;  1RGA A;  1DET A;  1TRP A;  1B2S A;  2BIR A;  1HYF A;  4GSP A;  1GMQ A;  1I0V A;  3DGY A;  5GSP A;  2KF3 A;  1C54 A;  1RHL A;  1BRK A;  3A5E A;  1X1X A;  1GMP A;  1BNF A;  1YNV X;  1BSE A;  2C4B A;  1SAR A;  3AGN A;  1BNR A;  1B20 A;  2F56 A;  1A2P A;  1FZU A;  1ZGX A;  1GSP A;  1RSN A;  2KF6 A;  1B2X A;  2HOH A;  1JBS A;  1RGL A;  1B2M A;  1BSD A;  1BSA A;  3HOH A;  1RLS A;  1LRA A;  1BAO A;  1RTU A;  8RNT A;  2KAA A;  1B2U A; 
#chains in the Genus database with same CATH topology
 3NQY A;  1PU4 A;  2HMN B;  2CHC A;  4NRE A;  5M19 A;  1STD A;  2OWP A;  1FGM A;  1G96 A;  2CFW A;  1FW7 A;  1DE3 A;  2CFG A;  3UL6 A;  2BO9 B;  1RGG A;  1EEJ A;  3X42 A;  5EVH A;  1TRQ A;  2CW9 A;  2OTL 3;  3DGL A;  1ROV A;  3ALA A;  5AEU B;  1YGW A;  1DYU A;  1FGQ A;  1Q81 4;  1UCI A;  3EBY A;  3G71 3;  3B7C A;  1LNI A;  2STD A;  4XM4 A;  7RNT A;  1JN5 B;  4N6N B;  3NQZ A;  3VF1 A;  6GSP A;  1E97 A;  3FF0 A;  3NV0 A;  4J5G A;  4QWT A;  3K0Z A;  5HOH A;  2KF5 A;  1RNT A;  2OOV A;  1LVN A;  3D3L A;  1ULJ B;  5DRV A;  4EC6 A;  3GZR A;  1MOL A;  3V92 A;  4KFD A;  1BRS A;  1I8V A;  1QAF A;  2QIY A;  5CLK A;  1GD4 A;  1YVS A;  1ZX2 A;  2CFD A;  1D6Z A;  4HAA A;  2ZA4 A;  1JZD A;  1Q86 4;  4AEQ A;  1QJG A;  2KF4 A;  3LZA A;  1M1K 4;  1IVV A;  2IUK A;  1HKX A;  1NDO B;  2K3D A;  2WOF A;  3FKA A;  1VQQ A;  3K5T A;  4K90 B;  4R80 A;  5FGO A;  4BU4 A;  4O3V A;  5JPP A;  1W5Z A;  1IQY A;  2ZDJ A;  1BRJ A;  1W6C A;  1RN1 A;  3HI7 A;  4LYL B;  4NPB A;  2YFJ B;  4GHO A;  3S29 A;  4BTW A;  1EQK A;  3DGN A;  3FH1 A;  1BRN L;  2Z76 A;  3AHS A;  3CC2 3;  5IG5 A;  1SQW A;  4JRF A;  1QMA A;  3O8Y A;  1VQ8 3;  4J8T A;  1M9G A;  1MGR A;  1I2F A;  2AAE A;  4XBT A;  3CCV 3;  1T2I A;  3WHO A;  3JUP A;  2PNC A;  2B1X B;  3SVA A;  3VSY A;  1I0X A;  3EB8 A;  1BSB A;  1RNB A;  1V74 A;  1CQS A;  3CCS 3;  3T0U A;  1C7H A;  3WA3 A;  1E3R A;  2KCD A;  4HYZ A;  3ECF A;  2P09 A;  3WOD G;  2JDI H;  1FUS A;  4U13 A;  4Q53 A;  3KZT A;  1VQ5 3;  1ZO2 A;  1OGX A;  2O9U X;  1SII A;  1RKY A;  3I56 3;  1W01 A;  3N54 B;  3WMD A;  5BVB A;  1EG9 B;  3AGO A;  3NV0 B;  5IEP A;  3FG4 A;  1IK3 A;  1RGC A;  2XFS A;  1ROA A;  1VQ6 3;  2V1L A;  1GOU A;  2CH9 A;  5FW5 A;  1DMM A;  1G0T A;  3X3X A;  1LQG C;  3F7X A;  2RSX A;  4HBR A;  4LSO A;  5IER A;  4HM8 B;  2F5M A;  1RRH A;  2CFL A;  5BIR A;  3UB1 A;  1LOV A;  1MNL A;  3MHE A;  3WA2 X;  1BRH A;  5I97 A;  2RGQ A;  1TUH A;  1V57 A;  3EF8 A;  2OCT A;  2CWT A;  3HII A;  4N6T A;  3CPO A;  5M18 A;  4RNT A;  1BNE A;  2CX0 A;  3I55 3;  1AV4 A;  1DET A;  3T8N A;  1N8R 4;  1M90 4;  1YJ9 3;  4R1K A;  2IY2 A;  3DZL A;  1OHS A;  2BHM A;  2CIU A;  3A5E A;  3JUO A;  1YNV X;  4K61 A;  1BSE A;  2E2T A;  4HKV B;  3MSO A;  4CJN A;  3AGN A;  1YJN 3;  2GU3 A;  5IG4 A;  1EA2 A;  2GU1 A;  1B20 A;  5KP3 A;  1UUW B;  1GY7 A;  1GS3 A;  3DUK A;  1A2V A;  3WDG B;  3GZY B;  3BB9 A;  3KII A;  4FMD A;  1BSD A;  1BSA A;  2Z6B A;  4L8O A;  1QAK A;  3BNC A;  1LQM B;  5JPU A;  1KSI A;  1BAO A;  1AVK A;  2HML B;  2JQ5 A;  4J9A A;  1IQX A;  2CWU A;  5EQL A;  3HIG A;  2D42 A;  4O8S A;  1FUT A;  2OQE C;  1IVU A;  2R4I A;  3PCR A;  1UUV B;  1W6Y A;  2XRX B;  4MMY B;  4XB5 A;  1A67 A;  1BAN A;  3WOF B;  2CX1 A;  1Q7Y 4;  1IVW A;  3K7C A;  3DMC A;  3WR2 A;  1UI8 A;  4L7K A;  4R4K A;  2C11 A;  2J8X B;  2XH9 A;  1FGT A;  1NB3 I;  2BU4 A;  1UGI A;  2GBX B;  3U97 A;  5LC7 A;  1YJW 3;  1W7C A;  1QVF 2;  4FR9 A;  1HZ1 A;  3OXA A;  2FNQ A;  1UCJ A;  4STD A;  1BNG A;  1GD3 A;  4AKZ A;  1PFP A;  1VQM 3;  3MKI A;  5IEO A;  1O7P B;  2F4Y A;  3PGB A;  1NO3 A;  1UCL A;  3SED A;  4HM2 B;  1DMN A;  2W9P A;  4H3U A;  3KSP A;  3S5C A;  3K9M C;  2XEP A;  4MEI A;  1TFK A;  2ZL8 A;  3G16 A;  1B21 A;  3FSD A;  3BLZ A;  2RNT A;  3SYU A;  1IDP A;  1OHP A;  1RDS A;  3OWY A;  1S5A A;  1X1U A;  1SPU A;  3G6E 3;  3CCQ 3;  1CYU A;  2XFT A;  5CF1 A;  1IYY A;  3S28 A;  1IVX A;  5D81 A;  1BOX A;  3CCM 3;  1W00 A;  5DRE A;  3F8H A;  5IF6 A;  2HMJ B;  2P38 A;  2RBI A;  4BTX A;  4CCV A;  4N6U A;  1Z1S A;  1RGK A;  4ORL A;  1PY3 A;  4RNY A;  3LTA A;  3OWU A;  1JKG A;  2W03 A;  1QVG 2;  3DH2 A;  1W2B 2;  1OCV A;  5BU4 A;  1BNS A;  1BNI A;  1IV9 A;  1DMQ A;  5KP1 A;  1TIJ A;  1A2K A;  2CG1 A;  3GSP A;  5G2G A;  4FMC A;  3F8X A;  2Q07 A;  1GY6 A;  1O7W B;  3PCS A;  1MWU A;  2O3O A;  1HU9 A;  2QA4 3;  2UGI A;  4TX4 A;  5JBS A;  3CCL 3;  4NHF A;  2F98 A;  1BRG A;  3DXO A;  4WYK A;  2BMO B;  1FUW A;  2XR8 B;  1FYS A;  3OV4 A;  2K0M A;  3FLJ A;  3PZW A;  1UDI I;  3MG2 A;  2GSP A;  1S72 3;  1BUQ A;  2I9W A;  3JUM A;  4WHA A;  2Z77 A;  3I0Y A;  4JF8 A;  1B3S A;  1BGS A;  1LOW A;  2P05 A;  3FGY A;  1AR0 A;  2KRT A;  3NBJ A;  3NM7 A;  3X3Y A;  3T8U A;  2L1S A;  5LC6 A;  2MC8 A;  1W02 A;  2H0H A;  1KWI A;  1X1Y A;  2KXG A;  1RN4 A;  1RMS A;  5CXO A;  2BMQ B;  3BND A;  4I4K A;  1AY7 A;  1IU7 A;  2AAD A;  4HM6 B;  4EXR A;  1VQ4 3;  1TRP A;  2Y73 A;  3CCU 3;  3DGY A;  1OF5 A;  4AKY A;  1EUI C;  1K8A 4;  3MG1 A;  5AIF A;  1RHL A;  3H51 A;  1JRQ A;  5HGR A;  1BNF A;  1L5G B;  3G4S 3;  1JB4 A;  4N6O B;  3X3Z A;  2C4B A;  1IT7 A;  1UGH I;  7STD A;  1JB5 A;  1NB5 I;  2E2V A;  3QRD A;  4LEH A;  3AMO A;  4XDV A;  3OW2 2;  2CFK A;  1A2P A;  1O7G B;  1FZU A;  2C10 A;  1N5H A;  2ML5 A;  1TP6 A;  3ER7 A;  3G0K A;  3M8C A;  3KKG A;  5IG0 A;  1B2M A;  1RGL A;  2LYX A;  4WFO A;  1D6U A;  3HOH A;  5D82 A;  1VQK 3;  1RLS A;  3SLU A;  5TGN A;  4LMI A;  4G1M B;  6STD A;  5IG3 A;  1O7H B;  8RNT A;  1KC8 4;  1B2U A;  1OGZ A;  4KVH A;  3NM2 A;  3X40 A;  2CWV A;  2W2C A;  3AMO B;  3LYG A;  2CG0 A;  4GL6 A;  2W04 A;  1I70 A;  2B24 B;  5AII A;  2OOV C;  3D79 A;  3PYJ A;  4IPB A;  3CCR 3;  2BT3 A;  5M1A A;  1WNH A;  3GRD A;  3GZX B;  3ZG0 A;  5IEN A;  3BNE A;  3LTD A;  4LGQ A;  1TJD A;  1UI7 A;  3UL5 A;  3MWZ A;  1I3I A;  4LZI A;  1JJ2 2;  1BVI A;  1LOY A;  1WMP A;  1JKG B;  4MMX B;  4HM1 B;  4HZ9 B;  4HM7 B;  1MWR A;  2XF3 A;  3JVC A;  1US1 A;  3H3H A;  3IJE B;  4X2O A;  1JBR A;  3CCJ 3;  1AQZ A;  4EBG A;  3EX9 A;  1JN5 A;  1QAL A;  4MJD A;  3ROB A;  2GEX A;  3KE7 A;  2M7O A;  4EYC A;  1I2E A;  1UCK A;  2E2U A;  3A76 A;  3OX9 A;  4EV2 A;  1YVB I;  3CNM A;  4WYK B;  5AYR B;  7GSP A;  1OUN A;  4RNZ A;  3CU3 A;  2K54 A;  3DY5 A;  2CK3 H;  1OH0 A;  4GB5 A;  4KT3 B;  5EEO A;  3STD A;  1Q42 A;  1TFO A;  3MG3 A;  1YIT 3;  2F5W A;  3B8L A;  1YGE A;  3LH4 A;  3CCE 3;  2A15 A;  1EKM A;  1BRI A;  1X1W A;  2SBL A;  1OF5 B;  2QEX 3;  1Q82 4;  1RCL A;  1O7N B;  1SJW A;  4FCJ A;  5ELU A;  4HOH A;  2WGO A;  4HM0 B;  3IMA B;  4ZM8 A;  3NHX A;  3SX1 A;  2UX0 A;  3EJV A;  1RGF A;  2QGU A;  4N3V A;  4N6M A;  1R4C A;  2GXF A;  4WP5 A;  1PYL A;  3HZP A;  1GYB A;  1N8Q A;  3F9S A;  2RFR A;  1T3B A;  1I2G A;  3FG1 A;  1RRL A;  2SAR A;  4H61 A;  2HMO B;  1Q40 B;  1K41 A;  2CKF B;  4O2H A;  1VQN 3;  1TTO A;  2YX9 A;  1K9M 4;  4KFE A;  4HZB B;  4IT7 A;  1JB2 A;  2PZV A;  1GMR A;  3BIR A;  3N9H A;  1DVC A;  4IIA A;  1CEW I;  1J2B A;  4CDL A;  1OPY A;  1NJI 4;  2FGT A;  1N9E A;  3D5I A;  3TDG A;  5AEW B;  3V98 A;  1NWW A;  2XGL A;  3S27 A;  4J5K A;  2W6J H;  3CD6 3;  1BSC A;  4KFF A;  1B2Z A;  2GEY A;  2ZHX B;  1RGE A;  3Q3F A;  4FCM A;  4RZM A;  4R9L A;  1STF I;  4OUQ A;  1OHO A;  3Q1C A;  3RGR A;  3EHC A;  5BXQ A;  2WGQ A;  4EW5 A;  3CME 3;  3DGO A;  1B2S A;  4FMB A;  4MMZ B;  4XBX A;  5CK6 A;  4GSP A;  3NBR A;  1I0V A;  3CNX A;  4OK0 A;  2OQE A;  2IYJ A;  1C54 A;  1BRK A;  3S67 A;  1RN7 A;  1X1X A;  4K1U A;  4K1V A;  1WMO A;  1VQ7 3;  2H0I A;  2L4V A;  3QK9 A;  1Y4K A;  3LML A;  1CYV A;  1GSP A;  1RSN A;  3N8B A;  2IUJ A;  3UNL A;  3V99 A;  1E3V A;  1JBS A;  3MPH A;  1TU5 A;  2BMR B;  3EBT A;  3KFQ C;  2W9Q A;  4ILF A;  3X41 A;  1GY5 A;  2W56 A;  3L0R A;  5AYS C;  3RGA A;  4BTY A;  1KD1 4;  4R9K A;  4N6V 0;  4BL2 A;  1RTU A;  3VGN A;  3NBB A;  1YHQ 3;  3NX0 A;  1U8C B;  1VQP 3;  4L8P A;  1JNQ A;  1N5P A;  3FZW A;  2ML6 A;  1NU3 A;  1LNH A;  3JUQ A;  9RNT A;  3HK4 A;  3LT8 A;  3SOY A;  5IW9 A;  1BUJ A;  2H0G A;  1Q7H A;  2WO0 A;  4EV5 A;  1RJO A;  3B4O A;  2F86 B;  3K63 A;  1BNJ A;  2RCD A;  1W4N A;  3EN8 A;  4BIR A;  1G02 A;  5CF2 A;  3GZB A;  4HM5 B;  1NNV A;  2HMM B;  1RCK A;  3FG3 A;  3WOE B;  1F8N A;  4X2H A;  1UUG B;  1MWT A;  1UW1 A;  3FCS B;  3U1W A;  1VQO 3;  1M1X B;  3KSE D;  1BU4 A;  3OWS A;  1FGR A;  2R41 A;  1OAC A;  3LTB A;  1N9J A;  3AHW A;  5KP4 A;  3CPW 2;  1KQS 2;  3PXM A;  3DM8 A;  1T5Y A;  2IA7 A;  5A0O B;  3IPT A;  3LXU X;  1CH0 A;  1VQL 3;  3KCH A;  3HX8 A;  2CC3 A;  3Q2P A;  3CMA 3;  5ELJ A;  2UUG C;  3D4A A;  2XSO B;  3Q90 A;  1BIR A;  3EQQ B;  1WMN A;  3RNT A;  2W0Q A;  1VZZ A;  3SOA A;  2XGN A;  1I3F A;  3F14 A;  1WTH A;  4FCZ A;  4WWU C;  1MGW A;  3JUN A;  1ASK A;  6RNT A;  2W56 B;  1SIH A;  1RGH A;  1T2H A;  3G8Z A;  3F40 A;  1IQ8 A;  4HM4 B;  3CC7 3;  1A90 A;  1DVD A;  5G1L A;  4N6L A;  3UJM A;  2BNG A;  1W2Z A;  3NUV A;  1LOX A;  3PS8 A;  4HJL B;  1WQL B;  3ZG5 A;  4BL3 A;  3FF2 A;  2MF7 A;  3EN1 B;  1VQ9 3;  3D5G A;  3LTC A;  1FA3 A;  1IT8 A;  2D1W A;  3SXX A;  2IMJ A;  2OTJ 3;  3URP A;  5G1K A;  3NXJ A;  4OVM A;  4HM3 B;  2P0M A;  3BNB A;  1W6G A;  1ULI B;  3LT9 A;  1GOY A;  5AIH A;  1K73 4;  2HMK B;  4FMA A;  2Z7A A;  3BU4 A;  1K28 A;  3CC4 3;  5STD A;  1U5O A;  1R4Y A;  1YIJ 3;  1ZS7 A;  2LQV A;  1GOV A;  5D83 A;  1V58 A;  3DGM A;  3EE1 A;  8CHO A;  5RNT A;  1O7M B;  1B27 A;  1JBT A;  1D6Y A;  1RGA A;  3ZFZ A;  2BIR A;  1FGO A;  1HYF A;  2WOH A;  2FXT A;  1GMQ A;  2XSH B;  3GWR A;  3LOY A;  2Y74 A;  4KZ1 A;  5GSP A;  2KF3 A;  4XDW A;  3RDE A;  3J7Y d;  1JV2 B;  2P0X A;  3MYT A;  1GMP A;  1Q40 A;  4HVN A;  4RBN A;  4I5Q A;  4XBY A;  4DKI A;  3E99 A;  2INX A;  1SAR A;  1ISK A;  1IV7 A;  3EC9 A;  1BNR A;  3F7S A;  2F99 A;  2YFL B;  5AIG A;  1MWS A;  2F56 A;  3GAX A;  4CPK A;  1ZGX A;  3D9R A;  5AI1 A;  1AVL A;  2YFI B;  3B4P A;  2KF6 A;  1B2X A;  2HOH A;  1JZO A;  3CXC 2;  1YI2 3;  1LXE A;  4O02 B;  4PEJ A;  1LRA A;  3KN4 A;  2KAA A;  2GBW B;  1Q9E A; 
#chains in the Genus database with same CATH homology
 1FUT A;  1FW7 A;  1DE3 A;  1BUJ A;  1I70 A;  9RNT A;  1BAN A;  1RGG A;  1TRQ A;  3WR2 A;  1BNJ A;  1YGW A;  2BU4 A;  1UCI A;  1LNI A;  4BIR A;  7RNT A;  1G02 A;  1I3I A;  1HZ1 A;  1BVI A;  6GSP A;  1RCK A;  1UCJ A;  4J5G A;  1LOY A;  5HOH A;  2KF5 A;  1RNT A;  1BNG A;  2F4Y A;  1BRS A;  1I8V A;  1BU4 A;  1UCL A;  1YVS A;  1JBR A;  1AQZ A;  2ZA4 A;  4HAA A;  3AHW A;  2KF4 A;  1B21 A;  1I2E A;  1UCK A;  2RNT A;  3SYU A;  4BU4 A;  1RDS A;  1CH0 A;  1X1U A;  1BRJ A;  3KCH A;  1RN1 A;  7GSP A;  1IYY A;  4GHO A;  1BOX A;  1BRN L;  3D4A A;  3AHS A;  1BIR A;  2RBI A;  3RNT A;  2F5W A;  1I3F A;  1RGK A;  1PY3 A;  1MGR A;  1I2F A;  2AAE A;  1BRI A;  1T2I A;  1X1W A;  3WHO A;  1MGW A;  3DH2 A;  6RNT A;  5BU4 A;  1BNS A;  1RCL A;  1BNI A;  1RGH A;  1I0X A;  1T2H A;  1BSB A;  1RNB A;  3GSP A;  4HOH A;  1Q9E A;  1RGF A;  1PYL A;  1FUS A;  1I2G A;  2SAR A;  1BRG A;  3AGO A;  3D5G A;  1FYS A;  1RGC A;  1TTO A;  1GOU A;  2GSP A;  3BIR A;  1GMR A;  3URP A;  1B3S A;  1BGS A;  1LOW A;  2F5M A;  5BIR A;  3D5I A;  1GOY A;  1LOV A;  1BRH A;  4J5K A;  3BU4 A;  1X1Y A;  1BSC A;  1RN4 A;  1RMS A;  1B2Z A;  1R4Y A;  1RGE A;  3Q3F A;  1GOV A;  1AY7 A;  1BNE A;  2AAD A;  4RNT A;  5RNT A;  1B27 A;  1JBT A;  1RGA A;  1DET A;  1TRP A;  1B2S A;  2BIR A;  1HYF A;  4GSP A;  1GMQ A;  1I0V A;  3DGY A;  5GSP A;  2KF3 A;  1C54 A;  1RHL A;  1BRK A;  3A5E A;  1X1X A;  1GMP A;  1BNF A;  1YNV X;  1BSE A;  2C4B A;  1SAR A;  3AGN A;  1BNR A;  1B20 A;  2F56 A;  1A2P A;  1FZU A;  1ZGX A;  1GSP A;  1RSN A;  2KF6 A;  1B2X A;  2HOH A;  1JBS A;  1RGL A;  1B2M A;  1BSD A;  1BSA A;  3HOH A;  1RLS A;  1LRA A;  1BAO A;  1RTU A;  8RNT A;  2KAA A;  1B2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...