1BSDA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
b'INTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLVYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 33
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bsdA00
1BNJA 1FZUA 1MGRA 2HOHA 3KCHA 8RNTA 1RMSA 1JBRA 2C4BA 1GOVA 1G02A 3BIRA 1TTOA 3GSPA 4RNTA 1B27A 1RN4A 3AHSA 1I3IA 3AGNA 1BRJA 1GSPA 2AADA 2RNTA 2KF3A 1BRGA 1BNGA 1JBSA 2BU4A 1RN1A 1RNTA 1R4YA 3D4AA 1BIRA 1BNEA 1B2XA 1I2GA 1JBTA 1Q9EA 1A2PA 1UCLA 1MGWA 1FYSA 3AGOA 3WHOA 1RNBA 1I70A 1I0VA 1RGEA 3DGYA 1B21A 1BNRA 1GMRA 1BOXA 1RCLA 1BRHA 1X1XA 1BRKA 1RGKA 1X1YA 1BUJA 4GHOA 2ZA4A 6RNTA 1RLSA 1BSBA 1B2MA 1BRSA 1RSNA 4J5GA 5BIRA 1BNFA 2RBIA 1RHLA 1SARA 1B3SA 1UCJA 1RGAA 1DE3A 1CH0A 1UCIA 3D5IA 1AY7A 1I3FA 2GSPA 1C54A 3URPA 1YVSA 5BU4A 6GSPA 1ZGXA 3Q3FA 1BSAA 1HYFA 3WR2A 2AAEA 2F5MA 4BIRA 1BRIA 4GSPA 1BSEA 2KF5A 3DH2A 1RGCA 1T2IA 1T2HA 5RNTA 3HOHA 3AHWA 1X1WA 1LOYA 1RGLA 2BIRA 1LRAA 1BNIA 7GSPA 1RTUA 1BVIA 1YNVX 1BAOA 1B2ZA 1PYLA 2SARA 1RDSA 1TRQA 3RNTA 1BU4A 2F56A 4HAAA 7RNTA 1UCKA 2KAAA 1GOUA 1X1UA 1YGWA 1LOVA 1I2FA 1HZ1A 1BNSA 1RGGA 9RNTA 2F4YA 3A5EA 1GMQA 1FUSA 2KF6A 2KF4A 1BANA 3D5GA 1BSDA 1AQZA 1FW7A 1RGFA 1B2SA 1FUTA 4BU4A 1IYYA 4HOHA 1DETA 3BU4A 1GOYA 1BGSA 5HOHA 2F5WA 1I8VA 1I0XA 1TRPA 1PY3A 1RCKA 1BRNL 1B2UA 1LNIA 3SYUA 1RGHA 4J5KA 1BSCA 1LOWA 1B20A 1GMPA 5GSPA 1I2EA
chains in the Genus database with same CATH superfamily
1BNJA 1FZUA 3DUKA 2W0QA 1FGRA 2HOHA 1QAKA 3UJMA 1O7GB 2C4BA 3EX9A 4WYKB 4FMAA 3X3XA 4RNTA 1B27A 1VQP3 3B7CA 3K63A 2WOHA 1EEJA 1UW1A 1I3IA 1KSIA 1AVLA 4HM1B 3AGNA 3KZTA 4XBTA 5AIIA 2WOFA 3V98A 2KF3A 2GU1A 2WGOA 3DM8A 3EN8A 4AKYA 2BU4A 2C11A 4FCZA 4CDLA 1R4YA 4KZ1A 2INXA 1CYUA 5A0OB 2BO9B 2BMRB 1B2XA 4AKZA 2RCDA 3K0ZA 4EW5A 1GY6A 1Q9EA 3MKIA 5IF6A 1VQM3 1UCLA 3D79A 3NHXA 1IVXA 4G1MB 1MGWA 4I4KA 3WHOA 4Q53A 1RGEA 3DGYA 1B21A 6STDA 1U5OA 3DXOA 3K5TA 3QK9A 1KD14 1JKGB 1NNVA 2XF3A 1RCLA 3CPOA 3CME3 3NV0A 3E99A 4RNYA 1BRKA 2IMJA 1SJWA 3GZXB 1VQ63 4GHOA 2BMQB 2OQEC 5KP4A 1W01A 1EG9B 2QEX3 3CC23 4MMYB 5AYRB 5I97A 1O7NB 2D42A 4HKVB 4HM7B 2RBIA 1TIJA 1RHLA 3PS8A 1DVCA 2OQEA 1LXEA 3S67A 1G0TA 3B4PA 3D5IA 3EJVA 3MPHA 3LH4A 1C54A 2H0GA 4BTYA 1UI7A 2L1SA 1YVSA 2MF7A 5BU4A 5M19A 4GL6A 1VQ73 1ZS7A 1ZGXA 3SXXA 2BHMA 4OK0A 3Q1CA 3Q3FA 3CCJ3 3WR2A 1ASKA 2F5MA 1BRIA 3HIIA 5EVHA 3X42A 3CCE3 1VQ93 1DVDA 3DH2A 4X2HA 4EC6A 2QGUA 3DGNA 5DREA 1T2IA 1JRQA 2CC3A 4L7KA 5JBSA 4N3VA 2Y74A 1ZX2A 2BIRA 4FMBA 1D6UA 3PXMA 1A2VA 1ROAA 3JUQA 1YNVX 2HMNB 1PYLA 3LTCA 2GBXB 1WMNA 2YFLB 3RNTA 3T8UA 3GZBA 1N8R4 2F56A 1FGMA 2OOVA 7RNTA 4N6V0 1UCKA 2KAAA 3K7CA 1N8QA 2CWVA 4IPBA 1GOUA 1N9JA 3KSED 1FGOA 1W6GA 3CXC2 2LYXA 3GRDA 1E3RA 2E2TA 1I2FA 1LOVA 2CFGA 5G1LA 2R41A 4BL3A 1YHQ3 9RNTA 1UUWB 2J8XB 3MG2A 2KF4A 5IW9A 3NXJA 3KIIA 2BNGA 1O7HB 3FH1A 3F7SA 1AQZA 1HU9A 2QA43 1B2SA 3FG3A 3IMAB 4HZBB 4KVHA 4R9LA 2XGNA 3G16A 3LOYA 2O3OA 3UB1A 3JUPA 3WOFB 3WA2X 1DETA 3LMLA 1K9M4 4K1UA 1GS3A 1BGSA 1W7CA 1YIJ3 1I0XA 3DMCA 2Q07A 1W00A 1IVVA 1STDA 1IQYA 2C10A 7STDA 4RBNA 3FF0A 1CYVA 3S27A 5CLKA 1O7WB 1ROVA 2JQ5A 3S5CA 3IPTA 1MGRA 3IJEB 3WOEB 3OW22 1VQ83 3KCHA 1MWUA 1RMSA 4N6LA 8RNTA 2K0MA 1JBRA 2OTJ3 2GEXA 4R1KA 4R9KA 2XEPA 1GOVA 3EE1A 4NREA 1Q42A 2IUKA 1OH0A 1TFKA 1N9EA 1OF5B 4K1VA 4OVMA 1F8NA 5CXOA 4CJNA 1JBSA 1FUWA 1SIHA 3AMOB 1ZO2A 4WFOA 3J7Yd 1EUIC 4OUQA 3PCSA 3H51A 1VQ53 1QJGA 3D4AA 3CC43 3JUNA 5IG3A 2CIUA 1IVWA 2JDIH 2WO0A 3I0YA 2IA7A 1JBTA 4HYZA 2CH9A 2Z7AA 3RDEA 2IYJA 2CFWA 2CWTA 4JF8A 2STDA 3KKGA 3O8YA 4IIAA 1VQQA 3DGMA 1VQN3 1BOXA 3UL6A 4AEQA 2CK3H 3MYTA 1WNHA 1BUJA 3FZWA 1Q7Y4 1RLSA 3PYJA 1OGXA 1IQ8A 1B2MA 3ZG0A 2CG1A 1UDII 5BIRA 2YX9A 3RGRA 1BNFA 3GZRA 2XR8B 1DMQA 4WYKA 1DE3A 4LSOA 3B8LA 3CCV3 2ML5A 3G8ZA 4RZMA 1I3FA 2GSPA 2GU3A 3B4OA 3VGNA 3MWZA 5EQLA 2CHCA 3BNCA 3JUOA 3URPA 7GSPA 1FA3A 2CFLA 4WWUC 3FG4A 3VSYA 6GSPA 3LYGA 1LQMB 5BVBA 1PFPA 5AI1A 1QMAA 4GSPA 1GD4A 3SVAA 1W6CA 3CPW2 1O7MB 1YVBI 3PGBA 4XM4A 5LC7A 3OXAA 1HKXA 3WMDA 5RNTA 2CX0A 2IY2A 3HZPA 1FW7A 3SX1A 2CFDA 1LOYA 1OHPA 1LRAA 1BNIA 4R80A 5DRVA 1W2ZA 4I5QA 4HM5B 2RSXA 1BVIA 4H3UA 4DKIA 1RRLA 3N8BA 1BAOA 1UGHI 1B2ZA 3U97A 1JKGA 1KC84 1RDSA 3FF2A 3MHEA 3G4S3 1K28A 3DGOA 1CQSA 3OX9A 4ILFA 2P05A 3EQQB 2E2UA 2UX0A 4BTXA 2M7OA 2WGQA 3LT9A 2F98A 3ER7A 1M9GA 1JN5B 5D83A 1BNSA 1MWTA 2O9UX 2E2VA 1FUSA 4IT7A 1TP6A 4HM0B 2GXFA 3LTDA 4MMZB 4XB5A 2Z76A 1YJN3 1QVF2 4WHAA 2FXTA 5D81A 5IEOA 3S29A 4LZIA 4BU4A 1Q40B 3CCQ3 2HMOB 2K3DA 1GOYA 2L4VA 1WMOA 3CCR3 1Q824 3PZWA 1TRPA 3DGLA 3HI7A 2XSHB 1B2UA 1GYBA 3LT8A 3SYUA 3GZYB 1W4NA 3HX8A 5GSPA 1V74A 1FGQA 4FCJA 1DYUA 4U13A 5IERA 2V1LA 1RKYA 1OHSA 3BNEA 1LOXA 1G02A 1K8A4 5FGOA 3BIRA 1NJI4 2YFIB 3EC9A 3WA3A 2LQVA 4JRFA 3N9HA 1UI8A 4EXRA 3AHSA 4FMDA 1BRJA 1GSPA 2GBWB 3G6E3 1T5YA 3WDGB 3BNDA 5IG0A 1RNTA 1UGIA 4LYLB 1BIRA 2W2CA 3NBBA 3ROBA 1US1A 3CU3A 3EBTA 3NM2A 3OV4A 4N6NB 1SIIA 3S28A 1LQGC 1CEWI 3EB8A 3SLUA 1A2PA 2ML6A 1YGEA 1FYSA 2UUGC 3AGOA 3T8NA 1DMMA 1RNBA 1I70A 1YJ93 1AVKA 1EKMA 1I0VA 2CWUA 3JUMA 2CKFB 1BNRA 3I563 1GMRA 2Y73A 3UL5A 1SPUA 3FCSB 1MWRA 3PCRA 4EV2A 3X41A 1BRHA 5AIHA 1JV2B 1RGKA 2XSOB 4NPBA 2W56B 2ZA4A 1EA2A 1JZOA 5KP3A 1BRSA 3DY5A 3HIGA 1VQ43 1RSNA 4J5GA 2HMLB 1SARA 1D6ZA 4EV5A 3EBYA 3UNLA 1CH0A 1OACA 2H0HA 2W56A 1E3VA 4LEHA 1AY7A 1QALA 4XBXA 5CF1A 2ZL8A 3MSOA 1J2BA 2P09A 4MMXB 1OF5A 4LGQA 5JPPA 1OUNA 2Z6BA 5AEUB 3AMOA 5IG4A 5KP1A 1Q864 1BSAA 2PNCA 4BIRA 2AAEA 2K54A 5TGNA 3CCM3 3LTBA 2W6JH 4NHFA 3BNBA 1BSEA 2KF5A 1RGCA 4ZM8A 3Q90A 1UUVB 1IVUA 2IUJA 1RN7A 1NB5I 2W03A 3F8HA 1V57A 3MG3A 1RGLA 4KT3B 1LNHA 1QVG2 2CX1A 2R4IA 2FGTA 2XFTA 2KCDA 2SARA 1Y4KA 1K734 1JZDA 1TRQA 5ELJA 4KFFA 4KFEA 1BU4A 4N6TA 3KSPA 3VF1A 4O8SA 2D1WA 4HAAA 3KE7A 3NBRA 5LC6A 1T3BA 1BUQA 3M8CA 3FG1A 1NB3I 2BT3A 4BTWA 5IENA 2RFRA 1YI23 1WTHA 1DMNA 4HM6B 2F4YA 4CCVA 1A2KA 1BANA 1NWWA 1NO3A 4LMIA 4KFDA 3CCL3 1M1K4 2Z77A 1SQWA 2B24B 3U1WA 3FKAA 1RGFA 3F8XA 1OCVA 3OWYA 1AV4A 3OWUA 1FUTA 3F9SA 4FMCA 2OWPA 4HVNA 4O02B 3KN4A 4HOHA 1IYYA 1Z1SA 2FNQA 4X2OA 1IK3A 8CHOA 2F5WA 4FR9A 1MNLA 3T0UA 1I8VA 1OGZA 2P38A 1OPYA 1C7HA 1PY3A 1RCKA 1BRNL 5M18A 5M1AA 3WODG 1N5PA 2ZDJA 4STDA 4L8OA 3LTAA 1R4CA 1JB4A 1WQLB 4J5KA 1JNQA 1JB5A 3F7XA 3NV0B 3F40A 3X3ZA 2H0IA 3STDA 4XDVA 1GMPA 4N6MA 4O3VA 1I2EA 4XDWA 1W5ZA 3EF8A 4ORLA 2RGQA 3D3LA 5ELUA 5D82A 2A15A 1Q7HA 1JJ22 3LXUX 1KQS2 1W2B2 2HMMB 4N6UA 3D9RA 3V92A 1TTOA 3GSPA 1RN4A 1LVNA 2YFJB 3NUVA 3ZFZA 1JN5A 4FCMA 3A76A 2AADA 2RNTA 4EYCA 1BRGA 1BNGA 3EN1B 4GB5A 1VQL3 1VQK3 1RN1A 1IU7A 4HM8B 4CPKA 1ISKA 4K61A 1S723 2XFSA 1BNEA 3TDGA 2OCTA 2XGLA 2KRTA 1I2GA 1MWSA 1Q40A 3X3YA 3GWRA 1U8CB 3NBJA 1VQO3 3CMA3 3CNXA 1ULIB 3DZLA 3FSDA 3GAXA 3FGYA 4HBRA 3CCS3 5STDA 1OHOA 1M904 1WMPA 1X1XA 5CF2A 1X1YA 2W04A 3SEDA 3HK4A 1GY5A 1TU5A 6RNTA 1BSBA 2SBLA 1GD3A 4N6OB 2OOVC 4R4KA 3CCU3 1A67A 1B3SA 1YJW3 1IV7A 1UCJA 1RGAA 2F99A 5EEOA 2XRXB 3FLJA 5AIFA 3CC73 1UCIA 4TX4A 3G713 3CNMA 1S5AA 2BMOB 2W9PA 3NM7A 4L8PA 3NX0A 5G2GA 1TUHA 1G96A 2W9QA 3LZAA 5IG5A 2ZHXB 3F14A 5AYSC 1W6YA 1HYFA 4K90B 2HMKB 3BLZA 3SOAA 4MJDA 4QWTA 2GEYA 5AEWB 1W02A 1L5GB 1TFOA 3SOYA 4HM3B 4PEJA 1T2HA 3HOHA 3G0KA 2P0XA 4HJLB 3AHWA 5BXQA 1X1WA 5FW5A 2HMJB 5AIGA 1IQXA 3BB9A 3L0RA 1RTUA 3RGAA 1FGTA 2CFKA 2PZVA 1STFI 1MOLA 1VZZA 2UGIA 3K9MC 4H61A 1TJDA 5JPUA 3OWSA 3Q2PA 5CK6A 1RRHA 4MEIA 2OTL3 3EHCA 5IEPA 1D6YA 1E97A 1X1UA 4HM4B 2CW9A 1ULJB 1YGWA 2QIYA 1V58A 4XBYA 1HZ1A 2B1XB 1KWIA 5HGRA 2F86B 1RGGA 1K41A 4RNZA 5G1KA 3A5EA 2CG0A 1GMQA 2KF6A 2KXGA 3ALAA 1JB2A 1O7PB 3NQZA 1YIT3 4O2HA 1QAFA 1M1XB 3D5GA 3H3HA 3ZG5A 2MC8A 1IDPA 1IT8A 1BSDA 4EBGA 1Q814 1IT7A 3CD63 4BL2A 3I553 3X40A 3ECFA 3BU4A 1NDOB 2XH9A 1N5HA 5HOHA 3JVCA 3V99A 3N54B 3MG1A 4J8TA 4HZ9B 3NQYA 4J9AA 1RJOA 4HM2B 1A90A 1GY7A 1LNIA 1EQKA 1PU4A 1RGHA 2P0MA 4WP5A 1IV9A 3QRDA 1UUGB 1AR0A 1BSCA 1LOWA 1B20A 2I9WA 1NU3A 3KFQC
chains in the Genus database with same CATH topology
1BNJA 1FZUA 1MGRA 2HOHA 3KCHA 8RNTA 1RMSA 1JBRA 2C4BA 1GOVA 1G02A 3BIRA 1TTOA 3GSPA 4RNTA 1B27A 1RN4A 3AHSA 1I3IA 3AGNA 1BRJA 1GSPA 2AADA 2RNTA 2KF3A 1BRGA 1BNGA 1JBSA 2BU4A 1RN1A 1RNTA 1R4YA 3D4AA 1BIRA 1BNEA 1B2XA 1I2GA 1JBTA 1Q9EA 1A2PA 1UCLA 1MGWA 1FYSA 3AGOA 3WHOA 1RNBA 1I70A 1I0VA 1RGEA 3DGYA 1B21A 1BNRA 1GMRA 1BOXA 1RCLA 1BRHA 1X1XA 1BRKA 1RGKA 1X1YA 1BUJA 4GHOA 2ZA4A 6RNTA 1RLSA 1BSBA 1B2MA 1BRSA 1RSNA 4J5GA 5BIRA 1BNFA 2RBIA 1RHLA 1SARA 1B3SA 1UCJA 1RGAA 1DE3A 1CH0A 1UCIA 3D5IA 1AY7A 1I3FA 2GSPA 1C54A 3URPA 1YVSA 5BU4A 6GSPA 1ZGXA 3Q3FA 1BSAA 1HYFA 3WR2A 2AAEA 2F5MA 4BIRA 1BRIA 4GSPA 1BSEA 2KF5A 3DH2A 1RGCA 1T2IA 1T2HA 5RNTA 3HOHA 3AHWA 1X1WA 1LOYA 1RGLA 2BIRA 1LRAA 1BNIA 7GSPA 1RTUA 1BVIA 1YNVX 1BAOA 1B2ZA 1PYLA 2SARA 1RDSA 1TRQA 3RNTA 1BU4A 2F56A 4HAAA 7RNTA 1UCKA 2KAAA 1GOUA 1X1UA 1YGWA 1LOVA 1I2FA 1HZ1A 1BNSA 1RGGA 9RNTA 2F4YA 3A5EA 1GMQA 1FUSA 2KF6A 2KF4A 1BANA 3D5GA 1BSDA 1AQZA 1FW7A 1RGFA 1B2SA 1FUTA 4BU4A 1IYYA 4HOHA 1DETA 3BU4A 1GOYA 1BGSA 5HOHA 2F5WA 1I8VA 1I0XA 1TRPA 1PY3A 1RCKA 1BRNL 1B2UA 1LNIA 3SYUA 1RGHA 4J5KA 1BSCA 1LOWA 1B20A 1GMPA 5GSPA 1I2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNJ A;  1FZU A;  1MGR A;  2HOH A;  3KCH A;  8RNT A;  1RMS A;  1JBR A;  2C4B A;  1GOV A;  1G02 A;  3BIR A;  1TTO A;  3GSP A;  4RNT A;  1B27 A;  1RN4 A;  3AHS A;  1I3I A;  3AGN A;  1BRJ A;  1GSP A;  2AAD A;  2RNT A;  2KF3 A;  1BRG A;  1BNG A;  1JBS A;  2BU4 A;  1RN1 A;  1RNT A;  1R4Y A;  3D4A A;  1BIR A;  1BNE A;  1B2X A;  1I2G A;  1JBT A;  1Q9E A;  1A2P A;  1UCL A;  1MGW A;  1FYS A;  3AGO A;  3WHO A;  1RNB A;  1I70 A;  1I0V A;  1RGE A;  3DGY A;  1B21 A;  1BNR A;  1GMR A;  1BOX A;  1RCL A;  1BRH A;  1X1X A;  1BRK A;  1RGK A;  1X1Y A;  1BUJ A;  4GHO A;  2ZA4 A;  6RNT A;  1RLS A;  1BSB A;  1B2M A;  1BRS A;  1RSN A;  4J5G A;  5BIR A;  1BNF A;  2RBI A;  1RHL A;  1SAR A;  1B3S A;  1UCJ A;  1RGA A;  1DE3 A;  1CH0 A;  1UCI A;  3D5I A;  1AY7 A;  1I3F A;  2GSP A;  1C54 A;  3URP A;  1YVS A;  5BU4 A;  6GSP A;  1ZGX A;  3Q3F A;  1BSA A;  1HYF A;  3WR2 A;  2AAE A;  2F5M A;  4BIR A;  1BRI A;  4GSP A;  1BSE A;  2KF5 A;  3DH2 A;  1RGC A;  1T2I A;  1T2H A;  5RNT A;  3HOH A;  3AHW A;  1X1W A;  1LOY A;  1RGL A;  2BIR A;  1LRA A;  1BNI A;  7GSP A;  1RTU A;  1BVI A;  1YNV X;  1BAO A;  1B2Z A;  1PYL A;  2SAR A;  1RDS A;  1TRQ A;  3RNT A;  1BU4 A;  2F56 A;  4HAA A;  7RNT A;  1UCK A;  2KAA A;  1GOU A;  1X1U A;  1YGW A;  1LOV A;  1I2F A;  1HZ1 A;  1BNS A;  1RGG A;  9RNT A;  2F4Y A;  3A5E A;  1GMQ A;  1FUS A;  2KF6 A;  2KF4 A;  1BAN A;  3D5G A;  1BSD A;  1AQZ A;  1FW7 A;  1RGF A;  1B2S A;  1FUT A;  4BU4 A;  1IYY A;  4HOH A;  1DET A;  3BU4 A;  1GOY A;  1BGS A;  5HOH A;  2F5W A;  1I8V A;  1I0X A;  1TRP A;  1PY3 A;  1RCK A;  1BRN L;  1B2U A;  1LNI A;  3SYU A;  1RGH A;  4J5K A;  1BSC A;  1LOW A;  1B20 A;  1GMP A;  5GSP A;  1I2E A; 
#chains in the Genus database with same CATH topology
 1BNJ A;  1FZU A;  3DUK A;  2W0Q A;  1FGR A;  2HOH A;  1QAK A;  3UJM A;  1O7G B;  2C4B A;  3EX9 A;  4WYK B;  4FMA A;  3X3X A;  4RNT A;  1B27 A;  1VQP 3;  3B7C A;  3K63 A;  2WOH A;  1EEJ A;  1UW1 A;  1I3I A;  1KSI A;  1AVL A;  4HM1 B;  3AGN A;  3KZT A;  4XBT A;  5AII A;  2WOF A;  3V98 A;  2KF3 A;  2GU1 A;  2WGO A;  3DM8 A;  3EN8 A;  4AKY A;  2BU4 A;  2C11 A;  4FCZ A;  4CDL A;  1R4Y A;  4KZ1 A;  2INX A;  1CYU A;  5A0O B;  2BO9 B;  2BMR B;  1B2X A;  4AKZ A;  2RCD A;  3K0Z A;  4EW5 A;  1GY6 A;  1Q9E A;  3MKI A;  5IF6 A;  1VQM 3;  1UCL A;  3D79 A;  3NHX A;  1IVX A;  4G1M B;  1MGW A;  4I4K A;  3WHO A;  4Q53 A;  1RGE A;  3DGY A;  1B21 A;  6STD A;  1U5O A;  3DXO A;  3K5T A;  3QK9 A;  1KD1 4;  1JKG B;  1NNV A;  2XF3 A;  1RCL A;  3CPO A;  3CME 3;  3NV0 A;  3E99 A;  4RNY A;  1BRK A;  2IMJ A;  1SJW A;  3GZX B;  1VQ6 3;  4GHO A;  2BMQ B;  2OQE C;  5KP4 A;  1W01 A;  1EG9 B;  2QEX 3;  3CC2 3;  4MMY B;  5AYR B;  5I97 A;  1O7N B;  2D42 A;  4HKV B;  4HM7 B;  2RBI A;  1TIJ A;  1RHL A;  3PS8 A;  1DVC A;  2OQE A;  1LXE A;  3S67 A;  1G0T A;  3B4P A;  3D5I A;  3EJV A;  3MPH A;  3LH4 A;  1C54 A;  2H0G A;  4BTY A;  1UI7 A;  2L1S A;  1YVS A;  2MF7 A;  5BU4 A;  5M19 A;  4GL6 A;  1VQ7 3;  1ZS7 A;  1ZGX A;  3SXX A;  2BHM A;  4OK0 A;  3Q1C A;  3Q3F A;  3CCJ 3;  3WR2 A;  1ASK A;  2F5M A;  1BRI A;  3HII A;  5EVH A;  3X42 A;  3CCE 3;  1VQ9 3;  1DVD A;  3DH2 A;  4X2H A;  4EC6 A;  2QGU A;  3DGN A;  5DRE A;  1T2I A;  1JRQ A;  2CC3 A;  4L7K A;  5JBS A;  4N3V A;  2Y74 A;  1ZX2 A;  2BIR A;  4FMB A;  1D6U A;  3PXM A;  1A2V A;  1ROA A;  3JUQ A;  1YNV X;  2HMN B;  1PYL A;  3LTC A;  2GBX B;  1WMN A;  2YFL B;  3RNT A;  3T8U A;  3GZB A;  1N8R 4;  2F56 A;  1FGM A;  2OOV A;  7RNT A;  4N6V 0;  1UCK A;  2KAA A;  3K7C A;  1N8Q A;  2CWV A;  4IPB A;  1GOU A;  1N9J A;  3KSE D;  1FGO A;  1W6G A;  3CXC 2;  2LYX A;  3GRD A;  1E3R A;  2E2T A;  1I2F A;  1LOV A;  2CFG A;  5G1L A;  2R41 A;  4BL3 A;  1YHQ 3;  9RNT A;  1UUW B;  2J8X B;  3MG2 A;  2KF4 A;  5IW9 A;  3NXJ A;  3KII A;  2BNG A;  1O7H B;  3FH1 A;  3F7S A;  1AQZ A;  1HU9 A;  2QA4 3;  1B2S A;  3FG3 A;  3IMA B;  4HZB B;  4KVH A;  4R9L A;  2XGN A;  3G16 A;  3LOY A;  2O3O A;  3UB1 A;  3JUP A;  3WOF B;  3WA2 X;  1DET A;  3LML A;  1K9M 4;  4K1U A;  1GS3 A;  1BGS A;  1W7C A;  1YIJ 3;  1I0X A;  3DMC A;  2Q07 A;  1W00 A;  1IVV A;  1STD A;  1IQY A;  2C10 A;  7STD A;  4RBN A;  3FF0 A;  1CYV A;  3S27 A;  5CLK A;  1O7W B;  1ROV A;  2JQ5 A;  3S5C A;  3IPT A;  1MGR A;  3IJE B;  3WOE B;  3OW2 2;  1VQ8 3;  3KCH A;  1MWU A;  1RMS A;  4N6L A;  8RNT A;  2K0M A;  1JBR A;  2OTJ 3;  2GEX A;  4R1K A;  4R9K A;  2XEP A;  1GOV A;  3EE1 A;  4NRE A;  1Q42 A;  2IUK A;  1OH0 A;  1TFK A;  1N9E A;  1OF5 B;  4K1V A;  4OVM A;  1F8N A;  5CXO A;  4CJN A;  1JBS A;  1FUW A;  1SIH A;  3AMO B;  1ZO2 A;  4WFO A;  3J7Y d;  1EUI C;  4OUQ A;  3PCS A;  3H51 A;  1VQ5 3;  1QJG A;  3D4A A;  3CC4 3;  3JUN A;  5IG3 A;  2CIU A;  1IVW A;  2JDI H;  2WO0 A;  3I0Y A;  2IA7 A;  1JBT A;  4HYZ A;  2CH9 A;  2Z7A A;  3RDE A;  2IYJ A;  2CFW A;  2CWT A;  4JF8 A;  2STD A;  3KKG A;  3O8Y A;  4IIA A;  1VQQ A;  3DGM A;  1VQN 3;  1BOX A;  3UL6 A;  4AEQ A;  2CK3 H;  3MYT A;  1WNH A;  1BUJ A;  3FZW A;  1Q7Y 4;  1RLS A;  3PYJ A;  1OGX A;  1IQ8 A;  1B2M A;  3ZG0 A;  2CG1 A;  1UDI I;  5BIR A;  2YX9 A;  3RGR A;  1BNF A;  3GZR A;  2XR8 B;  1DMQ A;  4WYK A;  1DE3 A;  4LSO A;  3B8L A;  3CCV 3;  2ML5 A;  3G8Z A;  4RZM A;  1I3F A;  2GSP A;  2GU3 A;  3B4O A;  3VGN A;  3MWZ A;  5EQL A;  2CHC A;  3BNC A;  3JUO A;  3URP A;  7GSP A;  1FA3 A;  2CFL A;  4WWU C;  3FG4 A;  3VSY A;  6GSP A;  3LYG A;  1LQM B;  5BVB A;  1PFP A;  5AI1 A;  1QMA A;  4GSP A;  1GD4 A;  3SVA A;  1W6C A;  3CPW 2;  1O7M B;  1YVB I;  3PGB A;  4XM4 A;  5LC7 A;  3OXA A;  1HKX A;  3WMD A;  5RNT A;  2CX0 A;  2IY2 A;  3HZP A;  1FW7 A;  3SX1 A;  2CFD A;  1LOY A;  1OHP A;  1LRA A;  1BNI A;  4R80 A;  5DRV A;  1W2Z A;  4I5Q A;  4HM5 B;  2RSX A;  1BVI A;  4H3U A;  4DKI A;  1RRL A;  3N8B A;  1BAO A;  1UGH I;  1B2Z A;  3U97 A;  1JKG A;  1KC8 4;  1RDS A;  3FF2 A;  3MHE A;  3G4S 3;  1K28 A;  3DGO A;  1CQS A;  3OX9 A;  4ILF A;  2P05 A;  3EQQ B;  2E2U A;  2UX0 A;  4BTX A;  2M7O A;  2WGQ A;  3LT9 A;  2F98 A;  3ER7 A;  1M9G A;  1JN5 B;  5D83 A;  1BNS A;  1MWT A;  2O9U X;  2E2V A;  1FUS A;  4IT7 A;  1TP6 A;  4HM0 B;  2GXF A;  3LTD A;  4MMZ B;  4XB5 A;  2Z76 A;  1YJN 3;  1QVF 2;  4WHA A;  2FXT A;  5D81 A;  5IEO A;  3S29 A;  4LZI A;  4BU4 A;  1Q40 B;  3CCQ 3;  2HMO B;  2K3D A;  1GOY A;  2L4V A;  1WMO A;  3CCR 3;  1Q82 4;  3PZW A;  1TRP A;  3DGL A;  3HI7 A;  2XSH B;  1B2U A;  1GYB A;  3LT8 A;  3SYU A;  3GZY B;  1W4N A;  3HX8 A;  5GSP A;  1V74 A;  1FGQ A;  4FCJ A;  1DYU A;  4U13 A;  5IER A;  2V1L A;  1RKY A;  1OHS A;  3BNE A;  1LOX A;  1G02 A;  1K8A 4;  5FGO A;  3BIR A;  1NJI 4;  2YFI B;  3EC9 A;  3WA3 A;  2LQV A;  4JRF A;  3N9H A;  1UI8 A;  4EXR A;  3AHS A;  4FMD A;  1BRJ A;  1GSP A;  2GBW B;  3G6E 3;  1T5Y A;  3WDG B;  3BND A;  5IG0 A;  1RNT A;  1UGI A;  4LYL B;  1BIR A;  2W2C A;  3NBB A;  3ROB A;  1US1 A;  3CU3 A;  3EBT A;  3NM2 A;  3OV4 A;  4N6N B;  1SII A;  3S28 A;  1LQG C;  1CEW I;  3EB8 A;  3SLU A;  1A2P A;  2ML6 A;  1YGE A;  1FYS A;  2UUG C;  3AGO A;  3T8N A;  1DMM A;  1RNB A;  1I70 A;  1YJ9 3;  1AVK A;  1EKM A;  1I0V A;  2CWU A;  3JUM A;  2CKF B;  1BNR A;  3I56 3;  1GMR A;  2Y73 A;  3UL5 A;  1SPU A;  3FCS B;  1MWR A;  3PCR A;  4EV2 A;  3X41 A;  1BRH A;  5AIH A;  1JV2 B;  1RGK A;  2XSO B;  4NPB A;  2W56 B;  2ZA4 A;  1EA2 A;  1JZO A;  5KP3 A;  1BRS A;  3DY5 A;  3HIG A;  1VQ4 3;  1RSN A;  4J5G A;  2HML B;  1SAR A;  1D6Z A;  4EV5 A;  3EBY A;  3UNL A;  1CH0 A;  1OAC A;  2H0H A;  2W56 A;  1E3V A;  4LEH A;  1AY7 A;  1QAL A;  4XBX A;  5CF1 A;  2ZL8 A;  3MSO A;  1J2B A;  2P09 A;  4MMX B;  1OF5 A;  4LGQ A;  5JPP A;  1OUN A;  2Z6B A;  5AEU B;  3AMO A;  5IG4 A;  5KP1 A;  1Q86 4;  1BSA A;  2PNC A;  4BIR A;  2AAE A;  2K54 A;  5TGN A;  3CCM 3;  3LTB A;  2W6J H;  4NHF A;  3BNB A;  1BSE A;  2KF5 A;  1RGC A;  4ZM8 A;  3Q90 A;  1UUV B;  1IVU A;  2IUJ A;  1RN7 A;  1NB5 I;  2W03 A;  3F8H A;  1V57 A;  3MG3 A;  1RGL A;  4KT3 B;  1LNH A;  1QVG 2;  2CX1 A;  2R4I A;  2FGT A;  2XFT A;  2KCD A;  2SAR A;  1Y4K A;  1K73 4;  1JZD A;  1TRQ A;  5ELJ A;  4KFF A;  4KFE A;  1BU4 A;  4N6T A;  3KSP A;  3VF1 A;  4O8S A;  2D1W A;  4HAA A;  3KE7 A;  3NBR A;  5LC6 A;  1T3B A;  1BUQ A;  3M8C A;  3FG1 A;  1NB3 I;  2BT3 A;  4BTW A;  5IEN A;  2RFR A;  1YI2 3;  1WTH A;  1DMN A;  4HM6 B;  2F4Y A;  4CCV A;  1A2K A;  1BAN A;  1NWW A;  1NO3 A;  4LMI A;  4KFD A;  3CCL 3;  1M1K 4;  2Z77 A;  1SQW A;  2B24 B;  3U1W A;  3FKA A;  1RGF A;  3F8X A;  1OCV A;  3OWY A;  1AV4 A;  3OWU A;  1FUT A;  3F9S A;  4FMC A;  2OWP A;  4HVN A;  4O02 B;  3KN4 A;  4HOH A;  1IYY A;  1Z1S A;  2FNQ A;  4X2O A;  1IK3 A;  8CHO A;  2F5W A;  4FR9 A;  1MNL A;  3T0U A;  1I8V A;  1OGZ A;  2P38 A;  1OPY A;  1C7H A;  1PY3 A;  1RCK A;  1BRN L;  5M18 A;  5M1A A;  3WOD G;  1N5P A;  2ZDJ A;  4STD A;  4L8O A;  3LTA A;  1R4C A;  1JB4 A;  1WQL B;  4J5K A;  1JNQ A;  1JB5 A;  3F7X A;  3NV0 B;  3F40 A;  3X3Z A;  2H0I A;  3STD A;  4XDV A;  1GMP A;  4N6M A;  4O3V A;  1I2E A;  4XDW A;  1W5Z A;  3EF8 A;  4ORL A;  2RGQ A;  3D3L A;  5ELU A;  5D82 A;  2A15 A;  1Q7H A;  1JJ2 2;  3LXU X;  1KQS 2;  1W2B 2;  2HMM B;  4N6U A;  3D9R A;  3V92 A;  1TTO A;  3GSP A;  1RN4 A;  1LVN A;  2YFJ B;  3NUV A;  3ZFZ A;  1JN5 A;  4FCM A;  3A76 A;  2AAD A;  2RNT A;  4EYC A;  1BRG A;  1BNG A;  3EN1 B;  4GB5 A;  1VQL 3;  1VQK 3;  1RN1 A;  1IU7 A;  4HM8 B;  4CPK A;  1ISK A;  4K61 A;  1S72 3;  2XFS A;  1BNE A;  3TDG A;  2OCT A;  2XGL A;  2KRT A;  1I2G A;  1MWS A;  1Q40 A;  3X3Y A;  3GWR A;  1U8C B;  3NBJ A;  1VQO 3;  3CMA 3;  3CNX A;  1ULI B;  3DZL A;  3FSD A;  3GAX A;  3FGY A;  4HBR A;  3CCS 3;  5STD A;  1OHO A;  1M90 4;  1WMP A;  1X1X A;  5CF2 A;  1X1Y A;  2W04 A;  3SED A;  3HK4 A;  1GY5 A;  1TU5 A;  6RNT A;  1BSB A;  2SBL A;  1GD3 A;  4N6O B;  2OOV C;  4R4K A;  3CCU 3;  1A67 A;  1B3S A;  1YJW 3;  1IV7 A;  1UCJ A;  1RGA A;  2F99 A;  5EEO A;  2XRX B;  3FLJ A;  5AIF A;  3CC7 3;  1UCI A;  4TX4 A;  3G71 3;  3CNM A;  1S5A A;  2BMO B;  2W9P A;  3NM7 A;  4L8P A;  3NX0 A;  5G2G A;  1TUH A;  1G96 A;  2W9Q A;  3LZA A;  5IG5 A;  2ZHX B;  3F14 A;  5AYS C;  1W6Y A;  1HYF A;  4K90 B;  2HMK B;  3BLZ A;  3SOA A;  4MJD A;  4QWT A;  2GEY A;  5AEW B;  1W02 A;  1L5G B;  1TFO A;  3SOY A;  4HM3 B;  4PEJ A;  1T2H A;  3HOH A;  3G0K A;  2P0X A;  4HJL B;  3AHW A;  5BXQ A;  1X1W A;  5FW5 A;  2HMJ B;  5AIG A;  1IQX A;  3BB9 A;  3L0R A;  1RTU A;  3RGA A;  1FGT A;  2CFK A;  2PZV A;  1STF I;  1MOL A;  1VZZ A;  2UGI A;  3K9M C;  4H61 A;  1TJD A;  5JPU A;  3OWS A;  3Q2P A;  5CK6 A;  1RRH A;  4MEI A;  2OTL 3;  3EHC A;  5IEP A;  1D6Y A;  1E97 A;  1X1U A;  4HM4 B;  2CW9 A;  1ULJ B;  1YGW A;  2QIY A;  1V58 A;  4XBY A;  1HZ1 A;  2B1X B;  1KWI A;  5HGR A;  2F86 B;  1RGG A;  1K41 A;  4RNZ A;  5G1K A;  3A5E A;  2CG0 A;  1GMQ A;  2KF6 A;  2KXG A;  3ALA A;  1JB2 A;  1O7P B;  3NQZ A;  1YIT 3;  4O2H A;  1QAF A;  1M1X B;  3D5G A;  3H3H A;  3ZG5 A;  2MC8 A;  1IDP A;  1IT8 A;  1BSD A;  4EBG A;  1Q81 4;  1IT7 A;  3CD6 3;  4BL2 A;  3I55 3;  3X40 A;  3ECF A;  3BU4 A;  1NDO B;  2XH9 A;  1N5H A;  5HOH A;  3JVC A;  3V99 A;  3N54 B;  3MG1 A;  4J8T A;  4HZ9 B;  3NQY A;  4J9A A;  1RJO A;  4HM2 B;  1A90 A;  1GY7 A;  1LNI A;  1EQK A;  1PU4 A;  1RGH A;  2P0M A;  4WP5 A;  1IV9 A;  3QRD A;  1UUG B;  1AR0 A;  1BSC A;  1LOW A;  1B20 A;  2I9W A;  1NU3 A;  3KFQ C; 
#chains in the Genus database with same CATH homology
 1BNJ A;  1FZU A;  1MGR A;  2HOH A;  3KCH A;  8RNT A;  1RMS A;  1JBR A;  2C4B A;  1GOV A;  1G02 A;  3BIR A;  1TTO A;  3GSP A;  4RNT A;  1B27 A;  1RN4 A;  3AHS A;  1I3I A;  3AGN A;  1BRJ A;  1GSP A;  2AAD A;  2RNT A;  2KF3 A;  1BRG A;  1BNG A;  1JBS A;  2BU4 A;  1RN1 A;  1RNT A;  1R4Y A;  3D4A A;  1BIR A;  1BNE A;  1B2X A;  1I2G A;  1JBT A;  1Q9E A;  1A2P A;  1UCL A;  1MGW A;  1FYS A;  3AGO A;  3WHO A;  1RNB A;  1I70 A;  1I0V A;  1RGE A;  3DGY A;  1B21 A;  1BNR A;  1GMR A;  1BOX A;  1RCL A;  1BRH A;  1X1X A;  1BRK A;  1RGK A;  1X1Y A;  1BUJ A;  4GHO A;  2ZA4 A;  6RNT A;  1RLS A;  1BSB A;  1B2M A;  1BRS A;  1RSN A;  4J5G A;  5BIR A;  1BNF A;  2RBI A;  1RHL A;  1SAR A;  1B3S A;  1UCJ A;  1RGA A;  1DE3 A;  1CH0 A;  1UCI A;  3D5I A;  1AY7 A;  1I3F A;  2GSP A;  1C54 A;  3URP A;  1YVS A;  5BU4 A;  6GSP A;  1ZGX A;  3Q3F A;  1BSA A;  1HYF A;  3WR2 A;  2AAE A;  2F5M A;  4BIR A;  1BRI A;  4GSP A;  1BSE A;  2KF5 A;  3DH2 A;  1RGC A;  1T2I A;  1T2H A;  5RNT A;  3HOH A;  3AHW A;  1X1W A;  1LOY A;  1RGL A;  2BIR A;  1LRA A;  1BNI A;  7GSP A;  1RTU A;  1BVI A;  1YNV X;  1BAO A;  1B2Z A;  1PYL A;  2SAR A;  1RDS A;  1TRQ A;  3RNT A;  1BU4 A;  2F56 A;  4HAA A;  7RNT A;  1UCK A;  2KAA A;  1GOU A;  1X1U A;  1YGW A;  1LOV A;  1I2F A;  1HZ1 A;  1BNS A;  1RGG A;  9RNT A;  2F4Y A;  3A5E A;  1GMQ A;  1FUS A;  2KF6 A;  2KF4 A;  1BAN A;  3D5G A;  1BSD A;  1AQZ A;  1FW7 A;  1RGF A;  1B2S A;  1FUT A;  4BU4 A;  1IYY A;  4HOH A;  1DET A;  3BU4 A;  1GOY A;  1BGS A;  5HOH A;  2F5W A;  1I8V A;  1I0X A;  1TRP A;  1PY3 A;  1RCK A;  1BRN L;  1B2U A;  1LNI A;  3SYU A;  1RGH A;  4J5K A;  1BSC A;  1LOW A;  1B20 A;  1GMP A;  5GSP A;  1I2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...