1BSDA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
INTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLVYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 33
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bsdA00
1BNFA 1BNIA 3BIRA 1CH0A 3HOHA 1B2SA 1RGEA 1X1XA 1RGAA 1GSPA 2KAAA 1BNGA 1UCKA 2BU4A 2F56A 1BOXA 1YNVX 1BUJA 2C4BA 1PY3A 1IYYA 3Q3FA 1BRIA 3D5IA 1RCLA 1JBRA 1TTOA 4RNTA 3RNTA 1BIRA 1BNSA 1GMRA 1BGSA 1GOVA 1MGRA 1AY7A 1BRGA 4GSPA 3WHOA 7GSPA 1RNTA 1JBSA 1I2GA 1I0XA 4HAAA 1I2FA 1BSCA 3URPA 1RGFA 1BSBA 1RMSA 1HZ1A 1UCIA 1X1YA 3AGNA 4BU4A 5RNTA 2F5WA 1Q9EA 4J5KA 4J5GA 1FYSA 1RCKA 2ZA4A 1FUSA 1LOWA 2RNTA 1X1UA 5HOHA 2HOHA 1MGWA 6RNTA 1RGHA 1RGCA 1GMPA 1LOYA 1I3FA 1RDSA 6GSPA 1BANA 1BNEA 2RBIA 1G02A 1DE3A 4GHOA 4HOHA 1BRHA 3AHWA 1R4YA 1BSAA 1GOYA 2F4YA 2SARA 1BRJA 1B20A 3A5EA 1FUTA 3WR2A 1DETA 1B2XA 1I2EA 1ZGXA 2KF3A 9RNTA 1LOVA 1SARA 4BIRA 1GOUA 1BSDA 1RSNA 3DGYA 1BU4A 2KF5A 1RNBA 2F5MA 1RTUA 1RGLA 1AQZA 1B2UA 3D4AA 1BRNL 1RLSA 1YGWA 1T2HA 1BRSA 1BRKA 1YVSA 1I3IA 1RN1A 2BIRA 3D5GA 5BU4A 1BNRA 1RGGA 3KCHA 1FZUA 3SYUA 1UCJA 1B3SA 5BIRA 1B2ZA 2AAEA 2GSPA 1X1WA 1RHLA 1T2IA 2KF6A 3AGOA 1BVIA 3GSPA 8RNTA 1I8VA 7RNTA 1BAOA 1JBTA 1TRQA 3DH2A 1A2PA 1GMQA 1I70A 1PYLA 1B27A 2AADA 1BNJA 1BSEA 1HYFA 1LNIA 2KF4A 1LRAA 3BU4A 1I0VA 1B21A 3AHSA 1B2MA 1C54A 1FW7A 1TRPA 1UCLA 5GSPA 1RN4A 1RGKA
chains in the Genus database with same CATH superfamily
1IT8A 2OOVA 4O8SA 5AYSC 3PYJA 3K7CA 5HGRA 3BIRA 1IV7A 1CH0A 4STDA 1RGEA 1YGEA 2KAAA 5G1LA 1VQL3 3S29A 1J2BA 1UCKA 3I563 3EN1B 1SIIA 2BU4A 2K0MA 2I9WA 3F8XA 3G16A 1QVG2 2F56A 3OW22 3EE1A 3VGNA 3G713 4J8TA 4N6OB 4RNZA 2IMJA 3EBTA 2CFKA 3CME3 3Q3FA 1BRIA 4HM8B 1OH0A 1RCLA 1DYUA 2HMMB 3IMAB 3I553 1JBRA 1JJ22 1EA2A 1GOVA 1MWRA 1VQQA 2CFDA 2CH9A 2GBXB 2H0GA 1QAFA 1IVWA 4ORLA 1JBSA 1OCVA 4HBRA 1JB2A 3NX0A 2F98A 3MYTA 5A0OB 1C7HA 1ISKA 1FGRA 1WMPA 3BLZA 2W04A 3EN8A 1DMQA 3CC73 3MSOA 2ZL8A 3KSPA 2WOFA 3RGRA 3AGNA 1YJN3 3MG2A 4J5GA 1VZZA 1Q7Y4 3CC23 2ZA4A 4ILFA 3HIGA 5LC7A 2XH9A 2QIYA 1OACA 1SJWA 2IUKA 4IT7A 1FGQA 5BVBA 1FGMA 1GMPA 4I4KA 2W9PA 2CC3A 1IT7A 2Z77A 1RDSA 1PU4A 5STDA 4O02B 4R80A 2OCTA 1BNEA 3EBYA 1G02A 2STDA 1KSIA 2M7OA 2RFRA 3G8ZA 4R1KA 4KVHA 3RGAA 1OUNA 3AHWA 1JN5A 2WGOA 1JZOA 4JRFA 1ULJB 1MWTA 1N8R4 5CF2A 4RNYA 5CLKA 1GYBA 1JV2B 1US1A 3ER7A 2LQVA 1VQ93 2L4VA 1GOYA 2OOVC 1LQGC 3EHCA 3HK4A 1B20A 1O7GB 3FSDA 1Q7HA 4OUQA 1ZGXA 1IVXA 1OGZA 1TFKA 4DKIA 3MG1A 1YVBI 4HM1B 3S28A 5JPUA 4MMZB 4WP5A 1RSNA 1SQWA 5AIGA 1S5AA 1PFPA 1O7MB 1O7NB 3EQQB 1W02A 3FF0A 3K63A 1DVDA 4IIAA 1RLSA 1YIT3 1IK3A 2BIRA 2MC8A 3SEDA 4LEHA 3FF2A 3KCHA 5IERA 2C11A 2E2UA 1K28A 1RRLA 3DMCA 1S723 4WWUC 2AAEA 3NXJA 1STFI 2P0MA 2QGUA 4H3UA 1K9M4 4EW5A 1BUQA 1X1WA 5IEPA 1QVF2 1T2IA 3X42A 1AVLA 3AGOA 4RBNA 3CU3A 3CXC2 3EC9A 1TRQA 3DH2A 1A2PA 1WNHA 3O8YA 1I70A 1B27A 1DVCA 1W2B2 1HYFA 2B1XB 1M904 1TJDA 1GY6A 3MG3A 2W0QA 4HM6B 3MWZA 5IENA 3AHSA 1O7PB 3OWUA 1B2MA 2Y74A 1FW7A 1AVKA 1UCLA 2GEXA 1RN4A 8RNTA 3FCSB 1KQS2 1Q42A 2W6JH 3FG1A 3LTCA 2CHCA 1HU9A 2O9UX 2OTJ3 3HOHA 2BO9B 5D82A 3UL5A 1GSPA 4RZMA 2F99A 4LGQA 1AR0A 5IG4A 4CJNA 1V58A 2K54A 4HZ9B 4XDVA 1TIJA 1BOXA 3SLUA 3F14A 5AEWB 1YI23 1NU3A 1YNVX 2IY2A 3F9SA 1ASKA 2W56B 1MNLA 1PY3A 4R4KA 4WYKA 4FMCA 1RJOA 1CEWI 1IYYA 3NQYA 3HZPA 1JN5B 1F8NA 1E3RA 3WOFB 1T5YA 1M1K4 1GY5A 1TTOA 3QRDA 1M1XB 2WOHA 4WFOA 2CWVA 1AY7A 3UJMA 3WHOA 7GSPA 1RNTA 1I2GA 1A2KA 1IQXA 4XM4A 3CC43 3UB1A 1NJI4 1RGFA 1UUVB 2ZHXB 3OWSA 3HI7A 5KP3A 1RMSA 1HZ1A 1UCIA 4BL2A 3OX9A 2ZDJA 2XFTA 2P09A 2UX0A 3D3LA 4ZM8A 2F5WA 3DY5A 5RNTA 5ELJA 4J5KA 3QK9A 2CFWA 1RKYA 4Q53A 2OWPA 5EVHA 1KC84 1ROVA 5IF6A 1X1UA 3S5CA 2HOHA 4AKZA 1MGWA 4X2HA 1RGCA 3CCR3 1I3FA 5AEUB 5DRVA 1BANA 1D6UA 3NQZA 3AMOA 3KIIA 3T8UA 5AIIA 1WQLB 2KXGA 2P05A 4K1UA 3DGMA 1MOLA 4GHOA 3WODG 2XR8B 1IVVA 3DM8A 4EXRA 3KZTA 4XBTA 4L8PA 2W2CA 4FR9A 3A76A 1UW1A 3U97A 1OF5B 2E2VA 1BSAA 3N9HA 2SARA 3U1WA 4FCMA 3I0YA 5G1KA 2FNQA 3FGYA 3DGLA 1VQN3 3NM2A 9RNTA 3Q2PA 1LOVA 2BNGA 1SARA 5D81A 3VF1A 2Q07A 4BIRA 1NNVA 1V74A 3G4S3 1JKGB 1GS3A 4HJLB 1ZO2A 1BU4A 1Q864 3G6E3 1W6YA 3N8BA 4KFEA 2F5MA 3FG4A 4R9LA 1R4CA 3ECFA 1IQ8A 3D4AA 1B2UA 1UUWB 1M9GA 3NV0A 1YGWA 1T2HA 1BRSA 3EF8A 3SX1A 1YVSA 5BU4A 3GRDA 1JB4A 1LVNA 1GY7A 1B3SA 2P38A 2XEPA 1B2ZA 4L7KA 2HMOB 5I97A 1Q814 4WYKB 2CX1A 5KP1A 2MF7A 2GU1A 1YJW3 3Q90A 4GL6A 1IV9A 1JZDA 2HMKB 3BB9A 4TX4A 2KF6A 4EV5A 1BVIA 5M18A 3CMA3 3Q1CA 2GU3A 1UI7A 1GMQA 3EJVA 5EQLA 3M8CA 3CCJ3 1PYLA 4CCVA 3SOYA 1IU7A 1JRQA 2Y73A 4K90B 2KF4A 3WA2X 1LRAA 3ZFZA 3BU4A 3JUPA 1HKXA 1B21A 5IEOA 5M1AA 3LT9A 4LSOA 1TRPA 3X41A 3CCU3 3GZBA 4N6LA 1C54A 3CCV3 1VQP3 1W7CA 1BNFA 1KD14 3BNBA 1JNQA 1Q40A 2JDIH 3DUKA 3EB8A 5IG3A 2OTL3 4PEJA 4FCJA 3DGOA 2B24B 1BNGA 1FA3A 4HVNA 3NUVA 1VQO3 3D9RA 2R41A 5ELUA 3JVCA 2D1WA 4JF8A 3MKIA 4XBXA 2XSOB 3FG3A 1ROAA 3B8LA 1BUJA 4FMAA 1MWSA 1UUGB 3S27A 2ML6A 1QALA 3DZLA 5CF1A 1O7HB 3MHEA 1IQYA 3BNEA 3F40A 2CWTA 2YFJB 4RNTA 3RNTA 1BIRA 1BNSA 1MGRA 1BGSA 1VQ73 1A90A 1AV4A 2XGLA 4GSPA 1V57A 4LZIA 4HAAA 1W00A 2HMLB 3K9MC 1BSCA 5IG0A 4MEIA 1N9EA 4N3VA 5AYRB 1Z1SA 1FUWA 3K0ZA 4HM2B 1NB5I 4MMXB 2HMNB 3B7CA 3X3ZA 3JUQA 1E3VA 1X1YA 3IJEB 4HM5B 4BU4A 1A2VA 3JUNA 1KWIA 1LQMB 1FGOA 2CK3H 4O3VA 3NBRA 1K8A4 3FH1A 1RCKA 4NHFA 4N6NB 1FUSA 1LOWA 1LXEA 2RNTA 5HOHA 3FLJA 2PZVA 6RNTA 1OHSA 1RGHA 1U8CB 8CHOA 2OQEA 1LOYA 5IG5A 1EKMA 3GZXB 5KP4A 6GSPA 4EV2A 4NPBA 2YFIB 2Z7AA 3L0RA 2QA43 4WHAA 1G0TA 1DE3A 1UI8A 3CCQ3 3CPW2 4XB5A 3NM7A 5TGNA 5D83A 1BRHA 3N54B 5AIFA 1TFOA 1STDA 1ZS7A 2IA7A 2RCDA 2F86B 2UUGC 3JUOA 4KT3B 4N6UA 3CCM3 4AEQA 1W5ZA 2F4YA 3GWRA 3PXMA 3T8NA 3A5EA 4OVMA 3V92A 3VSYA 3V99A 4CDLA 4EYCA 1B2XA 1OGXA 1GD4A 1U5OA 3S67A 1ZX2A 2R4IA 1CQSA 1OHPA 2K3DA 2ML5A 3PGBA 5G2GA 3PZWA 4BTWA 4BL3A 3DGYA 3K5TA 4FMDA 1N9JA 3E99A 1IVUA 2H0HA 1AQZA 1YHQ3 2W9QA 1BRNL 3CPOA 3ZG5A 2H0IA 1K41A 1RN1A 2LYXA 1RGGA 4IPBA 3X3YA 1FZUA 4K1VA 4QWTA 1UCJA 2HMJB 5BIRA 4O2HA 4MJDA 2GSPA 1RHLA 4BTYA 4LMIA 3LTDA 3ZG0A 3B4PA 3NBJA 2FGTA 4R9KA 4GB5A 3GSPA 2BMQB 4G1MB 2D42A 3JUMA 1BAOA 1JBTA 4HYZA 1T3BA 1VQM3 2BHMA 4BTXA 3FZWA 1BNJA 3KSED 1SIHA 1WMOA 2CW9A 2Z6BA 1LNIA 5CK6A 1EQKA 2XRXB 1G96A 1WTHA 4H61A 2OQEC 5JBSA 2INXA 3LOYA 3LYGA 5GSPA 1NO3A 1BNIA 5AI1A 2CG1A 1B2SA 3OWYA 3TDGA 1X1XA 4HM3B 3EX9A 1RGAA 2CFGA 4U13A 2BMOB 3LT8A 2L1SA 1VQ43 3WDGB 1IDPA 1SPUA 3BNCA 1E97A 3LMLA 2C4BA 2CWUA 3HX8A 1W4NA 1W01A 2BMRB 3BNDA 3D5IA 2J8XB 3NHXA 2UGIA 2PNCA 1GMRA 2QEX3 3NBBA 2O3OA 1BRGA 2E2TA 2W56A 3IPTA 6STDA 4HM4B 5CXOA 1I0XA 1RN7A 1I2FA 3CNXA 4NREA 5EEOA 2GXFA 3WOEB 3UNLA 1O7WB 5BXQA 1UGIA 2W03A 3URPA 1OPYA 5JPPA 2KRTA 3F8HA 1BSBA 3CD63 3PCSA 1VQ83 5FGOA 3STDA 3ALAA 1WMNA 4KFDA 3LTBA 3KE7A 3LTAA 1DMNA 3GZRA 1Q9EA 3V98A 1FYSA 3FKAA 4FCZA 4FMBA 3CCS3 3UL6A 1W6CA 2YFLB 3RDEA 4HM7B 4OK0A 2V1LA 1VQ63 3AMOB 3OV4A 2WGQA 4J9AA 1TP6A 1N8QA 3PCRA 3DXOA 1RRHA 1UGHI 2KCDA 3WMDA 1Q824 3CCL3 1Y4KA 2FXTA 3B4OA 2XSHB 1YJ93 2RBIA 1K734 1N5PA 2XGNA 3PS8A 4HOHA 1QAKA 1EEJA 4N6MA 1FGTA 4X2OA 2CX0A 1JB5A 3HIIA 4CPKA 1R4YA 1MWUA 3X3XA 2BT3A 2IYJA 2XF3A 4L8OA 4EC6A 3SVAA 1YIJ3 1BRJA 4KFFA 1UDII 2RSXA 3LH4A 2CG0A 2YX9A 1VQK3 3DGNA 1FUTA 4AKYA 4KZ1A 1CYUA 3WR2A 1DETA 1I2EA 1L5GB 2RGQA 4K61A 1OF5A 2KF3A 3G0KA 4HKVB 4N6V0 1N5HA 1OHOA 4N6TA 2GEYA 1NDOB 1W6GA 1GOUA 1BSDA 3F7XA 2IUJA 3CCE3 3NV0B 1EUIC 5FW5A 1A67A 3T0UA 1DMMA 4MMYB 1LOXA 2KF5A 2XFSA 4I5QA 4HZBB 1D6YA 4LYLB 1RNBA 3H51A 3OXAA 1RTUA 1RGLA 3CNMA 5DREA 1JKGA 1QMAA 1TU5A 3WA3A 3GAXA 3ROBA 1VQ53 1QJGA 1BRKA 2CIUA 1I3IA 3D5GA 3D79A 4XBYA 1BNRA 3SXXA 4XDWA 2P0XA 3SYUA 2A15A 5M19A 3MPHA 4EBGA 3KKGA 2CFLA 3KN4A 2GBWB 1D6ZA 1NB3I 3X40A 1GD3A 1NWWA 1ULIB 2C10A 5IW9A 3F7SA 1I8VA 3GZYB 3LZAA 5LC6A 7RNTA 4HM0B 3J7Yd 2WO0A 1W2ZA 3LXUX 2JQ5A 3KFQC 1LNHA 2AADA 3SOAA 1BSEA 2SBLA 3H3HA 7STDA 5AIHA 1Q40B 1I0VA 1CYVA 2Z76A 2CKFB 1EG9B 1TUHA 1RGKA
chains in the Genus database with same CATH topology
1BNFA 1BNIA 3BIRA 1CH0A 3HOHA 1B2SA 1RGEA 1X1XA 1RGAA 1GSPA 2KAAA 1BNGA 1UCKA 2BU4A 2F56A 1BOXA 1YNVX 1BUJA 2C4BA 1PY3A 1IYYA 3Q3FA 1BRIA 3D5IA 1RCLA 1JBRA 1TTOA 4RNTA 3RNTA 1BIRA 1BNSA 1GMRA 1BGSA 1GOVA 1MGRA 1AY7A 1BRGA 4GSPA 3WHOA 7GSPA 1RNTA 1JBSA 1I2GA 1I0XA 4HAAA 1I2FA 1BSCA 3URPA 1RGFA 1BSBA 1RMSA 1HZ1A 1UCIA 1X1YA 3AGNA 4BU4A 5RNTA 2F5WA 1Q9EA 4J5KA 4J5GA 1FYSA 1RCKA 2ZA4A 1FUSA 1LOWA 2RNTA 1X1UA 5HOHA 2HOHA 1MGWA 6RNTA 1RGHA 1RGCA 1GMPA 1LOYA 1I3FA 1RDSA 6GSPA 1BANA 1BNEA 2RBIA 1G02A 1DE3A 4GHOA 4HOHA 1BRHA 3AHWA 1R4YA 1BSAA 1GOYA 2F4YA 2SARA 1BRJA 1B20A 3A5EA 1FUTA 3WR2A 1DETA 1B2XA 1I2EA 1ZGXA 2KF3A 9RNTA 1LOVA 1SARA 4BIRA 1GOUA 1BSDA 1RSNA 3DGYA 1BU4A 2KF5A 1RNBA 2F5MA 1RTUA 1RGLA 1AQZA 1B2UA 3D4AA 1BRNL 1RLSA 1YGWA 1T2HA 1BRSA 1BRKA 1YVSA 1I3IA 1RN1A 2BIRA 3D5GA 5BU4A 1BNRA 1RGGA 3KCHA 1FZUA 3SYUA 1UCJA 1B3SA 5BIRA 1B2ZA 2AAEA 2GSPA 1X1WA 1RHLA 1T2IA 2KF6A 3AGOA 1BVIA 3GSPA 8RNTA 1I8VA 7RNTA 1BAOA 1JBTA 1TRQA 3DH2A 1A2PA 1GMQA 1I70A 1PYLA 1B27A 2AADA 1BNJA 1BSEA 1HYFA 1LNIA 2KF4A 1LRAA 3BU4A 1I0VA 1B21A 3AHSA 1B2MA 1C54A 1FW7A 1TRPA 1UCLA 5GSPA 1RN4A 1RGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNF A;  1BNI A;  3BIR A;  1CH0 A;  3HOH A;  1B2S A;  1RGE A;  1X1X A;  1RGA A;  1GSP A;  2KAA A;  1BNG A;  1UCK A;  2BU4 A;  2F56 A;  1BOX A;  1YNV X;  1BUJ A;  2C4B A;  1PY3 A;  1IYY A;  3Q3F A;  1BRI A;  3D5I A;  1RCL A;  1JBR A;  1TTO A;  4RNT A;  3RNT A;  1BIR A;  1BNS A;  1GMR A;  1BGS A;  1GOV A;  1MGR A;  1AY7 A;  1BRG A;  4GSP A;  3WHO A;  7GSP A;  1RNT A;  1JBS A;  1I2G A;  1I0X A;  4HAA A;  1I2F A;  1BSC A;  3URP A;  1RGF A;  1BSB A;  1RMS A;  1HZ1 A;  1UCI A;  1X1Y A;  3AGN A;  4BU4 A;  5RNT A;  2F5W A;  1Q9E A;  4J5K A;  4J5G A;  1FYS A;  1RCK A;  2ZA4 A;  1FUS A;  1LOW A;  2RNT A;  1X1U A;  5HOH A;  2HOH A;  1MGW A;  6RNT A;  1RGH A;  1RGC A;  1GMP A;  1LOY A;  1I3F A;  1RDS A;  6GSP A;  1BAN A;  1BNE A;  2RBI A;  1G02 A;  1DE3 A;  4GHO A;  4HOH A;  1BRH A;  3AHW A;  1R4Y A;  1BSA A;  1GOY A;  2F4Y A;  2SAR A;  1BRJ A;  1B20 A;  3A5E A;  1FUT A;  3WR2 A;  1DET A;  1B2X A;  1I2E A;  1ZGX A;  2KF3 A;  9RNT A;  1LOV A;  1SAR A;  4BIR A;  1GOU A;  1BSD A;  1RSN A;  3DGY A;  1BU4 A;  2KF5 A;  1RNB A;  2F5M A;  1RTU A;  1RGL A;  1AQZ A;  1B2U A;  3D4A A;  1BRN L;  1RLS A;  1YGW A;  1T2H A;  1BRS A;  1BRK A;  1YVS A;  1I3I A;  1RN1 A;  2BIR A;  3D5G A;  5BU4 A;  1BNR A;  1RGG A;  3KCH A;  1FZU A;  3SYU A;  1UCJ A;  1B3S A;  5BIR A;  1B2Z A;  2AAE A;  2GSP A;  1X1W A;  1RHL A;  1T2I A;  2KF6 A;  3AGO A;  1BVI A;  3GSP A;  8RNT A;  1I8V A;  7RNT A;  1BAO A;  1JBT A;  1TRQ A;  3DH2 A;  1A2P A;  1GMQ A;  1I70 A;  1PYL A;  1B27 A;  2AAD A;  1BNJ A;  1BSE A;  1HYF A;  1LNI A;  2KF4 A;  1LRA A;  3BU4 A;  1I0V A;  1B21 A;  3AHS A;  1B2M A;  1C54 A;  1FW7 A;  1TRP A;  1UCL A;  5GSP A;  1RN4 A;  1RGK A; 
#chains in the Genus database with same CATH topology
 1IT8 A;  2OOV A;  4O8S A;  5AYS C;  3PYJ A;  3K7C A;  5HGR A;  3BIR A;  1IV7 A;  1CH0 A;  4STD A;  1RGE A;  1YGE A;  2KAA A;  5G1L A;  1VQL 3;  3S29 A;  1J2B A;  1UCK A;  3I56 3;  3EN1 B;  1SII A;  2BU4 A;  2K0M A;  2I9W A;  3F8X A;  3G16 A;  1QVG 2;  2F56 A;  3OW2 2;  3EE1 A;  3VGN A;  3G71 3;  4J8T A;  4N6O B;  4RNZ A;  2IMJ A;  3EBT A;  2CFK A;  3CME 3;  3Q3F A;  1BRI A;  4HM8 B;  1OH0 A;  1RCL A;  1DYU A;  2HMM B;  3IMA B;  3I55 3;  1JBR A;  1JJ2 2;  1EA2 A;  1GOV A;  1MWR A;  1VQQ A;  2CFD A;  2CH9 A;  2GBX B;  2H0G A;  1QAF A;  1IVW A;  4ORL A;  1JBS A;  1OCV A;  4HBR A;  1JB2 A;  3NX0 A;  2F98 A;  3MYT A;  5A0O B;  1C7H A;  1ISK A;  1FGR A;  1WMP A;  3BLZ A;  2W04 A;  3EN8 A;  1DMQ A;  3CC7 3;  3MSO A;  2ZL8 A;  3KSP A;  2WOF A;  3RGR A;  3AGN A;  1YJN 3;  3MG2 A;  4J5G A;  1VZZ A;  1Q7Y 4;  3CC2 3;  2ZA4 A;  4ILF A;  3HIG A;  5LC7 A;  2XH9 A;  2QIY A;  1OAC A;  1SJW A;  2IUK A;  4IT7 A;  1FGQ A;  5BVB A;  1FGM A;  1GMP A;  4I4K A;  2W9P A;  2CC3 A;  1IT7 A;  2Z77 A;  1RDS A;  1PU4 A;  5STD A;  4O02 B;  4R80 A;  2OCT A;  1BNE A;  3EBY A;  1G02 A;  2STD A;  1KSI A;  2M7O A;  2RFR A;  3G8Z A;  4R1K A;  4KVH A;  3RGA A;  1OUN A;  3AHW A;  1JN5 A;  2WGO A;  1JZO A;  4JRF A;  1ULJ B;  1MWT A;  1N8R 4;  5CF2 A;  4RNY A;  5CLK A;  1GYB A;  1JV2 B;  1US1 A;  3ER7 A;  2LQV A;  1VQ9 3;  2L4V A;  1GOY A;  2OOV C;  1LQG C;  3EHC A;  3HK4 A;  1B20 A;  1O7G B;  3FSD A;  1Q7H A;  4OUQ A;  1ZGX A;  1IVX A;  1OGZ A;  1TFK A;  4DKI A;  3MG1 A;  1YVB I;  4HM1 B;  3S28 A;  5JPU A;  4MMZ B;  4WP5 A;  1RSN A;  1SQW A;  5AIG A;  1S5A A;  1PFP A;  1O7M B;  1O7N B;  3EQQ B;  1W02 A;  3FF0 A;  3K63 A;  1DVD A;  4IIA A;  1RLS A;  1YIT 3;  1IK3 A;  2BIR A;  2MC8 A;  3SED A;  4LEH A;  3FF2 A;  3KCH A;  5IER A;  2C11 A;  2E2U A;  1K28 A;  1RRL A;  3DMC A;  1S72 3;  4WWU C;  2AAE A;  3NXJ A;  1STF I;  2P0M A;  2QGU A;  4H3U A;  1K9M 4;  4EW5 A;  1BUQ A;  1X1W A;  5IEP A;  1QVF 2;  1T2I A;  3X42 A;  1AVL A;  3AGO A;  4RBN A;  3CU3 A;  3CXC 2;  3EC9 A;  1TRQ A;  3DH2 A;  1A2P A;  1WNH A;  3O8Y A;  1I70 A;  1B27 A;  1DVC A;  1W2B 2;  1HYF A;  2B1X B;  1M90 4;  1TJD A;  1GY6 A;  3MG3 A;  2W0Q A;  4HM6 B;  3MWZ A;  5IEN A;  3AHS A;  1O7P B;  3OWU A;  1B2M A;  2Y74 A;  1FW7 A;  1AVK A;  1UCL A;  2GEX A;  1RN4 A;  8RNT A;  3FCS B;  1KQS 2;  1Q42 A;  2W6J H;  3FG1 A;  3LTC A;  2CHC A;  1HU9 A;  2O9U X;  2OTJ 3;  3HOH A;  2BO9 B;  5D82 A;  3UL5 A;  1GSP A;  4RZM A;  2F99 A;  4LGQ A;  1AR0 A;  5IG4 A;  4CJN A;  1V58 A;  2K54 A;  4HZ9 B;  4XDV A;  1TIJ A;  1BOX A;  3SLU A;  3F14 A;  5AEW B;  1YI2 3;  1NU3 A;  1YNV X;  2IY2 A;  3F9S A;  1ASK A;  2W56 B;  1MNL A;  1PY3 A;  4R4K A;  4WYK A;  4FMC A;  1RJO A;  1CEW I;  1IYY A;  3NQY A;  3HZP A;  1JN5 B;  1F8N A;  1E3R A;  3WOF B;  1T5Y A;  1M1K 4;  1GY5 A;  1TTO A;  3QRD A;  1M1X B;  2WOH A;  4WFO A;  2CWV A;  1AY7 A;  3UJM A;  3WHO A;  7GSP A;  1RNT A;  1I2G A;  1A2K A;  1IQX A;  4XM4 A;  3CC4 3;  3UB1 A;  1NJI 4;  1RGF A;  1UUV B;  2ZHX B;  3OWS A;  3HI7 A;  5KP3 A;  1RMS A;  1HZ1 A;  1UCI A;  4BL2 A;  3OX9 A;  2ZDJ A;  2XFT A;  2P09 A;  2UX0 A;  3D3L A;  4ZM8 A;  2F5W A;  3DY5 A;  5RNT A;  5ELJ A;  4J5K A;  3QK9 A;  2CFW A;  1RKY A;  4Q53 A;  2OWP A;  5EVH A;  1KC8 4;  1ROV A;  5IF6 A;  1X1U A;  3S5C A;  2HOH A;  4AKZ A;  1MGW A;  4X2H A;  1RGC A;  3CCR 3;  1I3F A;  5AEU B;  5DRV A;  1BAN A;  1D6U A;  3NQZ A;  3AMO A;  3KII A;  3T8U A;  5AII A;  1WQL B;  2KXG A;  2P05 A;  4K1U A;  3DGM A;  1MOL A;  4GHO A;  3WOD G;  2XR8 B;  1IVV A;  3DM8 A;  4EXR A;  3KZT A;  4XBT A;  4L8P A;  2W2C A;  4FR9 A;  3A76 A;  1UW1 A;  3U97 A;  1OF5 B;  2E2V A;  1BSA A;  3N9H A;  2SAR A;  3U1W A;  4FCM A;  3I0Y A;  5G1K A;  2FNQ A;  3FGY A;  3DGL A;  1VQN 3;  3NM2 A;  9RNT A;  3Q2P A;  1LOV A;  2BNG A;  1SAR A;  5D81 A;  3VF1 A;  2Q07 A;  4BIR A;  1NNV A;  1V74 A;  3G4S 3;  1JKG B;  1GS3 A;  4HJL B;  1ZO2 A;  1BU4 A;  1Q86 4;  3G6E 3;  1W6Y A;  3N8B A;  4KFE A;  2F5M A;  3FG4 A;  4R9L A;  1R4C A;  3ECF A;  1IQ8 A;  3D4A A;  1B2U A;  1UUW B;  1M9G A;  3NV0 A;  1YGW A;  1T2H A;  1BRS A;  3EF8 A;  3SX1 A;  1YVS A;  5BU4 A;  3GRD A;  1JB4 A;  1LVN A;  1GY7 A;  1B3S A;  2P38 A;  2XEP A;  1B2Z A;  4L7K A;  2HMO B;  5I97 A;  1Q81 4;  4WYK B;  2CX1 A;  5KP1 A;  2MF7 A;  2GU1 A;  1YJW 3;  3Q90 A;  4GL6 A;  1IV9 A;  1JZD A;  2HMK B;  3BB9 A;  4TX4 A;  2KF6 A;  4EV5 A;  1BVI A;  5M18 A;  3CMA 3;  3Q1C A;  2GU3 A;  1UI7 A;  1GMQ A;  3EJV A;  5EQL A;  3M8C A;  3CCJ 3;  1PYL A;  4CCV A;  3SOY A;  1IU7 A;  1JRQ A;  2Y73 A;  4K90 B;  2KF4 A;  3WA2 X;  1LRA A;  3ZFZ A;  3BU4 A;  3JUP A;  1HKX A;  1B21 A;  5IEO A;  5M1A A;  3LT9 A;  4LSO A;  1TRP A;  3X41 A;  3CCU 3;  3GZB A;  4N6L A;  1C54 A;  3CCV 3;  1VQP 3;  1W7C A;  1BNF A;  1KD1 4;  3BNB A;  1JNQ A;  1Q40 A;  2JDI H;  3DUK A;  3EB8 A;  5IG3 A;  2OTL 3;  4PEJ A;  4FCJ A;  3DGO A;  2B24 B;  1BNG A;  1FA3 A;  4HVN A;  3NUV A;  1VQO 3;  3D9R A;  2R41 A;  5ELU A;  3JVC A;  2D1W A;  4JF8 A;  3MKI A;  4XBX A;  2XSO B;  3FG3 A;  1ROA A;  3B8L A;  1BUJ A;  4FMA A;  1MWS A;  1UUG B;  3S27 A;  2ML6 A;  1QAL A;  3DZL A;  5CF1 A;  1O7H B;  3MHE A;  1IQY A;  3BNE A;  3F40 A;  2CWT A;  2YFJ B;  4RNT A;  3RNT A;  1BIR A;  1BNS A;  1MGR A;  1BGS A;  1VQ7 3;  1A90 A;  1AV4 A;  2XGL A;  4GSP A;  1V57 A;  4LZI A;  4HAA A;  1W00 A;  2HML B;  3K9M C;  1BSC A;  5IG0 A;  4MEI A;  1N9E A;  4N3V A;  5AYR B;  1Z1S A;  1FUW A;  3K0Z A;  4HM2 B;  1NB5 I;  4MMX B;  2HMN B;  3B7C A;  3X3Z A;  3JUQ A;  1E3V A;  1X1Y A;  3IJE B;  4HM5 B;  4BU4 A;  1A2V A;  3JUN A;  1KWI A;  1LQM B;  1FGO A;  2CK3 H;  4O3V A;  3NBR A;  1K8A 4;  3FH1 A;  1RCK A;  4NHF A;  4N6N B;  1FUS A;  1LOW A;  1LXE A;  2RNT A;  5HOH A;  3FLJ A;  2PZV A;  6RNT A;  1OHS A;  1RGH A;  1U8C B;  8CHO A;  2OQE A;  1LOY A;  5IG5 A;  1EKM A;  3GZX B;  5KP4 A;  6GSP A;  4EV2 A;  4NPB A;  2YFI B;  2Z7A A;  3L0R A;  2QA4 3;  4WHA A;  1G0T A;  1DE3 A;  1UI8 A;  3CCQ 3;  3CPW 2;  4XB5 A;  3NM7 A;  5TGN A;  5D83 A;  1BRH A;  3N54 B;  5AIF A;  1TFO A;  1STD A;  1ZS7 A;  2IA7 A;  2RCD A;  2F86 B;  2UUG C;  3JUO A;  4KT3 B;  4N6U A;  3CCM 3;  4AEQ A;  1W5Z A;  2F4Y A;  3GWR A;  3PXM A;  3T8N A;  3A5E A;  4OVM A;  3V92 A;  3VSY A;  3V99 A;  4CDL A;  4EYC A;  1B2X A;  1OGX A;  1GD4 A;  1U5O A;  3S67 A;  1ZX2 A;  2R4I A;  1CQS A;  1OHP A;  2K3D A;  2ML5 A;  3PGB A;  5G2G A;  3PZW A;  4BTW A;  4BL3 A;  3DGY A;  3K5T A;  4FMD A;  1N9J A;  3E99 A;  1IVU A;  2H0H A;  1AQZ A;  1YHQ 3;  2W9Q A;  1BRN L;  3CPO A;  3ZG5 A;  2H0I A;  1K41 A;  1RN1 A;  2LYX A;  1RGG A;  4IPB A;  3X3Y A;  1FZU A;  4K1V A;  4QWT A;  1UCJ A;  2HMJ B;  5BIR A;  4O2H A;  4MJD A;  2GSP A;  1RHL A;  4BTY A;  4LMI A;  3LTD A;  3ZG0 A;  3B4P A;  3NBJ A;  2FGT A;  4R9K A;  4GB5 A;  3GSP A;  2BMQ B;  4G1M B;  2D42 A;  3JUM A;  1BAO A;  1JBT A;  4HYZ A;  1T3B A;  1VQM 3;  2BHM A;  4BTX A;  3FZW A;  1BNJ A;  3KSE D;  1SIH A;  1WMO A;  2CW9 A;  2Z6B A;  1LNI A;  5CK6 A;  1EQK A;  2XRX B;  1G96 A;  1WTH A;  4H61 A;  2OQE C;  5JBS A;  2INX A;  3LOY A;  3LYG A;  5GSP A;  1NO3 A;  1BNI A;  5AI1 A;  2CG1 A;  1B2S A;  3OWY A;  3TDG A;  1X1X A;  4HM3 B;  3EX9 A;  1RGA A;  2CFG A;  4U13 A;  2BMO B;  3LT8 A;  2L1S A;  1VQ4 3;  3WDG B;  1IDP A;  1SPU A;  3BNC A;  1E97 A;  3LML A;  2C4B A;  2CWU A;  3HX8 A;  1W4N A;  1W01 A;  2BMR B;  3BND A;  3D5I A;  2J8X B;  3NHX A;  2UGI A;  2PNC A;  1GMR A;  2QEX 3;  3NBB A;  2O3O A;  1BRG A;  2E2T A;  2W56 A;  3IPT A;  6STD A;  4HM4 B;  5CXO A;  1I0X A;  1RN7 A;  1I2F A;  3CNX A;  4NRE A;  5EEO A;  2GXF A;  3WOE B;  3UNL A;  1O7W B;  5BXQ A;  1UGI A;  2W03 A;  3URP A;  1OPY A;  5JPP A;  2KRT A;  3F8H A;  1BSB A;  3CD6 3;  3PCS A;  1VQ8 3;  5FGO A;  3STD A;  3ALA A;  1WMN A;  4KFD A;  3LTB A;  3KE7 A;  3LTA A;  1DMN A;  3GZR A;  1Q9E A;  3V98 A;  1FYS A;  3FKA A;  4FCZ A;  4FMB A;  3CCS 3;  3UL6 A;  1W6C A;  2YFL B;  3RDE A;  4HM7 B;  4OK0 A;  2V1L A;  1VQ6 3;  3AMO B;  3OV4 A;  2WGQ A;  4J9A A;  1TP6 A;  1N8Q A;  3PCR A;  3DXO A;  1RRH A;  1UGH I;  2KCD A;  3WMD A;  1Q82 4;  3CCL 3;  1Y4K A;  2FXT A;  3B4O A;  2XSH B;  1YJ9 3;  2RBI A;  1K73 4;  1N5P A;  2XGN A;  3PS8 A;  4HOH A;  1QAK A;  1EEJ A;  4N6M A;  1FGT A;  4X2O A;  2CX0 A;  1JB5 A;  3HII A;  4CPK A;  1R4Y A;  1MWU A;  3X3X A;  2BT3 A;  2IYJ A;  2XF3 A;  4L8O A;  4EC6 A;  3SVA A;  1YIJ 3;  1BRJ A;  4KFF A;  1UDI I;  2RSX A;  3LH4 A;  2CG0 A;  2YX9 A;  1VQK 3;  3DGN A;  1FUT A;  4AKY A;  4KZ1 A;  1CYU A;  3WR2 A;  1DET A;  1I2E A;  1L5G B;  2RGQ A;  4K61 A;  1OF5 A;  2KF3 A;  3G0K A;  4HKV B;  4N6V 0;  1N5H A;  1OHO A;  4N6T A;  2GEY A;  1NDO B;  1W6G A;  1GOU A;  1BSD A;  3F7X A;  2IUJ A;  3CCE 3;  3NV0 B;  1EUI C;  5FW5 A;  1A67 A;  3T0U A;  1DMM A;  4MMY B;  1LOX A;  2KF5 A;  2XFS A;  4I5Q A;  4HZB B;  1D6Y A;  4LYL B;  1RNB A;  3H51 A;  3OXA A;  1RTU A;  1RGL A;  3CNM A;  5DRE A;  1JKG A;  1QMA A;  1TU5 A;  3WA3 A;  3GAX A;  3ROB A;  1VQ5 3;  1QJG A;  1BRK A;  2CIU A;  1I3I A;  3D5G A;  3D79 A;  4XBY A;  1BNR A;  3SXX A;  4XDW A;  2P0X A;  3SYU A;  2A15 A;  5M19 A;  3MPH A;  4EBG A;  3KKG A;  2CFL A;  3KN4 A;  2GBW B;  1D6Z A;  1NB3 I;  3X40 A;  1GD3 A;  1NWW A;  1ULI B;  2C10 A;  5IW9 A;  3F7S A;  1I8V A;  3GZY B;  3LZA A;  5LC6 A;  7RNT A;  4HM0 B;  3J7Y d;  2WO0 A;  1W2Z A;  3LXU X;  2JQ5 A;  3KFQ C;  1LNH A;  2AAD A;  3SOA A;  1BSE A;  2SBL A;  3H3H A;  7STD A;  5AIH A;  1Q40 B;  1I0V A;  1CYV A;  2Z76 A;  2CKF B;  1EG9 B;  1TUH A;  1RGK A; 
#chains in the Genus database with same CATH homology
 1BNF A;  1BNI A;  3BIR A;  1CH0 A;  3HOH A;  1B2S A;  1RGE A;  1X1X A;  1RGA A;  1GSP A;  2KAA A;  1BNG A;  1UCK A;  2BU4 A;  2F56 A;  1BOX A;  1YNV X;  1BUJ A;  2C4B A;  1PY3 A;  1IYY A;  3Q3F A;  1BRI A;  3D5I A;  1RCL A;  1JBR A;  1TTO A;  4RNT A;  3RNT A;  1BIR A;  1BNS A;  1GMR A;  1BGS A;  1GOV A;  1MGR A;  1AY7 A;  1BRG A;  4GSP A;  3WHO A;  7GSP A;  1RNT A;  1JBS A;  1I2G A;  1I0X A;  4HAA A;  1I2F A;  1BSC A;  3URP A;  1RGF A;  1BSB A;  1RMS A;  1HZ1 A;  1UCI A;  1X1Y A;  3AGN A;  4BU4 A;  5RNT A;  2F5W A;  1Q9E A;  4J5K A;  4J5G A;  1FYS A;  1RCK A;  2ZA4 A;  1FUS A;  1LOW A;  2RNT A;  1X1U A;  5HOH A;  2HOH A;  1MGW A;  6RNT A;  1RGH A;  1RGC A;  1GMP A;  1LOY A;  1I3F A;  1RDS A;  6GSP A;  1BAN A;  1BNE A;  2RBI A;  1G02 A;  1DE3 A;  4GHO A;  4HOH A;  1BRH A;  3AHW A;  1R4Y A;  1BSA A;  1GOY A;  2F4Y A;  2SAR A;  1BRJ A;  1B20 A;  3A5E A;  1FUT A;  3WR2 A;  1DET A;  1B2X A;  1I2E A;  1ZGX A;  2KF3 A;  9RNT A;  1LOV A;  1SAR A;  4BIR A;  1GOU A;  1BSD A;  1RSN A;  3DGY A;  1BU4 A;  2KF5 A;  1RNB A;  2F5M A;  1RTU A;  1RGL A;  1AQZ A;  1B2U A;  3D4A A;  1BRN L;  1RLS A;  1YGW A;  1T2H A;  1BRS A;  1BRK A;  1YVS A;  1I3I A;  1RN1 A;  2BIR A;  3D5G A;  5BU4 A;  1BNR A;  1RGG A;  3KCH A;  1FZU A;  3SYU A;  1UCJ A;  1B3S A;  5BIR A;  1B2Z A;  2AAE A;  2GSP A;  1X1W A;  1RHL A;  1T2I A;  2KF6 A;  3AGO A;  1BVI A;  3GSP A;  8RNT A;  1I8V A;  7RNT A;  1BAO A;  1JBT A;  1TRQ A;  3DH2 A;  1A2P A;  1GMQ A;  1I70 A;  1PYL A;  1B27 A;  2AAD A;  1BNJ A;  1BSE A;  1HYF A;  1LNI A;  2KF4 A;  1LRA A;  3BU4 A;  1I0V A;  1B21 A;  3AHS A;  1B2M A;  1C54 A;  1FW7 A;  1TRP A;  1UCL A;  5GSP A;  1RN4 A;  1RGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...