1BSVA

Gdp-fucose synthetase from escherichia coli complex with nadph
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
317
structure length
317
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords PROTEIN (GDP-FUCOSE SYNTHETASE)
total genus 103
structure length 317
sequence length 317
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bsvA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1bsvA02
1SNYA 3NYWA 3SX2A 1GZ4A 1NFFA 2Q1WA 3KETA 1UZMA 3WQSB 2LDBA 2VUUA 2VYVA 2AQIA 4QECA 1W0CA 4W7HA 1DHRA 1E7QA 4MKXA 3IAHA 3DZGA 4ND1A 3JD4A 1P3DA 5ER9A 4E2WA 4U8GA 4MOWA 4OXYA 4FOSA 3ETEA 1XWFA 4QO7A 1NR7A 3PDUA 4Z0PA 1F8GA 4OMUA 3LLVA 2Q4BA 5U4QA 3N7UA 4RDIA 3U0BA 1GDHA 5IN4A 1IYZA 1C0PA 1ZK3A 4L73A 4NH4A 1Z82A 1DPGA 2EXXA 2IE0A 2X22A 5DNAA 3T7CA 3JQAA 4M86A 3IKVA 4DYDA 5A02A 4HFJA 2Q1UA 1DHTA 2XF8A 1O9BA 1YH3A 5LDHA 4BO1A 3RJ9A 5CFZA 2FY8A 3AY7A 3IP3A 3K8ZA 3W6ZA 2O4CA 4YYZA 4QEDA 2FN7A 3Q3CA 1KVSA 2X9GA 1C3VA 2CY0A 4DUPA 4NDNE 3PHJA 4NK4A 3S2GA 4MIYA 5JAMA 3ITKA 4RQUA 5A9TA 4U7WA 2Y67A 2RIRA 1XGKA 4XIJA 4E33A 3GH3A 4QFDA 4YPOA 3GMDA 4CLHA 4J7CA 1LU9A 5DCWA 5IZ4A 1V8BA 1T4DA 3EW7A 2EJWA 3JQ6A 4R1UA 3VPHA 3JCZA 3PVZA 3WYBA 3DTYA 4EJ0A 3KOUA 3WWYA 3VTZA 3UF0A 2CF6A 2EP7A 4XR9A 1P9LA 1YS4A 4DA9A 8ADHA 1MFZA 3RKUA 1R6DA 4QXMA 3DBLB 1L7DA 2X5KO 3K73O 2OXIA 1GU7A 4TRMA 2Q46A 1HDCA 2A9FA 2FRDA 4IJWA 3WWZA 2P5YA 1H6BA 1YE3A 3DXFA 1RPNA 4UUMA 2B0JA 5DCUA 4YB8A 4JNKA 4OOFA 4W9NA 2I3AA 2YHUA 1SOWA 5ICSA 5JE8A 4XJTA 2B4QA 2OO5A 2P2SA 2WD7B 5B4UA 5G4KA 3LK7A 3I83A 3GDGA 5T6BA 3TFQA 4R4JA 3O8QA 5EMHA 3CSDA 2V65A 2ZB7A 5L3ZA 3JQAD 3W4JA 4WCDA 1BVUA 3GA0A 3P19A 1HEUA 3ZV4A 2AA3A 4N7RA 2YZ7A 1EK6A 5B4VA 3JD0A 1PSDA 1WP4A 5L53A 1EK5A 3U4IA 4CM5A 1XELA 2UDPA 1YDEA 2ZB8A 4TVBA 1P1FA 1XIVA 2EKQA 2CD9A 2WD8A 2Y1OA 4YBZA 2BD0A 4XGNA 3TZKA 5LCXA 5KCZA 4GH5A 4GQAA 2D3TA 1I3NA 1LDBA 4BS9A 3AFMA 3ZW8A 3ZU4A 2C0CA 3FPLA 1NPTO 4K26A 4E5PA 4LW8A 3PXXA 3WJAA 3GEMA 2DBVO 1BGVA 2BGLA 1U28A 1PS8A 4U6QA 1UXGA 2YYYA 1HZJA 3E18A 3PI7A 1E5QA 1A4IA 2PFGA 3G17A 1WMBA 1UAGA 2W2LD 1LQUA 2GERA 2Q1TA 4DQUA 2GZ3A 3PPIA 4R5HA 3TOXA 1CDOA 1D1TA 4DIBA 2C7GA 4ZVVA 2QRLA 3NUGA 4WPGA 4MP8A 4QSMA 3EVTA 3EDMA 3P2OA 4FIZA 4GX0A 3PGXA 4BNIA 1NQ5A 1X7DA 1UP7A 3PYMA 1HYEA 3H9JA 4E2ZA 1DRWA 2GCGA 1DIBA 3MTJA 4KWHA 3AM5A 4BOYA 4UUPA 4CR6A 3GGGA 4OGWA 1B7GO 3O38A 3L4SO 4BMSA 5K0ZA 1NM5A 4PRLA 2D0IA 2B4RO 2ZCVA 4TVOA 3WYCA 5TF4A 5JAZA 5K6AA 3HNPA 1KC3A 3ONDA 3JQ7B 3SJ7A 2Q3EA 3P2YA 3FNHA 2VYVD 3DTTA 3WGYA 2PKRA 3GAFA 2QHXA 3S1LA 3ULKA 5JCXA 3WJ7A 1JWAB 5A9SB 4W9NC 5HA5A 3RUFA 4ALKA 5GZ3A 3JQ8B 4CQMD 1N8KA 4YJDA 1F14A 1D3AA 4RZIA 1XU9A 1ZEJA 2RAFA 1DIRA 1ZXBA 3V2HA 1EBFA 2DUWA 4YCAA 1MGOA 3FNGA 3E8XA 5KOIA 5KVCA 3BMCB 3EC7A 5I8ZA 5COQA 1UH5A 1KY5A 2B4TO 5AXBA 2Q99A 3RUHA 2IDZA 5L7TA 1ID1A 2O48X 2J8ZA 3GY0A 2VHZA 2Z5LA 4J49A 4YT5A 2X0RA 4IZIA 4YA6A 4RPJA 3WNQA 4CM7A 5JDIC 1WZEA 1ULUA 1JVBA 3PQFA 1ONOA 1Z74A 1EMDA 1GPDG 3SJUA 4I5EA 3JQFC 4J2OA 2J5KA 4CMBA 3GNQA 4N18A 4XB2A 2ZTMA 1Y9EA 1HTBA 2AE1A 4CR8A 2VWHA 4PG6A 1K89A 3F3SA 5A1TA 4WLUA 4LVCA 4EITA 4G65A 3KUXA 4JGBA 3V8BA 4FBGA 3VKUA 1NQTA 1LTHR 1PJSA 3K2EA 4J7UA 3VH1A 3PHGA 3UN1A 1SOVA 2HJRA 3BMNA 2Q4EA 3QP9A 2EF1A 2VRBA 4LRTB 3P7MA 5JC8A 1XYGA 1AHHA 4HFNA 2BHLA 3RIHA 3JSAA 3TL3A 1I32A 2VNSA 4QTZA 4OM8A 3ZWMA 1KEWA 3DOCA 2HJSA 1P74A 4IGEA 4YWJA 3KZVA 2EW8A 3ON5A 3VZPA 4C7KA 4FN4A 1QXSA 3GVPA 3TRIA 3U4DA 4F6CA 3GMSA 4HFRA 5JDCC 4BKUA 1F8FA 2POQX 3DBHB 4HUJA 4OYRA 4CLXA 1F0YA 2CNBA 4FCCA 2ZJ0A 2VQ3A 4NFYA 1A27A 5F5LA 2NU8A 2AMFA 2EJVA 3T4XA 3GPDG 5JAQA 2WDZA 3H6KA 1I30A 3MWDB 3PWZA 4PLPA 4I5GA 3K30A 2ET6A 1B8VA 1XDWA 4NBTA 2NU9A 3RC1A 2HMSA 4M89A 2HLPA 3CPSA 4TWRA 2BFPA 3PIDA 3GK3A 5KVQA 4FC7A 1Z75A 4WNCA 1VRWA 4L4XA 5A5EA 4UUOA 1R0LA 4A7PA 4NFSA 3K2BA 4NR0A 4ZRMA 4IQGA 5A06A 1YQGA 4TKLA 1T25A 1XQ6A 3OA2A 4YJFB 3WLFA 4OIMA 1UXKA 1W4ZA 1F06A 1M6WA 1OAAA 4ND5A 3I9JA 4PLYA 1LNQA 4PGFA 1YL6A 4BMNA 2FSVA 2FHSA 4K6FA 3KSDO 4PVCA 3X2FA 1C1DA 3ZV6A 1GY8A 3FN4A 1H6DA 4D0SA 5JMWA 4D0RA 3OQ6A 1Y8RA 4BNWA 4RF2A 3PLRA 5EESA 3IJRA 2HQ1A 3OICA 1DC4A 4WLVA 1WLYA 2OBYA 4JJIA 4CM8A 4A73A 4B79A 3L07A 2BELA 3B20A 3G79A 4Q3NA 5JLAA 4D3FA 2V6GA 1J49A 4AJKA 1Q0LA 3F46A 1DFIA 3GNSA 4I9NA 2Y66A 4CMAA 1HE5A 4FGWA 5J23A 1M76A 2OOSA 1PR3A 1LDYA 1PX0A 3RKRA 2HK9A 5IDWA 2E4AA 3PP8A 4XD2A 4BUCA 4HXYA 1VC2A 1R16A 1E0DA 3IIEA 1YQDA 3PWSA 3ZZNA 1VPDA 1XSEA 5I7FA 4J1QA 2GASA 2E49A 4FSHA 4GAEA 3BMQA 3QLJA 1ISIA 2C2XA 2RH4A 3I4FA 3PJFA 4CQLA 1DLJA 4OSPA 4BL5A 2AE2A 3GHHA 5DBFA 2GZ1A 3KRTA 1H6AA 1LRLA 1LSUA 2NVBA 4PLZA 4MVJH 2IODA 1BXGA 2FZEA 3IUSA 5F1KA 3ZWYA 1GUZA 1V3VA 1HDYA 4YT4A 3JYPA 3I6IA 1QV7A 5EL0A 4BNXA 2FPGA 1Q0QA 5EERA 2DQ4A 2VOJA 2PH3A 2GO1A 1U8XX 3E1KA 3FWNA 4YAJA 1U3WA 3DMYA 3C8MA 3V1UA 3G1UA 2E48A 4PLTA 5AXAA 5T67A 3VPSA 3JQBA 3MJSA 3NT2A 3WGTA 1WDMA 2EGHA 3UCXA 2DUUA 1P31A 4W7IA 4TZTA 1NFQA 5A05A 2X23A 1H6CA 4ZQHA 1MUUA 1MC4A 4AJ1A 4CQMA 3ANLA 2DLDA 5ITVA 5JO9A 2D1YA 1Z45A 3TPCA 3IQDB 2RHRA 4YQZA 5ES3A 1PJQA 4B8ZA 4E3ZA 3AUSA 4GSLA 5KJCA 1H94A 4Y9DA 2SCUA 3AK4A 5AXCA 2X8LA 5CEJA 4E32A 2IXBA 2R00A 4J0FA 3MOIA 3RJ5A 3F1LA 4PLGA 1Y9AA 3U3XA 3CZMA 4YR9A 6LDHA 4CUJA 2DAPA 4WCFC 4CLOA 4XB1A 1NR1A 3H9UA 3KM0A 3O4RA 1C1XA 2PNFA 4NJMB 5G0VA 1ZK1A 2PTGA 4FFPA 5JS6A 1YBVA 1OC4A 1GQ2A 4AJPA 3CH6A 4A5OA 5BNIA 1DFGA 1DRVA 5TT1A 3DBHA 4HFMA 1E7MA 3OECA 3Q6IA 4YJFA 3VPFA 1E3SA 3PFWO 7MDHA 1DIGA 1PJBA 4RPHA 4Y67A 4CLOB 1JQBA 3DWFA 2Q2QA 3DZFA 4DL9A 2DBRA 3U4CA 5F3RA 2D5AA 1BDMA 4FGSA 4ZA2A 4LRSB 1WAMA 4YJHB 3U5TA 1HDRA 5AXDA 3G3EA 3CTMA 4AJIA 2X86A 3JTMA 3KYCA 2B5VA 2PZJA 4HADA 3RBZA 3RUCA 1R66A 2NTJA 4EJ6A 1YWGO 1PS0A 2Y68A 4NBWA 4MKRA 3LU1A 4YDRA 3ICPA 3JQ9A 2YDXA 2Q2WA 5L45A 4NBRA 4XQCA 4MPDA 1I3LA 3VOSA 4AICA 2YV2A 2A92A 2YFHA 2YHIB 3KV3O 4IBOA 4U5QA 3RUIA 3QA9A 2QZZA 3RC7A 3MTGA 4ITUA 1X0XA 4XX0A 1YL7A 4CPDA 3DBRA 2DTEA 4JBHA 4JP2A 2XXJA 4R9RA 4IINA 4WUVA 3WBBA 4EEXA 3OSUA 3ZI0A 5T64A 3U4HA 2QIOA 3WMWA 1XEAA 3H9QA 3CUKA 4KQXA 3JYQA 1DOHA 1T4BA 1Q7CA 1SC6A 3LT2A 1FDUA 1ENYA 4HNGA 3TDKA 1LDMA 1ZSNA 1R4NA 3TZQA 3BMCA 1PWXA 1ZKMA 1WDKA 4DLAA 1R4NB 5HS4A 4CM6A 5IF3A 4BB6A 3DZHA 4FD3A 1OZAA 1Q2XA 5DF1A 3C24A 2DTXA 2ZCUA 3I6QA 3W8EA 2C59A 1KY4A 3W1VA 4K6CA 5JXWA 1C0LA 1E6WA 5IZCA 4CL3A 4CQLB 2ZJ1A 3ZV3A 2JHFA 4DRYA 3OIGA 4LMRA 1LRKA 5I9MA 2ZQYA 1LC0A 3G1TA 2PKQO 3L4BC 4IIVA 1I2BA 4PN3A 1K6IA 2C7VA 3QY9A 1YBAA 5G2OA 3NRCA 5CDGA 1YQXA 4U6SA 1KIFA 3VPXA 4YRAA 3F6YA 1R12A 4P8RA 1VSUA 4M55A 3Q2KA 1HE2A 1T2FA 3O26A 1IZ9A 4FW8A 2X6TA 3JD2A 1O6ZA 3GVXA 4CMKA 4PLWA 1I36A 3NJ4A 3H4VA 4ONEA 4EUHA 4XGKA 3HFSA 2QG4A 5EQDA 3UCFA 5A3VA 1P1HA 1NYTA 4LISA 3D64A 1LLUA 3KXDA 1HXHA 3DHEA 3BZUA 1WW8A 4NPCA 4B7UA 3H8VA 4BNMA 5KJ6A 3O03A 1NWHA 1NAIA 3TZHA 3WGIA 3WOHA 1BVRA 3L9WA 4XYEA 4MIEA 4BO6A 3A1NA 3D3EA 3ICCA 3NDRA 4MVJA 2HUNA 1LA2A 2YQ5A 5CDSA 3UVEA 4I1IA 1E6UA 4J1TA 2D2IA 4PLVA 2NNLD 4DLBA 4I08A 1B3RA 3NT4A 4MIOA 1HDOA 3D5TA 4NNJA 1VSVA 3LF2A 1H0KA 4KUGA 4BNUA 3HB4X 1P0FA 1LC3A 2YDYA 4D43A 3T7EA 5T5QA 5AVOA 4K9DA 1K0UA 3R3JA 1J4AA 1PS9A 1XU7A 4RDHA 3VH3A 3LC1O 2AQ8A 1FK8A 3GHYA 4ZQFA 3RASA 4CR7A 1Z73A 3JQ9C 3H5RA 4YXFA 5L4LA 1WWKA 1GCUA 4IIUA 2UV8A 1NVGA 1RM0A 5F5NA 3VH4A 3QVTA 4E6PA 3ZW9A 2X1HA 2I67A 1C0KA 4I5FA 3ROPA 3HJAA 4A2CA 4AJJA 4H16A 1R37A 1T1SA 4XDYA 2XOXA 1GPJA 4GBJA 4E2YA 1BWSA 1PJ2A 3WGHA 4BO9A 3NDIA 1N9GB 1A9ZA 4KDFA 5TRTA 1U3TA 4GSKA 3GC6A 4MJLA 3IJPA 3PYLA 4KUHA 3OF2A 1TEHA 4K1LA 4MVJF 4XRGA 5G4KB 1PJTA 3DOJA 3ZHZA 1FF9A 4CMEA 3WG9A 3GGOA 2O4UX 1YVEI 2I3GA 3RUAA 5B1YA 5I9NA 5THQA 3JQEA 4G5HA 4AJ4A 1DJNA 3HG7A 4JQCA 4B4UA 4F45A 4L4SA 3K96A 5AOVA 3LF1A 4XCVA 1CIVA 2FP4A 3A14A 4J0EA 2TMGA 3B1JA 3ZNNA 1YO6A 2V6MA 3I3OA 3F5QA 4GX2A 1Y7TA 3JYNA 4PZEA 5HS6A 1GFSA 4N5MA 3PJGA 3WQQA 5JSFA 4LGVA 4PG4A 1MXHA 4R41A 2AHRA 4RORA 5I7EA 1ISFA 1EUZA 3FWZA 1ADCA 5L51A 4EBFA 1IE3A 2CVOA 4XA8A 4E0BA 2QZ9A 1SEPA 2WMDA 5AYVA 2B37A 4X54A 4Q3DA 1NVTA 4BGIA 3JD1A 3M2PA 3AU9A 1P0CA 1EVJA 4H7PA 5I9LA 4CL8A 3AI2A 3OP4A 5H83A 3TOZA 1A5ZA 1E77A 3MEQA 2VTDA 1PZFA 3TNLA 3B1KA 1CEQA 2VHWA 4DIFA 4I9HA 3C1OA 4Q3AA 4M54A 4Z0HO 3K31A 1GZ6A 3DZBA 4H15A 1B8PA 3PZBA 4D3SA 4J1SA 4JBIA 3ZHXA 4P22A 2JD1A 2NACA 2D8AA 2VWPA 3C7DB 1M75A 2FPPA 3NGLA 3WNVA 1V6AA 4O6VA 4YAKA 1PWZA 5DP2A 3EZYA 3WDSA 1V3TA 4WGGA 4UREA 3ITDA 3WLEA 4B3IA 3PQEA 2AEJA 5T57A 4C4OA 1CETA 4XGIA 2I9PA 3WTCA 5HWSA 1R4MA 5TS3A 1R0KA 2DC1A 4OOEA 4CODB 1ISJA 1SCUA 2OORA 1A72A 3DMTA 4GPD1 1LLDA 1LX6A 4UUNA 2C29D 3UKOA 5JW6A 1JA9A 3QVSA 3PDJA 3FTNA 1DAOA 5TSDA 4IDEA 2WE7A 1Y6JA 3HDYA 1ARZA 1TVEA 3INRA 3ZHYA 2X0JA 3OJ0A 3D3WA 3UAGA 1L1FA 2GLXA 2ZIZA 1DC5A 3OEYA 1BMDA 4CV0A 4WLOA 3SLKA 4WLEA 1DFHA 1R4MB 2V6BA 1ZVMA 3OIDA 4FOOA 1FDVA 3ONFA 4UVIA 3SEFA 5CDUA 1AXGA 1PGQA 2ZB3A 1U7HA 3X2EA 1I24A 5G0UA 3ZU3A 3GVHA 4BNVA 3EY4A 4WOKA 5TNXA 4QUKA 1T2EA 5GZ6A 3V2UA 2VTEA 4B7XA 5IDXA 1WDLA 2Y1DA 5JO0A 3T4EA 1HSOA 1HYGA 1LLCA 1T2CA 1W6UA 2PLAA 3SLGA 4MP3A 2J3HA 3KSZO 4YQYA 5F1PA 3BXXA 4GKVA 5TC4A 1GZ3A 3B6ZA 4OKNA 1CQJA 3DR3A 3GRPA 3L6OO 4BO3A 1QG6A 3E6AA 4FDAA 3HZZA 5HM8A 1LSOA 4IDAA 4DC1A 4DVJA 3NKLA 1CERA 1X7GA 4GWGA 3NTQA 3V5NA 1QMGA 2XPCA 2EKPA 2ZTLA 1ISHA 3LC7O 1Y81A 1V35A 1ZUD1 1GR0A 2GRAA 4RPKA 2NTVA 5JDIA 2H6EA 2VZ8A 5FFFA 3FR7A 1YJ8A 2VZ9A 4NIMA 1QV6A 3ZNOA 1N7HA 1SB9A 4IUYA 3GF4A 1IY8A 4J6FA 4BNJA 5EINA 1E3IA 1KBZA 2I5PO 4WKGA 3QV1A 4CUZA 5KWEA 1P44A 2ZB4A 3U09A 5A04A 4IXWA 3UICA 3I23A 4A03A 1MX3A 1VL8A 1F17A 3KHUA 3WQRA 1RKXA 1X14A 5BSFA 4R3WA 4PIVA 3SBOA 1LQTA 3F4BA 2BFAA 2C82A 1ADGA 1LI4A 2O3RA 2PV7A 3VC7A 1S6YA 4BKOA 4IMRA 1ISGA 3NEPX 3W8DA 5DOVA 3ZWNA 1TI7A 4E5KA 1CF2O 2EIHA 2Z1MA 1XG5A 3GG2A 3H3JA 3PJDA 3VKVA 4DGSA 3WGQA 4A26A 4XWYA 3HQ4O 4KQWA 2DU8A 5CDTA 4WLNA 1T2AA 1VKNA 2VHVA 3JQ7A 3RFXA 4G2NA 4WEQA 3UH1A 4N5NA 4CJXA 3GZNB 2W2KB 2ZK7A 3M1LA 1E5LA 4S3MA 3GGPA 4BO5A 3QVWA 4CMJA 5I7SA 2XXBA 1Z6ZA 4EUEA 5G0TA 3KSUA 5TQVA 1KEPA 1QYWA 3ANMA 4K28A 1Q7GA 2JAHA 3DHNA 1JU9A 4RV9A 2P68A 1FDSA 1NTOA 5BNTA 2GN8A 1QSGA 4MVJD 5KTKA 2X58A 4R69A 5L7WA 3EMKA 9LDBA 1N9GA 5H82A 4BO8A 3L9XA 4GVXA 1K2WA 3OJOA 3EUWA 3ANNA 2NU6A 3LVFO 3DC2A 4QT0A 2FR0A 5F21A 3WMXA 4CLRB 1B3BA 5CP8A 1C1DB 1ZJYA 3VVBA 3INTA 2EGGA 2RHCA 2AG5A 4ID9A 5G0SA 4BNHA 4UEKA 3JQAB 5GY7A 4CLRA 5DOZA 3BA1A 4A10A 1PL6A 1UDBA 4I9UA 5C3MA 4E21A 1PZGA 3VTFA 1MB4A 3ZH2A 4P4GA 3H2ZA 4ROSA 2NTNA 1GD1O 2Y0CA 2H5LA 4IJUA 5FF9A 1U7TA 3WBFA 3Q11A 2GSDA 5CG2A 3DONA 1ZSVA 2QW8A 4CM3A 5JY6A 3ZNQA 4L9RA 3LT4A 2IYOA 3MWEB 1X13A 1JVSA 3EVNA 1KETA 3MJVA 2G17A 4XIYA 3S55A 1DAPA 3OBBA 4OKIA 3BYZA 5HTOA 4BHTA 4DTIA 2Q50A 4J90A 4D45A 2Y1EA 2X7HA 3ROQA 2J3JA 3ZU2A 2OZPA 3PYXA 3WR5A 3FBGA 4R01A 4TZKA 5DBGA 4ILKA 4Q3CA 5L95A 2H1SA 3IOYA 3FD8A 3KTDA 3LZ6A 4P4NA 4ZQGA 5FI3A 4CMHA 1VL0A 2I66A 3UGKA 2ZYAA 1DIAA 2WYVA 3NDJA 2PY6A 1PJ4A 5MDHA 5KVVA 1JKFA 4ZHSA 5BQFA 2YV1A 1PGOA 1YJQA 2HMVA 4PZCA 4TROA 3CIFA 4CM4A 1ZIDA 3JYOA 4M87A 1B16A 4M1QA 3K9QO 1D4FA 2GGSA 3FNEA 1VL6A 3DQPA 1E1MA 1RJWA 4FS3A 4GKBA 2OGUA 3QWFA 4PLHA 1T24A 1JDJA 1XQ1A 1YONA 1VE9A 5A3JA 1ZMTA 4J16A 2CMDA 4CLEA 1EUDA 5ENDA 3WXBA 1ZO8A 2JCXA 3AWDA 1PJ3A 3BMQB 4GMFA 2QRKA 4BNNA 1YB4A 2YHIA 4MVJE 4RVHA 5L9AA 2PD3A 5ICMA 2EP5A 3FPCA 1DBVO 5KVSA 1X1EA 4J9VA 2PZKA 4L74A 2EERA 3RVDA 2IEBA 2O50A 3RU7A 1WMAA 2VOEA 3BTOA 3Q9NA 3V1TC 1PZHA 1J0XO 2HMTA 1QORA 1PJLA 2DBQA 1NBOA 2V6FA 4LSMA 2RCYA 3VHRA 2FMUA 3AUTA 4JK3A 3ZDFA 1K3TA 3B1FA 5L40A 1X15A 4JX8A 1GYPA 1D8AA 1DJQA 3W6UA 4J1NA 1Y5RA 4YAGA 4EI2A 5A9SA 3RC2A 3DBRB 3GUCA 1I10A 2DPHA 1EVYA 4QX6A 3WFIA 3KO8A 3JYLA 2FWMX 1EUCA 4M8SA 2GUGA 1P77A 5JNLA 2HKIA 4WECA 3EHEA 3VDRA 4GGOA 4YTEA 5COAA 4LSWA 3TSCA 4ZU3A 1WVGA 4GWKA 5ADHA 4TRRA 3CMMA 2GYYA 3AUAA 2JFHA 2C54A 4D7AA 4GVLA 4MVJP 3NTRA 3L77A 4AG3A 4Z9YA 4YEDA 2JD2A 5L4NA 2FPIA 1EE9A 4YACA 4AJ2A 4BNKA 3LDHA 3ORFA 1HE3A 5C7LO 2UUPA 1IB6A 3ZWXA 1MXFA 3L0DA 3O9ZA 1AN9A 4BGUA 1QYXA 4FC6A 1PL7A 1VJTA 2Y99A 2E37A 1X1TA 4O1MA 2OP0A 4HP8A 4UVDA 5IDYA 3VZQA 2QRJA 3DBVO 3QWBA 3EAGA 1SB8A 4IGFA 4J3FA 3DO5A 2X9VA 4YJGA 1U3UA 4I5DA 2CSUA 3MJTA 4L4RA 1O5IA 5GMOA 1CJCA 4IPTA 4L0QA 2UVDA 2FZWA 1NP3A 2QYSA 3GR6A 1G0OA 1MV8A 3D3WB 3OQ1A 3TFOA 5KJEA 4YJGB 5KJ1A 4BO4A 1AUPA 4WASA 3BTVA 4R68A 2PGDA 1GAEO 5IFLA 3GEDA 5C7IO 5JC1A 1HL3A 1HRDA 4A27A 3AOEA 3D7LA 3L6EA 1OC2A 4MDHA 4UVHA 1HDZA 1BDBA 3Q0EA 3UFXA 3AM3A 3E48A 4LN1A 4D42A 1J5PA 3KB6A 3EK2A 4ALNA 2O3UA 2VHXA 3KEOA 1RYDA 4KTVE 5ENVA 1KVRA 1U8FO 3WIEA 1QYDA 4CUKA 5ITWA 3U62A 5BSGA 4FFRA 3KYDB 2B35A 3A28A 3DL2A 2DFDA 1N92A 1G0NA 2LDXA 1LDNA 3GFGA 1ML3A 1U2DA 3U9LA 4DPMA 2EV9A 4FFOA 4GI2A 4KMSA 4R5MA 2CDAA 1VLLA 1UDAA 4RVSA 2VWGA 5BT9A 4IQ0A 5IG2A 3RUDA 1SMKA 1SBYA 1QYVA 3GEGA 1U5AA 4E5NA 3RUEA 4KDEA 3W4IA 4IQ8A 2YUTA 2A4KA 4RVDA 2GF2A 3HB5X 1M2WA 4G81A 4DIOA 3PFFA 2WM3A 5A03A 2VUSA 3FF4A 2O7QA 4GMGA 2O3QA 3I5MA 3VAZA 1BTOA 3CINA 5I8WA 5FWNA 4R51A 3QHAA 3ZWCA 3DHYA 4DYVA 4XYMA 4YT2A 5COBA 4JJFA 3RWBA 4RL6A 4CV1A 3RAJA 1D1SA 4CMGA 3RBXA 1H9AA 1I3MA 3PLNA 4IS3A 3UXYA 1DXYA 1GUYA 2G82A 1M67A 1C0IA 2I6TA 4RPLA 4B4VA 4D3DA 4TMFA 3F5SA 1YDWA 1NNUA 3ENKA 4M49A 1UXIA 2WWRA 4J43A 5MGBA 1JAXA 1MA0A 1PQUA 3NX4A 1K6XA 1OBFO 1LXCA 5L7YA 4B3HA 3AI3A 4OJNA 2B5WA 4OH1A 3FR8A 5HRUA 4DREA 4FB5A 1T26A 3DEYX 4WEOA 3H5AA 1H2BA 4RLSA 1HETA 1DLIA 4NHEA 1N7GA 1Q7BA 8LDHA 4PCVA 2CF5A 2DVMA 2FR8A 1OMOA 4NJMA 3ZWVA 1R0SA 4L75A 4RZHA 3E03A 4BV9A 5KIAA 2C2YA 2AEFA 1QKIA 2P9GA 1G1AA 4WCFB 1GUFA 3DAFA 4CV3A 3PK0A 4E30A 3WGZA 4HBGA 3ROMA 3IDSA 2H9IA 3ZU5A 1T2DA 2G0TA 1B2LA 1ZK0A 2EEZA 1CWUA 4W82A 1I8TA 2DFVA 3FSRA 4DWVA 3WGOA 3RFTA 4BMVA 1B14A 1IUKA 4ND4A 2O2SA 3H2SA 4UVGA 2PR2A 5CEFA 4E5YA 4Z3KA 2WYUA 1QYCA 1RM4A 5IDQA 1QRRA 1DEHA 3TF5A 1QLHA 1B15A 2B69A 2I76A 3OJLA 3QSGA 3MJEA 3ABIA 4WCFA 1B26A 1M6HA 2BKAA 1TA4A 1OFGA 2R6JA 3STHA 3ZV5A 4LK3A 4EUFA 3M2TA 2J3IA 5A9RA 1JKIA 1I3KA 5LDGA 1YL5A 1HYHA 3MOGA 1JW9B 2BMAA 3U49A 2WE8A 4PRKA 1RM3A 4HNHA 2Y1CA 1ZNQO 1HT0A 2I65A 3UCEA 2ZTUA 4EYEA 2VCYA 5BSHA 1QP8A 1DB3A 2YV3A 3I9OA 2XAAA 3WSVA 1XCBA 3ETDA 3PEFA 3HFGA 5DT9A 1PTJA 1DC3A 4XYLA 1HDGO 4KWIA 5JY1A 2GN6A 1UJMA 2CDBA 1FJHA 2HCTA 3HDHA 2JCYA 3NGXA 4WK6A 2Y0EA 4QFCA 3C7AA 3RQSA 5EPOA 3VPGA 4HWKA 3KYDA 1ORRA 4XYBA 1PL8A 1GADO 4H3VA 3COSA 4O5OA 3QIVA 4EJMA 1O89A 2JFFA 3AM4A 4BKPA 3WIDA 3JQBC 1YBMA 3OJFA 4NBUA 5G0WA 1DDOA 4W6ZA 4BNFA 1OI7A 2X5JO 4AL4A 2NSDA 2O23A 2P4HX 3E9QA 1UZNA 4EW6A 5CAEA 4RVUA 3S8MA 1BW9B 3HSKA 1KOLA 1U1IA 4IY1A 3GDFA 5DCYA 2O3JA 1WZIA 3K6JA 3I9LA 5DP1A 1IOLA 3HDJA 1SPXA 3E9NA 4R16A 2YJZA 5C37A 1U4OA 4YJHA 4EEZA 1E3LA 1ENOA 3OHSX 1PGNA 1W8DA 2V7PA 1KYQA 1EZ4A 4RVGA 4NU6A 1I5RA 2PA3A 1EVIA 3H7AA 5TGDA 4PZDA 2X5OA 3LT1A 4ESOA 2YW9A 4D46A 3KEQA 2ZQZA 1Z7EA 3TL2A 3LLSA 1LRJA 4FFNA 3TZ6A 3G49A 3RFVA 1HZZA 5TLSA 1GEEA 3DZKA 2PKQP 2Y05A 1ENZA 1Y8QB 3AFNA 4R3NA 1HSZA 4RPGA 3JQGB 4DPLA 1ZBQA 3S2EA 1KEUA 2UYYA 5KNLA 3PRJA 3OM9A 3H9EO 1DIHA 3AUUA 1DO8A 4PG7A 1IPEA 3SXPA 4II2A 3Q9UA 2VRCA 4Z3DA 3OMLA 2PWZA 2Y0DA 3GAZA 4R9SA 3ZGYA 4MVJG 2RH8A 2Q45A 3ZWAA 4ZQBA 3LSYA 3MZ0A 4AJHA 4NBVA 3TN7A 4KOAA 3ZWOA 1LJ8A 3OQBA 4J4HA 4MKZA 2AEMA 1ULSA 1YB5A 3CKYA 4Z6KA 3G0OA 5CPBA 2CVQA 2HAEA 3DAGA 1NQOA 1Y1PA 4JLWA 4BKRA 2NM0A 1IHYA 2NLOA 2NVUB 3A06A 5BSEA 3I9NA 4CM1A 4EGFA 2VT2A 4FJ2A 1JLLA 4IDDA 3EZLA 4IJVA 1IHXA 3QVOA 4FPXA 3DZIA 1YGYA 3E9MA 1U5CA 1UZLA 2X9NA 4XYGA 5HBRA 4R54A 3PJEA 4CQMB 3FNFA 3CMCO 4PFJA 1XHLA 6ADHA 2Q2VA 4Z0TA 4BNGA 4P4LA 4YRBA 2BI8A 1ISMA 3GLQA 3V2GA 1O0SA 4E4YA 1MG5A 4D79A 3N74A 1GYQA 1N2SA 2IZZA 3O8QB 2BI7A 2JKVA 4CMIA 4OSOA 1P33A 4OQYA 1SEVA 3D4OA 4BNYA 3S2FA 1NVMB 1X0VA 3OIFA 4WJZA 1TT7A 3CZRA 2X4GA 2NUAA 3GQVA 1FXSA 4INAA 5EN4A 2HK7A 2YQ4A 3GNTA 2O2YA 4BKQA 1AXEA 2WTBA 3KVOA 4FFMA 4DMLA 1A7AA 1KVQA 5K6AC 4IDCA 5B37A 1YXMA 1G6KA 1OOEA 2Z1NA 4CM8B 3HN2A 1Q0HA 2BLLA 3E5RA 3I4CA 4ZN6A 2VYND 4RQTA 3QW2A 3C3XA 3GPIA 4E13A 2OFPA 3CE6A 2ZTVA 1O8CA 3OJEA 4IDGA 1V0JA 2J5RA 4OAQA 3ZHBA 2BH9A 3ZCXA 4D44A 5JAIA 2AQKA 5CG1A 1GV1A 3WSWA 1I2CA 2ILTA 4UEJA 1EFKA 1D7OA 3JD3A 5FI5A 4CM9A 4DLLA 1FMCA 3NAQA 5I7VA 1UUFA 4DMMA 4AJNA 2J5QA 1ZCJA 2F00A 4NI5A 4BO2A 3KLPX 4LCEA 2QYTA 2R00C 1NHGA 1P1RA 4FQ8A 2CUKA 2IXAA 1LUAA 2HDHA 1EE2A 4WE3A 3WB9A 1EFLA 4E5MA 5C5IA 2NU7A 1W73A 1BSVA 4RLHA 1ZFNA 4BO7A 5IXYA 1UP6A 2EKLA 1DSSG 2WYWA 4Z9XA 4MVJI 1E3EA 1BHSA 2WJPA 4XR4A 2UAGA 3AJRA 1PJCA 2IYPA 4BO0A 1KS9A 1VM6A 4IJKA 1TXGA 4FJ1A 2W90A 4TSKA 4ZQEA 4CLDA 3IMFA 2H63A 4KP7A 4FR5A 1VJ0A 3UUWA 4II3A 4RF4A 4XEHA 3UW3A 2HU2A 5L4SA 3CEAA 1BXKA 2PGLA 2Q49A 3VZRA 4BGEA 2Q1SA 3HN7A 3QWAA 1Z7BA 2NV6A 4BIIA 4AJEA 3ZWPA 2GDZA 1N1GA 1SAYA 3RBVA 4BV8A 4YVFA 3EYWA 1I2ZA 3SC4A 1MG0A 3I9KA 5DZSA 1A7KA 3AOGA 1NPDA 2C5AA 1EBUA 3GFBA 4J4TA 5JYEA 3D5QA 4N54A 5ILGA 4N5LA 1CRWG 2HK8A 1VJ1A 3D1LA 2P5UA 3EGOA 2VHYA 1ZW1A 3BMNB 4UULA 2Y1GA 1P1KA 4XDZA 4XQ9A 4AVYA 4XKJA 2OHXA 2VYNA 1HKUA 3GG9A 3GUYA 3RROA 3TZCA 1H5QA 3ENNA 1EQ2A 4YT8A 4YRDA 4XRRA 1GL3A 1O94A 1U2GA 1A4UA 4ZD6A 1H2HA 2YFQA 3PHHA 1UDCA 1IPFA 2HO5A 1JWBB 3TJRA 4YAIA 3RD5A 3H65A 4ALMA 2W2LA 3RSHA 4LCJA 2DPGA 4CV2A 3F9IA 3N58A 5KJFA 3C85A 4OXNA 1NASA 3F47A 3R3SA 3MJCA 2D4AA 3LC2O 1ZH8A 4XQEA 1Y5MA 4DXHA 2VWQA 1ZZEA 4DBZA 1BRMA 4NFHA 1HLPA 3RCBA 3UOGA 3WGGA 1AGNA 2OP1A 2QQ5A 4PG5A 4E12A 3BAZA 3FTPA 1FDTA 1ONPA 1GYRA 1N5DA 2W8ZA 4JIGA 4MVJM 4MP6A 3SC6A 1PU2A 4DQVA 3LT0A 2OMEA 3ADOA 4Q3EA 5IJZA 1MFPA 3DBLA 5ILOA 3WX0A 2C20A 4XQGA 3ETGA 1RWBA 3IUPA 3PGJA 3TWOA 3DDNA 1KERA 9LDTA 4WOJA 4S1VA 2HMUA 2JJYA 1ADFA 2PZLA 1E1NA 2W2KA 3PHIA 2DT5A 2P9CA 4JCOA 4NK5A 4WLFA 4C7JA 3FCOA 4D41A 3C1AA 2NADA 1PEDA 4GGPA 4B4WA 1KVTA 3JV7A 2AG8A 4CMIB 5CDYA 3HHPA 4RF5A 5JCJD 1YOVB 1I0ZA 4ND3A 2ZKLA 1JN0A 5BNFA 3D4PA 3E82A 1K6JA 3KLMX 4GL4A 3SVTA 4NZ9A 4TQGA 2C07A 4NU5A 3AU8A 1RM5A 3ASUA 4GLLA 1HWYA 2A94A 3DOOA 4L76A 4FFLA 4PVDA 3M1AA 5TT0A 4I8XA 2EW2A 3R1IA 5KKCA 3BMOA 4O63O 2JHGA 1XA0A 3IS3A 4ALIA 4ZJUA 2CDCA 5F1OA 3D0OA 3GOHA 1SZJG 2VRCD 4RF3A 3BTUA 4E2XA 4Y6SA 5CHEA 3JQFA 1C1XB 4GX5A 4F3YA 1YB1A 4DPKA 5T8KC 2NVUA 5H81A 1JAYA 4RGBA 1NFRA 2NWQA 3MJ4A 5A4DA 1BXZA 2DBZA 2IZ1A 3DB2A 1R15A 4TRJA 4B4OA 3DFZA 3KYBA 3ZN2A 2E82A 3F4LA 4KTTE 3PIIA 1H93A 1LLQA 1ZSYA 3QWHA 4HKTA 3WICA 2J3KA 3KYCB 2CVZA 4LVUA 4DBVO 2R2GA 2B83A 3I9MA 1AE1A 2EHDA 3A9WA 3HADA 1PGJA 1E6EA 1XR3A 3JQCA 3LYLA 4Y6PA 1O95A 1IZ0A 2P4QA 4J91A 2AW5A 1MC5A 1ENPA 2JCVA 2BFOA 2FOIA 1WXDA 1V9LA 3RU9A 4BB5A 2VUTA 3JQGA 4BQPA 4CM9D 7ADHA 5U9CA 4CMEC 5JPIA 1EDZA 2NQTA 2X0NA 4U0KA 2I99A 1UP4A 1LSSA 3K92A 1PZEA 3WTBA 1E92A 2OL4A 3DAPA 1A9YA 3VZSA 3AI1A 1MLDA 3QVXA 1NPYA 5U1PA 3HDQA 1UXHA 2J6IA 2WD7A 4AJLA 5BR7A 4EDFA 5FEUA 1SO8A 3RC9A 3BMOB 3D4NA 1WNTA 2E6UX 1LBEA 1H9BA 5FYDA 3HUDA 4TRNA 1E3WA 4GX1A 4RO0A 4Y6RA 2G1UA 5LC1A 4OL9A 4BVAA 4JBGA 3VVCA 1P1IA 3A4VA 4WNIA 3NTOA 4JN6B 1VI2A 4IMPA 2A35A 2JD0A 4AFNA 1N1EA 1HF3A 1YKFA 4URFA 3KBOA 1GV0A 5IZCC 1YOVA 5TJHA 2PK3A 3NV9A 1Y8QA 4XJSA 3DZJA 3NT5A 2PGJA 3L4BA 1BW9A 1E7RA 5DBIA 1XKQA 2DM6A 4JP3A 2ZYGA 3H5NA 3S2IA 1PQPA 3GRKA 4GLOA 3LQFA 4KZPA 4Y98A 1B0AA 1LDEA 2BGMA 5B12A 1TT5A 3WS7A 3NJ8A 3W8FA 1KC1A 3L6DA 4HV4A 3CXRA 5DN9A 1GTMA 4NMHA 4OO3A 1E7YA 2TMDA 3BTSA 3PTZA 3R6DA 1U3VA 3F1KA 3ONEA 1T1RA 4BNTA 2W98A 2WSBA 5AQ1A 2DTDA 2VN8A 2ZATA 4IM7A 3ZNPA 3HE3A 1C14A 4ZRNA 2X0IA 4IDFA 2VT3A 1Y8RB 4UVEA 1BXGB 1KVUA 3B70A 1E3WB 4NQZA 3WFJA 2UUOA 2HRZA 3P5SA 1E1LA 4R1TA 1I01A 1UXJA 4Q39A 4MO2A 5T8KA 1XLTA 3H3FA 1JKJA 3MCVA 1GQYA 5EIOA 5JBIA 4HX5A 4B8WA 1QR6A 4RCVA 4W99A 5B4TA 2BFMA 3Q2IA 4P38A 1E1KA 3GDOA 2W4QA 4JROA 3I52A 1MP0A 3QRWA 4ND2A 1ZEMA 2HRBA 3PQDA 4R1NA 2GD1O 3OA0A 3R0IA 3OFSA 1PQWA 2Z95A 3BHMA 3BIOA 3BHJA 4J7XA 2QX7A 1PIWA 5IXSA 2AXQA 2Y93A 2O3TA 2P9EA 2PH5A 2O3SA 3C1TA 4DQXA 1DRUA 3ASVA 3AW9A 1TB4A 1X7HA 1I33A 1E3JA 1V3UA 4CM4B 3Q1LA 1UR5A 1WPQA 3GN1A 3ROKA 4YAEA 3M6IA 4O0LA 1KEVA 3I1JA 3FI9A 1NX6A 4FJ0A 2VNAA 3PZRA 4KUEA 2GN4A 3GN2A 1NHWA 4RVFA 3OETA 4IS2A 5K9ZA 2PZMA 2PD4A 5JFOA 1ZJZA 4L8VA 5EJ2A 1UAYA 1P1JA 1Q1NA 3AOEC 1LEHA 2GPTA 4JXKA 5JDCA 1EVZA 4NJOA 4EZBA 5DDIP 1AHIA 2IEDA 1ZMOA 5JMPA 1HLDA 1ONNA 5CPFA 4ZICA 4DC0A 2GN9A 3OH8A 2NVWA 2EWMA 3VDQA 5JYDA 1A71A 4Y8VA 3DMTC 3QE3A 1CQIA 2BRUA 5KKAA 3ST7A 4U0JA 1FDWA 1E7SA 3ZWBA 3E5MA 2OBNA 3K5PA 1YRLA 2VZ0A 2EG9A 2OUIA 4BGVA 2G5CA 1RYEA 4B7CA 4JJGA 4UEOA 4PLCA 3QWIA 2JFGA 3IL2A 4RJTA 3TQHA 1NQAO 1U4SA 3GVCA 3AY3A 1VKOA 1ZXLA 3ADPA 4BQRA 2JAPA 2IZ0A 4TKMA 4B3JA 1U9JA 5EQFA 1DC6A 5IN5A 3W4KA 2DKNA 2FSSA 4HY3A 4OXKA 1B8UA 2BF7A 3INGA 2RBEA 4Z9FA 2YY7A 1TLTA 1ZK4A 2GZ2A 1BG6A 4BNLA 3HWRA 2P91A 4J4BA 2F1KA 3JQ8A 4J2HA 1GQQA 4O59O 2D59A 1GCOA 2C5EA 2GR9A 2JL1A 1EEHA 3FRJA 4QQRA 4UAGA 4F6LA 1E7WA 4OQZA 5JCJA 3GZ4A 4QO8A 1TT5B 3AY6A 4AJOA 4CMCA 2NQ8A 2Y1FA 1F12A 1NAHA 1IULA 1GEGA 2PD6A 3GVIA 3RI3A 4R1SA 4PLFA 3GZNA 5GZ1A 3JQDA 1HE4A 2CFCA 4IDBA 5TIIA 4ZGWA 1P45A 3FBTA 1L7EA 3IKTA 1ZK2A 2GNAA 3VH2A 3H9GA 4IXTA 4E31A 5A5FA 1PR9A 2D5CA 2B36A 1QLJA 1EDOA 2G76A 2FR1A 5TX7A 3WYEA 1IL0A 4ALLA 5C7OO 3C7CB 1CYDA 2ZYDA 3QJ5A 4IZHA 2HMWA 5TJ9A 1EQUA 1LSJA 3V1YA 2AQHA 4MINA 5DULA 2CZCA 1HDXA 3IP1A 2WEKA 5ER6A 4NG5A 4W4TA 3QQPA 1J6UA 4PG8A 4BNZA 4F46A 3PHLA 5IAAA 1NWCA 3ZWWA 5CEEA 2O7SA 5THKA 4Q3BA 1M66A 1JTVA 1ADBA 4ALJA 4Q9NA 3PWKA 1NXQA 1S7CA 4OHUA 3DFUA 1LDGA 1K5HA 3IC5A 5G4LA 1PGPA 3BHIA 2HSDA 3GT0A 4J9UE 2IRWA 3FHLA 4LMPA 3UHAA 3OEWA 4XZ3A 2BGKA 4A0SA
chains in the Genus database with same CATH superfamily
3HO1A 2APJA 1CUAA 1KY2A 1E9VA 1UZMA 1ZHFA 2D0PB 2LDBA 3WQSB 4XVUA 5JAHA 2D3WA 4LRWA 1KMHA 4AO7A 2N1MA 1DHRA 1G18A 4LNAA 1B1CA 1VPVA 2CZQA 2QE6A 4FMCB 3JD4A 4IIDA 1EESA 3L8HA 2WB2A 1MABB 4ZI7B 5FWDA 1F1JA 2XVAA 2HN9A 3T9AA 1TGVA 3ETEA 2GYVA 1L5ZA 2IXTA 3TIXB 1S02A 3A9RA 3UNXA 1TIBA 5U4QA 1O57A 1RIIA 3G02A 4OU5A 5B30A 1H66A 3E58A 4RDIA 3BF8A 4KR2A 1J1UA 4HQ0A 1O97D 2VJNA 3PNYA 5HP4A 1C0PA 1P4AA 1RJGA 1NATA 5B3KA 2YWJA 3OKPA 2PX3A 1DPGA 5AJTA 3JAMA 2EXXA 1WVMA 3HUTA 2X9LA 3SM3A 3UYKA 1SCQA 2Q1UA 2XF8A 1O9BA 2YJ4A 5KBYA 5IBPA 1J42A 4KO8A 2SICE 3KJQA 2FY8A 5HPYB 3QF7A 4YYZA 2RGXA 3DQZA 3H3XA 4BWVA 3VU0A 4WI1A 1H0RA 1KQOA 2VH5R 2ECOA 1KVSA 2YNMA 1X7XA 1B6SA 3Q3CA 1TK9A 2YJNA 3CT6A 2PZFA 4DUPA 5BW6B 1CZNA 4NK4A 2ZPAA 3EA0A 3S2GA 3AFOA 4R1MA 3GAMA 5JAMA 4IVRA 3QI7A 5A9TA 3O2SB 4NYMQ 2R6DA 2B6NA 3G8YA 1HQKA 2ZJAA 2AFIB 2ZW9A 4QFDA 3AP3A 2OYRA 1EK0A 3GMDA 1WPGA 3M9LA 5C4GB 2QTRA 2WA1A 5JCZA 1J99A 1V8BA 2AVNA 2XMZA 4LGMA 3HO6A 3OTQA 4UXIA 2JVJA 1N2BA 2I6FA 3OLXA 3PVZA 1XPJA 4G56A 4MARA 4NONA 1NG1A 1FFCA 2NW6A 3B1VA 3DTYA 4X0EA 1JYSA 4DQDA 3AR6A 4JLDA 3E2PA 3F5MA 4WKBA 1F3OA 4F5DA 4CFZA 1KZ9A 4UPVA 1ID8A 1LVGA 3TNDA 4DA9A 1YS4A 3D6MA 2VJBA 4MS1B 4OKSA 4P7BA 3RKUA 1R6DA 3CRW1 1M6VA 1BH6A 2VS1A 3PDIA 3PGA1 3LPMA 3QBTA 2OXIA 5KDLA 3RVLA 3ZQJA 4EKYA 2Q46A 2A9FA 2JGIA 4ETWA 1PWEA 1VZ3A 2QTBA 4QD3A 3LS2A 1ELOA 3BEOA 4UOEA 3RAGA 5FNVB 1EFCA 2QN6A 2RHLA 3ZWDA 2B0JA 4YB8A 4JNKA 4PX2A 3OZEA 5BVHA 2A1UA 4N0EA 4EO9A 3K4HA 2OV1A 2QN3A 3FVRA 1C3OB 2YHUA 3R74A 3OQHA 4HTFA 3NTXA 3VX3A 3OQNA 3E84A 3K1AA 3MINA 4O2LA 5LFAA 3LNCA 5LUBA 3SIPA 5I5GA 3L1UA 1NSFA 1DO0A 2WD7B 3S7ZA 3UWOA 3KZCA 5BSTA 1ZI9A 1ZKDA 3Q2OA 1DEAA 3LK7A 3I83A 1Y42X 5DM1A 1S0UA 7REQA 1I3CA 5CW1A 3IELA 5EXEA 2X15A 3G1WA 4G85A 3IALA 3CA8A 3TFQA 3WRWA 1MJHA 2CNWD 5ENZA 3TRDA 3WOVA 3EGVA 1T8TA 2B94A 2HD4A 3AWIA 3PHCA 4H1HA 4QPPA 4D56A 5JATA 4AZTA 3IJ5A 3GA0A 1AHNA 2WIGA 4C6HA 4PCUA 3AR3A 2AA3A 4N7RA 4NYJR 1EK6A 4B80A 1CEEA 4OVKA 1RZ3A 5A71A 2GJAA 1C9EA 3G2NA 3ACDA 5EE3A 5SICE 4AXXA 2D5BA 3L1HA 5ALFA 4HQRA 1IM2A 3LUBA 5E1MA 3B5EA 3FMVA 1ZXXA 4ZCIA 2XJ9A 1RZRD 2UDPA 4ZAGA 3VKGA 1ZWLA 2I71A 4TVBA 2WYOA 3B82A 5BN4B 3L4EA 3ABZA 2QTVA 4EECA 2CD9A 2WD8A 4OYHA 1EAYA 2YHBA 3C97A 5C9ZA 1NURA 3D1JA 2M1ZA 4GQAA 4UZSA 3EHDA 1NVWQ 3FOWA 3MB5A 1U8AA 2DQYA 3Q8WA 3SKYA 4BS9A 2C0CA 1SRRA 3HXLA 1V5GA 2BEKA 3LXRA 4HDRB 1KTIA 1EEXB 3GEMA 1T5SA 2BGLA 2IYLD 3BXOA 4U6QA 4URVR 1NLMA 3S29A 1O8BA 3LHIA 2E4WA 2ZBDA 3LZDA 3M6VA 2M9MA 2QP3A 4WZBA 1NJSA 1QH1A 1UAGA 2JLRA 3KJNA 3NXSA 4PSCA 1P3JA 4B5KA 4OLHA 3TOXA 1CDOA 1ES9A 2G04A 2AJBA 1OFTA 2GAAA 2J3EA 2YJ5A 3IV6A 2VR1A 3OCJA 3UAZA 1NG9A 2QTLA 2YV4A 5IK2A 3P0IA 4FIZA 5C2JB 3PGXA 5HKOA 1X1BA 3EMBA 5FYQA 1GPMA 2XVMA 4NP6A 5KZMB 1X7DA 4CU2A 1UP7A 3OHMA 3L49A 4FYPA 3FVVA 3LO8A 4KSCA 1PR0A 2OKGA 3H9JA 5FI0B 4AYTA 2GCGA 4P92A 5IUNC 2H7XA 2WMNB 5CB4B 4KYTA 1TL7C 2PLFA 3AM5A 4JXXA 2ZPTX 1PQYA 3OOSA 2EEPA 4L5CA 4N40A 2PU7A 4RZ2A 5CTJA 2QPLA 5LNK6 1WSDA 2BEWA 3H2IA 1NM5A 4B5LA 4PYMA 1Z88A 2B4RO 2ZCVA 1XDDA 4TVOA 1ZL2A 3R5XA 4MKIA 3QXSA 1MRSA 4OB6A 4Z7JA 2I8AA 4YBRA 4U6NA 3UMSA 3ONDA 3ZBPA 4X60A 3KPUA 1KFJB 1U8TA 1Y6ZA 2VYVD 3VHXA 3WGYA 1N6PA 3FGNA 1JH9A 1BFKA 1RS0A 1WY7A 1JWAB 1W34A 3B5IA 4NZMA 4QM7A 5HA5A 4ALKA 1LX7A 3K09C 4OX9B 4CQMD 4MPPA 1AS2A 1GGJA 4KC0A 1M1YE 2YQZA 3CKLA 3OU2A 3C3YA 5EP1A 1XU9A 4ZEWA 3V2HA 1EBFA 1XK6A 3ELUA 2XZLA 3SWWA 5BQOA 1D6SA 5I8ZA 5KOYA 4DLRA 1KY5A 1ID1A 4ZGBA 3GARA 5BWOA 3B52X 4YT5A 4WY8A 2VHZA 2JLQA 3QFHA 3R0VA 1RAFA 3WNQA 3PDWA 5JDIC 1VRCA 1AGXA 5DLPA 1ONOA 1BD4A 3CNOA 1EMDA 1PNOA 4X61A 3I04M 4L8FA 5I9SA 5TGZA 2J5KA 3GNQA 2FEXA 1R9NA 2C4KA 2VXOA 2ZTMA 1Y9EA 1Y6QA 1BVYF 2XMGA 2AE1A 3RH0A 2VWHA 4PG6A 5DV9A 5TQ2A 5A1TA 1IOZA 2W7TA 1JECA 1PT6A 1PZMA 3G9UA 4U2KA 1ZD5A 4HGQA 4EITA 1YGPA 2GHIA 5IAEA 4YIHA 1YZHA 1OYYA 4ZT4A 1NQTA 5FT9A 1PJSA 1FE8A 1HG0A 1WNFA 3NP9A 2O7VA 4JVOA 1K3FA 5A5GA 4B3TB 1AHHA 2C3YA 3CR3C 2BCJQ 3EOZA 3FZYA 3QFSA 4EYSA 1HFWA 2B61A 5B57C 3BWCA 2W6MA 3QUSA 1XXHB 4CKWA 4L4YA 1BNCA 3DOCA 2AXPA 2NSJA 1QGOA 4C1BA 3IVMA 3WGUA 4CEHB 1JR3E 2IYYA 4HZGA 2X6RA 3KZVA 1JAZA 1SJ9A 3ON5A 4MW6A 2RGDA 5D1HA 1IN7A 2JI6A 4FN4A 1QCDA 3AHFA 3ILYA 4M36A 4OQLA 3TRIA 3GBPA 3U4DA 1CY7A 1T6ZA 1WV0A 1V26A 4JSTA 4CLXA 4FILA 5FO1A 2IDJA 4BZZA 1KMIY 2WVHA 2ZJ0A 5AH0A 4PWYA 2G09A 1F3LA 5IYZF 1Y7IA 2ZRDA 1PNQA 4IV5A 2AMFA 4ENVA 9ABPA 1AQJA 2H17A 1UIMA 3EGXB 1JMYA 3G9XA 4BFLA 3OZVA 4FFWA 5HE9A 3WJ2A 1QHIA 5HILA 1T8UA 4OHFA 4UM8B 3IGFA 2PZAA 5NLLA 1S2NA 1NUTA 4PLPA 1JALA 3KQQA 3K30A 8AT1A 1OWLA 2HYDA 1B8VA 1XDWA 3RC1A 2NU9A 4D4JA 1U7XA 3RYCA 3OPXA 1ACLA 1I4TD 2CVPA 2HMSA 4UNNA 5CW2A 2XT9A 2YWGA 3UXHA 3PIDA 2F55A 5DKFA 5A5EA 1VRWA 3GJ4A 2WAYA 5AHRA 2Z8YM 2GK6A 1R0LA 1WO8A 3GD7A 1US8A 2AYYA 3BA6A 3OAAA 1ZI6A 2YWFA 4NFSA 2BGJA 4ZRMA 5E8JA 3QTTA 1UPXA 4HWOA 4M60A 4WFJA 3TNFA 3WLFA 3SDZA 2WI8A 4FE4A 5HQ3B 2MSNA 4ND5A 3I9JA 1UQTA 2FE1A 1YL6A 1TM3E 2FHSA 1RLTA 5IANA 4ZVTA 2JIPA 3BUSA 3JR3A 2DH6A 2OBBA 1XTQA 3H75A 2SKDA 4EBBA 5DBOA 3OQ6A 4NOMA 1TTTA 4LJ9A 3R0ZA 4J2TA 1XT6A 1K0FA 5JAUA 4DR6B 2CJPA 3LBYA 1ZGAA 4RELA 3OC0A 3FWKA 1CVRA 2HQ1A 4BVFA 2XV1A 1XNRB 3WQHA 1TKRA 3VO9A 3VSAA 4A73A 3L07A 5BPFA 2BELA 3B20A 3SE0A 2FFHA 3AEUA 4N8EA 4PEVA 4WJLA 3UB2A 4Y2VA 1LPBB 1W2HA 1T9ZA 4FGWA 3T7EA 3SZLA 2ORIA 1JHRA 2PUFA 4M8LA 4O2BB 1X8JA 3I1FA 1X7ZB 4MWBA 5FUYA 1F1BA 4M1KA 1B93A 1V5FA 2KSQA 2WLTA 3PP8A 4BUCA 5TMPA 2OLJA 4Q9DA 3W5HA 1D09A 1MGPA 1R0RE 4MLCA 3R6LA 5EZ6B 3W7VA 1Z5OA 3PWSA 4TTTS 3WDKA 1QGUA 1CDZA 2VP0A 5I7FA 4J1QA 3K7EA 1CQXA 2A58A 2GHQA 1CUHA 5LZ7A 3FFXA 3OHPA 3WLKX 5AIBA 5JJCA 2J3MA 4LPKA 1NRXA 1CUVA 1WD7A 4I9FA 4L5AA 3QLJA 4LRYA 2Q4OA 2JEOA 2C2XA 3STWA 2RH4A 4UBKA 5LLTA 1E6MA 3PNSA 4CQLA 1DLJA 4BL5A 4FI3C 2AE2A 3UEOA 3MSXA 3GYBA 1H6AA 1XVUA 1EK2A 3OEED 4QUEA 2LWIA 5F2KA 1KYWA 4J03A 5FULA 4RXTA 4CFYA 2C5BA 2I4OA 2OC9A 3Q10A 4LNUA 4E88A 3F9CA 2ZRCA 2FZEA 2PIDA 4K9PA 2HK6A 4QFBA 4RNCA 5F1KA 5JV5A 5E0OA 1X1RA 3BFXA 1K5GA 5HKKA 1QV7A 1RJ9A 5ALNA 2FPGA 3MW8A 3QFTA 1OAOA 5EYPA 5BV7A 3G6KA 3ESQA 2ENWA 5EERA 4UOZA 1X8KA 2Q3BA 1SXJB 1E89A 2CHFA 1J00A 2IHJA 2IY8A 1QB8A 2QXTA 4G23A 4CTMA 3PX7A 1A76A 1Y5NA 4HAWA 3E1KA 3FWNA 4FYIA 3N8KA 2OG1A 3ESDA 1VBMA 3X1JA 2CXTA 1PQ4A 2E48A 3PC4A 4H1WA 3ZVMA 3A10A 4OX9Y 4FSDA 2COEA 4HGOA 5J2UB 1YCFA 3AUFA 3B13B 2EGHA 3GEHA 3R7SA 4C0BA 4CDMA 5K0FA 1ZW6A 2DUUA 1P31A 2JHCA 4JT8A 1XA3A 4TZTA 4DCUA 1S9DA 4KQ6A 1KEZA 1H6CA 1UPCA 1BJTA 1DXQA 4ZO7A 1UC5B 4JJEA 4QWWA 4ZQHA 5ECYA 3FUUA 1FVHA 1NDUA 3L7NA 3T34A 4UM5A 3SQMA 2IXDA 3KTAA 1M2OB 3IQDB 4ZO6A 4QUIA 1C7QA 4B0PA 3QTBA 3K0KA 3F7NA 4E3ZA 2R7NA 3HDGA 3AUSA 3VR6D 2OBFA 4AS3A 2REOA 5K03A 5CEJA 1K75A 2DFKB 4QE3A 4QFMA 221PA 2EG5A 4M0LA 2R00A 2GFIA 4K9MA 4U4AA 4YRQA 5SYMA 2Q5IA 3RFUA 3RJ5A 1LY1A 3U3XA 5B36A 1K68A 2PMCA 4BTLA 3WB1A 2W6JD 4WCFC 3Q7TA 4F7DA 4CLOA 1EIWA 4XB1A 1NR1A 3MRTA 4DWOA 3H9UA 3KM0A 1ECPA 4AW9A 4CDRA 2OD9A 1C1XA 4FR2A 2QV0A 4XUEA 2WM9B 2FSIA 4CF3A 4A8JC 3WLNA 5G0VA 4E1VA 3ESCA 1W4RA 2PTGA 4I4IA 4FFPA 4IAOA 1YBVA 2BKUA 5C8YB 1QYIA 5IYZB 3IQEA 5JS6A 5KNDH 1JI0A 1HH4A 1VIYA 5CNKA 1FP4B 3MPOA 1H22A 1DRVA 3UA3A 5KHOC 3IE0A 2Y9PB 2VRWA 1FJXA 3DBHA 1ND6A 3BFKA 1Z2PX 4HYQA 5E4FA 3ZTYA 1G8HA 4C0HA 5IJ9A 3VPFA 3T95A 3RK1A 1T0HB 2LKCA 3PFWO 2DWOA 4F9EA 7MDHA 3A9SA 4KG7A 1NV8A 1QZ3A 2KJQA 3GP3A 4RPHA 3LSTA 4CLOB 5JD5A 2CJFA 1JQBA 1T1IA 1U3GA 4OM7A 3DWFA 5F7ZA 3RVRA 4ER6A 3NWEA 1IZ8A 2R1UA 2D5AA 2Z83A 2Z8YA 4DGQA 3DOUA 3EXIB 4ZA2A 5JFGA 1X8XA 1X94A 1BOOA 4S05A 1HDRA 5JH7B 4F4DA 4PIPA 1T6XA 4UCFA 5AXDA 3WI7A 3ZJUA 4LFCB 3A4NA 3QX8A 2B92A 2PQ2A 5G53C 5HKLA 2IV3A 4HADA 4OP2A 3E1GA 3T5BA 1P5JA 1YWGO 4QHTA 1NXPA 1TADA 2JGKA 1TJ3A 2HU5A 2R60A 2ZJBA 4MV5A 3JQ9A 4BNDA 2Q2WA 1LFDB 5ESWA 3TVYA 1BCRA 3O94A 4NBRA 4MGHA 4QXAA 3VGPA 3KCNA 1Z6AA 4XVQA 2YFHA 3EB9A 2YHIB 3GRVA 4LTNA 4AIIA 4I81A 3X1XA 3RYHB 4MGYR 3MTGA 4MULA 4CPDA 3AF5A 4XX0A 1ZHOA 3DBRA 1NA5A 4JLVA 1GCAA 1HORA 1XALA 4FQ5A 4IH9A 3TQQA 4WUVA 3WBBA 1S3GA 1JR4A 4YMVA 2P78A 2QI9C 3EZ2A 5T64A 3UC5A 4AI6A 4PZZA 1XEAA 1LKZA 4YRLA 1WE2A 3CUKA 4KQXA 3LT2A 3AFHA 2GRUA 1SC6A 2JGLA 3FFBA 4V0QA 4Y9TA 4HNGA 2GUWA 2WSYB 2VJDA 3ZE2B 2OHOA 3TZQA 2CJWA 1D0IA 2C2OA 3BMCA 1KPGA 1WDKA 3N53A 3AF1A 3FYHA 1R4NB 4DLAA 1I80A 4CM6A 4F4UA 4TVSA 5IF3A 2BKEA 3DLCA 1OZAA 1P5RA 1Q2XA 3PD7A 4C76A 4IGAA 2AYZA 4X85A 3W2EA 2XYGA 2YFKA 1AB6A 3N0XA 4S04A 1NLFA 1QOPB 2DTXA 3LCUA 2C59A 1KJQA 4RY8A 3W1VA 1L5QA 4XIIA 4A8JB 4GOMD 2ZJ1A 5ALGA 3ZV3A 5HDBB 1LRKA 2ZQYA 4NRDA 4IIVA 5BUZA 4N3NA 3NJRA 1FSZA 4PBTA 4GMDA 3TS1A 3ZHVA 5CBPA 4N0DA 1IY1A 1IBCA 4GDFA 1JXOA 3BWXA 3SLRA 5JU6A 3ZHOA 3O82A 3P2MA 4I4LA 2C2KA 3NRCA 5G2OA 1YQXA 4RIGA 1FYVA 1KIFA 1JBQA 1GIAA 121PA 1WU8A 2AG1A 2JIMA 1G5HA 4LXTA 2CHVA 1G3QA 2Z08A 1E2BA 4JNCA 4IP0A 4O02B 3NPMA 3Q2KA 1CJTC 3QEOA 1DKQA 1IZ9A 1C1HA 1VL5A 1XHFA 4HWGA 4GRIA 3JD2A 3I32A 2IS1A 1O6ZA 3VU9B 4KLNA 4X1IB 3NJ4A 1PEYA 2YN2A 5HIJA 3VI4B 3LY5A 4G0OA 4X92A 4NOKA 4OJTA 4XGKA 5K3BA 3E3LA 3EJ6A 5EQDA 4ES6A 5KNDD 3U4MA 2C4TA 4FT2A 1GN8A 2WF6A 2C2HA 2IIBA 3DFIA 1P1HA 3FKSD 2GTIA 4LISA 2G9NA 4KREA 1REQB 2FA9A 1U5BB 3DWGA 3KXDA 3PJRA 2AFHA 3RVMA 4A5SA 3BZUA 1FFBA 1WW8A 3DKKA 1Q1QA 2DHCA 2RGYA 3K9BA 4Q01A 2ERXA 2ZAMA 3H8VA 3LQ1A 5DW0A 5IAJA 4TLEA 5EKTA 5BSVA 4FD2A 3WGIA 3WOHA 3R3UA 1BVRA 1II8B 4MIEA 5DM0A 3A1NA 3D3EA 3N5KA 4YFYA 5BOVA 4MVJA 2DF8A 4NZZA 3A3YA 4LTMA 1LA2A 2ODPA 2YQ5A 3WNZA 4PY2A 4E11A 2HWUA 5CDSA 3UO8B 4I1IA 1C7ZA 2QSUA 4ZT3A 2OECA 3GLUA 4PLVA 1H4QA 4S1PA 2AZXA 1B3RA 3UK7A 4KO3S 1N6LA 4Q7EA 3V4PB 1PT9A 3P2KA 2RI1A 4NNJA 2QUKA 2WTNA 3L7CA 4H6VA 5T4HA 4Q12A 4P08A 1ZU4A 3HB4X 1UBTS 2YDYA 5DLQC 3SHWA 5ICFA 4D6PA 5T5QA 4JASB 4TYMA 5AVOA 4K9DA 1GKIA 1PR2A 3DAYA 1RQGA 4ZOQI 1JDBC 3LC1O 5IVIA 4HZIA 3GHYA 3AZQA 4FOPA 5DGHA 3RASA 4YXFA 4C5AA 1IPHA 1RXUA 1WWKA 1GCUA 4IIUA 1U63A 3CJRA 3FNQA 3VH4A 1WBDA 2CK3D 4DUGD 2DEUA 2EFYA 3JVIA 5KU1A 5AKZA 4YPVA 1JEYA 3QX3A 3PC6A 1R37A 2XOXA 4GBJA 4QOSA 4WJKB 4TT8A 4WUTA 1YZYA 4E2YA 1YKGA 2X3YA 4EQ6B 3EAFA 1K6EA 4PR3A 1TM1E 1QE0A 3WIOA 4LK2A 2JASA 1FXWA 1L4GA 4KUHA 1LK5A 1RBZA 3OF2A 3PD0A 3QUAA 4MV8A 1FX0B 1UK8A 4M46A 2N75A 4XJVA 4XRGA 1SXJA 3ZHZA 2C4VA 2YH2A 3WG9A 1HTTA 2YRFA 3RUAA 5I9NA 5JXIA 2QIPA 3T6KA 1SCJA 2Y92A 3LG2A 4MR7A 5LQNA 1TVKB 1XRLA 3R5JA 4R8VA 3RTDA 3HG7A 4MUGA 4B4UA 4BQFA 3LF1A 2ADMA 4M4SA 2W5UA 4XCVA 3L7YA 5FUXA 1FFGA 1RABA 3B1JA 2O2JA 5KX5F 5EVJA 2F1JA 1YO6A 1JU3A 2V6MA 3CRRA 3I3OA 4GX2A 3E2MA 3K9GA 4HX9A 4PZEA 5KX5A 2LTAA 3HM2A 4N01A 3PJGA 1VHTA 4K9SA 3WQQA 5K05A 4PG4A 5I4CA 1PJ8A 1WB6A 1E2UA 2XGOA 4R41A 4U7PB 5HGXA 2I34A 3FWZA 2COKA 3PPWA 4RCYA 1YDGA 4QYTA 5HKKD 4I1PA 2XB8A 4XIGS 1Z4OA 1X3LA 3OT1B 2C04A 3IUEA 4M0DA 3UMRA 4LJLA 4DIUA 4EBFA 5HF5A 2QUAA 2QZ9A 3JY6A 5LA6A 4P58A 1U7ZA 9MHTA 1U1EA 4H77A 5CGZA 4BGIA 4JJ7A 1X86B 1MOPA 3JD1A 1X2EA 4ZDIA 1SKYB 4L28A 9ATCA 3NAMA 1P0CA 4HTFB 4LMAA 4H7PA 4A8HA 5I9LA 1U2ZA 5B3JC 4MW4A 2CJWB 1C7IA 3NM6B 3TOZA 1A5ZA 4KMOA 3MEQA 2UYHA 3COPA 3HY3A 3TNLA 1CEQA 2HH9A 4DIFA 1VCHA 2JATA 3C1OA 1H05A 2F8MA 2JFYA 4G1VA 3PZBA 1P60A 3V1NA 4QKQA 5ALPA 2J30A 4L0DA 3ZHXA 1SBHA 1YZFA 3DV9A 1AKTA 2D8AA 2VWPA 3C7DB 3HYRA 4X71A 3WNVA 4R81A 3ZQUA 1H1LB 5CXUA 1B8OA 3N76A 2XWPA 2P67A 3DD1A 5DP2A 1LTQA 1UADA 3ZY6A 1SWVA 3T99A 1YDFA 4WGGA 3L7LA 3LHKA 2PSHA 2PSDA 1N5LA 3QHPA 4HGPA 3ITDA 2J3DA 1XJ0A 1Z35A 2VNHA 1O5TA 4ZAFA 3PKZA 4H0CA 4TWBA 5C32A 2AEJA 1VDZA 4MQ5A 4O4JF 3RG8A 5HUHA 1Z18A 2Z09A 2R6R1 2OM2A 4C4OA 3K72B 5T41A 1XVIA 5JQWA 2RHHA 4GM0A 1V9SA 4EOGA 2DECA 5AVTA 1E2IA 1EWYA 2DC1A 2QMEA 3RF7A 4CODB 2JGJA 1SCUA 3PA8A 3LBNA 3AEUB 1EGQA 2OORA 3DBOB 5DTRA 3VOBA 5JHHB 1XVVA 3GAAA 4FFBA 3H42B 3PDJA 4GZ5A 1CZLA 1TX4B 5TSDA 2WWWA 2WE7A 2WFZA 5AVJA 1U2SA 2UXDB 2X4IA 1I6LA 3IUJA 3ZHYA 3IRVA 1N8SA 3OJ0A 4JI1B 1MABA 4WN3A 2GLXA 3RANA 1EFAA 1IBLB 1PUJA 3Q40A 4JYMA 1JBKA 2HU8A 2WMOB 4CV0A 1R8XA 3C4JA 4WLOA 2N1BA 1SH7A 2ZWOA 3SLKA 1DFHA 1ZVMA 1W30A 4UVIA 3SEFA 1W85A 1AXGA 2H52A 5AVUA 1U7HA 1I24A 1CJBA 4YLEA 5G0UA 3NHJA 1TMYA 4BX0A 3MYYA 2O52A 4WOKA 3T5AA 2B7CA 4PZ9A 5DVZA 3UJ7A 2HM7A 1T2EA 3FOAA 3LIIA 3V2UA 3K70C 2IVZA 3Q7EA 1ORVA 2C8JA 4FZ3A 4LV6A 4POAA 3NHRA 4D81A 3H1BA 3HBFA 4OK3A 5ALHA 4AROA 1WDLA 3BBPA 3OIYA 4EEKA 2G72A 1LLCA 3HU3A 1T2CA 4HATA 4DABA 3K2QA 2J3HA 3MMNA 1WY5A 1QP0A 4NCJA 4E1BA 1FRNA 5HF9A 5TC4A 2YXBA 1X1AA 4COOA 4Y2RA 4ETMA 2PRZA 1KNQA 3DR3A 3GRPA 3OM8A 2XB6A 3RT9A 3WGLA 1P1BA 2RARA 1C3EA 4G63A 4WWHA 4A8TA 1TAHA 3C39A 3LAWA 2HJWA 5EIBD 1U81A 1GLGA 4PZPA 4YRKA 4C4PA 4DC1A 3SHVA 1SQGA 2ZUWA 1AUXA 3CPEA 3B7PA 5EGSA 3KC2A 1QMGA 3HY4A 4C78A 3Q85A 2XPCA 1HI9A 1QWSA 4Q1BA 2AMJA 4CL2A 2XUIA 3QK7A 4XGQA 3IODA 2YMQA 3I8OA 3OPQA 3B3GA 2L0XA 4NATA 4RPKA 3MD9A 1GQOA 2VZ8A 1BROA 4KKXB 3FR7A 4FUQA 5EJEA 1QV6A 1AG9A 1C3XA 3KVVA 3PEEA 3EASA 4JJ4A 1OVMA 1THGA 3MQ2A 3RS4A 2L18A 1VPWA 1N2IA 4IUYA 3GF4A 1MCZA 1ORIA 3HHEA 4FGJA 2L69A 4ZQIA 1H4SA 1AS0A 1KP3A 3ORSA 3RABA 4TVKA 3OX1A 3QV1A 4CUZA 5B3JA 3BE6A 3COYA 2AB0A 1UJ5A 1U1GA 2VAXA 4LJ6A 4O2RA 4HZUA 1Z3IX 1LW6E 2C2GA 3EIEA 3I23A 2O8FB 1Z62A 1VL8A 3OU7A 1F17A 3CB2A 4P32A 1X14A 4PHGA 3GRZA 4R3WA 2H51A 3GP5A 1Q84A 3F6SA 3F4BA 4B75A 4N41A 2BEUB 2HSJA 2AWOA 5BVGB 1LI4A 1R10A 5BVHB 2XZPA 4KQGA 2PV7A 1T6BY 1RZVA 4ZTBA 1S6YA 2AG0A 3EXFB 4LVNA 2JKYA 2ORYA 1ISGA 3W8DA 1W5BA 4MGIR 5DOVA 4TTVA 3SG0A 3ZWNA 1XNQB 2EIHA 5TMBA 2QP9X 5IARA 4LYEA 4C4TA 2DKFA 4IIYA 4L8YA 3A1SA 3WISA 4F71A 4Y2SA 5CDTA 3JQ7A 1DDIA 2OXRA 4FWIB 4LJ5A 1C3LA 5K8JB 1KFCB 1CR2A 1YBHA 3M1LA 1E5LA 2H1FA 3B2QA 2WB4A 3R23A 5J2TF 1NP7A 3KEMA 3GGPA 3FLBA 4Z4EA 1PR1A 5A2GA 3PTAA 2FEAA 3ZHTA 1NRJB 2BH2A 5J5VA 4G4IA 2NSHA 3GT4A 3BC1A 4NFLA 1APBA 3KKMA 3IAXA 1KEPA 1T3TA 1QYWA 2YWRA 3ANMA 1Q7GA 2JAHA 1Z0IA 2HDWA 3DBIA 5DHSA 3IR6A 3TXAA 2TMYA 3PB3A 5H70A 4JBLA 4RV9A 1FDSA 1UFVA 5LBTA 3W8NA 5A6VA 2Z8XA 2CLOB 4P7JA 4UZEA 3HRKA 4MVJD 2IY7A 2VUHB 1T2VA 2J0EA 3ETCA 1XTPA 2PJZA 1A5SB 3TCNA 2M6KA 1UPUA 2ASVA 2IIQA 5G1PA 1U28C 5JWRA 1G38A 1BA3A 5H82A 3WK6A 4ZMRA 3L9XA 1DKPA 1K2WA 1G5RA 2E2WA 4QOEA 2DWUA 4QT0A 5F21A 3SMVA 4G4GA 1RXYA 2F3QA 3UV3A 1B3BA 2JJ1D 1ZJYA 4O4JB 4CLRB 2ZXUA 1PYOA 2X4DA 1WSWA 2AG5A 4BNHA 1PR5A 4QQKA 2BT4A 5DOZA 4RXMA 4A10A 4CDNA 3DNPA 1Q21A 1DKOA 3OCZA 4QBKA 3K0CC 3ZK8A 4R71A 1PZGA 3OE7D 2HNAA 3ONNA 3ZH2A 4IXDA 4WADA 4DUGA 4MW2A 5KYXA 2J4CA 1MR3F 3MBOA 3TRJA 2PSEA 4K9KA 3H2ZA 4ROSA 3ZE7A 3M9WA 4U02A 4URWR 2ZIAA 4JU9A 2Y0CA 4YUVA 2H5LA 3ND8A 3PNVA 4MVXA 5FF9A 5TEVA 1U7TA 3CN7A 4HG2A 4DOMA 4ZJZA 4WCVA 5CG2A 4CM3A 3OO0A 4L1KA 3TCXB 1M5UA 4FGUA 3KHTA 4BQNA 2XQGA 4MWTA 4YUYA 3IVCA 1WU7A 2ZYVX 3DFKA 1CW2B 1DAPA 3QUTA 3D3NA 3M4YA 4KX5A 4UPDA 5CVVA 2JGEA 4PBRA 1UXOA 3HCWA 1VLQA 3ORRA 5E7JA 4J90A 3ZIAA 4FU0A 2JIBA 1GG5A 4Y0VA 2FAXA 3PYXA 3W90A 4YJ2B 4YCCA 3RS9A 5J47A 3LPCA 1E1RA 5L95A 3N7AA 3ZK9A 1S4MA 3LGSA 4KIFA 3FD8A 3KTDA 4KQKA 4P4NA 4F85A 1D0VA 4EMBA 2I66A 4JJ6A 5B64A 1DBWA 2CHEA 1TRKA 5FI1B 3CZPA 2FFJA 1NSYA 2OZLA 3NDJA 2KWIA 2MSEB 3GP8A 4V2IA 1FLNA 1RXSA 2PMKA 3MCUA 3P2EA 1UBSB 5BQFA 1TYDE 2VVTA 2YV1A 2HMVA 4F5ZA 1WM1A 4CM4A 4BJ6A 1SCDA 4ZKDA 1SBTA 2YRXA 4BWGA 2QVYX 3K9QO 3LWBA 2ZT7A 3OCYA 4H59A 1DBQA 1VG8A 2GGSA 1Q91A 1LW7A 1L8QA 1NKTA 2WHPA 3DQPA 1RJWA 2PGNA 1UKYA 1WR8A 1LNSA 4GKBA 4KFUA 4P36A 5JQGF 2OGUA 1Z9BA 2G08A 1JJIA 3DF7A 3ECAA 3LUCA 3QWFA 1U2GC 3VAAA 1JDJA 4CVNA 5A3JA 3AHIA 4MVWA 2C9DA 3SHFA 2Q3LA 2R7LA 2WFLB 3EULA 3WFZA 3AWDA 2ANBA 1KJ9A 4Y6QA 1PKEA 1MAVA 2DOKA 1B6RA 5FBLB 2I4LA 1MOSA 1YS7A 2HRCA 2YHIA 3T5DA 1TMGE 4RVHA 1KKLA 2BFWA 2G07A 2PD3A 2EP5A 3G23A 3FPCA 4IEEA 2ABWA 3HR7A 4BAGA 3OTOB 3RVDA 4J9VA 2EERA 1II0A 5AKYA 1QFXA 1Q0ZA 3KSRA 4UFPA 2AT1A 1JIQA 4BNDB 5JNWA 2O1EA 2VOEA 3N5CA 1IXRC 1QO0D 2I4TA 3QVMA 2O2CA 4MQ4A 4MUHA 1PJLA 4F21A 3Q41A 1A5AB 3BT7A 1JFRA 2DBQA 3VR1A 2IS4A 3S44A 1PT7A 1ESDA 2Y76A 1R8QA 2XIQA 3OQJA 1K3TA 3B1FA 4NKRA 3TQRA 3S2ZA 1X15A 4IOMA 4JJAA 3VUFA 1GYPA 1DJQA 3W6UA 5JBNA 5KYYA 4J1NA 3WGKA 5KREA 3ZD7A 5T7BA 1Y5RA 3M5DA 1EVKA 4ID3A 4OQFA 2DSNA 4KJXA 4YRMA 2EL7A 3GUCA 3I8SA 3FB1A 1Z0ZA 2DPHA 3OZFA 3UENA 4C3VA 1EVYA 5LOVB 3IAUA 3ZJTA 3GLVA 3NKVA 3ZVRA 2V7WA 2FWMX 1EUCA 4KNWA 4YUZA 3ER6A 3OWHA 5KTMA 3IQWA 4NS1A 2VNKA 3J7TA 1U0RA 4QGGA 3VDRA 5FHRA 3CIOA 1TECE 4IHJF 3HUEA 3FBWA 2P9HA 3AX6A 5ICEA 5IC4A 4O29A 4JKIA 3VC2A 3NP7A 5AW2A 4KXUA 1V16A 2OXEA 2QXUA 4HEHA 4DBLE 2JFHA 4D7AA 1QX4A 3CF4A 2Q8QA 3BGDA 3LUKA 2PCJA 5EWMA 2SECE 1F4LA 4EDHA 4JYZA 2FU5C 3I2GA 2FPIA 1EE9A 2IZ5A 4YACA 4BNKA 3C3JA 2SKCA 2FVYA 1DE0A 2HOQA 2ZJFA 3R5SA 1TQ6A 4HLUC 2ST1A 3LLUA 3L0DA 3O9ZA 1QYXA 1UAAA 4LIPD 1BE6A 3TD9A 5B1DA 4GYWA 3BX1A 2GT1A 4GXNA 4XASA 1ZOPA 4EVQA 2E37A 5DLDA 1KTVA 1X1TA 4DSZA 1K5DA 2OP0A 1DJOA 3EXG1 1M5TA 3SBEA 1IVSA 3GA5A 1Q6YA 5C8YA 2C8LA 3QWBA 4NJEA 3C14C 4IGFA 3CLSC 4J3FA 3WAKA 1UMCB 1GFWA 1V37A 4GBGA 4Q05A 4DG8A 5GMOA 4IPTA 3C74A 3KQMA 1IRIA 2QYSA 4B3FX 1MV8A 3MWYW 1N9ZA 3GFVA 3VJKA 3NETA 4AWBA 4DA0A 3D3WB 3T0IA 3AFIA 3OQ1A 1SUSA 4M21A 2YY5A 3I0NA 4XDHA 2Y27A 3ZCUA 4MUAA 6REQB 3F98A 1OV4A 4OA8A 3KJXA 4D2IA 3AR7A 4K7JA 4QDKA 4WASA 3X1KA 3ZEIA 2GZMA 3PVSA 2DULA 2R4UA 1NIPA 1NIJA 4ECEA 3K16A 5KWSA 4J0KA 5CFOA 1ZNZA 3UMBA 4GM1A 4YNBA 5EZYA 3U5ZB 1FMJA 1VJGA 2PBFA 2H1IA 1OC2A 3L6EA 1J33A 5KWJA 3MB8A 1HDZA 3Q0EA 5JZOA 4WKPA 5A7HA 3CSSA 2BR3A 2ERYA 1KDOA 2M6RA 1Q0SA 3AKDA 4LN1A 1UC8A 1X6VA 1CB7A 2CMFA 1QFYA 3LL7A 2R6FA 4ZVKA 3TFWA 4F3CA 4DAEA 5JEEA 1RYDA 3EIUA 3BGVA 5ENVA 1QR2A 3WIEA 2CL0X 1IDN1 4PYRA 4FMDF 1KE1A 5IULC 5BSGA 1YHZA 4FFRA 5TQ0B 3KQPA 4D96A 5IKXA 4B46A 5U4XA 1EB8A 2B35A 3IMKA 2XTMA 5AVSA 4DV7B 3DO8A 1VMIA 3KQOA 3EIOA 3EQ9A 1G55A 3N0RA 3JWGA 2GJ8A 4IICA 1U2DA 1IXYA 2IYZA 2UZAA 4IO1A 3WP1B 1Z8DA 4GI2A 3S5UA 2WTUA 4RVSA 2VWGA 1N3IA 4IQ0A 3RUDA 1BGWA 2BN4A 4MGZR 2XUPA 4E4TA 3OZAA 421PA 1QYVA 3GEGA 3JW8A 3CJQA 4ZCSA 1IEWA 1U5AA 4QRHA 1ECJA 1E2EA 2R6ZA 2HHLA 3H0KA 3A0RB 4KDEA 3UWKA 1VE3A 2JAWA 1JG1A 2WTAA 1XTKA 3GX1A 4RVDA 4UAJA 2GF2A 2QAGA 3D7MA 3HB5X 4G81A 1XMVA 4FW9A 5FA6A 3W2GA 4DIOA 4WBSA 1PVOA 1FX0A 1DV2A 2WM3A 2ACWA 4L8WB 1K63A 1F0KA 5M3BA 2YWDA 3K3PA 4JL5A 4OI1A 4WV3A 2Q29A 4RFSA 4XM2A 1PD1A 5IW8A 5C18A 1BXRA 7AT1A 2NT3A 2C97A 2XECA 3CINA 3T35A 3R76A 3AVOA 4X94A 5EJ5A 3AF0A 2O1XA 3ZWCA 4XYMA 3NTVA 3GFFA 2ZSHA 4RK5A 5JBQA 2K87A 4JJFA 4WN9A 1QTIA 2VF2A 1ZH4A 5GGXA 3VVMA 3DVRX 3AUXA 4BUZA 1JEYB 5IVKA 2WLSA 3RBXA 4CKZA 1OV6A 2BMJA 2Y71A 1I3MA 1UDXA 2HWYA 1FUEA 3PLNA 1JIJA 2AFVA 1GUYA 2LVBA 1XP8A 4JZKA 2CMHA 4UHHA 1X9HA 1E2HA 2G82A 3I01M 1M67A 4KXVA 3VI3B 1C0IA 4R8LA 2R4TA 4HEJA 1L6IA 4J07A 4D3DA 4TMFA 3F5SA 3PNOA 1E99A 1YDWA 1NNUA 3ENKA 2CL5A 5AMXA 1XEFA 4KVZA 4D6XA 2J6HA 3ND6A 4GEGA 4J43A 2WNHA 5MGBA 1MA0A 1RLIA 5LN1A 1SOUA 2C0QA 1K6XA 1OBFO 2JBAB 2JIZD 4KQIA 3BORA 3BULA 4F4HA 4MB2A 2WPDA 3U4QB 3AI3A 2GBPA 5BP7A 4OH1A 1M73E 5H68A 1BZYA 4DREA 1EWQA 3U56A 5E6UB 1YF3A 1MOQA 3HA2A 4ON9A 1T26A 2B2CA 2Q5CA 3DEYX 3ESAA 4WEOA 3JVEA 5ALEA 2YX1A 4KHZA 5M7EA 3T5TA 3PFCA 3PKJA 5K0CA 4NHEA 1K4KA 1L5SA 3PL5A 2CF5A 4PCVA 4JP1A 5ADUS 2QNBA 4LY3A 1XTVA 1W4LA 4BV9A 1AF4A 2A5JA 3HCEA 1QQTA 2I80A 5FPTA 4WZAE 1G1AA 1IWOA 2OBXA 1OUMA 2JBAA 1U04A 3RJTA 1O7JA 5GONA 2ZS9A 3BZWA 1SBZA 4E30A 1IZYA 2GHRA 3WGZA 3ZCSA 2QEQA 2VDMB 1P7WA 2YOHA 1B6GA 3ROMA 3IDSA 2H9IA 3GJ5A 3B9PA 4J1GA 5ALDA 4Z99A 5DI9A 2XUHA 2ZUTA 3PF9A 3IXQA 3Q3EA 4JLPA 4C2BA 1I8TA