1BSVA

Gdp-fucose synthetase from escherichia coli complex with nadph
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
317
structure length
317
Chain Sequence
b'KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQDRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GDP-FUCOSE SYNTHETASE)
publication title GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 103
structure length 317
sequence length 317
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bsvA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1bsvA02
1IY8A 3TN7A 4AJJA 1B3RA 5IDWA 4RJTA 3DBHA 3DBVO 1PQPA 5C5IA 4HBGA 1B7GO 3ITKA 4L75A 1HLDA 2NQ8A 4XDZA 2XXJA 2VWQA 2ZYDA 3E6AA 4CMJA 4P8RA 5TJHA 1E7YA 1BXGA 3GN2A 3MWDB 1E6EA 1XG5A 1FJHA 1W73A 3OQ6A 1TXGA 3VAZA 3VZPA 3HWRA 1NHWA 3QVTA 3FWNA 1JDJA 7MDHA 4RCVA 1TLTA 3BMOB 1ISFA 1TT5B 5TF4A 4FJ1A 1JVSA 3G17A 2JHGA 3GEMA 3O8QB 1PJTA 3L4BA 4II3A 1E1KA 1TT5A 1DHRA 1BHSA 3F4BA 1T1SA 4L0QA 1PQWA 1QYDA 3PI7A 1P3DA 4CL3A 3LVFO 1KS9A 3KYBA 4HNHA 3U49A 4PZDA 3W4KA 2XXBA 3GZNB 5KVQA 3JQ7B 4DTIA 4I5GA 3RBXA 3CSDA 3CZMA 1I2ZA 4PZCA 1GTMA 2PKRA 4FFLA 5CHEA 4WCDA 5KOIA 4B4VA 2PK3A 3ROPA 3ANLA 3INGA 3MZ0A 1PJQA 4URFA 1XU9A 5T5QA 3Q0EA 4CLEA 2DUUA 4BV8A 1NX6A 2HMWA 5T57A 1MC4A 3KOUA 3HG7A 1X15A 1P1KA 5KJEA 2R6JA 4NJOA 3H4VA 2X0JA 3QRWA 5C3MA 3H65A 5AXDA 3VPSA 1PGJA 3AU9A 5K9ZA 4FFNA 4DBVO 3L6OO 1PZGA 4E3ZA 3UKOA 3OH8A 3MJEA 3AJRA 4DBZA 4WE3A 3GH3A 3JQFC 4XGNA 4UVGA 5FYDA 5TRTA 1L7EA 1PJ2A 2DPHA 4R1UA 3TZHA 2PZKA 4OHUA 1WPQA 2G5CA 1R66A 2WYWA 4UULA 4D3DA 4ZN6A 3JQAB 4ZRMA 4JP2A 1O94A 1NPYA 3WBBA 1CF2O 2FMUA 1UXIA 2C5EA 3HQ4O 3ZN2A 4GMGA 3INTA 1JWAB 3L9XA 1M66A 1C1DB 5L9AA 2O3UA 1JLLA 4MP6A 3KLMX 3MWEB 3KO8A 3RAJA 1IOLA 3RJ5A 1LNQA 2DTXA 4EYEA 2VYVD 1ZK0A 2OMEA 3LC2O 4J91A 3TFQA 2HDHA 2J5KA 3GEGA 1XIVA 1CDOA 1KEUA 2Y1FA 3GUCA 5JYEA 4BIIA 2ILTA 1R15A 2QZ9A 3DBLB 3D5QA 4EBFA 1V3VA 1A71A 4XYMA 1H94A 1GV1A 1PU2A 4QSMA 3V1YA 1H2BA 1PJCA 1SOWA 1BXKA 1SCUA 3W4IA 5GZ6A 1O5IA 4PVDA 3OFSA 4WCFC 5L7YA 4IQGA 2GDZA 3AM4A 2O2YA 3C8MA 2HQ1A 4WCFA 4UUOA 2ZJ0A 1IZ0A 3H6KA 3DZBA 4BQRA 2GN4A 2VNSA 1DJQA 1I3MA 2VNAA 2YZ7A 4DQXA 3WFIA 1Y81A 2EW8A 2OBYA 4W82A 2HK9A 5B12A 2PKQP 3GMSA 1ZXBA 3LT1A 2AQ8A 1U7HA 3ONFA 5JCJA 4B3IA 2ZCVA 5BNTA 2OFPA 4F46A 1ZUD1 3E9MA 4CUJA 1Z45A 1Y5MA 4ALJA 4A03A 5JAZA 3H9EO 3EZLA 3INRA 2WYVA 4BNGA 4A2CA 3RUAA 3NJ4A 4CMHA 3B20A 3OA2A 1Y8QB 1JKFA 1ZJYA 3ZHZA 3KYDA 1KY4A 2HO5A 2X1HA 4I08A 5I9MA 4AJEA 4JROA 4GX0A 4M87A 5K6AA 5DBIA 2EEZA 2BLLA 3PWZA 4PLGA 2NLOA 4UVEA 2G1UA 4CJXA 1C1XB 2JCXA 5DBGA 2VRCD 2PNFA 2VWPA 1EZ4A 1ZK1A 1KC1A 4DXHA 1CIVA 3NKLA 4M8SA 3PHIA 2R2GA 2D59A 2UV8A 3DZFA 3DZKA 4TWRA 4Y67A 5BSGA 4QFCA 4A73A 4CM7A 3GGGA 1DRUA 3AWDA 3O4RA 1SEPA 3KHUA 1JW9B 4JP3A 5KVCA 3HE3A 3GN1A 3COSA 3ZWVA 4YRBA 3FN4A 3AI3A 4S1VA 1GYQA 1DFHA 1FDTA 5DDIP 4BGUA 4B4OA 2E6UX 1GADO 4HFJA 3OEWA 5IZCC 1Y7TA 3KVOA 2IYPA 3BA1A 5A5FA 4AFNA 5B4VA 3UH1A 3Q2IA 4FOSA 4GMFA 3CZRA 1K2WA 5IZCA 3OP4A 2EKPA 2GN6A 3CH6A 1GCUA 3K6JA 4R16A 3AM5A 4FC7A 3OF2A 3OMLA 1ISIA 5COBA 4MVJI 2AE2A 2V6MA 3I52A 1Z82A 1YJQA 5AOVA 4DGSA 3H8VA 3KUXA 4MVJM 4NBRA 2Q4EA 1XWFA 1TEHA 5BR7A 4J1TA 4ZRNA 5IZ4A 1N9GB 5G0WA 4CQMA 3ABIA 4W7HA 1ID1A 3CUKA 4G81A 2Q2WA 1ZEJA 1N9GA 2ZB7A 3NAQA 4XR9A 5LDGA 2BD0A 5F1PA 3C1OA 1NM5A 3RUIA 4CM9D 4CV1A 1SOVA 1AXEA 1PSDA 3DMYA 4IUYA 2YDYA 1OFGA 1U1IA 1VLLA 3U62A 4D3SA 3JQCA 5BT9A 3VPHA 3OEYA 4JLWA 2A4KA 2CSUA 4ID9A 4CLOB 4A27A 1YB4A 4R01A 4CLRB 1KERA 1VJ1A 2X0RA 3RD5A 4GWKA 3RUCA 1DC5A 2DFVA 2NVUA 2AXQA 4EJ6A 3WMWA 2Q99A 2UYYA 4BMVA 3HDHA 5JSFA 4DIOA 1DFIA 2YV2A 4NPCA 3ADPA 3B1FA 1DRVA 4R1NA 4LSMA 4L8VA 2QX7A 3C3XA 3L6EA 4ZICA 4DA9A 3GY0A 2WMDA 1X1EA 3ZV6A 1PZFA 3ZW8A 5JBIA 2FWMX 4YPOA 4CMIA 1XA0A 3DAGA 2QIOA 3JQ8A 3LK7A 1DHTA 5GMOA 3RFTA 1YBVA 2PA3A 1HDZA 3A28A 4KUEA 1T1RA 1SZJG 4BO8A 3JD2A 5KJCA 2CF5A 2PLAA 4GPD1 2FPIA 1UDAA 2JFFA 4N7RA 4I9HA 3GPDG 2C0CA 3ZW9A 5KWEA 4Z3DA 3ST7A 4NBVA 5A9TA 3VDRA 4BKPA 2Q1UA 4JK3A 5L3ZA 2JAHA 4M49A 2H6EA 1P45A 2I67A 3AUAA 1XELA 2B0JA 2XF8A 1U4OA 1TA4A 3ENNA 3ZU4A 4DQVA 1EVZA 2LDXA 1ZK2A 4O0LA 4MVJH 3IS3A 4TRRA 3DBRA 4BNWA 2DQ4A 2HMTA 3ZCXA 2DBRA 4N5LA 3WGGA 2IODA 3GRKA 1M76A 3KYCA 3SC6A 1V6AA 1SPXA 2AE1A 5CEEA 1F8GA 1NPDA 1LSOA 4R41A 4IZHA 4TZTA 3NT2A 4RVGA 3RUEA 4CM6A 3ORFA 1Y8RB 1D1SA 3L77A 2X5OA 1HEUA 4G5HA 2BELA 3SBOA 5IXYA 4GGOA 1RPNA 3T4EA 4CLDA 1BTOA 5T6BA 2OBNA 4W9NC 1NVTA 3CIFA 1ZNQO 2V6BA 3ZNOA 1YVEI 3UCXA 5CEFA 1ISMA 4EI2A 4Z6KA 4ZQBA 4PLYA 2FSVA 4Z0PA 1DRWA 3KB6A 4CQLA 2I76A 1SC6A 4W9NA 4ALNA 4PLHA 2EV9A 1E6UA 2WJPA 3ON5A 1B26A 1M75A 2E49A 3MTGA 5IG2A 3QVOA 5U4QA 3B1JA 3IKVA 4AJHA 2DUWA 2DBVO 2P5YA 2CDBA 3FBTA 1X7GA 3LF1A 2UUPA 4NDNE 4DQUA 4FSHA 2GNAA 3HN7A 2Y68A 2EIHA 2C82A 3ITDA 2PZLA 3DWFA 3RI3A 3RJ9A 5F3RA 4RPHA 4QQRA 4LSWA 1K6XA 3GUYA 1DAPA 3CTMA 3WJAA 5I7EA 1PJ4A 3GVCA 1YONA 3PWSA 4CMEC 4B7XA 1BGVA 2ZB3A 4E12A 1H93A 1VL6A 1XU7A 3RC2A 1DPGA 3O26A 1UXJA 1YOVA 4HNGA 4I9UA 4BNIA 5KIAA 3WLFA 3TZQA 3IKTA 5EERA 3RFXA 3TZKA 4CMEA 4CUKA 3H9UA 2GO1A 1T26A 2B4RO 2WD7A 4RQTA 4Y6RA 1R4NA 1WAMA 4IM7A 3TNLA 1FDWA 3QWAA 3PTZA 2GD1O 3Q1LA 2HSDA 4ND3A 3CINA 5L40A 5L4SA 2VRBA 2AA3A 3F5SA 3BTVA 3F9IA 3FPCA 1C0KA 3BHMA 2RAFA 4WEOA 3ICPA 4CODB 1N8KA 3JQGA 4WGGA 3FCOA 3UICA 2DC1A 1J4AA 2HRZA 2Z1MA 4RZIA 4Z9XA 4BS9A 4EEXA 1KIFA 1X13A 3AY7A 4YQZA 1I2CA 4BKQA 3DFZA 4GI2A 4PG7A 2WD8A 2CVOA 4HP8A 4NBTA 1GZ4A 3WNQA 3QWIA 4IGEA 3H7AA 1DLIA 1U5CA 3WGQA 4PRKA 3D4OA 4NR0A 4XQGA 1PJ3A 2YW9A 1YL5A 4HFNA 1E0DA 1K3TA 2BHLA 1I32A 2YHIA 1QG6A 4Q39A 2AEFA 2Q46A 4ND4A 3QVXA 5JDIC 3I4FA 3ANMA 3N7UA 4DLBA 3WGIA 3JTMA 4M1QA 2X22A 5H81A 3RUHA 2NVBA 5C7IO 3K96A 4YJFA 1UDCA 3NT4A 5F5LA 4NJMA 4WK6A 5JDIA 2O3QA 2VT2A 3EVTA 4IDBA 4WLOA 4ALLA 5KNLA 1JKJA 3ZWPA 1C0IA 2ZQZA 4UVIA 1HWYA 3WJ7A 1PWXA 5JCJD 5TSDA 4BL5A 3JD0A 3WMXA 1XYGA 1CERA 5CDYA 4JCOA 4EJ0A 1VL8A 4YQYA 3AUSA 1CQIA 3PGJA 3X2EA 3ZWWA 2YYYA 2O7SA 4A26A 5CDGA 2XOXA 5JFOA 3U09A 4D43A 3WXBA 1NNUA 3CE6A 1D1TA 1VJ0A 2GR9A 3JQ6A 1A9ZA 3I9KA 4OGWA 3WGZA 1KOLA 1Y6JA 3E9QA 4YAKA 4IDCA 3TDKA 1D3AA 2YUTA 1Q0LA 5KKAA 4BNJA 2FSSA 1PIWA 4B7CA 4B7UA 3TZCA 1AXGA 3RASA 1OAAA 2Y0DA 3UXYA 4Z9YA 4CV3A 3DAPA 2HMSA 2NQTA 3DHNA 2BKAA 1H5QA 2FY8A 2NU6A 4YB8A 3DC2A 4F6LA 3MEQA 4R54A 1P9LA 1FDVA 2I66A 2FP4A 3PJGA 4IGFA 4DIBA 5JAIA 4KQWA 1PS9A 2GN9A 4L4RA 1SBYA 1UXHA 1YL7A 4ZGWA 1YDEA 5JW6A 5A3VA 3D1LA 3DFUA 2X58A 1ZK4A 4AJOA 4XRRA 1FXSA 1MXHA 1NQ5A 3PQEA 2G82A 3Q11A 4UEJA 3UW3A 2FN7A 2Y1GA 4B8WA 5EN4A 1U3VA 2RH8A 3U4HA 1U3TA 1WLYA 3IMFA 3ZI0A 2AHRA 1GV0A 2D0IA 2DM6A 2HLPA 3MJCA 4NK4A 4Q3AA 1UUFA 1NAHA 1T24A 3FR8A 4CM1A 2YV3A 4E5KA 1XCBA 3QWFA 5F1KA 3SLKA 2EHDA 1UP4A 2WM3A 2Q3EA 2CDCA 4O1MA 1DIBA 4WNCA 5IN4A 3LT4A 2GLXA 2P4HX 2QZZA 3OQBA 4CQMD 2IXAA 3CPSA 4Q3EA 5IJZA 1ADCA 4YWJA 4O59O 4HXYA 3GNSA 1C0PA 2ZB4A 3WIEA 3EY4A 4BNMA 1K0UA 3AUUA 3KSDO 1U5AA 3OJLA 3K5PA 3GEDA 2E48A 3PWKA 3S2FA 4AJ2A 4RF4A 2Z1NA 3P7MA 4PLPA 5CPFA 3GVIA 1QV7A 1LRKA 1H6BA 1MFZA 3UOGA 2VYNA 1WZEA 3NTRA 1ZSNA 3KZVA 1A27A 4WKGA 5ENDA 4R3NA 4LGVA 3P2YA 1SO8A 5JXWA 1A7AA 1XGKA 5A05A 1EVIA 4TSKA 3OA0A 3DDNA 3GA0A 1C14A 3BMNB 1P74A 4Y98A 2OO5A 1YE3A 1HETA 2YV1A 3P2OA 2P9EA 4MVJG 5LDHA 3EDMA 1PR9A 1BWSA 3B6ZA 2A92A 2C07A 1I3NA 1ZZEA 1E3WA 3C85A 2PD3A 1VPDA 3L07A 3RKRA 1Z74A 2OZPA 1XEAA 3DZHA 3E8XA 5IDXA 4J7XA 5I7FA 1D8AA 1AGNA 1EUZA 4R68A 3U4CA 3UCFA 3O9ZA 1NVMB 3FBGA 4J43A 2A9FA 4FR5A 2W2KA 3QVWA 1F8FA 1NYTA 1PS0A 2X5KO 3HFSA 3K2EA 1GQYA 2EERA 4NI5A 1KVSA 3H3JA 3FNFA 1DIRA 4DIFA 4E0BA 4KOAA 3V2GA 1UZLA 2JJYA 5KKCA 4XKJA 1DJNA 2IEDA 3PPIA 3EAGA 4I8XA 4MVJF 5ES3A 3ZNQA 4CR7A 3JYQA 1ENZA 2RHRA 1E5QA 2WE7A 2Q2QA 4FS3A 5DULA 3GAFA 3QY9A 1Y9AA 4OAQA 3C1TA 1OC4A 4FW8A 4I5FA 2IXBA 1MFPA 4GVLA 3IP1A 2ZK7A 4E32A 5AQ1A 3UN1A 5JAQA 4YJHB 1HZJA 2OORA 1ADGA 4RORA 2RIRA 4QECA 4IINA 1YBAA 2FRDA 4XYBA 4BMSA 2J6IA 2UUOA 4E5YA 2OGUA 4YACA 4LMPA 4J6FA 4H3VA 1QV6A 3L4BC 4P4NA 3GGOA 4HUJA 4CM8B 4ZQEA 3SVTA 1EMDA 3FSRA 5KTKA 4LVCA 3BMOA 1LDNA 3ANNA 3AOGA 2ZYGA 1IL0A 3O8QA 1SMKA 1KY5A 2WYUA 3ZGYA 4AJKA 3L6DA 1LC3A 1ONPA 3OIFA 3MOIA 4IIVA 4XCVA 3WICA 4RPKA 3AU8A 4TZKA 1MUUA 3GZNA 3JQ7A 5KVVA 5B1YA 5BSFA 3PYMA 1HXHA 4IDDA 4J1QA 1A4IA 1B15A 2Z5LA 5ER9A 1U3UA 4IXWA 1DAOA 5GY7A 5DCWA 3I6IA 4J49A 4Y6PA 4BB6A 5TNXA 3AW9A 3JD4A 1G6KA 1ARZA 1HDGO 4TRNA 4J1SA 2O4CA 4XJTA 3V5NA 4E33A 1ONNA 1H6CA 3UUWA 2X6TA 5LCXA 2NU7A 1QLHA 4XYEA 2B4QA 1LXCA 2PZJA 1D7OA 5JC8A 4XB1A 2Q1TA 1K89A 3C7AA 3PZBA 4OOEA 4BKUA 5KJFA 3TPCA 4XB2A 4IQ8A 3UAGA 1BW9B 4E4YA 4GKBA 4RVDA 4JGBA 1NWCA 2ZTMA 3GVPA 4AL4A 1XHLA 2JD0A 2VUTA 3TRIA 4DMLA 3JQAA 4ILKA 3WNVA 1LJ8A 1LDYA 4H16A 1NVGA 1VKOA 4K6FA 4WOKA 2BF7A 5EIOA 4E6PA 1R37A 5LC1A 4J0FA 5A4DA 4WLNA 3NEPX 4DC1A 3QW2A 1I10A 1V3UA 4E21A 1C1DA 2EKLA 5EMHA 2FPPA 1NFQA 2ZTLA 4G2NA 3TZ6A 4AG3A 3VZRA 3GFGA 3EGOA 2J5QA 2J3IA 2CMDA 4FN4A 3WB9A 3DOJA 1WW8A 5COQA 3ZHXA 1I3KA 2CY0A 2AQKA 3PIDA 1R0KA 4JJIA 4U0KA 4XX0A 5THQA 3W8EA 3V1UA 4BHTA 3SXPA 1UZNA 3V2HA 4W4TA 1KC3A 9LDTA 3DBLA 2NACA 3ZU5A 5MGBA 1LX6A 2X9VA 4FOOA 3EYWA 1MV8A 4BNXA 2GZ3A 4Q3NA 9LDBA 3R6DA 2RHCA 3IDSA 4OXYA 1U2DA 3ICCA 1X7HA 1LDEA 4XYLA 1LSJA 2J5RA 2X5JO 1VKNA 1ZXLA 3VPXA 3ZHBA 4J1NA 4WECA 4XYGA 5EJ2A 1HL3A 3IAHA 5DOZA 4YT8A 4AJ4A 2E37A 1V8BA 3NTQA 5TC4A 4E5NA 1LSSA 5AXAA 1F12A 2PD6A 3SJUA 1BXZA 3WWZA 3TJRA 3DZIA 3GT0A 4OXKA 2BGMA 4BNHA 3DAFA 5DP2A 4FB5A 1G0NA 2FR1A 2POQX 5G0TA 2PH3A 4PLVA 3G3EA 4FC6A 3NJ8A 5K6AC 3DZJA 1DLJA 1Y8QA 1Y9EA 3NDIA 4KTVE 3TSCA 2PFGA 4QT0A 3WGOA 1R6DA 1IPEA 2O7QA 4UUNA 1LC0A 4AJPA 3VPFA 2CZCA 1I24A 4NU6A 4GSLA 1C1XA 2A94A 3E82A 3AUTA 4U6QA 4AJ1A 4HV4A 4HX5A 3PQDA 5JCXA 4Q3BA 5IN5A 4II2A 3RCBA 1VI2A 3KSUA 3DHEA 2ZCUA 4GKVA 1ZKMA 4PG6A 1N1GA 3ADOA 3GQVA 5DF1A 4BKRA 1U9JA 1BVRA 3H9QA 3WQRA 4K6CA 1DDOA 5JNLA 2B83A 4XWYA 3CXRA 4WUVA 1F14A 1T25A 2DFDA 5ICSA 1E3SA 4IY1A 4PGFA 5EQDA 1PL7A 3BHIA 4DL9A 1T2DA 5HS4A 3ROMA 1B8PA 5ITVA 4NNJA 3A06A 4RZHA 1QXSA 1DIGA 1ZFNA 3PVZA 2G76A 2GZ1A 1AHIA 2PV7A 1ZW1A 4J2OA 4J9UE 4YAJA 1T2EA 3HDJA 4QFDA 3ZWBA 4L9RA 3FRJA 3G1UA 4ROSA 2PD4A 1KEPA 1X0VA 2WTBA 5JS6A 2VYND 1NWHA 2IZZA 3UFXA 5G0SA 3PDUA 3KXDA 4MKRA 2V65A 4AICA 3L4SO 4TRJA 3JYOA 3X2FA 3ZWNA 2W2LA 4RPLA 2NTJA 3DL2A 3T4XA 2OUIA 3SJ7A 3FNHA 4ITUA 4QO7A 3FPLA 3PEFA 4R3WA 3WGYA 1JA9A 3KRTA 3MJVA 3U5TA 5G0UA 1ZSYA 3ONEA 2QHXA 4M89A 4WLEA 4NG5A 3MOGA 3EK2A 1HDRA 4LRTB 4FIZA 1EVJA 2VOJA 4DLAA 3QIVA 4CLOA 2NU9A 1D4FA 1I33A 3AY6A 3OSUA 1HSOA 2IE0A 4CLRA 1R0LA 5THKA 3L9WA 2Y0CA 5F5NA 3K30A 4K1LA 3RROA 4OYRA 1MLDA 1U28A 3JV7A 4D7AA 1O0SA 3JQ9C 2C54A 1I5RA 3M2TA 3T7CA 5HM8A 1B8VA 1DFGA 4CR6A 4R1TA 4PG4A 1J0XO 3PHJA 3R3JA 3JQ9A 4M55A 2JCVA 2J8ZA 3RFVA 3Q9UA 5L45A 3JD3A 4ALKA 4WNIA 3VC7A 1XR3A 2O3TA 4C4OA 2ZKLA 3ASUA 3K9QO 1W0CA 5GZ1A 1P0FA 5ER6A 3HDYA 3K31A 3WTBA 4CL8A 1JAXA 4ND5A 3E03A 2BRUA 1YKFA 4RVFA 2H1SA 5FI3A 1WXDA 3AFMA 2PY6A 5JAMA 1ZMOA 1ISHA 3QLJA 3F1KA 4NFHA 2GN8A 1PGQA 3MJSA 4IDFA 4OL9A 3UHAA 1AUPA 3VKVA 1EK6A 5CDUA 1YJ8A 3G79A 4MJLA 4RPGA 1EUCA 3I4CA 4J0EA 2I65A 1I36A 4MKZA 4JJFA 3RIHA 1KEVA 1U7TA 1YB1A 3Q6IA 2AMFA 1I8TA 5DCUA 3ROKA 4XGKA 4YJGB 5G0VA 3E5RA 4FJ2A 1UH5A 1ZO8A 1ADFA 1V3TA 1ISGA 2CVQA 3I23A 4LMRA 1HLPA 3WG9A 5IF3A 4D45A 1MB4A 3H5AA 3A14A 3E9NA 4OKIA 5EESA 1XSEA 2W90A 3RU7A 2OOSA 1WMBA 1Y8RA 1Q0QA 1VJTA 2B35A 4KUHA 1B14A 1BVUA 2JCYA 4OSPA 2ZYAA 3S2EA 2QYTA 4BNVA 1XQ1A 2Y1OA 3WLEA 1N7HA 2B69A 3ZDFA 3KEOA 3PYLA 4R9RA 2HUNA 1QMGA 1ML3A 1DSSG 3F4LA 1GPJA 1NR7A 4YT5A 5G4KB 5C7LO 1X14A 3EMKA 2B5WA 1RM5A 2WDZA 3IJPA 1H9AA 1P31A 4CPDA 2Q50A 3GK3A 1N1EA 1HSZA 1TT7A 3SX2A 4K28A 4LISA 5CFZA 3GDOA 1LLUA 3KM0A 5HS6A 1XDWA 3IQDB 1E77A 5CG1A 4ZQGA 4LCEA 4BGIA 1SB9A 1HYEA 1TB4A 4W99A 4QO8A 3W1VA 1E3IA 1LTHR 2QW8A 1T4BA 4Q9NA 1CJCA 3OIGA 5TJ9A 3IC5A 2Y93A 1KEWA 1WP4A 3I5MA 3TOZA 4PLFA 1QP8A 4MO2A 3ZH2A 1JN0A 1LLCA 4IJKA 3MTJA 3JQAD 1J5PA 1NAIA 2GYYA 5K0ZA 2D5AA 2X9NA 4TRMA 4UUMA 4KUGA 4IBOA 1UZMA 4EJMA 3D3WB 3H9JA 1Q7BA 1HTBA 1EDOA 4JBIA 4UVDA 4ESOA 3H5NA 3VH1A 4BNFA 2V6GA 3BMCB 1LQTA 3BMQB 1C0LA 1PJSA 5A04A 1PL8A 3WTCA 4J4HA 2NTVA 1FMCA 1BG6A 3NRCA 1UXKA 4O63O 4XQ9A 2GCGA 3M1LA 5CG2A 4NZ9A 4OSOA 4YDRA 4NH4A 3M2PA 1WMAA 5A02A 1KETA 4R5HA 1NFRA 4YBZA 1EUDA 2P2SA 4OJNA 4DLLA 3HFGA 2R00C 2PWZA 2YQ4A 4IQ0A 4XDYA 3RC1A 4CM4B 4MVJP 1I01A 4E2ZA 4D0SA 1UP6A 3TQHA 1ULSA 4IS2A 5B37A 2PGJA 2DKNA 5DN9A 3TWOA 2R00A 3RU9A 5DOVA 3LC7O 4QEDA 4Z0TA 3I3OA 3ROQA 3WQSB 3OETA 2JD1A 3DO5A 5JC1A 2DTEA 1DC4A 3R3SA 2OP0A 2Z95A 3FNGA 2BFAA 4XD2A 3HDQA 3F1LA 1ZVMA 4MINA 1CQJA 5F21A 1KVUA 4JQCA 2ET6A 4NMHA 3S2GA 1LSUA 3GFBA 2WEKA 4BNUA 5IDYA 4QXMA 5EPOA 1CYDA 2QRLA 1GEGA 1JKIA 4J4BA 3NX4A 1KVTA 3K92A 4TKMA 3GLQA 5G2OA 5TT0A 3OICA 1TVEA 3DMTC 1U4SA 4BO1A 1NASA 2W98A 3W8FA 4CV2A 1AN9A 4KTTE 3CEAA 4IIUA 1RYDA 4PLTA 5B4UA 4L4XA 3DMTA 3V8BA 1KVQA 3DEYX 4PCVA 4KP7A 1T4DA 4FFRA 3GHYA 3WWYA 2FR0A 1R4MB 2GPTA 4XZ3A 1Y1PA 3LDHA 5COAA 2OL4A 2V7PA 3HJAA 3QQPA 5U9CA 1M67A 3U0BA 3C7CB 3ZU3A 3PRJA 2Y67A 2FZWA 4NK5A 5ILOA 1RJWA 1KYQA 1LLDA 1P0CA 1PJLA 3E1KA 1JAYA 2Y1DA 3OM9A 3STHA 4AJNA 4YA6A 4NFSA 1DXYA 2EG9A 3NGLA 3DTTA 1H9BA 2BGLA 3OECA 1PZEA 3WYCA 4CMKA 4DREA 1B16A 1LLQA 1OC2A 1EBFA 1L7DA 2VN8A 2NNLD 3UGKA 1B2LA 1MA0A 4YEDA 5HRUA 2VUSA 3QP9A 3QWHA 2HK7A 1QR6A 4RVHA 3RC9A 3DZGA 2IYOA 2DLDA 4P4LA 5ENVA 2C7GA 2YFHA 1U8FO 4D44A 4B4WA 4WOJA 2Y1CA 5DZSA 1LUAA 5DT9A 3U3XA 3VZSA 4DC0A 1VRWA 1YS4A 5T67A 3GHHA 3MJ4A 4PG5A 4E5MA 3EVNA 1EE9A 5CDTA 3GGPA 3WS7A 4HKTA 3RBZA 4BKOA 1Q0HA 4J3FA 2EJWA 2P68A 1Y5RA 5I9LA 2W2LD 1B3BA 4FD3A 2AG5A 1I3LA 4GLOA 1ZMTA 4YYZA 4FFPA 2VCYA 1OBFO 3ZV5A 1ZSVA 3VTZA 1I0ZA 2NU8A 1GD1O 2FR8A 3RSHA 4O6VA 3ETEA 4EUEA 4BGVA 4BGEA 1U8XX 3NDJA 3WX0A 3EUWA 1PGOA 1HE5A 1WDKA 4D41A 3ZWMA 5JO0A 1HE4A 4JBGA 4YAEA 2EF1A 3JYNA 1CEQA 3VTFA 4BQPA 3DQPA 1PWZA 3JSAA 1AHHA 5DNAA 5TGDA 3BMNA 4M54A 5AYVA 3W8DA 4F6CA 2C5AA 1MP0A 1ZJZA 3DR3A 1E7RA 2BFMA 3G0OA 2DTDA 4KDFA 4PLWA 3ZWOA 5L53A 4XR4A 3RVDA 4U0JA 2JD2A 4GSKA 4C7KA 4IXTA 1ZK3A 1GCOA 1PJBA 2XAAA 2O50A 1ORRA 4RF5A 3BXXA 2HRBA 2P91A 1Q2XA 5ILGA 4RF2A 1RYEA 4NIMA 3G1TA 1P1FA 4RQUA 3JD1A 1RM4A 1MG0A 2HAEA 3NV9A 3WDSA 2EXXA 3LYLA 3KLPX 3A9WA 4EITA 2VHWA 2GF2A 3E5MA 4U8GA 2DT5A 3WBFA 2DBZA 4CMCA 3QE3A 1Z6ZA 1E92A 3GF4A 4GH5A 3VVCA 1MC5A 5JO9A 1NR1A 4CR8A 4Z3KA 3O03A 3PDJA 5ITWA 2X23A 3PXXA 1SNYA 3FTPA 4BB5A 4Y8VA 3PHLA 3QSGA 3PJEA 4WASA 4A10A 4KZPA 4MIOA 4YJDA 2Q45A 3KEQA 4FBGA 1NBOA 2PTGA 2DPGA 5JLAA 4E5PA 1EQ2A 2PKQO 3D0OA 1F0YA 3HSKA 4IJWA 4PZEA 4RVSA 2QRKA 3SLGA 4J2HA 5JPIA 1HYGA 5AXCA 3QWBA 2AG8A 4YJHA 1P44A 2UVDA 2PR2A 3OIDA 3VKUA 4YT2A 2YY7A 1PGPA 3HZZA 3DBHB 3DOCA 2PZMA 1YBMA 2V6FA 4DPKA 3WFJA 1ENPA 1LI4A 1YH3A 5FI5A 1W8DA 1M6HA 4CM8A 2O2SA 2WWRA 1HE2A 2VHVA 1BRMA 1VC2A 2VT3A 4CV0A 3PLRA 3GZ4A 1BXGB 4GQAA 4MPDA 4ZQFA 4I5DA 1RWBA 1XLTA 4Y9DA 5HTOA 2O4UX 3ZWCA 3VVBA 3BTOA 4IJVA 5ADHA 2B37A 2H63A 1NQOA 1C3VA 3S1LA 3CKYA 4YAIA 1V9LA 3Q2KA 3TOXA 2HKIA 1W6UA 2BI7A 3V1TC 4XRGA 5IAAA 3H2ZA 5G4LA 4JIGA 3OBBA 2H9IA 3VH2A 3N58A 2B36A 1HDYA 3G49A 2NVWA 3B70A 4B3JA 2D5CA 4MP3A 1Z7BA 2HMUA 1UJMA 3OJEA 5C37A 1CRWG 1IHYA 5ICMA 3ZNNA 1R16A 4EDFA 1S6YA 1UXGA 1E6WA 3FTNA 2VWGA 1MG5A 1A72A 4WJZA 5IFLA 4OQZA 1A5ZA 4RVUA 1VE9A 2CD9A 1E3EA 1NFFA 3M6IA 4TMFA 5JMWA 4ZD6A 4RLSA 5KCZA 2GASA 3C24A 4RO0A 5L7WA 4IMPA 1RKXA 1K5HA 4PRLA 3RQSA 2GUGA 4HADA 2Q2VA 1JU9A 1BW9A 1DOHA 1GPDG 1NQTA 3H9GA 3MJTA 1EBUA 4ZJUA 5BSHA 4FGWA 1LA2A 3I9JA 4FJ0A 4I1IA 3PZRA 4H7PA 4PN3A 4E2WA 3LLVA 1OI7A 4QTZA 5U1PA 2Y66A 1OZAA 1O8CA 4GX1A 4UUPA 1N92A 4MIYA 5AXBA 5BSEA 3JQFA 2HMVA 4LRSB 1P77A 3PLNA 4J7CA 3RUFA 4AJLA 4B4UA 2D1YA 2VWHA 3GMDA 3WOHA 4XEHA 1HZZA 2IZ0A 5L4NA 2JKVA 1FK8A 1QKIA 1YQDA 4WEQA 4WLUA 1DIAA 2QRJA 3F47A 3W6UA 1UAGA 2QQ5A 4MDHA 3ZV3A 1M6WA 2VUUA 3PHHA 1ZBQA 3IIEA 4Z9FA 5JDCC 4BO9A 1QORA 1WZIA 3VOSA 1GQ2A 5J23A 5AVOA 4ZVVA 2ZJ1A 8ADHA 4F3YA 4BO2A 5JDCA 2HK8A 3ULKA 1B0AA 3AY3A 2OP1A 1ADBA 2IDZA 3SEFA 1M2WA 2BI8A 2JHFA 3LF2A 4FGSA 2I3AA 1FF9A 2O3RA 3BTUA 2EP5A 4HFRA 5EQFA 3TL2A 3KSZO 1GUYA 3U4DA 3VDQA 3ZNPA 1BSVA 3IJRA 4INAA 2PGLA 4FFMA 4UAGA 2LDBA 1GEEA 2X7HA 4OQYA 4KMSA 4ND2A 4YRAA 2HJSA 3GDGA 4WCFB 1YRLA 3MCVA 5A9RA 1PL6A 2GRAA 4WLVA 4G65A 1TI7A 1DC3A 3PJDA 3RUDA 3A4VA 4FQ8A 1WWKA 2B5VA 5HBRA 5TT1A 1ZEMA 1E1LA 3HNPA 4BUCA 1FDSA 1ZCJA 2I3GA 4W7IA 1X7DA 5HWSA 1RM0A 4K9DA 4EUHA 1F17A 4ONEA 2VQ3A 3PQFA 1E7SA 4GGPA 1IYZA 2YFQA 4R5MA 4IMRA 1UDBA 4XGIA 1LDMA 2C7VA 1G1AA 1SAYA 3WIDA 2Y0EA 2J3KA 2BFOA 1J49A 2HJRA 1ZIDA 3KYDB 5A06A 1N7GA 4W6ZA 1ENYA 4XIJA 4BO7A 3A1NA 4DYDA 3HUDA 4BVAA 4ZU3A 3UVEA 1ENOA 4GVXA 3FD8A 1ISJA 4FCCA 4Y6SA 4BO5A 1YQGA 4YTEA 4YRDA 2VHXA 3AFNA 4ALMA 2BFPA 2AEMA 4JNKA 1F06A 3I9LA 3M1AA 1JVBA 2X8LA 1P1RA 1UR5A 4DWVA 1HT0A 2ZATA 5A03A 4EZBA 4R9SA 1U3WA 2O3SA 2X0NA 3JYLA 2RH4A 2J3JA 4Q3DA 3ZWXA 4OOFA 4E2XA 1RM3A 2UAGA 5I8ZA 1NHGA 5JYDA 4PFJA 3GPIA 2D2IA 4MOWA 1LDGA 4KQXA 3U9LA 2DU8A 3NT5A 2P9CA 4TVBA 2G17A 4M86A 1NQAO 2AW5A 4KDEA 4RF3A 3S2IA 4E13A 2VOEA 3D4NA 2FPGA 2QG4A 3EC7A 3GG2A 3ZV4A 6ADHA 2VZ9A 2JFGA 3I9MA 4BNZA 3GDFA 2NM0A 4GWGA 4PLZA 1Z7EA 4ZA2A 1YO6A 2OXIA 1UAYA 3K73O 3PFWO 4P22A 1UP7A 1N2SA 2JAPA 3LZ6A 4GLLA 3D5TA 1Q7GA 4JXKA 3RBVA 3AOEC 3R0IA 3FWZA 5CAEA 1LQUA 3NYWA 4CQMB 1SB8A 1T2CA 3AI2A 1DC6A 1GR0A 4IS3A 3VPGA 3GAZA 1IE3A 1KBZA 3CMCO 3AOEA 3W6ZA 3ZU2A 3PGXA 2ZTVA 4IDAA 4XA8A 5JY6A 3S8MA 2I5PO 4RDHA 3CMMA 3K2BA 3VH4A 4EEZA 4LW8A 4A0SA 2NADA 4N54A 6LDHA 3EHEA 4UEKA 5I7SA 4IZIA 4NBWA 4U5QA 4HY3A 3QVSA 1E3JA 4OKNA 2FHSA 3N74A 5DBFA 4XQCA 2A35A 2NVUB 4OH1A 4J4TA 4PIVA 4IDGA 3EW7A 3GVHA 1NPTO 1E7WA 2CFCA 3KTDA 1SEVA 4MVJE 4NHEA 1BDMA 3NTOA 3ASVA 2CNBA 1LDBA 3WGHA 2YQ5A 4YVFA 4OMUA 4BO0A 3C1AA 4BO4A 2P5UA 1YL6A 4IJUA 7ADHA 4OM8A 2C20A 1ZH8A 1GY8A 1J6UA 2X9GA 4TKLA 1BDBA 3LQFA 4YAGA 1A9YA 3GNTA 4CMIB 2W4QA 3PK0A 1IHXA 3JQ8B 3RWBA 4IPTA 5L95A 3JQBC 5KJ1A 3IUSA 1DIHA 3GVXA 4IDEA 1YDWA 2O48X 4XJSA 1A7KA 3D3EA 4NQZA 5I9NA 2BGKA 2VZ0A 3JQBA 4PLCA 2X4GA 3S55A 2WE8A 3T7EA 3LU1A 1PS8A 3E18A 4YJGA 3QHAA 1AE1A 2H5LA 2E4AA 2AQIA 1YB5A 3OHSX 4ALIA 5A9SB 5A5EA 1GUZA 3O38A 4R4JA 4P38A 2NUAA 4GL4A 3ZWYA 5A9SA 1IB6A 2NV6A 3JCZA 5H83A 4RPJA 1G0OA 1CWUA 4MVJA 4N5NA 1OMOA 3DBRB 3IUPA 5TIIA 1LRJA 4RV9A 1IUKA 4F45A 2J3HA 3DOOA 3QJ5A 3RKUA 3KYCB 4E30A 2XPCA 1GL3A 2EW2A 2ZB8A 1XQ6A 4J9VA 1Q1NA 2G0TA 2BH9A 2DBQA 3KV3O 3UF0A 3AK4A 3H3FA 1E1NA 4FFOA 1WVGA 3BYZA 4ZQHA 5B4TA 5G4KA 3HB4X 3JQDA 2C2XA 4BV9A 1NP3A 4RGBA 3QV1A 4CQLB 1PEDA 1MGOA 3FHLA 3H2SA 2GSDA 3OJOA 4U7WA 2EP7A 3GNQA 5CDSA 1P1HA 2AQHA 4LVUA 2YJZA 1PZHA 3V2UA 2CUKA 1IZ9A 2C59A 4K26A 2TMGA 5I7VA 4D42A 3WQQA 3DHYA 4AVYA 3FR7A 1Z75A 1QYXA 4OIMA 1GZ6A 4E31A 3PJFA 3OJFA 1I30A 2NWQA 5T8KC 4L74A 2FZEA 1YWGO 2P4QA 4CLXA 1MXFA 3OJ0A 5L4LA 1K6JA 2PH5A 3FF4A 1E1MA 5DCYA 4RL6A 5T8KA 5GZ3A 1WDLA 2WSBA 1OOEA 4C7JA 3WGTA 3DB2A 4EGFA 4D3FA 3D3WA 4X54A 3GC6A 2B4TO 1O89A 1YOVB 2C2YA 5DP1A 1H6AA 1QYVA 3AI1A 3ETGA 2FOIA 3BMCA 2NTNA 3BMQA 3DONA 4MP8A 3DXFA 4BO3A 4NBUA 4RLHA 1A4UA 2WD7B 4DVJA 1R4NB 1W4ZA 2Q1WA 1GYPA 4DYVA 2F00A 2P9GA 3EZYA 4LK3A 5C7OO 2D8AA 2RCYA 2VHZA 3JQEA 2HU2A 3I9OA 1K6IA 1PR3A 3I1JA 4BNTA 3D7LA 1EFKA 3I6QA 3ZZNA 4Z0HO 3C7DB 4CM4A 1H2HA 1E7MA 3IOYA 3JQGB 1EEHA 1NXQA 5BNIA 4JX8A 1QRRA 4B3HA 4N18A 4CLHA 8LDHA 5FWNA 5TLSA 3VHRA 4S3MA 2CDAA 1S7CA 4FPXA 4L73A 1MX3A 2YHIB 2VTDA 3LT0A 1HF3A 2VYVA 3IL2A 3R1IA 1HKUA 1HE3A 4R69A 1PGNA 2IZ1A 3LSYA 5MDHA 4BO6A 2YHUA 3ENKA 5KVSA 5I8WA 4YJFB 3Q3CA 4MKXA 3F6YA 4NJMB 1YGYA 2AEJA 4KWIA 1QYCA 5TQVA 3OQ1A 1DB3A 1GFSA 3L0DA 3TL3A 4QUKA 1LBEA 4DRYA 4DPMA 4BNNA 2VZ8A 1R4MA 2GERA 3U4IA 1X0XA 2EGHA 4BOYA 4GX5A 4JN6B 1JQBA 4DPLA 3DTYA 1VL0A 3PHGA 2Q1SA 4NU5A 2CVZA 5JE8A 3VZQA 4U6SA 3W4JA 3JYPA 2IRWA 4UREA 1GUFA 1EK5A 3ZHYA 1U2GA 4I9NA 1HRDA 3P5SA 3D4PA 4KWHA 2UDPA 4XIYA 4AJIA 4BNLA 2EWMA 4HFMA 4YR9A 1P33A 4XQEA 3PYXA 1FDUA 1HDOA 3I9NA 4HWKA 5F1OA 4RDIA 4CMAA 4H15A 3HB5X 3PP8A 1B8UA 2CF6A 4OXNA 1HDCA 2D3TA 4NFYA 4UEOA 1O95A 1DO8A 3BAZA 3I83A 4DMMA 3F46A 4CUZA 4D79A 4TVOA 3QA9A 2X86A 4R51A 3HN2A 2SCUA 3BHJA 4OO3A 4WPGA 3FNEA 5BQFA 4B8ZA 2ZIZA 2QYSA 2EGGA 4YCAA 4CMGA 5L7TA 3SC4A 3ETDA 3NUGA 4CM5A 5BNFA 2EJVA 3UCEA 2VHYA 5TX7A 2VRCA 4B79A 2Y05A 2F1KA 1XKQA 1QSGA 2E82A 2ZQYA 4A7PA 5A3JA 1GDHA 5EL0A 1GYRA 3AM3A 4BNYA 2VTEA 4TROA 1IPFA 2I99A 3VH3A 4TQGA 4R1SA 2NSDA 3Q9NA 5IXSA 4GAEA 2ZTUA 3HHPA 4ND1A 4BNKA 5EINA 2OHXA 1T2AA 1P1JA 2IEBA 2JFHA 4QX6A 3KETA 2X0IA 2YDXA 4UVHA 1T2FA 4J7UA 5TS3A 4Q3CA 2O23A 3GRPA 5CP8A 3PFFA 2GGSA 1LRLA 2DAPA 3WSVA 5HA5A 3LT2A 4WLFA 1HDXA 2RBEA 4D46A 1HYHA 1E3LA 3IP3A 3E48A 1GAEO 4DUPA 1IULA 1GZ3A 2DVMA 4A5OA 2I6TA 3WYEA 1X1TA 1GU7A 1JTVA 4GBJA 1VM6A 1QYWA 1I2BA 2Y1EA 3F3SA 4E2YA 1O9BA 5FFFA 1V35A 3WYBA 2Y99A 1N5DA 4J16A 3GG9A 3BTSA 1P1IA 4EW6A 1H6DA 2JL1A 1WNTA 2EKQA 1DBVO 4CM9A 4L4SA 4I5EA 4BMNA 1VSVA 3ONDA 3BIOA 4N5MA 3D64A 1Z73A 1WDMA 4D0RA 3B1KA 3WR5A 2HCTA 1R12A 5CEJA 2W8ZA 1KVRA 3TF5A 1EFLA 3P19A 3FI9A 4PG8A 1E3WB 4CM3A 2PGDA 1PX0A 3TFOA 4PVCA 2C29D 5A1TA 4CMBA 4EUFA 1NTOA 5H82A 5FF9A 2TMDA 3WSWA 2I9PA 3F5QA 1YXMA 1R0SA 2D4AA 1H0KA 3PIIA 3HADA 1O6ZA 1DEHA 4P4GA 4MIEA 5KJ6A 2O3JA 3NDRA 2W2KB 2Q4BA 4LN1A 1E5LA 1GQQA 3NGXA 5FEUA 3RC7A 1CETA 4YXFA 3GR6A 1V0JA 3K8ZA 1L1FA 1VSUA 1EQUA 1BMDA 2Q49A 5JY1A 3KBOA 1ULUA 3LLSA 4LCJA 4GX2A 4J90A 3ZWAA 1LU9A 4JJGA 1EVYA 5JMPA 5T64A 1YQXA 1QLJA 2BMAA 4ZHSA 1Q7CA 1PQUA 4YT4A 4O5OA 1LEHA 1ONOA 1PTJA 3LC1O 1EDZA 4L76A 5IDQA 1E7QA 3GOHA 4FDAA 4MVJD 5L51A 4JBHA 3BZUA 3H5RA 2GZ2A 5CPBA 1JWBB 1EE2A
chains in the Genus database with same CATH superfamily
1T5SA 3TN7A 3EVBA 2C4VA 3EN0A 4JVNA 2BPOA 2F9LA 4AMGA 4RJTA 1GKKA 1ULBA 2AG6A 1YJBA 2HWKA 2YIMA 1PQPA 4DMCA 2BP7A 3QXXA 5LM3A 1F4VA 2EZ8A 3HL4A 4IFEA 5JNSA 3ITKA 1WHTB 4K9KA 1G7CA 1HLDA 2NQ8A 4D2IA 5LP6C 1ZMRA 2ZYDA 3UOWA 1SIUA 3N1UA 2V55B 3IT1A 1BU8A 1LNSA 1N3YA 3HY4A 1FJHA 2OV6A 2QYHA 4J7AA 4X1OA 1RYYA 1W73A 4PR3A 5DGDA 4LDQA 3OCZA 3VZPA 4RXMA 2KYRA 3FWNA 1DAFA 1N2IA 4B4DA 2YWFA 2P3SA 3NTVA 1ISFA 1JSRA 4Y9UA 1Z6GA 5SYMA 1TT5B 5TF4A 1BQ4A 5GINE 1JVSA 3HM9A 1G8FA 5K0JA 3L4BA 2PYIA 4II3A 1ZRSA 4URHA 3WIUA 2D7JA 4F9FA 1JHVA 3S2SA 2IUYA 3LK6A 1BHSA 4YYEA 1BD4A 4FI3C 1ECBA 2PXXA 3L84A 1G4AE 3H04A 4JXZA 2BSAA 3PI7A 4F1WA 5TMBA 2M6KA 4HDNA 1FVFA 1NJGA 2JJ8A 4LWOA 1V4VA 1V7CA 3EG5A 2RGDA 1IZYA 2XXBA 3L7IA 4ENSA 2GEVA 2YZKA 2Q07A 2OXRA 3CSDA 3U1TA 3QIAA 3DE3X 5NLLA 4OMDA 3GFTA 3D7RA 3NVAA 1P6XA 2B20A 4FFLA 4KXUA 4Y6GB 5CHEA 3UK1A 3WE7A 3ANLA 5HXAA 3ZYZA 3M5DA 4X20B 5REQA 2WDPA 3VR6D 2BH2A 1MC4A 1ORTA 4D8TA 1X15A 1UMDA 5FH9A 3OZIA 1YF3A 2PCLA 1R9MA 3MGGA 4X7BA 5LNK1 1L8QA 2Q6IA 1G7SA 3JARB 4NJOA 2Q5EA 4Z8YA 3TQTA 4R3UC 2X0EA 2F62A 3ILXA 3NG1A 5E3JA 3VPSA 4FFNA 4KXVA 5ERXA 3GRAA 5F64A 2HUPA 3LBIA 2PUGA 1NI4A 3L6OO 4I2VA 4Q4JB 3WLPA 3ZZ0A 1AQYA 2VQSA 1SQ5A 3MGAA 1D07A 1F7VA 1OF1A 1GGKA 4Z7QB 2CLMB 5HQ3B 1OW3B 3UKDA 3JQFC 3KQPA 4RWEA 4D0LB 4F84A 5LQRA 1UBOS 3FJYA 5CLGA 5TRTA 3RYHB 3OZXA 4G4SP 4BMXA 3Q72A 4JD5A 1Y6FA 2B98A 3E3OA 2G5CA 1Z56C 2FYTA 1R66A 4M0LA 1U9YA 4UULA 1M6VA 3KAPA 3W6NA 3I6ZA 3M4ZA 3AVUA 4HGZA 3MJFA 4GYKA 1Q20A 3PR3A 3R7BA 1SG9A 2GAFA 1OWMA 3IQZA 1YD7A 4WFKA 1DI0A 4GMGA 3INTA 5AM3A 3L1JA 3G2KA 5E1DA 2P1RA 4FDTA 3TEFA 2LCFA 2XUZA 3AHIA 4Q34A 1GZ7A 1IU9A 1EK0A 4MEBA 5B3JA 2NUPB 4C01A 1LNQA 2DTXA 2GA9A 2PRZA 2VYVD 3OLVA 4QUBA 4RKFA 2OMEA 4F4CA 5YASA 3TFQA 1F9AA 2J5KA 3UYLA 3TQSA 3GUCA 2R2AA 4DQKA 4BIIA 3E7PA 4HD8A 5C1PA 2BUCA 5BSVA 3WLMA 4MDEA 4LXYA 3CF4A 3RS8A 2H0QA 1T8RA 4EBFA 4BX0A 4UAVA 4YMUA 1PSZA 1FPQA 1Z37A 2YJ3A 4XYMA 5BY2A 1H94A 1GV1A 1NBAA 3F5DA 3EGXB 4IIXA 4QODA 4QSMA 3ZCUA 3H5LA 2AOVA 1Y9JA 3WK8A 1PI3A 2WHRA 3UMJA 2GESA 5GZ6A 5NULA 3I2KA 1JLHA 1M2HA 1L5VA 2HU8A 4IQGA 4RK6A 3ZS9A 4OHVA 4XVQA 5K05A 3HYNA 2PRIA 4P7JA 3T1OA 3BQNB 5BSWA 2PX0A 4FEGA 4HOYA 4C05A 1F5NA 1FVOA 2COEA 2PS9A 3BSFA 4BMZA 1IZ0A 2MYPA 2RGYA 2HWYA 2GN4A 3A3OA 1DJQA 3ANYB 5G1NA 3FTFA 4MYHA 5C32A 4QRHA 2GXQA 3UWMA 4DRZA 3OE4A 4D4HA 2E1PA 5DRTA 1RYNA 3L18A 1ZXBA 3LT1A 2AQ8A 4OJQA 4RWZA 3QNWA 5DEOA 4EKDA 2FW6A 5C7YA 3R7LA 3T3IA 1ZUD1 4BASA 4B75A 4CUJA 1MC8A 1Z45A 2HT1A 1ECGA 1Y5MA 1QZXA 5IH3A 1UT6A 2OCIA 4V0RA 4CG3A 2V7BA 1O95D 2VXOA 4MUAA 3H9EO 2FUG6 4GPTA 3OM8A 4YDHB 5JAZA 1Q15A 3F5FA 4A2CA 3HA7A 4BNGA 3NJ4A 4J0IA 2JEOA 1TA0A 3NEYA 4QPJC 3KYDA 4EG7A 2GXAA 1NVBA 2HO5A 2QTWB 2QVLA 4PSKA 2XUOA 4AJEA 3EQ8A 3KJEA 4AQ7A 2IYVA 1QHHA 1IY2A 1GUBA 3K0AB 3ZCVA 4AULA 1AVTA 2BLLA 3ZBTA 1KI6A 4KHZA 1Q6YA 5DBGA 2PSJA 3LUJA 4PQRA 5BWLA 2PNFA 4UDYX 5E1MA 1QX3A 1T0JB 1EZ4A 2VWPA 5TGZA 3TVYA 4M46A 4YASA 1W4BA 1CIVA 1N6IA 1G4HA 4M8SA 1MX1A 1O6BA 3G68A 3DZKA 3L8FA 4TWRA 4Y67A 5FOSA 3DOIA 4KE9A 4ZVMA 4CM7A 2PKYX 3PKIA 4H1HA 4KAFA 3AWDA 3WRVA 3WL3A 1T36A 3DLPX 5JVDF 3HE3A 3COSA 5L6MB 3KVNA 3HBJA 4X97A 4XXHA 2PL9A 3KT0A 4Y2VA 4UAJA 5HR5A 1KYIA 2CHVA 3OX3A 3UO8B 1FFAA 1YC2A 5LQCA 1FU4A 1TEZA 4B4OA 2VSNA 2Q8QA 4WAUA 3G2OA 1HG0A 4FHFA 1H2YA 3KVOA 3BA1A 3MN1A 5IT0A 3UH1A 4O29A 4GZ6A 4ZVNA 1J2JA 4KE7A 3SBXA 2UKDA 1K4KA 3B5EA 4RM2A 5BV7A 3HJBA 4X1YB 2GN6A 3X1WA 5EHIA 1Q0PA 1VMDA 4YMLA 3PTAA 3LO8A 2PQMA 1W88B 4EB6B 1ADYA 3E0QA 4RTNA 4JITA 1AN0A 1QZ3A 1WXFA 4TXNA 1WR8A 1ZJ6A 1PZMA 2AE2A 2V6MA 4NPAA 3PC7A 3R9WA 4HH4A 4J1TC 1ZGHA 4L51A 4TXMA 4C1BA 1NSYA 3ZBQA 3ABRB 3KUXA 4MVJM 1WXHA 4Z8XA 2Z6VA 3UAZA 5ES4B 2W4IA 2HJVA 2JHAA 4QUJA 1NA5A 1TEHA 4ZRNA 5IZ4A 3NDBB 5AJXA 2C58A 5FBQB 5C5DA 1RZRA 5G0WA 4A1FA 1VPWA 5FBLB 3O2QB 4W7HA 4HN2A 1ID1A 4EARA 5I3ZA 5FA8A 1D2GA 2YJ6A 2BD0A 1XCGB 2XDAA 4CM9D 2HWUA 4V1CI 3OWOA 1GZ5A 2QAGB 2XUFA 2BBTA 1AXEA 2JANA 4H1TA 2HA3A 1UFVA 4M0MA 5AKKA 1PLLA 5E8JA 1QP0A 2FQYA 3TIXB 1M2OB 3N39C 1RBMA 3ZLTA 3JQCA 5I4BA 5BT9A 4J07A 3L7YA 3FRIA 2AH5A 4O25A 3OEYA 3VPHA 4Z9BA 3PFGA 3BJIC 3N2ZB 4QDUA 2ATVA 1YB4A 3DWIA 1T5OA 3O93A 4HDOB 2BAGA 1KERA 2A5GA 2X0RA 5ALOA 3OIYA 4OQFA 4XTCS 4JI1B 3RUCA 5A4IS 3RADC 4DCMA 1SUFA 1TCCA 1A1VA 5GP1A 1O08A 2AXQA 2OEPA 5BOSB 1IRXA 1QH0A 5K0BA 3EFBA 4B09A 3TSOA 3ADPA 1KMIY 1VKJA 4R1NA 3ZY5A 1ZM4A 1VIMA 4L8VA 4YI5A 4I50B 4FSXA 4CIYA 3C3XA 4ZICA 4C5BA 3I9V6 4ECAA 1IHDA 1LWOA 3ELYA 3D6HA 1RQXA 4COOA 1J9GA 3L3BA 2YWEA 3U7FB 3TMAA 1QOPB 1IZ8A 1S1MA 1OLSB 3VR0A 4J0KA 4RYLA 2XZDA 1EFRA 1O96B 3DAGA 2QIOA 1JZTA 2IUTA 3EY9A 4KWEA 2C3YA 2OGZA 1X8XA 2WIDA 4J75A 4OFXA 4AW9A 5C81A 5CYGA 1ID8A 1U2RA 1HTWA 1MAAA 1ODIA 2K7ZA 1SZJG 4LJ6A 4KH1A 1TYEB 3OQPA 1YNSA 5KJCA 2HQRA 3KQOA 3EXG2 2I87A 1UKEA 2FPIA 1UDAA 4ARVA 4F3KA 3GPDG 5H3LA 4N7MA 4D02A 5KPDA 2WSMA 5H8WA 1CNMA 4NBVA 4TTVA 4GR9A 1M8JA 5L3ZA 2HFJA 2FEPA 6CHYA 2IJGX 2QJFA 1D2NA 4NNOA 4OQQA 4PSAA 4M49A 4CDGA 2H6EA 1K6MA 1P5JA 3O8CA 3IEUA 4KQHA 2HSWA 2XF8A 1G20E 1LX7A 1TA4A 3EGIA 3ENNA 1FRNA 3JYHA 1VFPA 3HMQA 3K1AB 5IM5A 2LDXA 1PHPA 3NBAA 4LF7B 4OP1A 2W71A 4ISBA 1KPGA 2VBIA 4JT9A 1WEHA 3ZCXA 4BNWA 3QELB 4EI7A 2O5EA 3IXQA 3JWGA 5E4JA 1UPBA 1OI4A 1DQRA 4IFTA 4JLUA 3SC6A 3MINB 2AC2A 5CEEA 4MKFA 3JPYA 1NPDA 4TZTA 1N5OX 1Q1ZA 1KJNA 2CYAA 1YZUA 1QHNA 3EDRA 4FMDB 4RVGA 4QUEA 1XCPA 4DUZB 4YQEA 1O58A 2GAOA 2E3JA 2FDRA 2MYNA 1MQSA 1V16B 2IOQA 2Q9AA 2JFBA 1MENA 4PEVA 5EPUA 1UWCA 2OBNA 4W9NC 3U80A 2DQYA 1JG2A 1JE1A 1YCHA 1YVEI 2DR2A 3DVQX 5JMOA 1C81A 2NOAA 4UU7A 4ND7A 1TRHA 4PLYA 1FXWA 2YJNA 3KB6A 3SIXA 5FUWA 5JSZB 4K1XA 4HDMA 4ALNA 4A2PA 3U4MA 2EV9A 1QPBA 3QUSA 3UUGA 3CY6A 1CVLA 1OYYA 3NM4A 2ZRQA 3EXG1 1G20A 1Z9BA 1U3GA 5IG2A 2I7CA 1EXNA 1EWTA 3MOSA 3IKVA 3LQYA 3M8KA 3SHWA 2DBVO 1T1IA 3QFTA 3O4IA 2G4VA 2SECE 2ZUTA 2VPWA 3FBTA 4BTLA 2WAAA 1AZLA 2KLBA 4J94A 3QBEA 5LKAA 3EX7C 5LZ8A 2WIFA 3NHKA 5CVEA 1H8HA 4YRIA 4Q1EA 4XVUA 1EVQA 3OLXA 3ITEA 4YAWA 1GTG1 1EGMB 4P93A 5JWOA 1YA4A 1KZYC 3EMBA 2PZLA 5E6RA 5LQMA 1XEXA 3RJ9A 4KWCA 1KJZA 4LSWA 4W6QA 2ZLBA 1DAPA 3B6EA 4UNRA 1ANKA 3CRW1 1PJ4A 4EB8A 3VR6H 4M37A 1N78A 4HYTA 3PWSA 4B7XA 4QXPA 1AHNA 4E12A 1H93A 2J5BA 3H1TA 3LPMA 1P0MA 1XU7A 2FN4A 2LV8A 3O26A 1UXJA 4HNGA 2RGAA 3U3JA 2FNAA 2N0SA 1BIFA 3TZQA 1FP4A 5EERA 4YO7A 3TZKA 4CMEA 1VECA 2VUIB 4UE6A 2ZBEA 5EKUA 4BECA 2OZKA 2XGOA 4WVLA 4WZAB 5H5JA 3WYFA 5FV7A 3R7AA 2P2DA 3AR7A 1JYEA 2WD7A 3M82A 4ZDWA 3ZXXA 4Y6RA 4ABYA 3TNLA 4F0JA 3C97A 3QVJA 1S8NA 3PTZA 4KXWA 4IJSA 1SQ6A 2HSDA 4IZ6A 3QEMA 1QVAA 1UC9A 1O6FA 3WLLA 4M98A 3IR6A 3RODA 3P4XA 1T8TA 4IHJA 4N8EA 3M70A 4Q7LA 2VRBA 5AIAA 5L40A 4UKDA 5L4SA 3SWWA 1KK2A 4C4RA 3FCEA 3UT6A 4JLMA 4A2WA 1C0KA 5HKBA 3BHMA 2RAFA 5K3CA 5JYCA 4LFBB 3H6GA 1L5RA 3R9IA 2HRZA 3W3AD 3WLRA 1G5QA 1WW2A 4BS9A 2A1UA 1X13A 2I34A 1G6Q1 5K6RA 3DEAA 3R4VA 4PG7A 1B93A 2CVOA 3NXKA 5JCPA 1D9ZA 1Z68A 3QWIA 1Z4JA 4HJRA 5EKDA 2HREA 2FF7A 3LGSA 2A3NA 3RLIA 2AN5A 3OPYB 1W59A 2AG1A 2H59A 4K9RA 4XQGA 2C2HA 2PMFA 1PJ3A 3OT1A 3UANA 1YL5A 1I6KA 4KNYA 1VP3A 2B94A 1I32A 2BHLA 2WFLB 4MQ5A 3N75A 3DTVA 3OPVA 1KIMA 2P77A 2Q46A 4L2IB 4YPFA 3DCJA 3LX5A 1SU7A 4OHOA 2XOKD 1OB5A 2BJHA 4M1QA 2X22A 5BUSA 5H81A 3WLNA 3VO9A 3MCUA 3G0BA 3ROPA 4FMPA 5EVCA 1H2AS 4P2BA 2P4UA 3F3KA 4ESHA 2VHEA 3H1GA 2I4RA 4PQFA 4WLOA 4GUAA 4ALLA 4RKYA 1L0BA 2JGAA 4UVIA 3WJ7A 4JLOA 5ALWA 4BL5A 4AY3A 4NZMA 3WMXA 1XYGA 5CDYA 5E3IA 5CIYA 2G77B 3IKMB 3O94A 4KSBA 3Q5DA 3OQVA 1XZAA 1O6CA 1SUBA 5J1SB 4RJ2A 4ND8B 4A26A 4K9LA 3WZMA 2ODNA 3V7FA 4QHTA 1CUEA 4UUBA 2QMOA 3UAYA 2Z30A 3E0XA 1N8NA 3DP9A 3KKPA 3WXBA 1XFAA 4BX3A 4EYGA 1WCIB 2P2ZA 1SVMA 2GR9A 2HXGA 1QF7A 4FGUA 4LXTA 1KI3A 4IX9A 4GEGA 4P53A 2IIBA 3RT9A 1FIUA 3I9KA 3ZV7A 1T34A 4K0RA 4X65B 2BVNA 1IIRA 3MT8A 1H0HA 2Z9CA 3TDKA 2YUTA 4I3GA 4WA8A 5KQRA 1XNHA 1PIWA 4B7CA 3TZCA 3I9FA 2DPXA 3SP1A 2Y0DA 2XXAA 4Z9YA 4AUNA 4CFYA 4CV3A 3DAPA 4MTCA 2EZUA 3KSMA 4MYCA 3UQZA 3TRHA 2O5VA 2WF9A 4EHIA 1J2TA 1H5QA 2FY8A 3DAHA 4YB8A 3T1TA 2WF8A 3DC2A 4MI1A 3EPLA 4R54A 5AKGA 3P52A 3VMMA 1G55A 2KS6A 2GCOB 4YCBA 3IEPA 4KQWA 5DTIA 5EWLA 2GN9A 3OZCA 4ZGWA 1YL7A 5JAIA 4X62B 4FMBB 3KJHA 2PWPA 4JUAA 3D1LA 3AIIA 4RY0A 2X58A 1AXRA 3EE6A 1OLXB 2NYAA 4KLAA 2VIIA 4XRRA 3RB8A 2UYGA 1NQ5A 4MWSA 2G82A 3LOUA 1CT9A 1RAEA 3FFBA 3Q88A 4AWBA 2AW3A 4R05A 4HGYA 4KPFC 2QVGA 1KFEB 3DEHA 2I7VA 1U3TA 1V5WA 3R5JA 1MH9A 1N0IA 1MO6A 2AHRA 3D59A 1W1IA 1TAUA 3KPWA 5EAIA 4LHVA 5EMLA 2XRZA 3FR8A 4JUIA 1ECCA 1DEAA 3SLKA 4QHSA 1D4AA 4R8LA 5JOQA 1GM5A 2WM3A 3UB2A 4ZOLB 5EWJB 5DASA 2Q3EA 1VL1A 4GWLA 2H07A 1IEVA 5T41A 1A95A 1N5KA 1QIIA 3GP8A 2P4HX 5BV1A 2HZ7A 3BILA 3QA3E 2NZVG 4W5WA 4PC7A 4A16A 1KH2A 1EFUA 3HB0A 3OQBA 5F77A 1DRJA 3QU9A 4Q1VA 2GD2A 3GNSA 2WJZB 4BNMA 1GO2A 3JAMA 2HADA 4PINA 1N5LA 2OBXA 1FSFA 1XD8A 4I4TA 5A4FS 2E48A 3Q0TA 3L1HA 3NUZA 2NYUA 5AKZA 4D3XA 5BR8B 1JQEA 3P7MA 1TJ5A 3GVIA 4MQMA 1BE6A 1LRKA 1H6BA 1E4EA 4ENTA 3IOEA 3UOGA 1FUEA 4HNSA 4K3UA 1WZEA 4P7FA 4X24A 1SG6A 2GN1A 3NTRA 4KQFA 5I6DA 4UQPA 3X1KA 1A27A 3T5MA 4MQFB 1SO8A 4IR7A 5JHGB 3CH5A 1EVIA 2P0AA 1W44A 4TSKA 3BRSA 3RC3A 3FZQA 4LQ4A 5A7HA 3DDNA 4DM7A 4DSOA 1KH1A 4BVJA 2DWQA 1YE3A 1HETA 1T8UA 4H3SA 5EI5A 5JJKA 1SXHA 2CXPA 3LQQA 4TMZA 5IJAA 3UXMA 1BWSA 1USIA 2JEYA 4TXJA 5FI0B 3V32A 4AM8A 4BMDA 4BFUA 2NTEA 5K4AA 5LQAA 2A92A 2C07A 4L15A 1E3WA 4Z53A 4TYYA 1Z38A 5AHXA 1YRHA 1VPDA 2PD3A 1DCKA 4KNWA 2IY7A 3GFPA 1GSHA 3MAGA 3ODGA 2PKEA 1L6RA 2HPZA 5DI3A 1U7PA 5I7FA 2PX8A 3PNVA 4ZI3A 2VTBB 1J8YF 3K70C 3GFQA 2WUFA 3AR9A 3FOAA 4PX5A 5FI1B 3U4CA 3O9ZA 1NVMB 3UCFA 4BX9A 4NC9A 1X8KA 3NWPA 2X76A 1QDLB 2W2KA 3QVWA 4OYLA 4M83A 1F8FA 3MFYA 5DWDA 5IAKA 3ZWDA 4AJ9A 4RM3A 4AP5A 2I91A 1F3LA 1NJ6A 1PS0A 4P6VF 4YREA 1U94A 2ZQ5A 3HFSA 1GQYA 1XN1A 3D6VA 3RJTA 5FTJA 4P3KA 3IUNA 2XRFA 4AIRA 3EQ7A 2ZWVA 3CW8X 3PA6A 3RF7A 5LUAA 2RI1A 2AN4A 4YP7A 3GT7A 2C0QA 4OHFA 1E2LA 1Z08A 4A82A 4KOAA 1UZLA 1MIOA 3SHFA 3KQLA 5B1DA 4GZ3A 3SY8A 1IUPA 2Z1DA 4Q4LA 3TIIA 3ZXYA 1OQAA 3PPIA 2D2EA 1O9HA 1UF9A 3ADCA 2GBGA 3A4MA 3E1GA 5EUQB 3TX2A 1JI0A 2IF0A 3UUFA 1ENZA 3ZNQA 1GAQA 3KQKA 2RHRA 1QIJA 2WE7A 2IXGA 3G5UA 3UHJA 3FPAA 3GAFA 1Y9AA 4EMSA 1RWOA 3OTWA 1I7LA 4FW8A 4AQDA 1X1RA 1T10A 1TJPB 4K6GA 4DY4A 2OD2A 3COWA 3AP3A 1MABB 4B84A 4GOMD 4YJHB 1HZJA 1GPBA 2IS4A 3G0DA 4N0PA 1WHTA 4O4IB 1XL0A 4BATA 3WMFA 1OH8A 2YXEA 5CDFA 2OYCA 2ZBUA 4M76B 1F9EA 3IVAA 1W94A 2J6IA 4BMSA 2FSIA 2JLSA 4EEKA 4FDUA 4I4LA 5B1HA 4IFBA 4H3VA 4OBXA 2V7VA 3GGOA 1E9AA 4P4NA 3VI4B 4DIEA 2EZ4A 2FZGA 1QB7A 3G7SA 4R2LA 4ZQEA 2O6HA 3RIMA 4ARSA 2PS3A 1WD5A 3MLAA 3PBKA 3Q85A 3S2YA 3ELUA 5AVVA 5KTKA 2GAAA 4WBNF 1ZG3A 4UM7A 1WSBA 3FPSA 2JI8A 5DM4A 5CVTA 1ZD4A 4G63A 3O90A 2ZWMA 2EG5A 2QX8A 1URPA 1NU6A 2ZP1A 2QSJA 2FPXA 3MOIA 4F3NA 5I01A 3AF2A 1JMKC 1MB2A 3ESZA 3I12A 3KJZA 2IU3A 1LPPA 1ZISA 5CVVA 1JFLA 4CIAA 5BSFA 2BHTA 4JR0A 4RKWA 4Z1MD 5HIJA 5L3VA 3FOEC 5B1IA 1AS0A 2H8GA 1CRLA 3CEHA 4EIWA 5KU7A 2VT6A 1PDOA 2JAUA 4A8JC 5GY7A 1DAOA 1V5GA 1JPUA 2I80A 4DV7B 4P92A 4BB6A 2ACVA 4X20A 3KZKA 1UZAA 3F78A 3Q40A 4JMPA 1QE0A 3R74A 1FS6A 3PCXA 3HU5A 4J1SA 1L5YA 4RUKA 1II9A 1AO0A 4D1YA 3JARA 1QVZA 4Q48A 3BXFA 4ZV4A 5M34A 4JH0A 1ONNA 3OO1A 1H6CA 3BL6A 2HDOA 2PKWA 2WAOA 2Z4SA 5K0EA 1W7AA 5CM9C 4Q4JA 3TTYA 1EFTA 1CHDA 4PHFA 1U7OA 4EG3A 1WB9A 4MQ4A 5HQ3A 2JFPA 3D0KA 2Z8XA 1N6HA 3K9BA 4IW3B 4XB1A 2ILVA 2Q1TA 1KTIA 1SBCA 3R3WA 1K89A 4OOEA 3PZBA 3RYHA 2CXNA 4C5CA 1ZGZA 4PFQA 2KW5A 1TCBA 4ZCQA 4CE6A 4FT2A 5F7JA 2YICA 2GCIA 3EARA 4L27A 4ZPXA 1C0EA 5FUYA 2ZTMA 4AL4A 3DDUA 3QVMA 4YP5A 3TRIA 3TVDA 2CCKA 4ILKA 4K9QA 4GBGA 3WNVA 1SUSA 2W2QA 2YOHA 3KDPA 2HPHA 4LG1A 3Q7PA 2EJCA 4QREA 5EIOA 2XBMA 3SBDA 4LDJA 1R37A 2FPPB 1ZQ1A 4J0FA 4PGGA 3C41J 5LC1A 3NEPX 2V0CA 3QW2A 3HWX1 1V3UA 4P2GA 4RSHA 4U3JB 4LA4A 1F38A 4E21A 2N42A 1NFQA 1YJAA 4OF4A 1TL7C 2G72A 4AG5A 2C77A 3EGOA 1L5FA 3M33A 3O8BA 2C83A 5AHRA 3WB9A 4NE2A 2NUPA 3CKKA 3DOJA 1WW8A 3QUTA 1JDTA 4UHDA 5F4BA 5G3YA 3UAWA 1P60A 4AURA 3JY6A 3RARA 4CF3A 1YKSA 5SZKB 4XX0A 2GYUA 4UTXA 3PG5A 1KJWA 5LBTA 3V2HA 2ZRLA 3W3AH 4CKEB 3K35A 2NACA 3M83A 2NVOA 3MWJA 1LX6A 3INNA 3KL2A 1FP6A 1MV8A 5F23A 1JLRA 1WLSA 3WJ1A 4Q3NA 2RHCA 1QWOA 3EGXA 4EL0A 3HKCB 5CB4F 1ACMA 2XQIA 1JHAA 1SOAA 2PSEA 1U2DA 5AKYA 2ES4A 3G0GA 5AVSA 3GU3A 1OYVA 1EGQA 2QKYA 2J3EA 1Z4KA 5EZ6B 3T94A 1VKNA 3VPXA 4BQIA 5TPWB 1JG6A 3R24A 1Z39A 4QLOA 2HJGA 1NBMD 4OXIA 1DRKA 4LE1A 3L6RA 1C1YA 1V8ZA 3K5HA 3ELBA 4K9SA 4YT8A 4OH7A 5JQGB 1IBSA 1DTSA 4AS1A 1V37A 1PJ8A 1T2VA 2E37A 2EU8A 1QE5A 2IHZA 3CV3A 2E18A 3HEAA 2ZIVB 5TC4A 3CYFA 5D3MA 2PD6A 3DQQA 2JH8A 1NOIA 3SJUA 3ICOA 1BXZA 1BJTA 3DZIA 4QGGA 2WNHA 4DM3A 5FKJA 2XQKA 4ITRC 3C6QA 2P62A 1QPGA 2BGMA 3DXZA 3IBTA 4H7JA 5K8TA 1C1HA 3LRPA 3A3YA 2FR1A 4F5WA 2PT6A 4PLVA 4B3MB 1FX0B 3P20A 4OQEA 4ND6A 5TPZA 5SZHB 3TSCA 2R1UA 4C0XA 3V00A 3VSBA 3GJ7A 4C08A 3VX4A 2XECA 3KEMA 4ZARA 2HRCA 4JEHA 5D5HA 1UBRS 4TMKA 4DMKA 5I51A 3JAWB 2M6LA 3K0AA 1S2GA 4AJPA 1N6OA 4GM1A 5ESWA 3SQXA 1GFWA 1I24A 3DDWA 4MW2A 4RW0A 4GSLA 4P0QB 4HBZA 5CRIA 3AUTA 5FJJA 4CWAA 4UNPA 2G63A 4IKOA 1WCYA 1BA3A 1RCFA 4X91A 3WRXC 2C2WA 1NL3A 4Q3BA 4UNSA 3VKWA 3W9UA 1CDZA 1HGXA 2C8JA 2ZCUA 3B1WA 3PRHA 4BBJA 3GQVA 3ZCSA 3I5UA 1YDHA 3SS9X 1KYTA 4JC5A 3MJHA 1ZJ4A 3I73A 1OGJA 5TQ0B 3WQRA 1SUWA 2QTVB 1ESDA 1NC3A 2TMKA 5C1IA 1BZYA 2BR4A 4K6CA 1PSWA 4R8MA 2B2CA 3TZHA 4D98A 4F1KA 2B83A 4XWYA 1DP4A 1L4LA 3CXRA 4WUVA 2C1EA 5ICSA 2DFDA 1JDNA 1F0NA 5DE3A 1RABA 5B7PA 2OGSA 5EQDA 2G07A 4X71A 3P9RA 4DL9A 1E98A 2O1XA 1B8PA 5ITVA 1I4LD 3VO2A 4JYBA 3T3OA 1TF5A 3PEUA 1QXSA 4E08A 5AKIA 2AEEA 4FQ5A 1Y80A 2RMKA 3V4LA 1W88A 3ECSA 3T7AA 4IUCS 5BO5A 3WMRA 2Z43A 1A8QA 1U8YA 3RVLA 1K7SN 1G5RA 2FPGB 2PD4A 3IVXA 1KEPA 3BF8A 4UJ5A 5KO2A 3EXEB 4BJ5A 3GCZA 2IZZA 3KXIA 5I9IA 2IYYA 2BZGA 2V65A 4LRUA 1CY8A 2FQWA 3H4TA 4B4KA 3L82B 2P30A 1YUBA 3WL8A 2NTJA 1D5CA 3T4XA 4QE3A 2I1QA 3WLHA 4IHKA 4LHZA 4W5HA 1VXRA 5LA6F 1BH2A 5CAEB 1KP2A 4WJKB 1ATZA 1AGRA 4BBPA 5JASA 2ZKIA 3BWYA 1T9ZA 2QAGA 4JT4A 4L0DA 4C3OB 1J1ZA 1K08A 1RWMA 4N03A 1M2OA 2A0FA 2B8EA 2VPQA 2QHXA 1RTTA 4KE6A 1O9GA 2QTTA 4NG5A 5IT9A 1CUJA 4MROA 1HDRA 4LRTB 2F9FA 2M32A 2VRWA 4Y2UA 2QY6A 3MQ4A 4OHZA 4DV5B 4WXYB 4MV7A 3HGTA 5CLHA 4LOJA 4MV9A 4YMIA 5FAXA 4DLAA 1AA9A 1WO8A 2WA1A 2GPBA 2JI9A 2OLKA 1ATIA 4LYJA 4NABA 2GHRA 1FTGA 4OG2A 1U0HC 1RAIA 3BGIA 5J2UA 3K30A 4K1LA 1PR2A 4KMRA 3OO0A 5BOSA 1MLDA 1WIWA 4QEZA 1U28A 3TE6A 1SC3A 4IV0A 1SCNE 3FVWA 1O0SA 2QGZA 3OJWA 1E8DA 2C54A 4RK5A 3EXHC 2B61A 4NEGA 3NUQA 1TCUA 3EF3A 1E4VA 2KM1A 3AYXB 2C9DA 2DLNA 3VR3A 4I50A 2PGXA 3PHJA 1AKRA 1T3ZA 3R3JA 4CFZA 3BKWA 1I7SB 4Y2SA 1WETA 4Y7CA 4TMXA 2JAOA 5L45A 3KR1A 1MEJA 4R7TA 2OA0A 1XR3A 5F33A 1YV9A 3K7EA 1XEWX 3ASUA 1E2QA 3JX9A 4YQFA 3UT0A 1OLSA 3R6LA 4QL3A 1P0FA 5H0IA 3RFCA 1O96A 3NETA 2VYCA 4YV2A 2DF8A 5GV7A 4HWGA 4RVFA 4F38A 5MFPA 2YCBA 1WXDA 1K63A 3EFOB 3AFMA 2PY6A 1FU7A 1U1FA 1ZMOA 3A1VA 3QLJA 4NBKA 3W79A 3WK4A 2MIIA 2I3DA 1OROA 1JQLB 4IFIA 3BEOA 2OCPA 4EK9A 2CT8A 2FJUA 4LYYA 1EUCB 4OL9A 4B9EA 1AUPA 3ZV3A 1PUIA 1I7NA 4B80A 5ECYA 1CKEA 3CF0A 4B32A 5M7EA 3VUFA 1YJ8A 2XCIA 3G79A 4N3AA 3SDBA 3IV7A 3DLCA 5CA0F 4MKZA 1I36A 5CH5A 2RHJA 4JJFA 2O1EA 3A1FA 5DSXA 1QF6A 3FDIA 5ADVA 3Q6IA 3F7NA 1XVIA 4OGLA 4XGKA 2R87A 4EYOA 1QUEA 4YJGB 3K1AA 4IIJF 4RE5A 3UHPA 4ZHQA 5BYAA 2VG8A 3CPEA 4NOMA 2OK7A 4P7GA 1ISGA 1FRQA 1OJ7A 2LP4Y 2QUKA 3HCNA 3HVHA 4HZUB 4PAMA 5IF3A 5KSOA 1IHPA 3QELA 3S0JA 3BL5A 1ZOSA 1H1LB 3H5AA 3IQWA 3A14A 4D45A 4DS3A 5EJ8A 3MINA 2H57A 3LIIA 4Q9DA 4XM0A 2QTBA 1ZYUA 2NT3A 2PX5A 3DHWC 3VR2D 1A96A 1RMTA 1Q0QA 1VJTA 3EULA 1CY7A 4TL7A 2B35A 4ARAA 2EKDA 1ODLA 4O08A 2R7AA 1V16A 2XIQA 2ZYAA 4MUEA 3S2EA 2QYTA 2CFOA 3F4KA 2IZ6A 4BNVA 2WUEA 3SR4A 4F21A 5CX4A 1WMFA 2FEOA 2GJAA 3KEOA 4IICA 5B58T 2QI9F 1ZD8A 2DQKA 5KS2A 1JIVA 3IE1A 1ML3A 1DSSG 4TT3A 3R0ZA 3CO5A 1NR7A 4EVRA 4V1CB 1XTZA 5JSZA 1QCCA 1TYAE 3K8YA 5C7LO 5SICE 3EMKA 5EUMA 5JBNA 4W5JA 4QQKA 3IAFA 3UMMA 3QQ5A 1DKQA 1IK4A 1Y8CA 1H9AA 1NKTA 1RIFA 1BX0A 1SUDA 1TU3A 3PD1A 4XPIB 5DGCA 2ZUUA 3OEED 4ZCMA 2IZ7A 4XIFA 2AX3A 4ERXA 5JXHA 4K28A 2VFAA 4D97A 1K9SA 3C5WP 3UATA 5DN6A 2CUZA 2BR3A 1C3XA 3WLOA 3TECE 1UFQA 3ZJUA 2IELA 2QAJA 3P5BA 1D2CA 4HPWA 4JL5A 4BGIA 3B3JA 5CG1A 2IEIA 3LYUA 1HYEA 2GVNA 3D3JA 3HBLA 4W99A 3VYVA 3W1VA 2CVPA 5FL7A 4NAVA 2QSZA 1XP5A 4ZVTA 3VYTB 1PLKA 2W43A 4QHYA 1CJSA 1F8UA 2FFJA 5TJ9A 4EABA 3ZHSA 3LUBA 3IURA 4ODIA 4RTMA 2E55A 1FEZA 1WV0A 4DJTA 4DDWA 2YYAA 1LB1B 1D03A 4JYMA 1S7GA 4JJ6A 2ZUWA 4TYPA 1B6SA 4FP9A 4K8RB 1QP8A 4MO2A 2CK3D 3W7VA 4F72A 2UYCA 1LLCA 4PQGA 5J4VA 1V47A 3N8KA 2MMCA 3VKFA 4QBTA 1J23A 2IU6A 2X9NA 1E59A 2ZT8A 1CTQA 4KUGA 4TRMA 5IF9A 3BK7A 4EJMA 1W5EA 4WZAA 3D3WB 4JBIA 1W93A 2H16A 4C4TA 2L17A 3B7PA 3BMCB 1C0LA 1PJSA 1FSGA 1PL8A 2GXSA 2VK8A 2D8MA 3KK0A 4LVNA 4C88A 4D9GA 2DPLA 2NTVA 4RTPA 3BT7A 4GYJA 1UXKA 2GCGA 4KQIA 1SHLA 3M1LA 5CG2A 2PKCA 4AF7A 4NH4A 2RKBA 4ZFNA 1BH6A 1IDOA 1MRNA 1WMAA 1JKXA 5BRNA 1MQ9A 2C61A 3D8HA 2XGSA 4O4JB 4UASA 2GBPA 1UBKS 2PUWA 3L4EA 4FFBB 1SBIA 1B6GA 2W6CX 4YBZA 5JW6A 4AKHA 1NJFA 3H1PA 3SSAA 3UJ6A 3NNNA 5FQOA 4D4LA 5AJWA 2V74B 4DLLA 2YVKA 1KMHB 1UMCB 4HDCA 1P2DA 2OWEA 1E69A 1WM1A 1TEVA 4XDYA 2JRLA 1OH7A 2RFLA 1M1XB 4N0DA 3L7BA 1DCTA 1PEAA 4IS2A 4AS3A 4RH0A 2Y6VA 5C52B 3OPYA 2PGJA 2AFHE 3FETA 2O8EB 3UY4A 2YW2A 1X6VA 1GZVA 5LZ7A 3LC7O 4QEDA 2V7UA 3I3OA 2H0RA 4Z0TA 3V8PA 3U1VA 5JC1A 2DTEA 2Q3FA 2OP0A 4L2IA 3N8NA 1KA9H 2CBXA 3I8OA 2PO5A 1VBNA 2VJBA 2HNAA 2J33A 1CZUA 3ZHUA 5IKMA 3MTBA 4TWJA 1P6UA 1YMVA 2Z3ZA 4I4NA 5F21A 1L4GA 3GAMA 3W2EA 3SJZA 4JJKA 1J7JA 4JX9A 4BNUA 2IPLA 1UM9B 2C9OA 4QXMA 3ZLVA 1K8QA 2Y2VA 2QMZA 2MSKA 1CJBA 4JEUA 3T0GA 1KVTA 3K92A 2XTAA 3A6HA 3GLQA 3OQIB 1Z0FA 5G2OA 1N1MA 5KAPA 5JADA 2QJWA 2ZRMA 1Z28A 2ZVJA 1RXUA 3TRJA 3S4YA 1U4SA 2JGEA 1NASA 3BGVA 4RA9B 3ZBPA 4EZIA 1QDUA 3CO0S 3HN6A 4AY4A 4ND8A 4L4XA 5K0GA 5EHQA 3DEYX 2B1JA 5JH7F 1DDGA 2QRPA 4WNYA 3KAQA 3V8VA 2A0XA 4TOIA 5IABA 2PXAA 2GPTA 1WCIA 2BKXA 3VRHA 3QPDA 2AFHA 3A32A 2GKSA 2HMYB 1Y1PA 2AYXA 5U9CA 2OL4A 2V7PA 1E9BA 1K7CA 2ZUBA 3SU8A 3PXGA 1M67A 3GX1A 3EPHA 3ZU3A 3PRJA 4P31A 4DCJA 1IHOA 1LLDA 4MVWA 1PJLA 3E1KA 1NGSA 2Y1DA 3THRA 3STHA 4IO0A 3CUYA 3QF4B 3JATB 2BGLA 1GIAA 1SXJB 1LW6E 2CHGA 2LIPA 3K4HA 2OFWA 1PZEA 2PANA 3WYCA 4JLAA 1B16A 1LLQA 2YNMD 1OC2A 3FGNA 5E9JA 3P0FA 1L7DA 3UJBA 5EXTA 3LBFA 1AKEA 4FDLA 2GCOA 1KSGA 4Y2PA 5JCOA 5GVRA 1Q3KA 5HRUA 3BIJA 1J5XA 1DS6A 3PFCA 4IQ4A 5CUQA 2MCFA 5LBUA 2FMXA 2BGNA 2RONA 3GT4A 3KR2A 4B1FA 5KTOA 1OLXA 4RVHA 4DBLC 3GRCA 3T5AA 3PC8A 3DZGA 2C9CA 2CDRA 2YFHA 3CN7A 3CLUD 3G1WA 5K3FB 2DECA 4UNQA 2VP3A 4D44A 3IEMA 2E4VA 1NN1A 2QLTA 2X15A 1E32A 5DT9A 3SQOA 1XDUA 5ESDA 4JNCA 1YCFA 1TO1E 5AD1A 1I6WA 1XX6A 2G1AA 1E9VA 3OT4A 2WSYB 4OL0A 3BE6A 3GT3A 3M4YA 4YN3A 4CZ2A 3D4BA 4YRCA 4JC4A 3GGPA 1PDVA 3F71A 3WS7A 1YBFA 3KHSA 3L5KA 4ZOLA 5EWJA 1M54A 1I5EA 2XNDA 5K0CA 5CFMA 1QIGA 4I1PA 1II0A 1AV6A 1OPRA 1AKWA 3L1UA 3GO4A 3COYA 1U1DA 5BMVF 2VPTA 1WOYA 3BFPA 1OE0A 2K2WA 2RARA 4GLOA 1Z83A 2VCYA 1OBFO 5CW2A 4ZYUA 2JJMA 3MTDA 1RTKA 4UARA 2NZJA 4YR7A 1A77A 2WABA 3UKJA 4BFSA 2P69A 2FR8A 1WJGA 1Q57A 5K8CA 3LM8A 1XPJA 2Y4NA 1C7RA 1FYVA 3M9WA 3OE5A 4HQRA 4I6JA 3UGQA 2MSNA 3HCBA 1N32B 1ETHA 2OV4A 2R4UA 3C4JA 4B48A 2WVJA 3BWEA 1RCTE 2WB4A 3EDCA 2J0UB 2XNSA 4DMHA 3SSNA 1E1CB 1TYBE 3GB9A 4MQFA 1D6SA