1BSVA

Gdp-fucose synthetase from escherichia coli complex with nadph
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
317
structure length
317
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords PROTEIN (GDP-FUCOSE SYNTHETASE)
total genus 103
structure length 317
sequence length 317
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bsvA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1bsvA02
1I3MA 4MIEA 3JQ7B 4CUKA 3IL2A 4PG7A 4RQUA 5TT0A 5JC1A 4K26A 1E5QA 1X7HA 3I6QA 3EDMA 3M6IA 3NDJA 1R66A 5JLAA 1V0JA 3H4VA 3H65A 2I99A 2EIHA 2OHXA 3IIEA 3RUIA 1SNYA 3PQEA 3RUCA 1ML3A 5AYVA 2ILTA 1SEPA 1P1HA 2OBNA 4ZRNA 2ZJ0A 2CNBA 3EZYA 3OICA 3LU1A 3BHIA 4CM6A 1GUFA 1U4OA 1X0VA 4PLVA 3RD5A 1P44A 1NQAO 5KVVA 1A71A 1M75A 3OQ1A 3HFSA 5FFFA 1MG5A 4DYDA 3UHAA 1U8FO 2FPGA 1AUPA 1EMDA 3RUAA 1OMOA 3UN1A 3VPHA 4YT4A 2UVDA 4WLUA 2J3HA 1HYGA 4OYRA 4OKIA 1B2LA 4NBRA 3TZKA 4I9NA 4FC6A 1MGOA 2O23A 5DCUA 3WFJA 5C37A 2EV9A 4QQRA 3RJ9A 4NFHA 4E5KA 2DBQA 2I67A 5A04A 3DBHA 4FIZA 3WWZA 3HADA 2Q2VA 4MP6A 4RO0A 3RSHA 2G76A 4QFDA 2CSUA 2VYNA 2C59A 3T4EA 4YJDA 5BQFA 5L7YA 3WIEA 1U5AA 4MVJP 1D1SA 1K5HA 1QYDA 1DC5A 2Z1NA 3DAFA 5A05A 5A5EA 3FRJA 4JBHA 4CM9D 4WOJA 1LDEA 4XIYA 3OA2A 1ZJYA 1KVTA 1N7GA 4YQYA 4AJIA 4ZQGA 1C3VA 2P9CA 4OL9A 3WYCA 4B7XA 3W6ZA 5I7FA 1CQJA 4J1SA 2QX7A 4YWJA 1KY5A 3TF5A 5KJCA 1K89A 3ZCXA 4ZU3A 1ZZEA 1P1FA 1C1XB 3MWEB 4BO0A 4IMPA 3UUWA 4Q3AA 5JBIA 2E37A 4UUPA 1O6ZA 1PX0A 1ZO8A 4YCAA 1IULA 3H9QA 4NR0A 2DQ4A 3WFIA 3TN7A 3UICA 4DLAA 2CVOA 3BHJA 4FJ0A 4AJ1A 3GAFA 4IDBA 2FPPA 3GVXA 2PWZA 2J6IA 7ADHA 1XSEA 2AEJA 2NACA 1QP8A 4QUKA 4MVJA 2Q1TA 2TMDA 4GMFA 2CDBA 3A4VA 3JD0A 2O4CA 4YEDA 3ZNPA 3ENKA 5KJ6A 1MC4A 2Y68A 5JXWA 1RYEA 1HE4A 4MVJG 2VTDA 3IJRA 2Y1OA 5I7VA 1QSGA 3FNFA 4HNHA 3WBBA 3GGGA 2NTJA 3O9ZA 3DO5A 3EHEA 4RPHA 1HE3A 2P68A 3TZ6A 4BNWA 3NGXA 3GY0A 4CQMA 4OGWA 4CLOB 1B8UA 4BQRA 5HWSA 4D79A 3N58A 4WE3A 3O8QB 4B3JA 2H1SA 4XRGA 4D0RA 4CLRA 1HTBA 2FP4A 1HE5A 3AUSA 2H9IA 4IZHA 5EIOA 3FI9A 2H5LA 5AOVA 2I9PA 5EL0A 2XXJA 5T8KA 1KOLA 4EITA 1UDBA 3K92A 3AOEC 4MP3A 3ZWYA 1E3SA 1E7SA 4FB5A 1J4AA 3MJTA 2ET6A 1Y5RA 4TVOA 3AFNA 1ZSNA 5JO9A 2GPTA 3OJFA 4RVDA 3S2IA 2CDAA 1DIAA 1M6WA 5B37A 1EE2A 1GAEO 3RUFA 1ZKMA 2P4QA 3GHYA 1XHLA 3Q9NA 5G0TA 4FJ2A 5T5QA 5A1TA 4R9RA 4O5OA 3JQBA 1VI2A 1BHSA 1CERA 1MFZA 1YGYA 2Q1SA 3IQDB 3HQ4O 1UDCA 3B6ZA 4E5MA 1QYVA 3B20A 4LN1A 5IZCC 1PU2A 1P1IA 1MV8A 3SLKA 1DB3A 3ASUA 4CQMD 1PIWA 5JYDA 4DIFA 2WE7A 3RUDA 5A9SA 4Y98A 5H81A 2X6TA 5DZSA 4MKRA 4UREA 1KVSA 5ITVA 2VYVD 4B4WA 1IPEA 1PS9A 3VH2A 4XX0A 1YB1A 4CQLA 1P9LA 1XG5A 5L51A 3C24A 4EJ6A 8ADHA 4YT8A 2JCVA 3GDOA 3SJUA 2B83A 2VWQA 3KYCB 4IXWA 4IMRA 1XDWA 3UF0A 3GH3A 3RKRA 1Q1NA 3KZVA 1E0DA 4M89A 1XYGA 3AK4A 1T25A 5I8ZA 2C5AA 1V8BA 1QORA 2ZK7A 3LT4A 1B3RA 4P8RA 4BNJA 3ETGA 4CM3A 3VHRA 4WUVA 1EK6A 3Q2KA 4P4LA 4DPKA 3HFGA 1P77A 3QWHA 1DLIA 1NAIA 5TLSA 1YRLA 5TNXA 2WJPA 2BF7A 2I76A 3OQ6A 4K9DA 1OAAA 4K28A 3QSGA 4H15A 4A7PA 1E3EA 5AXAA 4PG4A 1TVEA 3AY3A 3RIHA 4I9HA 1UXJA 3JYLA 2HUNA 3ITKA 1TEHA 1BGVA 3DFUA 2BH9A 2V7PA 5JAMA 4MKXA 5TRTA 3VPSA 2X0JA 3LC2O 2FY8A 3KVOA 1TLTA 4MPDA 4E12A 5JO0A 5B4VA 1VE9A 1Z74A 3LT2A 3FPLA 2O2YA 3DC2A 2VTEA 1J0XO 3PHGA 2UYYA 4NBVA 2C7VA 3VDQA 1GY8A 3DHEA 4WCDA 1FK8A 2HMVA 3I3OA 4TVBA 4AJOA 4TSKA 3UCXA 4E3ZA 3W4IA 3PIIA 1LU9A 4CM7A 5K9ZA 2X58A 4YAIA 1WVGA 3E1KA 3KXDA 3KM0A 4FOSA 2CVQA 1FDWA 1PJ2A 2HRBA 2EGGA 2O48X 3BMCA 1PR3A 2HJRA 2EW2A 2IEDA 5A3JA 4AJPA 2BFPA 1K6XA 1UZMA 3LSYA 5JFOA 4NFSA 1NPDA 5AXDA 4MJLA 4Y6RA 1QYXA 2PD3A 3JQ6A 1UZLA 1KEVA 3VPGA 1GZ4A 4BB5A 5BNFA 3VTFA 2YQ4A 4IDGA 1JWBB 4G81A 4GBJA 3ROKA 3UOGA 3PGXA 4TKLA 4XB1A 3ZNOA 1DHRA 4MIYA 2IYPA 2O3TA 3TZCA 4A5OA 2WE8A 2BMAA 4WGGA 1D7OA 2CUKA 2WDZA 2Y1EA 5DP2A 4N54A 3RROA 5U4QA 3WJ7A 3RFTA 1OC4A 2HRZA 4CMIA 3WGZA 5C7LO 2FR8A 3ETDA 4M87A 4LK3A 1KIFA 3BZUA 3JD1A 2HQ1A 4D41A 5ICMA 3PFWO 4R5HA 5GY7A 4WJZA 4JIGA 6LDHA 1LX6A 4PLYA 3M2TA 1CF2O 2V6GA 3ASVA 1NAHA 1EQ2A 2WEKA 1JWAB 4D7AA 1MP0A 2OFPA 1SBYA 2GCGA 3NEPX 4RZHA 1PGJA 5KKCA 2G82A 4KUHA 4WCFA 3C1AA 2ZQYA 4DQVA 2X0NA 3PJFA 2W2LA 3W4JA 2ZB7A 1ZK4A 4XQCA 2DTEA 3EAGA 3JQFA 4RLHA 3DDNA 5IN5A 3ORFA 3PHHA 4B8ZA 2ZYGA 4Z9YA 3GK3A 1Z82A 1YXMA 1W6UA 2QIOA 2W2KB 1WXDA 5JY1A 3OIDA 2BGMA 1E3WB 1UP4A 2DU8A 3RCBA 4BNNA 3JQEA 4R51A 2NSDA 1K6JA 1NR7A 4CMBA 2E48A 1ARZA 1O89A 3EK2A 4RDHA 4IINA 5BR7A 2VUSA 3DMTC 5IN4A 1E7YA 2YHIA 2VRCD 3PIDA 4FFNA 1DC3A 1M67A 2WMDA 3DMYA 4J9VA 3WICA 1O9BA 3H9EO 4M49A 3PLRA 5LCXA 1XU9A 4BKUA 2E6UX 3RBVA 2EP7A 2C5EA 4NK5A 4YJGA 1Q0QA 2GGSA 3EY4A 3C7CB 2DTDA 5F5NA 1JVSA 3JD2A 3JYPA 3VH3A 3PYMA 5F1KA 3IAHA 3K2BA 2DUWA 1UDAA 3AM3A 1T4DA 1XWFA 2BI8A 5ITWA 1XKQA 2C82A 3DBVO 2A94A 4IXTA 2AQHA 3KSZO 1PJTA 4J4TA 5H83A 5ER9A 1HZJA 4ZVVA 4F46A 3SEFA 3JQ9C 3PP8A 3Q0EA 3SC6A 4M54A 1GR0A 5JAZA 3PLNA 2VOEA 4JJGA 1ZMTA 2DM6A 5ER6A 3GC6A 5JCJA 2YJZA 4CV2A 4Z3KA 2Z1MA 1P74A 4B4VA 3BIOA 4KZPA 5COQA 3ZWOA 1HDOA 4CLEA 1B26A 1QV7A 4XR9A 2OMEA 2Q4EA 4NPCA 1W73A 4S3MA 3FHLA 5HBRA 2IDZA 1YWGO 4FD3A 4FSHA 1MXHA 4GKBA 4U6SA 3QW2A 3KHUA 3RKUA 1H9AA 4Z9FA 5CAEA 3H3JA 1V3UA 2D2IA 1GFSA 2E4AA 3UW3A 2EWMA 4ZA2A 3QY9A 2O2SA 3HZZA 4Z6KA 5T6BA 3LQFA 5DULA 3DL2A 4FDAA 3VVCA 1I33A 3ZWCA 2E82A 5IJZA 1ZEMA 4QFCA 4I5FA 1VC2A 1ONOA 3NKLA 3NT5A 5COAA 3SC4A 4ZD6A 4II2A 4ND5A 1LQUA 1OZAA 1FDTA 2UAGA 3I9MA 3JQFC 4MIOA 1OOEA 4MO2A 4CM8A 4CLOA 4DPLA 1MXFA 1K0UA 5MDHA 3PYXA 1UP7A 3L77A 1EEHA 4PLHA 2GERA 1JA9A 2NNLD 2YDXA 4JROA 3F5QA 5DBIA 1B0AA 4DA9A 3D64A 1P1JA 1NP3A 4FQ8A 4KQXA 4NH4A 4A0SA 3GQVA 4BNGA 1FDUA 1PQWA 3DBRB 5BSHA 1AN9A 1Y9EA 2EF1A 3K5PA 2POQX 3UKOA 4RPGA 1A72A 1GU7A 4EJMA 2P9GA 1C0LA 5TC4A 2Y0DA 1LTHR 3ZN2A 3DOJA 4NMHA 2VNAA 4HP8A 3TL3A 1SB8A 3GMDA 2YV2A 1SCUA 3H5RA 5KWEA 4EBFA 1BXZA 3CXRA 3PRJA 1WPQA 4WPGA 1RYDA 6ADHA 4BNLA 3WQSB 1NR1A 2WYVA 5T57A 1XQ6A 1NWHA 2NM0A 3OMLA 3JQCA 2GZ3A 1PL8A 2OP0A 2YFHA 1ADFA 3KO8A 1JLLA 4XCVA 3VOSA 4CMJA 5I7EA 2Q1WA 3BHMA 3CZMA 4KWIA 1Y8QA 2D0IA 2EJWA 2R2GA 2X1HA 2VHXA 3IMFA 4GGPA 2BELA 3F1LA 3V2GA 4TWRA 4XYLA 3G3EA 5IDXA 2RAFA 3LT0A 1CIVA 3AY7A 4OKNA 5GZ1A 3TZHA 3GRKA 1N7HA 4TMFA 1Y9AA 1PGQA 4CQLB 5F21A 4RQTA 4CMEC 1GQYA 4EUFA 2BGKA 3RI3A 1GUYA 2DUUA 1XCBA 4E33A 1H9BA 4KQWA 4JBIA 1KETA 4W99A 1E1MA 4CM8B 1IPFA 3VKUA 4BGEA 4P38A 2GYYA 4J43A 1LRJA 3OM9A 1LDNA 2PK3A 3QVTA 4GMGA 2QG4A 4KUEA 2IODA 1G1AA 4BO6A 3NAQA 2B0JA 1EUZA 1E7MA 5CP8A 1IZ9A 4ID9A 2QYSA 3IDSA 4YAKA 2PR2A 5GZ3A 1ISJA 2I66A 3B1JA 3E9NA 1Y81A 4IQGA 4DTIA 1JN0A 2HLPA 1EZ4A 5JC8A 1D8AA 1H6CA 4YBZA 1M6HA 2W90A 4XDZA 4AJ4A 3ONEA 4IDEA 1DIGA 2YHUA 2YY7A 5JSFA 2P4HX 5IFLA 1X7GA 3UVEA 4IJKA 3CIFA 3E9QA 4YA6A 2LDXA 4LSWA 1DOHA 1FXSA 2FR1A 4JX8A 4MKZA 2PV7A 4NNJA 1VPDA 2NVWA 1YDWA 2BRUA 1EDZA 5A9RA 5BSEA 3RC9A 1SEVA 2W4QA 2ZCUA 2EKPA 4DVJA 4UVIA 3HUDA 1EVZA 1UR5A 4R5MA 2YUTA 3BXXA 4RF5A 3ZHYA 2JJYA 1U2DA 4TROA 3L6OO 4PG8A 1Q2XA 3WG9A 3I5MA 2PH5A 5BSFA 4FGSA 5EN4A 3OEYA 1GCOA 3OFSA 4GSKA 3WMWA 1C1DA 4Q3DA 4R1SA 3V1YA 1T1RA 1JKFA 1LQTA 4PVCA 3O03A 3P2YA 3EVTA 4AJJA 5L95A 4LCEA 4HBGA 4XWYA 1YE3A 4GPD1 1GYPA 3TDKA 2R00A 3OQBA 4J1TA 1R16A 3E48A 1LC0A 2AG8A 3DZKA 4GX1A 5JPIA 1FJHA 3JV7A 3VTZA 1I2BA 4LISA 1YQGA 5THKA 3ANNA 4JK3A 4ZGWA 3ONFA 3L6DA 5IZCA 3EMKA 4Q3EA 3FF4A 4W82A 2A9FA 5J23A 3E18A 3UAGA 3GUCA 1YL7A 1KY4A 2PKRA 3FN4A 3P2OA 1QYWA 4HXYA 1IHXA 2BFOA 3ROQA 5IXSA 4HY3A 2CMDA 1ORRA 1HF3A 1XELA 4D42A 5A06A 3D1LA 3NT2A 2AQIA 4EYEA 3WJAA 5I9NA 4QEDA 2C20A 3JQ7A 5ICSA 4BV9A 3AOEA 1VJTA 1YVEI 1ZUD1 1H2BA 5T8KC 4BNKA 2VT3A 3CINA 4NU5A 4F45A 1J5PA 3MZ0A 1FF9A 1BDBA 1GPJA 4BKRA 1ZK2A 2PD4A 3AM4A 4FGWA 1EBFA 1D3AA 4L74A 1N9GA 4ND4A 4CM4B 2ZYDA 3GZ4A 2BHLA 3GLQA 5TIIA 4XGKA 3KUXA 1XQ1A 2O3SA 2C2XA 3VPXA 4Z3DA 3ONDA 1RJWA 3EYWA 2DT5A 4GAEA 1I30A 1KC1A 1KEWA 2OL4A 1GZ6A 1TT7A 2V65A 4R1NA 1C0PA 1GEEA 4LMRA 4CM5A 1XA0A 5JDIC 1Z7EA 1OC2A 4JXKA 2CFCA 3JTMA 4UULA 2XAAA 4J7UA 1QLJA 1VSVA 2I5PO 2RHCA 3O8QA 1FMCA 5COBA 1E77A 1VJ0A 3WDSA 1BVUA 3WLEA 3LYLA 4NBWA 1B7GO 4FPXA 1NQ5A 2Q46A 3GR6A 3GVIA 4J6FA 4YAEA 1OBFO 4CL8A 2NU7A 4D3DA 3BMOA 4OMUA 5CEJA 2NU6A 3ZU3A 2FZWA 4U0JA 4G5HA 4WLOA 4BNXA 1UXKA 4NI5A 4HX5A 2GSDA 3SVTA 4LGVA 4YRDA 1ZK1A 1R0LA 3LC7O 1UH5A 1GD1O 1VSUA 2CDCA 2LDBA 2O50A 1RKXA 1W4ZA 1U7TA 1EQUA 4Z0TA 3QWAA 3Q9UA 3E5RA 4UVDA 3OBBA 1LSOA 5G0VA 4RLSA 2BKAA 5C7IO 9LDBA 3DQPA 3GVHA 4ZQBA 5JDCC 2JD2A 4ONEA 4R3WA 2Y67A 2VRCA 4BNTA 4U8GA 4K1LA 3BA1A 3D3WB 1N1EA 3BMCB 1ZK0A 2GZ1A 1BWSA 1KVUA 2VYND 2Y0EA 1HYHA 3ZNQA 3D5TA 1YONA 3U4IA 5KJEA 2AXQA 4Q9NA 3PYLA 2ZTUA 4OOEA 4FJ1A 2Q45A 3QWFA 5JCXA 2SCUA 4AJNA 1ZW1A 2BD0A 1JDJA 4CJXA 3PPIA 3MJ4A 4CLHA 3QA9A 2GLXA 4BNIA 2AQKA 4UEKA 4B7CA 1ZCJA 4BO5A 5G0WA 4D44A 5IG2A 2GN8A 1PEDA 4UEJA 4BMNA 2WSBA 1SC6A 5B1YA 2J3IA 2B4TO 1I8TA 3ZWNA 3PEFA 1O94A 4XJSA 4O63O 3QVWA 1QLHA 4BNVA 4E31A 2YHIB 3RUEA 1MA0A 1Q7BA 1DAPA 4II3A 4GX5A 4YYZA 1TT5B 4CMCA 3F3SA 1A4UA 5JCJD 3FWZA 4WEOA 1NVMB 4RF4A 4AJKA 1CEQA 4JP2A 4XRRA 3CE6A 2NQ8A 5KOIA 3IKVA 2O7SA 4A2CA 2HU2A 5AQ1A 1ISGA 5L4NA 2PA3A 4RZIA 4CV0A 1YBVA 3GUYA 4MVJM 4CL3A 4BMVA 1R4NA 4QTZA 4W6ZA 3R0IA 3WWYA 4J0FA 3IS3A 2VHYA 3OA0A 3W1VA 1A27A 1LSSA 3IUSA 4N5LA 3G1UA 1RM5A 4BIIA 4Y8VA 4CR8A 3P19A 3HB4X 1E7WA 1Y7TA 4B3HA 1R0SA 3MTJA 2H6EA 1F17A 1WDLA 2EP5A 4QXMA 3ZV5A 4DMLA 3LDHA 5L40A 3OHSX 3PQFA 3QWBA 1GYRA 3KLPX 1HSZA 4LMPA 4GWKA 4XJTA 5DP1A 4TRJA 4DBZA 1ID1A 1DPGA 3U4HA 2HK9A 3HDJA 4CM4A 1LUAA 2JCXA 2V6BA 3GAZA 4URFA 1F14A 3OF2A 4NBUA 3K30A 2YV1A 2HKIA 3CEAA 2D3TA 3NRCA 2Q4BA 1X14A 3TRIA 5LDHA 4IGFA 4OHUA 5THQA 3VC7A 2YDYA 2D5AA 2ZTMA 1BDMA 5T67A 5BNTA 1HSOA 1HL3A 2R6JA 1GCUA 1HLPA 1U8XX 3PK0A 3I4CA 2G1UA 5CPFA 3T7EA 3GVCA 1DLJA 1QKIA 1L7DA 2YYYA 4XYMA 4BS9A 3PDUA 4IDCA 3ZWVA 3HWRA 3UCEA 3HJAA 3PHJA 2WM3A 2VWHA 1ZMOA 4E4YA 4YR9A 5LDGA 4WLEA 4IIUA 1YDEA 1Q7GA 1F0YA 3E9MA 2CF6A 3U9LA 4CV3A 3OIGA 5LC1A 4XQ9A 3GNTA 1IUKA 3WTCA 4H7PA 5EESA 4L8VA 4OAQA 4CLDA 3O26A 2EEZA 1PQPA 3VZQA 2ZJ1A 4ALLA 2Q50A 5L4SA 4WLFA 3V2UA 1R4MA 1LEHA 1NQOA 1J6UA 2DBZA 4WLNA 1A4IA 5KVQA 1U7HA 4N5NA 3RU9A 2X0RA 1YQXA 4TZTA 3PDJA 1HWYA 1EBUA 1FDSA 3AY6A 5C3MA 1YBMA 2PNFA 3G1TA 4MVJE 3ZV3A 3EC7A 3WQRA 1ZNQO 2VCYA 4CMIB 4IJWA 4FFPA 3WX0A 2BI7A 3KB6A 2PGDA 2RH4A 3F9IA 4ILKA 2VRBA 1U5CA 3DBLA 3CMMA 3JD4A 1WZEA 2NU9A 1PWXA 1SMKA 4D3SA 4NHEA 1ZBQA 3BTOA 2J3KA 2HAEA 3QWIA 2NLOA 3NYWA 3D4NA 4AG3A 4AL4A 3ZWMA 3WGQA 4BQPA 2YW9A 3TFOA 1OI7A 1NHWA 2Q2WA 3AFMA 2B69A 3GNQA 1B8PA 1YOVB 2I65A 1YS4A 4HWKA 4H16A 3GMSA 1HDXA 4M1QA 2F00A 4GX0A 1PWZA 1NNUA 2FPIA 1A9ZA 5IF3A 3NDIA 1P3DA 2EERA 4RORA 1VL8A 2Q99A 4L9RA 4ZQFA 1N8KA 2ZB3A 4K6CA 2WD7A 1UJMA 4DL9A 4GLLA 1PL7A 2XOXA 5JMPA 1BSVA 3EVNA 5HS6A 4PCVA 4L4RA 4ALNA 4J0EA 1DIHA 1HLDA 1MG0A 1VM6A 1ZEJA 5I8WA 1JU9A 2Q1UA 1GQQA 1WMAA 1X0XA 2IE0A 3E6AA 3T4XA 4PZEA 3GPIA 3SBOA 3MOGA 4IGEA 2X4GA 3H9JA 4ND1A 4HV4A 1I0ZA 1HEUA 3QE3A 5DT9A 5CDSA 3C1OA 3GNSA 4FFMA 1LLCA 4R69A 1NPTO 1DDOA 1P1KA 3P5SA 3S2EA 3V2HA 2O4UX 3IJPA 1ISMA 2GNAA 4XYEA 4GQAA 3S1LA 4E2XA 3U5TA 3ZWXA 3JQAB 1Z7BA 3AUTA 1SB9A 5AXCA 5C7OO 3DTYA 2X5OA 1WAMA 2PD6A 3M1AA 2VNSA 3U3XA 4E21A 5CDYA 2VZ9A 3OJEA 5FI5A 1ISFA 1CRWG 2HSDA 4CM9A 3WS7A 3C7DB 4QSMA 3ULKA 2ZB8A 5K6AA 1V3TA 2ZCVA 2FSSA 2PZKA 3WYBA 3E03A 4W9NA 4IZIA 1H6BA 1V3VA 3DEYX 3ZHZA 3ICPA 4PLGA 3Q1LA 3DONA 4LSMA 4WEQA 4CMHA 2GZ2A 3GDGA 2QZ9A 1WDMA 1WW8A 3D4OA 3GZNA 4BO7A 1ZVMA 2D4AA 1YB5A 1P33A 1P0CA 1Y5MA 4BNYA 2NQTA 1ENZA 3INGA 3GT0A 5DF1A 3GN2A 4OSOA 1O0SA 1PSDA 2G17A 3IKTA 2AEFA 3WNVA 3OJLA 1SAYA 2AA3A 3G0OA 3WGTA 2TMGA 3FPCA 4E6PA 2VYVA 4BKQA 3GF4A 2JHGA 4A27A 5JDCA 4F6CA 4BKOA 3BMQB 4UUNA 1VKOA 4J1NA 5I9MA 5KJ1A 1NYTA 4XR4A 4YJGB 3R3JA 2VUTA 2Q49A 4YAJA 4OQZA 1E7RA 2GO1A 5EINA 4OOFA 3DR3A 1PJCA 2QZZA 2D5CA 4ROSA 5EPOA 1QYCA 3VH4A 3I23A 5K0ZA 3U62A 3JQDA 3AWDA 4XIJA 3INRA 1HKUA 2NVBA 4E2YA 5A02A 4LVCA 4R4JA 1GTMA 2GF2A 2VWPA 4PRKA 4YT5A 2JCYA 4HFMA 3KSUA 1LXCA 4BL5A 4YJFB 3AU9A 1KEUA 3QP9A 1EFLA 2V6MA 4YVFA 5G0SA 1X13A 1B14A 3OECA 4BO4A 1M66A 5DN9A 1VL0A 4IJUA 1AHIA 3DZIA 3RBZA 2FN7A 5JDIA 3L4BC 4AJEA 3FWNA 3OJOA 4R16A 2NVUA 2X23A 1T2CA 2Q3EA 4JCOA 1YBAA 1IY8A 1LRKA 4XYBA 5IDQA 2GN6A 1PR9A 3F1KA 4NG5A 1PZHA 3W8EA 4Q3NA 1I01A 2ZB4A 1Y8RB 5F5LA 2BFMA 3HDYA 4EJ0A 2DBVO 3MCVA 3OP4A 2O3QA 3V5NA 3MWDB 4Z0PA 4EI2A 1WZIA 4Y6PA 5BSGA 4GWGA 3NTOA 2JAPA 4ZQHA 4S1VA 3ADOA 1DHTA 3UCFA 4I5GA 1DRWA 2VZ8A 1Q0LA 3U49A 2YQ5A 2C54A 5L3ZA 3A28A 3TWOA 3JYOA 3MEQA 3ETEA 4UEOA 4D0SA 1DXYA 2QHXA 3ZW8A 4PGFA 1AE1A 3D3EA 1CDOA 2W8ZA 3PWZA 2PH3A 1C1XA 2A4KA 3RFVA 3ZU5A 1HDYA 2FR0A 2HJSA 3Q11A 3WGGA 3GHHA 1EE9A 1RM3A 3QVOA 2DTXA 3HB5X 1ENYA 3W6UA 5HS4A 3ZHXA 2Q2QA 1HZZA 4PLPA 5U1PA 1PJBA 3TZQA 4ALMA 2D1YA 4DQUA 4UVGA 4P4GA 1M2WA 1AHHA 3PZBA 5G4KA 3D7LA 4J49A 3DZFA 1HT0A 2XXBA 1MX3A 1NQTA 4RVGA 3RQSA 3VAZA 3E8XA 1RM4A 3OJ0A 4CUZA 3GPDG 3AI3A 3L07A 4K6FA 4JP3A 2VHVA 1U9JA 2P91A 2X5KO 2Y66A 3C3XA 3Q2IA 4RVHA 3ZU2A 4DLLA 3D4PA 1C14A 1Z6ZA 2HK7A 4PVDA 3DTTA 4FOOA 1LDBA 4IIVA 2R00C 2PZMA 1GEGA 1VRWA 2CVZA 4DWVA 3DHYA 2ZTVA 1FDVA 1LSUA 1DRUA 2DAPA 1R37A 1WLYA 4O0LA 1I2ZA 4DREA 3PWSA 4KMSA 3HHPA 3WIDA 4UUOA 4OH1A 3L9WA 3RC7A 4BB6A 3MJEA 3DBRA 4CV1A 4YRBA 1EUDA 3VPFA 1K2WA 4DC0A 1KYQA 1PL6A 3K8ZA 1TB4A 4PLCA 3GVPA 3BMNA 3F47A 1ADBA 8LDHA 2QRJA 2B4RO 3AOGA 4DIOA 1I3LA 5HRUA 1PJ3A 1TA4A 3PJEA 5I7SA 5F1PA 5GZ6A 3K31A 1E1LA 3A06A 4XGNA 4NQZA 4AJLA 3H9UA 5DBFA 2Y93A 5KTKA 1XR3A 3KLMX 4BNFA 3EGOA 2G5CA 3MJCA 4D43A 5L9AA 1GZ3A 1ONPA 2CF5A 2FHSA 1R4MB 2RHRA 4DUPA 1T4BA 1UZNA 2B4QA 2P5YA 1WWKA 3RBXA 5ADHA 2PGLA 4BO9A 3BTSA 3A14A 3H3FA 3I4FA 4I1IA 4XGIA 2B36A 1JVBA 1H93A 3TSCA 3IC5A 4CLXA 5JAIA 4IM7A 4AJ2A 4RF3A 2B5WA 3ZW9A 1NFRA 3DFZA 5EQFA 4A26A 5JW6A 1J49A 1G6KA 1H6DA 1Z73A 3HSKA 1NM5A 4GL4A 4ALIA 3KRTA 1ZSVA 3JQAA 3C1TA 3WMXA 1H5QA 3HDQA 4IS2A 5FYDA 4A03A 3EW7A 3WGOA 4DYVA 2OUIA 4CMEA 2EKLA 3GFGA 2P9EA 3T7CA 3VDRA 4E0BA 2DBRA 1LRLA 4NBTA 2JFFA 4Z9XA 4G65A 3M1LA 2I3AA 1T24A 3CPSA 4RPKA 4UUMA 3H5AA 3PGJA 2QQ5A 5JNLA 3K73O 2GRAA 4YTEA 4RVUA 1YO6A 2Y05A 1XLTA 4RL6A 4F3YA 1I2CA 1T1SA 2HMUA 3A1NA 4EUEA 5G0UA 3JQ8B 3H9GA 3WB9A 3BTVA 1LC3A 4J9UE 2EJVA 4L75A 4LVUA 2X5JO 4AFNA 1PJQA 2CY0A 1HDRA 4BO3A 3Q3CA 4R54A 1IZ0A 2AW5A 5IXYA 3PTZA 5MGBA 4L76A 4NDNE 3KV3O 4PLFA 2NV6A 4WOKA 4RCVA 1EVJA 2O3RA 3HDHA 3HN2A 2JFHA 2PKQO 4PZCA 3IUPA 4H3VA 3G49A 4U7WA 1I24A 3I9JA 4B4OA 1BXGA 4TRNA 4DQXA 2Y0CA 2AMFA 3TFQA 3S2FA 1VJ1A 1I36A 1LLUA 1LNQA 3JQGA 2FZEA 4OSPA 4PFJA 4R41A 1Y6JA 4YXFA 1LLDA 5B4TA 3ZNNA 1K3TA 3FNGA 3EUWA 2FWMX 2WD7B 2FRDA 5FWNA 1E3IA 3KTDA 2DVMA 1R6DA 5CDGA 4E30A 1E6WA 4BKPA 4YAGA 5TJ9A 3TNLA 5B4UA 1ENPA 3OEWA 3ZV6A 5A9TA 3ROMA 5FEUA 1PJSA 4X54A 3KOUA 4JLWA 3WLFA 2F1KA 1VKNA 2OXIA 3RJ5A 3DZHA 4XA8A 3ZGYA 2JD1A 1MB4A 4PLTA 1PGPA 1UXIA 3RVDA 2Z95A 3PHIA 3JSAA 1NFFA 1HXHA 2BFAA 4J4BA 7MDHA 4RJTA 1U3WA 2GASA 4BO1A 4U6QA 1BRMA 3MJSA 4MP8A 4DGSA 1U28A 1R15A 5DNAA 1SZJG 2IEBA 3A9WA 4OXKA 3DZJA 4BGVA 5CEFA 4RPLA 3SX2A 1BTOA 5F1OA 5H82A 3BMOB 1YQDA 3DOCA 1EDOA 1S7CA 1EVIA 1RWBA 2P5UA 2J5RA 3GZNB 3JQ9A 3PFFA 4OO3A 1WP4A 4FCCA 4U5QA 1HE2A 1UXGA 3AU8A 4KWHA 4C4OA 5L4LA 5U9CA 5CDTA 4N18A 5HA5A 2ZTLA 3I6IA 1N9GB 3QJ5A 3I9OA 1IE3A 4ITUA 4WECA 4Q3CA 4DRYA 3PWKA 2I6TA 3ZH2A 3I9NA 1Q7CA 3U4DA 4YACA 5KCZA 1DIRA 1A5ZA 1D4FA 3QRWA 1GYQA 5IDWA 4WCFB 4JBGA 4O1MA 2O3JA 1BW9B 5CHEA 5DOVA 1DIBA 1PS0A 1N92A 1O8CA 2GD1O 3LLSA 4TKMA 1AXGA 2VHWA 4NZ9A 3ZWPA 1C1DB 5TQVA 1DBVO 3ZWAA 2W98A 3DMTA 3E5MA 3W8DA 3GOHA 1TI7A 4HFNA 1CYDA 1NTOA 1Y1PA 2H63A 3S2GA 1R4NB 4HFJA 3V1TC 5TS3A 4NJOA 3CTMA 3VH1A 1DJQA 1KBZA 1RPNA 1H0KA 1XIVA 4JN6B 1X1EA 1GDHA 4ZN6A 4NIMA 2EGHA 2PZJA 1DO8A 3GEGA 4M55A 3TQHA 4CMAA 3VZPA 4RGBA 3WBFA 1V6AA 4GLOA 4Y6SA 3KYBA 2VWGA 2QYTA 3UFXA 2FMUA 4EW6A 4XQGA 1P0FA 2IRWA 4IQ0A 4N5MA 5JAQA 4UVHA 3GGPA 4WCFC 3IOYA 4CMKA 1JKIA 4FS3A 1ZFNA 4YRAA 2ZKLA 5IZ4A 5T64A 4IDDA 2HCTA 4J16A 2RH8A 1MC5A 3NT4A 1BVRA 3NUGA 2JHFA 3K96A 3FNHA 4L0QA 4RF2A 4R1UA 1D1TA 2PFGA 1SOVA 2DPGA 5TX7A 4AJHA 1A9YA 3ZWWA 3I83A 1ENOA 4NJMA 4J4HA 4PRLA 3NGLA 1R12A 2WWRA 2O7QA 4GI2A 2J8ZA 1WMBA 1YKFA 2C07A 2D59A 2A92A 1NWCA 2RIRA 1C0KA 3WNQA 5KVSA 3CSDA 2C7GA 2YFQA 4BNMA 3WXBA 2XPCA 4OXYA 3WQQA 5DDIP 3RWBA 2Y1CA 1HETA 3H5NA 2Y1FA 1F12A 1W0CA 3WTBA 3AUAA 2OGUA 4KOAA 5KKAA 4P22A 4OM8A 4R9SA 3LT1A 4M86A 4BGUA 4TRRA 1MLDA 2FSVA 4IUYA 1ULUA 5EERA 3KEOA 4E32A 4ND3A 3DHNA 4MVJF 2X7HA 1QV6A 2E49A 3LC1O 3OETA 1KS9A 2ZIZA 2IXBA 5CEEA 2GDZA 3TL2A 1QMGA 5CG1A 1XEAA 3GEDA 4BMSA 3QQPA 4DMMA 4I5EA 1PZEA 4UAGA 3L0DA 4OQYA 1SPXA 5HTOA 1PS8A 4NFYA 2IZ0A 4RDIA 4QECA 2WD8A 1AGNA 1KERA 3NX4A 5DOZA 3LF2A 2EKQA 2DFDA 2Y99A 4W4TA 1GQ2A 4IS3A 4E5PA 2HMWA 3K2EA 1U2GA 2PKQP 3ABIA 1E6UA 1MUUA 5ES3A 3V1UA 3W8FA 4KTVE 3DZBA 4WK6A 4B79A 2YV3A 2EHDA 3KYCA 1ONNA 2JD0A 1YJ8A 3HN7A 1LDGA 1IOLA 3JYQA 2UV8A 4L4SA 4FR5A 2RCYA 1SOWA 3F6YA 3F4BA 3NTQA 4LW8A 4DC1A 3FTNA 4BNHA 2B37A 3D3WA 4B3IA 5A4DA 4YJHB 5FI3A 5AVOA 1VLLA 3GG9A 4J3FA 4J91A 3ICCA 4YDRA 4DBVO 1Y8QB 3JYNA 2A35A 3STHA 1IHYA 1NXQA 2DFVA 4I9UA 3DBLB 3PJDA 1AXEA 3ZDFA 4YJFA 1P1RA 1JKJA 5KJFA 3TOZA 2GUGA 1ZJZA 5TSDA 2GR9A 1KVQA 5ENDA 4CQMB 1HDZA 1T2FA 3DBHB 4CUJA 1ULSA 4FFLA 3LLVA 1N2SA 3W4KA 4A10A 4D46A 2OOSA 5A5FA 1LI4A 3IP3A 1YOVA 5L53A 3O4RA 4CLRB 1OFGA 4CMGA 5CDUA 1LJ8A 1YB4A 4Y67A 3ZI0A 4R3NA 3RUHA 3DAPA 1I10A 1YJQA 5A3VA 1C0IA 3RU7A 4I5DA 3U4CA 4HADA 3JD3A 4HKTA 2GN9A 3LF1A 1NVTA 1EFKA 3QVXA 4FN4A 2WTBA 1NBOA 4IQ8A 2HDHA 2DC1A 3JQBC 1IYZA 3OIFA 1E1KA 2QRLA 1F06A 1E1NA 5I9LA 4QO7A 4Y9DA 4AICA 1ISIA 3C7AA 3DB2A 3K9QO 1KEPA 4D3FA 5C5IA 4J7CA 5L7TA 4IY1A 1X15A 3DZGA 4YQZA 3QHAA 2JL1A 3AI2A 4ZRMA 1EK5A 3N74A 4XD2A 3SLGA 2IZZA 2GN4A 3PQDA 5KIAA 3WSVA 4E13A 4ZJUA 1YL6A 3INTA 2Y1GA 1JAXA 1R0KA 5ENVA 4A73A 3FR7A 3MTGA 5JMWA 4FW8A 1O5IA 1CWUA 3H2ZA 5CG2A 5A03A 3NJ4A 4YJHA 5F3RA 5ILOA 3ROPA 5KNLA 1QR6A 3F4LA 1NX6A 4RVFA 2NTNA 3H2SA 3WSWA 2X8LA 4GH5A 1Z45A 3R3SA 3H7AA 3ON5A 4R01A 4DLBA 4E2ZA 4XDYA 3ENNA 3G17A 1LA2A 3DWFA 4JJFA 3RC1A 3ANMA 1NASA 5JYEA 1A7KA 4JQCA 1PGNA 1T26A 4XKJA 4WNIA 1T2DA 2W2KA 2NVUB 2X9VA 5JS6A 1LLQA 1ZK3A 3L4BA 2HMSA 4ZQEA 1IB6A 5DCWA 3HNPA 4J90A 5GMOA 5CPBA 1L7EA 3TPCA 1DAOA 5TJHA 4EGFA 2B5VA 4IJVA 5EJ2A 3F5SA 1ZSYA 2BLLA 3KYDB 3BMNB 2J5KA 1BMDA 1ZXLA 3AUUA 4JJIA 2OO5A 4ND2A 4N7RA 1U4SA 3VZSA 3X2EA 4F6LA 1L1FA 1HDCA 2CD9A 3ANLA 1SO8A 3ITDA 1I32A 4YT2A 1UP6A 1G0OA 1DC4A 3KETA 5G4LA 1GPDG 2Z5LA 5IAAA 4J2OA 3H8VA 3HE3A 4GGOA 1ADCA 3QVSA 1U3TA 1PZGA 4WLVA 4E5YA 2X86A 1G0NA 3JQGB 1P45A 1B16A 1I3KA 3GN1A 1Y8RA 2XF8A 5ILGA 3VZRA 4GSLA 4LCJA 4C7JA 3CUKA 4LRSB 4B7UA 2QRKA 2X9NA 4IDAA 1IL0A 3B1FA 1ISHA 3JQAD 3MJVA 1E92A 3R6DA 4O6VA 4YB8A 2UDPA 2AE1A 3UH1A 5EQDA 4FBGA 3AJRA 1E3LA 2PZLA 5G4KB 4KP7A 2CZCA 1PQUA 1TXGA 3ST7A 2VOJA 2HK8A 4OJNA 3S8MA 1BXGB 2NTVA 3U09A 2X0IA 3DOOA 4IBOA 4XEHA 1K6IA 2UUPA 1DSSG 1U3UA 5TF4A 3CMCO 1CETA 4MVJH 2VHZA 1GV0A 3FCOA 4BO2A 1S6YA 1T2AA 3GG2A 1GUZA 4Q3BA 4QO8A 3PZRA 4XYGA 3FTPA 3RFXA 4NJMB 1VL6A 4R68A 3RAJA 2W2LD 1X7DA 1UAGA 2I3GA 4TRMA 5FF9A 4IDFA 2G0TA 2ZQZA 2O3UA 3CZRA 2X9GA 2C2YA 2VQ3A 4KTTE 4B8WA 1Q0HA 1GV1A 4WNCA 3DXFA 3BMQA 3GRPA 4LRTB 3WR5A 4W9NC 4XZ3A 2AG5A 4ZICA 1I3NA 3L4SO 1UAYA 2UUOA 5K6AC 4J2HA 3FD8A 1PTJA 4KDEA 4E2WA 1JTVA 1DEHA 4C7KA 5TT1A 2J3JA 2J5QA 1V9LA 3H6KA 4B4UA 4NK4A 1ZH8A 1PJLA 2FOIA 2AEMA 3HG7A 4L4XA 4PLZA 4YPOA 2PGJA 3NDRA 1H94A 2EG9A 1E6EA 4MDHA 4EZBA 4BNUA 3NTRA 1NPYA 2NUAA 3S55A 4G2NA 3OSUA 4BV8A 1BG6A 1E3JA 2DLDA 3SJ7A 4RV9A 2IYOA 4CR7A 2HO5A 4IPTA 4MINA 4J7XA 1A7AA 3AM5A 2VUUA 3P7MA 4MOWA 3WGIA 3G79A 4PIVA 1MFPA 4I08A 4XQEA 1GADO 1PZFA 1QXSA 3FNEA 3L9XA 4UVEA 1I5RA 4W7IA 3PHLA 5DCYA 2V6FA 2JAHA 1T2EA 3DAGA 1LSJA 3KEQA 4CM1A 4D45A 5KVCA 3FBGA 2AQ8A 4PLWA 4CPDA 1NVGA 4NU6A 1JQBA 4EDFA 4OXNA 3VVBA 3ZHBA 3ZU4A 4L73A 1H6AA 1HYEA 2DKNA 2ZYAA 2VZ0A 1N5DA 3FSRA 2ZATA 2X22A 2C0CA 4GKVA 4P4NA 1X1TA 3NJ8A 1NHGA 4EEXA 4PN3A 1EUCA 1E7QA 1H2HA 3U0BA 3PXXA 5AXBA 3B70A 3WGHA 3QLJA 3UXYA 1JAYA 4DIBA 1WDKA 2IXAA 3CH6A 4Q39A 4OIMA 1ADGA 1CJCA 5L45A 1F8FA 1ZXBA 5BT9A 4O59O 5IDYA 4TQGA 1BXKA 2OZPA 4BUCA 4QT0A 1V35A 3X2FA 4BO8A 3I9KA 3TOXA 4EEZA 4BVAA 2VN8A 3KYDA 2BGLA 2WYWA 3GFBA 3L6EA 2VT2A 2NU8A 4E5NA 5B12A 3F46A 3LVFO 4RVSA 1HRDA 3FR8A 4WKGA 1YL5A 4PG5A 1B8VA 3I1JA 4TZKA 1DFGA 3TJRA 2DPHA 3WGYA 3PVZA 4KUGA 1E5LA 1RM0A 3UGKA 1DRVA 4FFOA 1TT5A 2IZ1A 3SXPA 5CFZA 2C29D 3BYZA 3E82A 3MOIA 3N7UA 2B35A 3R1IA 4GX2A 2AHRA 1N1GA 5EMHA 1UXHA 4XB2A 3ZZNA 4DPMA 3QIVA 5G2OA 4BOYA 3RASA 1O95A 4BNZA 1B3BA 5L7WA 4EUHA 2AE2A 3LZ6A 4I8XA 1KC3A 3M2PA 1WNTA 5DBGA 1DC6A 2PLAA 4HFRA 4R1TA 4ZHSA 4Z0HO 3NV9A 2OORA 2OBYA 2WYUA 1CQIA 3O38A 1DFIA 5A9SB 9LDTA 1UUFA 2QW8A 3ZV4A 5JY6A 3AW9A 4W7HA 1B15A 3C85A 4PZDA 3PJGA 4J1QA 4JGBA 4FFRA 3ZWBA 1Z75A 5JE8A 1U1IA 3JCZA 4ALJA 3LK7A 2Y1DA 3CKYA 3I52A 1LDMA 3D5QA 4ALKA 4CR6A 1XU7A 3K6JA 2PY6A 1BW9A 2OP1A 2P2SA 3OH8A 4HUJA 1P31A 4GVLA 1DJNA 4QX6A 1E3WA 4INAA 3BTUA 2HMTA 4M8SA 1LBEA 3Q6IA 3I9LA 3BAZA 3KSDO 3EZLA 4KDFA 3IP1A 3FBTA 1QG6A 4DXHA 2JKVA 3GDFA 1NFQA 3GGOA 4RPJA 1PGOA 1GL3A 1EVYA 1HDGO 1W8DA 2PTGA 4MVJD 4PG6A 3RC2A 2YZ7A 2RBEA 1LDYA 1F8GA 1KVRA 3QV1A 1U3VA 3C8MA 1YH3A 2JFGA 3GA0A 3COSA 4U0KA 4CODB 4BGIA 3VKVA 3V8BA 3D0OA 4FC7A 3AI1A 3JQ8A 3KBOA 4WASA 3WYEA 3GEMA 4AVYA 1XGKA 1QRRA 3WOHA 2EXXA 3PI7A 4JNKA 5BNIA 2NADA 1M76A 1PJ4A 1ZIDA 4MVJI 3B1KA 1DFHA 2NWQA 1JW9B 5TGDA 4HNGA 2EW8A 3ADPA 4BHTA 4ESOA 4GVXA 2D8AA 5HM8A
chains in the Genus database with same CATH superfamily
1I3MA 2GCOA 2HN9A 3MS2A 3N8DA 4G1EB 2JLZA 5TT0A 4K26A 1QIEA 2RBGA 5JQGF 3EDMA 4CRWB 3SWWA 3CCFA 1G5QA 1R66A 2WTXA 5JLAA 5K0GA 2HW8A 3RSZA 3I53A 2DWQA 2EIHA 2I71A 1PEAA 1LBTA 1SNYA 3PQEA 3U31A 3RUCA 4YXWA 1N2JA 3Q8MA 1W5FA 1Y48E 2WHRA 4CDMA 2C8VA 1EA5A 1JYFA 1ZD1A 2C03A 1P1HA 2HGZA 3BCHA 3C43A 3FLAA 4QDJA 5FJJA 1JDPA 4GDFA 2OBNA 4ZRNA 2ZJ0A 2TYSB 2FWAA 2CNBA 2J7PD 3H2YA 4HGRA 4QOHA 5TDHA 1FFAA 3MRXA 4PLVA 5HP4A 4KE7A 1NOKA 1RMTA 1BJKA 4JBNA 4MWCA 4AKEA 1A9TA 4BJ5A 2ZB2A 1PD1A 2ACVA 1A9OA 2PMWB 5J59A 4O4IB 3B8HA 2O0KA 4Y7CA 1CNEA 1PLJA 1AUPA 3PWTA 5D3MB 4WOBA 3RUAA 3UN1A 4BWGA 4YT4A 1G59A 4G8JA 4XSVA 5E6SA 2J3HA 1GSIA 3BVPA 4I66A 4WZZA 4KACA 3EF1A 1GT6A 1T5HX 4OKIA 5HGXA 4LJRA 3GJZA 3V8EA 1MGOA 2O23A 4J03A 1ZLXA 2YJ3A 1W88A 2XIQA 3RJ9A 1SG0A 4R9NA 4BN4A 1GA1A 5CA1B 3NYQA 5A04A 5IT4A 2O8CA 2ZJYA 2EFJA 5B2EA 3HADA 1BQEA 2CLFB 2J32A 4MP6A 5CLHA 5F5XA 5GOZA 1F1BA 4X95A 1V7PC 1Y7LA 2X8WA 1RI4A 4RE5A 2C59A 5FFMA 5FOSA 3FOAA 5BN5B 4RH0A 2AN4A 4TL8A 5BW5A 5ULLA 3HY3A 2IS6A 5L7YA 1UKZA 4YRKA 5DI3A 1WUKS 5E38A 4GYWA 2AFIB 2Z1NA 3L8ZA 1EFPA 4FYPA 1J97A 1OBVA 4CM9D 1KYIA 1J2JA 3IODA 3CZ5A 4WOJA 4CEHB 5FUWA 1G6Q1 3OA2A 3ZE0B 4D9FA 1ZJYA 1NNEA 4BNDB 3FTCA 1N7GA 2ISSD 3MOSA 1WRBA 4A1OA 3NPAA 1ESMA 3U26A 3WYCA 2ZANA 4ESEA 4EL0A 3DW1X 1Z34A 4KQHA 4R1PA 2BBOA 2ZE5A 1IMJA 1QGUB 3I0ZA 4U39A 1WPGA 1BHQ1 2AX4A 3DTVA 2HMAA 1OLUA 2XMDA 2PV0A 4B87A 1JQ3A 1CF9A 5DN6D 4ZU3A 3MWEB 1C1XB 1EWVA 3NVMB 4BO0A 2WP0A 1KDOA 4DDUA 1N4AA 4Q3AA 3UHFA 3AF5A 2E37A 4TLAA 3SAJA 4ND6A 3ZY5A 1POWA 4UUPA 4TVKA 1DV1A 1QIGA 1S96A 2FUCA 3DDUA 1WE2A 1ZO8A 3PUHA 4BP3A 3DV9A 5SICE 1OYVA 2OZLA 5CJPA 4PICA 3JX9A 1GKYA 4DLAA 2RDMA 1EVLA 1BIFA 2NXJA 3RYFA 3RNLA 2Q0QA 3RRXA 5L6MB 2C83A 3GAFA 2FPPA 4Q34A 3GVXA 4FGZA 1QTRA 2BTQA 1AMNA 5AH0A 5HHTA 4MVCA 2G7ZA 5EGNA 4IDPA 4II7A 3CZ9A 5I5EA 1OGJA 2OO5C 3OLXA 4UHCA 3VX3A 3TQHA 1FSZA 1PFGA 4B3XA 4U3JB 1EJ2A 1O57A 2JI6A 4WKPA 5DGDA 2IQ5A 1O54A 1WABA 4DHEA 5H9WA 1H1DA 2Y68A 1E1DA 2NPIA 1MX1A 1TPYA 1K2VN 3C3WA 3M1YA 1NW9B 2H1RA 4YXWD 3CNLA 4KNYA 1QSGA 2VRWA 4M0CA 1MPTA 5BUQA 3HM2A 2O0LA 2OVBA 5AVVA 3GGGA 1A8UA 3L6UA 3O9ZA 4L4ZA 4OB7A 3FZYA 4CL2A 1JKJB 4OYLA 1HE3A 3ENVA 1G9XA 2VP0A 4W1RA 4CQMA 4OGWA 1Z5WA 4ENRA 4BQRA 5HWSA 4RD6A 3U7QA 1ZN2A 4Q4HA 1WXIA 3NAZA 5FUQA 3K6SA 2GB4A 3DVAB 1HLGA 3NEJA 2WB2A 4F2GA 1JJ7A 2H1SA 1XZNA 1KSGA 4EAAA 3CR3C 4CLRA 2NNWB 1HO3A 4DUYB 2JIQA 1FNSA 2W8BB 5HDBB 3LYHA 3VR4A 2H9IA 4LE1A 2ICAA 2FEPA 4LY3A 5ANRB 3RRJA 3R3YA 4UFNA 3EXEA 1KU6A 2XXJA 4MWEA 5AVJA 4OB6A 5T8KA 3SBDA 1BMTA 3ENZA 3UNXA 3L2OB 1E3SA 1E7SA 4K8OA 2ZULA 3HI6A 2ZJOA 2ET6A 1Y5RA 2IPLA 3AFNA 3MJTA 3DTVB 4DWOA 4RVDA 4S12A 3S2IA 1DIAA 3AG5A 1W1IA 3QE4A 5FI1B 4P83A 3RT9A 3W5HA 1P0IA 4DLUA 3Q9NA 3B3AA 1P2FA 2J09A 1QH0A 2ID7A 4MWTA 3KXPA 1DWQA 4EABA 2Y4OA 3SZOA 2VDQB 3D2BA 5KYKA 2CVPA 1MFZA 1TX4B 3EDCA 1WUYA 2WWFA 3V4FA 3ZBPA 3B6ZA 4RSGA 3KHSA 1TK3A 2P7IA 1TM1E 3QMMA 1ZIYA 5ABPA 1ZUNA 4LEIA 4PGHA 3T0FA 3TD9A 2QRNA 4IGIA 4R2LA 2NZYA 1YU6A 3ZS8A 4DIKA 1ETUA 2WAAA 3EIXA 1XLVA 3TM4A 2JFOA 2XH8A 5AKIA 4KH0A 4DIFA 1D2RA 4KVGA 1X39A 2PS9A 3ORRA 3LBIA 1CQIB 4Y6OA 5A9SA 3F6PA 5H81A 2WG2A 3N3BC 3IDQA 3LKVA 4JYCA 4UREA 4A0GA 5KREA 1LF0A 3O1HB 1TEZA 2VYVD 2WUWE 4B4WA 3VH2A 1E1RA 3TLBA 3A1EA 2VK2A 4Y1RA 5CFMA 1NMZA 4CQLA 1XG5A 5CNMA 3PNQA 1ESEA 3SYTA 4FWIB 4RY9A 2BCGY 2VJMA 2XCUA 3RVQA 3P9XA 1SG6A 1Q44A 2NU7B 1N2CE 4Z1OA 1GR1A 2JCVA 4ASUD 1XRRA 3KYCB 4IXWA 4IMRA 3UF0A 4ZKDA 1Q1NA 3PQ3A 1Z0SA 3GMTA 1TF5A 5BQPA 3RLIA 4G1CA 1P3JA 2PZEA 4PSCA 3J7AC 1T25A 4KIJA 1N0HA 1ZHHA 2C5AA 4IJ5A 1WV1A 2ZK7A 1HQDA 1T9ZA 3TQIA 5ITZA 4P8RA 2HCJB 1L7QA 4DDTA 4WUVA 2YINC 2D7JA 4DPKA 2G71A 4P4LA 4Q0MA 1BVHA 3SHVA 1DO2A 2PKWA 2PVSA 5ALHA 4Z4FA 4OQFA 4RLFA 3CLSC 2IOYA 2KLHA 2Z3WA 1YRLA 3DO8A 3L02A 3OCZA 2VO1A 2ZIXB 2QJOA 3DXYA 2WJPA 3FPBA 3Q5GA 4K9DA 4KXLA 4OHPA 1BE0A 1OAAA 2HEIA 4EW1A 3RAFC 2BGTA 4EMSA 2OGZA 2L19A 2C7BA 4H15A 4IIGA 1E3EA 1A2QA 2D6FA 4Z4CA 1R4ZA 5EOVA 4Q1EA 3RIHA 4I9HA 4TMZA 5LZ2A 2HUNA 3TMAA 1TEHA 3C16C 1YR8A 1U2GC 2AJLI 3CEMA 3G2NA 4M8NE 2QR3A 4PYNA 4KJZA 3SFZA 3TCNA 3VPSA 1E9EA 5AW2A 1Q95A 3LC2O 1YR6A 4RMHA 1IZ8A 2HA2A 1MAWA 3U48A 4OUDB 1G21E 5CLGA 4E11A 3DLAA 1DZIA 1VE9A 2OBXA 1CFZA 4C0JA 4DDWA 5B3AA 1Y3CE 3MQFA 3SVLA 2C5FA 2C9MA 4M36A 3VDQA 2ADFA 3SDSA 1L8OA 1FK8A 3DE6X 4MV5A 1TCVA 1CHDA 1Q0RA 4TV8B 1VL5A 2P6NA 3BEDA 4DCMA 1OX5A 1G2QA 4HDOB 4R1MA 3W4IA 4ZK2A 4CM7A 1TQ8A 5K9ZA 3QNWA 4YAIA 1GJRA 3I1FA 3W7AA 3O31A 3TLYA 3LPLA 4QUAA 4N82A 2PRSA 2FZ4A 1J70A 5DHFA 4LDQA 2O48X 2EGGA 2FSVC 3BMCA 1PR3A 1C7RA 4G84A 4YIHA 5I4KA 1SQ5A 1U7XA 4FVTA 2BFPA 3GLGA 1K6XA 4PHGA 4H27A 2A1TR 1NPDA 1QYXA 2I1WA 4UCWA 3C5HA 3T5MA 3BD9A 3WNDA 4KOEC 3V9AA 4EEZA 5C80A 3AUXA 4B5KA 4KH1A 3O4VA 4GBJA 4PE5B 2XUKA 3OPMA 4XB1A 3ZNOA 2GHQA 1A8QA 2BMAA 1N5MA 1ZM3A 2SBTA 4WGGA 3WL6A 3I6BA 2QG6A 1UC4B 1U0NA 1E1RD 2WDZA 2YN0A 2OFOA 3NRJA 5G1PA 5G40A 1NW5A 3WJ7A 4E03A 1W46A 3KD2A 1YZLA 1N6NA 2GFHA 1UK7A 4LJAA 5LJIA 1I1HA 1C3OA 5BPHA 4Q47A 4CG0A 4HGYA 5KEIA 3GLRA 1HNXB 2QTZA 1N7IA 4EK9A 4C03A 3BZUA 1L1RA 2WA2A 5ICMA 3PFWO 1H1LB 1CY1A 2B34A 3EXEB 2ZRMA 3ND5A 1HLFA 1AU9A 4JHXA 5GY7A 3K1AA 1LVUA 1ZUHA 6LDHA 1V6CA 3U7GA 2V6GA 3ASVA 5DE3A 1VI6A 4RIEA 1N0UA 3G8AA 5F78A 1IPHA 3RGGA 5ADUS 2ETXA 4MWOA 4B6EA 1DAGA 4V02A 5TQ0B 6AT1A 1SQ0A 1AURA 1SBYA 2EBFX 4PU0A 2JGNA 3NEPX 4CG2A 1FEZA 2JLAA 3DAHA 1ANKA 2HU7A 2QJWA 1S5PA 1ULHA 3B1YA 5KHLB 1XZGA 4WCFA 4ZP1A 4P33A 2Z57A 3MTIA 3QVGA 2XUZA 2EJCA 2X8BA 1LPSA 4DQVA 1I13A 2VDRB 5KMGA 1DOAA 5KYTA 3W4JA 2ZB7A 1ZK4A 4QUBA 4AXXA 1UWKA 4YP9A 4MS1B 4MUEA 4P4SB 4CT0A 2J31A 3AVXA 3DGEC 4JU9A 4O5AA 3EAGA 4RLHA 1VMEA 3ISVA 2OTCA 3I6MA 3PNMA 4ZC8A 4QQ8A 4B8ZA 1N6OA 5C9ZA 1TMGE 1OX6A 5L3RA 3ILSA 2WZDA 5HKKD 3E0XA 3UG7A 4YUAA 2QIOA 4IMIB 3CX6A 4MB0A 4BDSA 1HMYA 5F12A 1E2EA 5JY1A 1RJDA 3RG8A 5CFOA 2WSMA 3M0EA 1UPFA 4MVYA 3R7FA 3STXA 3KLNA 3KPJA 4A3SA 2BGMA 3HYSA 3O3OB 2KWIA 3PUYA 1XPOA 3K4QA 5FPQA 1U7WA 4LTDA 3O3CA 4P7GA 2QT1A 2W71A 4D1YA 4ARAA 4RDHA 1O89A 2NIPA 4IINA 2QRMA 2R751 5IN4A 1QGDA 5B64A 1ODCA 1M67A 2WMDA 2ZYHA 4GO1A 2VSOA 4UHHA 4PCAA 3HV2A 2MMCA 4JEUA 5LCXA 5AKYA 1SXJD 2XUDA 5FOUA 5C1PA 4NK5A 5HUHA 1VSBA 4BE4A 4PNHA 5BW4A 1JR2A 3L84A 3EY4A 2DTDA 1UDXA 2ZSUA 1KI6A 3HCDA 5AKXA 3JYPA 3D6NB 5F5NA 4Q4HB 4C6TB 3K6SB 1M5RA 3K2BA 3KU1A 3KSMA 2DUWA 1KFKB 3WKAA 2ZJ5A 4GOMD 4MNTA 8OHMA 2BI8A 1XWFA 1T0JB 2HADA 1MV5A 2Q07A 3T6KA 1W59A 1XKQA 3PUWA 3PNVA 2C82A 2ZEJA 4RANA 4IMJB 4IXTA 3BD6A 5IYZF 1I4OA 1HZJA 3OQHA 4ZVVA 4EPYA 2FDCA 1PVDA 2Q8NA 2HB6A 3Q0EA 4Q7EA 3LFUA 5F76A 3L6RA 1GR0A 2D3WA 1B93A 3NWEA 3TFWA 1L1QA 3GC6A 3NHLA 2E18A 3IA2A 2F7SA 4EHIA 4QJ3A 3MTEA 4MCJA 3O9VA 1U28C 4KZPA 2VNHA 5KTYA 1V11A 5FLEX 1H23A 1P7YA 1AF7A 3VX4A 3H7IA 4C05A 4NPCA 1U2EA 3QTBA 3CW8X 4FSHA 2XE7A 3IBCA 3EUEA 5D6NA 3R24A 1H9AA 2BHNA 3LX8A 3IIIA 4Z9FA 3SDZA 2RK6A 2EZ8A 3UW3A 2HPVA 3M9LA 3CUEF 5ALEA 1M10A 2G08A 1GG5A 5LM3A 1U5BB 3P0RA 4XVRA 2ZWMA 2HA0A 3GEHA 1RQLA 2ZYVX 1Z83A 5B6PA 2E82A 3TUIC 2AS0A 2YW2A 1VIVA 1T13A 2C2BA 2IYEA 5COAA 3NKLA 1II8B 1YZVA 3DMRA 4ND5A 2WT4A 3NXKA 4P3NA 4B34A 1I7QB 1FDTA 2IV2X 5K3FB 4KV9A 1OOEA 4HX2A 4CLOA 1UJ6A 3G2IA 3QU9A 4PS0A 4M8KA 4BUZA 2AXEA 1ETHA 1DAEA 1X7XB 1CIJA 2IHJA 3L7NA 1EEHA 2D0PB 4ZVSA 5E2IA 4CKXA 3BE4A 2IGTA 4E13A 4YMIA 4A6DA 5LOVF 4KNVA 3M33A 3F5QA 2IY8A 3GJ4A 3ZCVA 5EZ5A 5LFAA 4P0QB 1CFJA 3N7TA 4C2TA 2DSTA 5KX5B 3S8YA 1KI6B 3DSRA 4ZCRA 2P30A 3HXLA 3KQLA 4XPZA 3UKOA 3AUKA 1A72A 1JTFA 2ZZNA 1M2GA 4B1FA 4UXIA 1LVGA 3U3DA 2WU4A 4MEAA 2VRNA 1JIQA 3K4PA 4H1WA 1SB8A 2ON6A 1K86A 1SCJA 5F2NA 4DV4B 3H5RA 1RRGA 2AH5A 4F92B 4DZRA 4IL5A 2WVAA 4F96A 3CXRA 6ADHA 1DL5A 1P0MA 3P4YA 1B8OA 1L4LA 1N6IA 1T4GA 1XQ6A 3BREA 1LKZA 2XTJA 1XEXA 3T94A 1XZQA 2FFHA 5AW7A 1I3CA 1ZQ9A 1ADFA 3Q85A 2ZRJA 3BK2A 3VOSA 4CMJA 3JS5A 4LOHA 3UMSA 5I7EA 1Y8QA 3EG5A 2EJWA 1TK9A 4I55F 5LD2C 4GGPA 2BELA 5EXEA 5FQNA 4YRPA 3SIPA 3V2GA 4TWRA 3ZXSA 4B3DA 2TSYB 1IUPA 4XYLA 3FROA 4HWPA 2VH5R 1P7VA 4AURA 5IDXA 2OAP1 4M76B 2RAFA 4L4YA 2YMQA 4URVR 1KE1A 1SD5A 1IIRA 3NIWA 1FOEB 2P2CA 1CE8A 4IRXA 5HK8A 4EB0A 3D6UA 5EAIA 2VA8A 3KKMA 1G7TA 1KK2A 4X7MA 4DE5A 4PX5A 5CYFA 3C8HA 5HKAA 1FA9A 3MQ2A 3N8KA 1D2NA 4I1SA 2XRZA 2HL6A 2WM2A 1RD4A 3IUBA 5BSHA 3UC5A 3B89A 2WWXA 4GIBA 3RI3A 1GUYA 2DUUA 4IYJA 1RC8A 1SQFA 3EVAA 3DHWC 2QUKA 4HJXA 2D2XA 2HQOA 4KQWA 5AW1A 4EKEA 5E8RA 5SYAA 2BM9A 1ECPA 3BFKA 4H4CA 4J43A 3UGJA 3KQKA 4TUYF 1XZBA 1CLEA 2PK3A 3QVTA 5HW0A 1E32A 2HQBA 1W93A 3G68A 2H7CA 3EAFA 3MCTA 1EEXB 1G8GA 1U99A 4MLPA 5K3CA 2NU8B 3SZRA 1E1QD 2GPAA 3A1VA 1P1CA 3NAQA 2FSHA 3NHPA 3RIYA 5LQAA 2R65A 1EUZA 3DE2X 3ENQA 1KR2A 1XK7A 4OJMX 1WEHA 3EWAA 3JRWA 2QYSA 3IDSA 2AG1A 4LTMA 2PR2A 4WL0A 5IASA 2W0SA 5EJMA 1CLUA 1WU7A 4X71A 5CA0A 4YRNA 4AWBA 5ALKA 1EZ4A 1JLRA 2GCOB 4FDVA 3L0ZA 2RAPA 1D8AA 2G63A 5GQSA 1TYDE 3T3EA 4YBZA 5LLTA 4G0MA 1MOSA 1F4VA 2QUIA 4AJ4A 5C46F 1KZ9A 1C0EA 1LV7A 1AC5A 5AI9A 5HCUA 3VR6D 3SR3A 4YECA 3E9QA 3A9SA 5HE9A 1DINA 5DISB 2P3LA 3ABOB 3NOOA 2EX1A 2OZEA 3VOBA 2FR1A 3UOWA 4MKZA 3F6RA 1ZIOA 1NF2A 1XJQA 2PV7A 1VPDA 1PFWA 2OCGA 3EA0A 4OUKX 1FU7A 1JQJC 2VJLA 3UK2A 5A9RA 1WX1A 2W4QA 1WMSA 2ZCUA 1F9AA 2QX4A 3NRBA 3VPAA 1M2EA 2WJ3A 3YASA 1KI1A 2P9YA 4R5MA 3M6FA 4XARA 4ZEMA 2QMUA 2WF5A 1XLUA 3BXXA 4QHTA 3S40A 3GA5A 3QE0A 3K4HA 3BE6A 3OCVA 4WXPA 2JJYA 2ZUBA 1UJBA 4TROA 3FUTA 5ECWA 1ZITA 5A7FA 5BSFA 2DKOA 5EN4A 5BV7A 3UJNA 1IVSA 5JH7A 3KPUA 4LNUA 1KFCB 4OBWA 3ZD8A 3ZE9A 3B60A 1BEUB 1JU3A 4Q3DA 4R1SA 4F0JA 1GAJA 1JKFA 1Z7YA 1A9QA 2VAVA 4Q6BA 5D3ZA 4AJJA 1XJWA 5L95A 5LA6F 4KCGA 1Z62A 3I6YA 1IXYA 4XWYA 2CCJA 1YE3A 3NONA 4EPTA 4V3BA 2XMPA 4MV9A 3BXGA 4AMBA 4O2AF 1XQ9A 4NMWA 4E4RA 4DV0B 1FX0A 3SI7A 1R16A 1YC5A 3E48A 3WY9A 4AZ0B 2CT8A 1VHLA 3MWFA 4GX1A 4J3JA 2ETVA 4P54A 5IKXA 5IK2A 1RLOA 4FYMA 1T9AA 1ZMXA 3VTZA 2FP4B 2IT1A 3UUGA 5KBYA 2VP6A 4Y8VA 1GWNA 4IQFA 2X0EA 5IULC 4AU1A 3Q1KA 1C30A 4WINA 5THKA 1QS0B 4HLCA 2O8EA 5CVDA 4JK3A 1A3CA 5F23A 3LQKA 3L6DA 5IZCA 2A9FA 4EHKA 1J33A 2BR4A 1FMLA 3R20A 1HZZC 4K86A 2IEZA 1TZBA 4M1WA 3PITA 1FXWA 5LWQA 3GLSA 1TC2A 3PR3A 1KY4A 2PKRA 1J8FA 1VJDA 1FX1A 3R0ZA 2UYCA 4K9LA 4KGZA 4MQBA 1BRTA 4HY3A 1P81A 2CMDA 3D4BA 1HF3A 1NVFA 3K0AA 1NV9A 3CVWA 2HV8A 2YXPX 1XELA 1Z3IX 4MH0R 2JATA 1YSCA 3A11A 1J1IA 1QVRA 3EQ7A 4OYHA 4G0XA 4Q4JA 3R8CA 3RVSA 3RVMA 3WJAA 2FEXA 1WTCA 3HR8A 3JQ7A 3AOEA 3Q3HA 621PA 5JHHB 2BH2A 4MRPA 1H2BA 3KCQA 1VPLA 2CV0A 3PXAA 2DYKA 1VE5A 2HWYA 4F45A 3PUZA 3WVNA 3MMPA 3MZ0A 3NWOA 2Y77A 1NVUQ 3EX7C 4MV1A 3L7AA 1ZK2A 2PD4A 1XTIA 2Y76A 3GUVA 3KB2A 3M6MD 4A0RA 3VKHA 4GVPA 3TNFA 1PFQA 4OFZA 1OLXB 3HSSA 3JRXA 3CNEA 1P5JA 2ZYDA 1N3BA 1JA1A 1E89A 3GZ4A 1OKKD 3ZW7A 2D1SA 3GLQA 1M7GA 3AILA 2C2XA 1K92A 1Z3CA 1G18A 1NBAA 3T4UA 3VPXA 4B17A 1RJWA 2AT1A 4C14A 1GZ7A 3MWGA 1P8AA 3P71T 1R0BA 1WZNA 1ZR4A 3KQWA 1FLVA 1P4AA 1TT7A 1YVUA 2V4MA 3D8RA 3ND6A 3PXDA 4JJ6A 1U94A 3LOUA 3L3BA 1B8NA 4LXYA 1GEEA 5ECYA 4LMRA 1MD9A 1KJIA 1Z7EA 2O57A 2QAIA 3VXKA 1KOFA 2IS4A 3L0CA 3FPSA 3Q7QA 2P9BA 1JXMA 1MH1A 4D4MA 3C5CA 4F5ZA 2Q4OA 3Q8WA 2HF9A 3O90A 5KYXB 1EINA 1RFLA 2RHCA 3HBJA 3IQZA 3DZCA 1Q17A 4NOMA 2ZPUA 2OHJA 2PJZA 3WDSA 2H5EA 2GDJA 1R1DA 1BVUA 1XD8A 2H48A 3MBIA 4Y0VA 1R18A 3W5IA 1RYYA 1WHSB 4NBWA 5BYJA 2HHAA 3U17A 1B7GO 1OBCA 3PDWA 1TCAA 1P7PA 3GR6A 1U0HC 2VAMA 3HCEA 4EA6A 4QLOA 1U1CA 1J9GA 3L8EA 1A4XA 4YAEA 5HF8A 2UYOA 4DWJA 2GQ0A 4HEJA 4RKEA 4AX4A 3WLSA 1U04A 4D3DA 3BXHA 4IDXA 3E7PA 3RSOA 5J1SB 1IOWA 2I2BA 2FZWA 2K5UA 4GI7A 4TTJA 3A0UA 4LYJA 2WJYA 3IMEA 2D74A 4LBZA 1M2NA 4BNXA 1LV8A 1KAQA 3LUHA 2GAJA 1SGWA 3EZXA 1HV8A 4UMDA 1HORA 5IH3A 3Q0TA 5IANA 1GD1O 4A82A 2FSPA 4ITVA 3SKXA 2GT1A 2O50A 4R1OA 5AI5A 3NBYC 2BL4A 3OQMA 3A6HA 2UYGA 1FTWA 4OATA 4Z0TA 2FG5A 5ARCA 4UVDA 3OBBA 4B83A 1LSOA 1ODSA 4HZGA 2BKAA 1RIFA 5G0VA 3L6CA 4JR1A 1XMSA 3GGSA 1QWOA 1DC7A 2BFDB 3TTVA 4PYJA 4F4IA 5JZSA 4NWIA 4PV7A 2O2EA 1U3CA 2R6FA 3KS9A 1TUBB 5SY9A 3TTUA 3FYUC 3K70C 3D3WB 3QXSA 4RACA 3BMCB 1ZK0A 4Z9AA 1OZFA 1YZFA 4JJEA 1H8EA 2RARA 4TV9B 5EE9A 4D4IA 1HYHA 3ZNQA 1E3MA 3EC1A 2BI4A 3OWOA 3H97A 3GPLA 2BTEA 2WJAA 1KK3A 4HAIA 1S8NA 4JLAA 3FAZA 3PIRA 3PYLA 4Q9NA 1J8MF 4I1UA 5AOCA 4OOEA 4EUNA 3HWX1 2CXSA 1FP4A 5IBRA 3TNDA 5JCXA 2AJBA 2V3VA 4PZYA 4V1CI 2C58A 4DABA 2VDPB 4BRSA 2EDCA 2C1EA 1CVIA 4G67A 2CNOA 3GBSA 1SXJA 2IELA 3PPIA 3FPFA 1CT9A 3QA9A 2BSQA 4RC9A 2FW1A 4JKIA 4NZNA 4BNIA 2OXCA 2VJAA 2W48A 1X1DA 4DCJA 2XGOA 2O52A 3ESZA 1Q50A 5KC8A 1QG0A 2P62A 4IJQA 3L8GA 3PNBA 2WIDA 1Z2CA 2A8YA 3PD7A 1O94A 3UAZA 4DCOA 3PFBA 4EHDA 3ZEIA 3QVWA 4E31A 2XZTA 4NENB 3K1AB 1MA0A 4EHJA 1Q7BA 1DAPA 1NBME 5EJIA 2LCQA 2ZRLA 1KFEB 4OGKA 1V6SA 2CLKB 1GL7A 4FNOA 5FA8A 1TJ5A 3IURA 1A4UA 1VIAA 2IYVA 4MQFA 4OAOA 5CTJA 3IT1A 4G5FA 1QC5B 4RF4A 1CEQA 4WEOA 1LS6A 3DE4X 1QO7A 3R6LA 4O1IA 1Y6ZA 2PRKA 4C01A 4ND7A 4M37A 5AQ1A 1XTSA 1U7UA 4HDKA 5FR2A 5KDLA 5L4NA 4CV0A 1CDZA 1JSRA 3LOPA 1P61B 1ZD5A 1PUJA 1LBHA 3K0AB 3W3AD 1R4NA 2PUWA 3JZDA 1IZYA 1S2LA 4J0FA 5JD5A 2VHYA 3VU8A 2O1XA 1YUBA 3THOA 3P0EA 1A27A 3K0HA 3B82A 1NDUA 2GWRA 3A6KA 2QN1A 221PA 4MGKR 2ARKA 2UVQA 4RD2A 4CR8A 4EYKA 4JC8A 4ZCLA 5IJ0A 4FYKA 2MINB 2H6EA 5B1HA 1L5GB 2R8PA 4DNXA 4ZYVA 3BGIA 3RHTA 4TWJA 1N3LA 2OCYC 2O8DB 4ZT6A 4TRJA 1A9RA 1YQ9A 1GQRA 2FDXA 3C7TA 2R60A 2HK9A 3H0EA 3HDJA 3W2GA 1H2RS 1AXRA 1KYXA 1LUAA 4DCPA 3B3QA 1ZJ5A 4MKHA 1CCWA 4NBUA 2QGZA 3T7DA 2YV1A 1KKLA 2HKIA 4WBNF 3CEAA 4B9EA 3S28A 1GVNB 4G1UC 3NRCA 5KX5F 4YV7A 1X14A 2GMWA 2YZGA 2AMJA 2PIAA 2XMQA 5T6MA 3ZY2A 3GU3A 4O4JF 2W6ID 4NS1A 4WBXC 4AECA 4QOSA 1HSOA 5LD2B 3JXEA 3SKVA 1DQZA 4XIFA 3S1AA 4HVCA 1U8XX 5JECA 2X1LA 5IVDA 2CNKA 1QH8B 2G1UA 2IPAB 3PEWA 3OF5A 5ALFA 4M0MA 4DAOA 4C3VA 4BS9A 1ZGBA 3LK6A 3KQYA 1A5AB 3B38A 4LZWA 3T3OA 1PJZA 3BZBA 5BWMA 4QUJA 2J85A 3RK1A 1B6SA 2O0JA 4S1PA 4PO9A 1Z18A 3A4TA 3ROFA 1ZHOA 3I3SR 2OFFA 5A3QA 2QPTA 2VWHA 5LBUA 4E4YA 4RTMA 3UG6A 2QLLA 3WFZA 2BT4A 2PFSA 4KQEA 1R0ZA 4OLHA 1YDEA 4B6SA 1F0YA 1L8AA 4CTKA 2AG6A 3HXQA 3Q8KA 4DJAA 5HIJA 1MDFA 3C4JA 2WF8A 4QFMA 1XEFA 3MC1A 4RABA 4UHEA 4XQ9A 1JFFB 3QMPA 1DAFA 4YRFA 4CLDA 3C98A 2H2IA 2UVPA 2YBDA 5F9FA 4ALLA 4HT3B 1FNCA 2IW3A 1M1YA 4D3XA 2VA9A 2XA2A 4Y2YA 1T1GA 4I4CA 4J07A 5LOVB 1A4IA 4YJ3A 1CD5A 4N5NA 5I4CA 1BD3A 2P2DA 2X0RA 4HDSB 3E8SA 4MYRA 4TZTA 3WJ1A 1A2BA 1FDSA 1B6RA 1QCZA 3ELBA 2W2VA 4H7KA 2PNFA 3HSYA 4EG3A 1XJ5A 3HJFA 2XCSB 1ZNQO 2CLSA 4CETA 1KSFX 4S1WA 3WX0A 4FHFA 3F9IA 4ILKA 3R3XA 4TZ0A 1EG7A 2AN5A 3JD4A 3OPYI 3K3PA 4I55A 2AUTA 1PWXA 3SR0A 3LPAA 4XDHA 4GYJA 2GCIA 3WYAA 2HZ7A 3FWPA 3D7MA 3QWIA 3E9CA 1E63A 2E1RA 2BOVA 1C81A 1Z26A 3ZWMA 2WHXA 4RCYA 5GWXA 1N5LA 2GZRA 2V54A 5KTRA 3TFOA 4IVNA 5DNDA 5IC4A 2Q2WA 4H18A 2B69A 3GNQA 1B8PA 3CONA 3KQUA 3FTDA 3B9BA 4HQLA 5DTRA 5K3EA 4Y0AA 1SUFA 1BE1A 2RHMA 1C7FA 1JPUA 1CY8A 1NNUA 4LA4A 4RXTA 4Z4QA 3GMIA 3NDIA 2Q5HA 4RORA 5K8IA 2EC5A 1QH1A 2I2AA 2FX2A 3NHUA 4ZQFA 4N49A 2WD7A 2QR5A 3MT0A 4ASUA 1BSVA 1CUUA 1NG1A 1VHJA 4PCVA 4BP8A 3D3JA 5AJUA 3SBXA 3LKZA 3JY6A 1MPXA 1NIJA 4MCAA 1VM6A 3ZIAA 3AF3A 2BEUB 3Q12A 1AGXA 2BPOA 4X97A 1TM7E 2V5AA 4C4XA 3TBKA 1VP9A 3E6AA 1XMIA 2QU7A 1P5ZB 1Z2DA 3CZAA 1CKEA 2PVPA 3IAFA 3MRVA 1EP9A 4PZEA 3SBOA 3X1KA 3G89A 5C8VA 1RRKA 1JR3D 2FEWB 1C4KA 1AZTA 2YFKA 4IGEA 3GJ6A 3NC4A 4HXFB 1C50A 4ND1A 1QM5A 2Q9AA 4KK4A 2R2AA 3RK4A 2XQFA 5IBPA 3IQXA 3ROEA 3NNSA 4LJ9A 5IABA 1LLCA 3WL5A 1M8GA 1DDOA 1P1KA 1NXTA 3DAYA 2IDJA 2JIZD 3AEQA 3GYGA 3V33A 2O4UX 3CFYA 1ISMA 3IJPA 3S1LA 4GQAA 3T3GA 1D04A 2ID8A 3JQAB 5AW5A 1SXPA 2XB4A 5BVGA 3AUTA 3KL4A 5CTAA 1JEAA 1EFRA 2OV6A 2DGDA 1V5GA 1Y4DE 4NBVA 2X5OA 2PD6A 5ADWA 2FXVA 4G5RA 1R50A 2YJTD 1X1QA 1CJBA 1FDIA 3OJEA 5ALDA 5JWHA 5JADA 2JKZA 1T5BA 1UK9A 5FI5A 4YMLA 2I9KA 2O8FB 1FNDA 3MJFA 2HSDA 4ZOLA 2OCAA 3HBNA 3H0CA 1G55A 3AVWA 1UJNA 1W9HA 2ZR7A 3WLNA 5ISMA 4RNDB 1O97C 1VG9B 3HP7A 3KWFA 2FSSA 4DGQA 2Y6UA 5BXYA 3CG0A 4OFWA 3GFRA 2ZM6B 3ZHZA 1BCRB 2BGUA 4WEQA 3L46A 4QOFA 4TKUB 5TS2A 2O2JA 1H2EA 2QZ9A 3GDGA 5KTPA 4KSCA 2VJCA 3AVOA 2QJRA 3AG6A 1I7LA 1P33A 1P0CA 1Y5MA 2B6NA 2C3OA 4RZXA 4C29A 4DA7A 5BVHA 1FTGA 2Q8QA 3HCWA 3GT0A 3GN2A 3H9BA 1O0SA 4PFQA 1PSDA 2ZTHA 5J5CA 1U2TA 4DQKA 2AEFA 2Q9CA 1YIDA 2V4UA 4M53A 3TD2A 3A26A 3WWEA 1CZUA 3FYUA 3EXIA 1UT8A 3VRHA 4BKQA 3W1WA 3U7QB 3HLTA 1E3DA 4DQLA 1KORA 4OHMA 3AHEA 5GTDA 4A2WA 4UUNA 3IAAA 2C99A 1YQUA 3UAVA 3DLBA 4JI0B 4CGZA 2IU6A 5KJ1A 1O6BA 5BSMA 2ZPAA 4XR4A 1H2FA 3QG5A 1YFKA 1KKUA 3OZDA 2ID4A 5B53A 2Q49A 3O5AA 2AX3A 1SELA 4GXTA 4FT4A 1PJCA 3LHIA 3NBKA 5FADA 4DDHA 1VMAA 2WWVD 1V8DA 2J30A 4UKDA 3E2MA 2B7LA 2P69A 2O5EA 3JVIA 3X43A 1JR6A 2QYOA 3HBLA 5JNTA 4C7BA 1JLMA 2ZP1A 1QDUA 4XIJA 3COYA 4WA7A 4E2YA 5EP4A 2GZSA 4LVCA 2GF2A 2WF7A 2HT1A 3V97A 1LK5A 4IIJA 3ZIAD 3G2OA 4OMDA 4DV2B 1O6FA 2ZSKA 1J7KA 1ZESA 2WHPB 1DTWB 4O4HF 4KXVA 1UBCA 4WI1A 3NKFA 2OV4A 4ZOLB 3REGA 4FKBA 4PAOA 2E5LB 3EVDA 3WC4A 3PENA 2CJXA 5I4BA 4X91A 1UANA 5BV2P 2FZLA 5ES4B 2NT3A 1NUPA 2BDEA 1XCMA 1UBFA 3O8OB 1NTRA 2OOKA 4LF9B 3CUUA 1YA6A 1SUBA 3EVBA 3ONWA 4BO4A 1U1FA 3LUAA 4X1YB 1VL0A 1WXFA 1AHIA 1GGJA 1ECLA 1FUYB 3DKPA 1T1EA 1ZN7A 1J22A 3M9XA 3O9MA 3RBZA 5CLLA 1K7EB 2H4JA 2H85A 4NBSA 5HF9A 3LHKA 2O7RA 4RHCA 2ZXUA 4CFYA 4R16A 4HGNA 4QNRA 1UOPA 1MEOA 1T2CA 1S8OA 4COOA 1YBAA 3QVKA 2XRMA 4DBLC 2RGRA 3FY4A 3HEAA 2CXQA 3PUVA 3DM5A 3W8EA 2AOUB 2WAOA 2TRSB 4Q3NA 4PHHA 1MABB 5LP6A 4F71A 2G0AA 3ANYB 1UKYA 5FTJA 4B3BA 2JJMA 3V5NA 1SVLA 5DU2A 3D5EA 1EDBA 2JGJA 4EI2A 3E3OA 3TMKA 1Q15A 1SZDA 1QB8A 4C4YA 4REOA 3NASA 4HNVA 5K8JB 1IN6A 3HHEA 1XTTA 2Z9DA 4P58A 2H17A 5DGIA 2WVGA 1FJ2A 1NRWA 3QGMA 1C7JA 2VZ8A 4HB3A 4AG5A 3EPHA 1WQ4A 1H1LA 2FMHA 4P3XA 5L3ZA 5B6JA 3A28A 2XDQB 2QRVA 3H87A 3TWOA 4ZYUA 4HRAA 1THTA 2ESRA 4YY3B 2QTCA 1YZ3A 2V7UA 3DAOA 4UEOA 5LIPA 4MS3B 3IEVA 2V7VA 3MFQA 1DXOA 2PKEA 3ZD7A 1VLVA 3ZD9A 2GZMA 2P9JA 2W8ZA 4BZXA 4D02A 1J9EA 2I4RA 3PWZA 1USIA 3MINB 4PBRA 2ECQA 2A4KA 2QUZA 4UNPA 1PEYA 1QQ7A 4KXQA 3JARB 1HDYA 1PRYA 3Q11A 2B1RA 1TAUA 4Z1MD 2DTXA 3PQ4A 3W6UA 2ZUFA 3RK0A 3ZHXA 3A1SA 3L0BA 3N05A 3N76A 3T1NA 1HZZA 2H0AA 3R0VA 1H0RA 2RGGA 3TZQA 1RABA 4ALMA 4IHJF 3S99A 5YASA 4LNUB 1M2WA 1RVV1 1OGIA 1PT5A 1JLLB 5JYCA 4J49A 2AR0A 1EGMB 1HT0A 1MX3A 2C88A 2XXBA 4N1AA 4RE6A 4RVGA 3RQSA 4CU2A 1RM4A 5JH7F 2CYBA 5KOHB 4K6FA 4EVQA 2G9VA 2VHVA 2CJPA 2P91A 2ASVA 3C3XA 3C0KA 3D4PA 4QD3A 2OPHA 4ZMBA 2CB9A 3QZUA 5FL7A 3GYBA 4FOOA 4DARA 1VL1A 3GFVA 2IWRA 3VC3A 1NJFA 3G8BA 3GJ3A 1SVNA 2CVZA 3VYTB 1I7DA 3DHYA 1Q6ZA 1FDVA 4GFDA 1JDZA 1DQYA 3D81A 3MVEA 4Q3KA 1DRUA 5FUVA 4HVAA 4ZAZA 1I2ZA 4HH0A 3PWSA 1NLYA 3DJYA 1F20A 4DF3A 4UUOA 2G80A 2C4HA 3K1YA 2EFYA 4CG1A 2N75A 2QVLA 4JCCA 3T3HA 4BB6A 2H92A 1HMPA 4QDZA 3O73A 3VR5A 5ELXA 1K2WA 4PZUA 3OT5A 1KYQA 1HC7A 1PL6A 2J0SA 3RVJA 1AA6A 4D9CA 1C3XA 2P3QA 2C61A 1N6KA 1UC8A 1Q12A 2QRJA 1FSPA 5BW8A 4G01B 2ONZA 1G21B 3PJEA 5I7SA 1ZOOA 3FMGA 3L79A 1J2UA 1T5DX 2Q0XA 2PT9A 2GBLC 2ZJBA 3AQ4A 3EXHB 4KU4A 4MMYB 2A57A 4NQZA 1ZRNA 2L69A 4NNPA 4UMFA 1GO2A 2R66A 2VF2A 2YN4A 5KTKA 3I2FA 1WJGA 1YZNA 3G2MA 1NE2A 3EGOA 3MJCA 1KO7A 4GP7A 1GAQA 5KYYB 1O5TA 3Q87B 1ONPA 5L9AA 4C7OA 2FHSA 1R4MB 4U63A 4FGKA 2I87A 4WHMA 1UZNA 1ULTA 2VDKB 1RWXA 4FXOA 1QYIA 4A2PA 3DPIA 5ADHA 1BC5A 3I32A 2Q5EA 1WETA 4EECA 5IYZB 3L06A 2QLNA 3B5JA 5DYTA 3WZLA 1H93A 4C0BA 4LIPD 3TSCA 3IC5A 5JAIA 1KMHA 2A5FA 4ZK6A 5BNWA 2X6QA 2B5WA 3EQ9A 1WXEA 2FW0A 4B76A 4PGAA 2JRCA 2JLBA