1BTEA

Crystal structure of the extracellular domain of the type ii activin receptor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
92
Chain Sequence
ETQECLFFNANWERDRTNQTGVEPCYGRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ACTIVIN RECEPTOR TYPE II)
publication title Three-finger toxin fold for the extracellular ligand-binding domain of the type II activin receptor serine kinase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 21
structure length 92
sequence length 96
chains with identical sequence B
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 1998-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1bteA00
2MJYA 2QJ9C 1IK8A 1ERGA 1H0JA 1KL8A 4ZQYA 1FSCA 4IYEA 2VLWA 1BTEA 4XJJA 2BHIA 1CDRA 1JE9A 1KTZB 1S4YA 1LXGA 1IQ9A 1TXBA 1ZADA 2GOOC 2HLRA 3KFDI 1IDLA 1XT3A 2MUPA 2QJAC 4P7UA 5IMYC 2CTXA 1NYSA 4OM4A 1L4WA 1KXIA 3EVSC 1CVOA 1YWHA 1UG4A 3LAQU 1CTXA 2K3GA 2JQPA 1RGJA 1NORA 1KBTA 1DRSA 5DZ5A 1HAJA 2QJBC 3PLCA 2H64C 2JVEA 2MUOA 1CRFA 1COEA 1LXHA 3HH7A 2BTXA 1F8UB 1KBSA 4AEAA 5EBXA 1CREA 2ABXA 2MJ0A 4RUDA 3VTSA 1HC9A 5DU1A 1HAAA 3U74U 1FSSB 1NTNA 4OM5A 2NBTA 1JBDA 1CDQA 1CODA 1QM7A 2QC1A 1KC4A 1IKCA 1NYUA 1LJZA 2H7ZB 4QTIU 2J8BA 2ERAA 3NEQA 1ERAA 4BDTB 1KFHA 1FRAA 2HLQA 1JGKA 1FASA 5DO6A 1KS6A 1NXBA 1BXPA 3FEVA 1I02A 1HOYA 5IMTD 1CXOA 1M9ZA 3NDSA 1IJCA 1RL5A 2GOOB 1G6MA 1IDGA 1ABTA 2I9BE 1QKDA 2H5FA 6EBXA 2H7ZA 1LSIA 2L5SA 1IDIA 1REWC 4BIKB 4DO8A 1W6BA 1KU6B 2MFAA 4FAOC 2LCRA 1CXNA 2PJYB 3ERAA 2H62D 1MR6A 3EBXA 4HQPF 2H64B 4EY8B 2L03A 1VB0A 1IDHA 1B41B 1TFSA 2UWRA 3NH7A 1NEAA 1TXAA 1ES7B 1PLOA 1CDSA 1LX5B 2CDXA 1MAHF 2X8BB 1CB9A 2LA1A 2MJ4A 1CCQA 1ONJA 2H62C 3BT2U 3BT1U 3U73U 2CRTA 1KBAA 2FD6U 3QB4B 4FAOE 1HC9B 3KFDE 1CHVS 2CRSA 2CCXA 1FF4A 2MHYA 1CDTA 1V6PA 2H8UA 4UY2C 1NTXA 1TGXA 1QKEA 2OFSA 2PJYC 4LFTA 1FFJA 2UX2A 1F94A 2N99A
chains in the Genus database with same CATH superfamily
2MJYA 2QJ9C 1IK8A 1ERGA 1H0JA 1KL8A 4ZQYA 1FSCA 4IYEA 2VLWA 1BTEA 4XJJA 2BHIA 1CDRA 1JE9A 1KTZB 1S4YA 1LXGA 1IQ9A 1TXBA 1ZADA 2GOOC 2HLRA 3KFDI 1IDLA 1XT3A 2MUPA 2QJAC 4P7UA 5IMYC 2CTXA 1NYSA 4OM4A 1L4WA 1KXIA 3EVSC 1CVOA 1YWHA 1UG4A 3LAQU 1CTXA 2K3GA 2JQPA 1RGJA 1NORA 1KBTA 1DRSA 5DZ5A 1HAJA 2QJBC 3PLCA 2H64C 2JVEA 2MUOA 1CRFA 1COEA 1LXHA 3HH7A 2BTXA 1F8UB 1KBSA 4AEAA 5EBXA 1CREA 2ABXA 2MJ0A 4RUDA 3VTSA 1HC9A 5DU1A 1HAAA 3U74U 1FSSB 1NTNA 4OM5A 2NBTA 1JBDA 1CDQA 1CODA 1QM7A 2QC1A 1KC4A 1IKCA 1NYUA 1LJZA 2H7ZB 4QTIU 2J8BA 2ERAA 3NEQA 1ERAA 4BDTB 1KFHA 1FRAA 2HLQA 1JGKA 1FASA 5DO6A 1KS6A 1NXBA 1BXPA 3FEVA 1I02A 1HOYA 5IMTD 1CXOA 1M9ZA 3NDSA 1IJCA 1RL5A 2GOOB 1G6MA 1IDGA 4KSNA 1ABTA 2I9BE 1QKDA 2H5FA 6EBXA 2H7ZA 1LSIA 2L5SA 1IDIA 1REWC 4BIKB 4DO8A 1W6BA 1KU6B 2MFAA 4FAOC 2LCRA 1CXNA 2PJYB 3ERAA 2H62D 1MR6A 3EBXA 4HQPF 2H64B 4EY8B 2L03A 1VB0A 1IDHA 1B41B 1TFSA 2UWRA 3NH7A 1NEAA 1TXAA 1ES7B 1PLOA 1CDSA 1LX5B 2CDXA 1MAHF 2X8BB 1CB9A 2LA1A 2MJ4A 1CCQA 1ONJA 2H62C 3BT2U 3BT1U 3U73U 2CRTA 1KBAA 2FD6U 3QB4B 4FAOE 1HC9B 3KFDE 1CHVS 2CRSA 2CCXA 1FF4A 2MHYA 1CDTA 1V6PA 2H8UA 4UY2C 1NTXA 1TGXA 1QKEA 2OFSA 2PJYC 4LFTA 1FFJA 2UX2A 1F94A 2N99A
chains in the Genus database with same CATH topology
2MJYA 2QJ9C 1IK8A 1ERGA 1H0JA 1KL8A 4ZQYA 1FSCA 4IYEA 2VLWA 1BTEA 4XJJA 2BHIA 1CDRA 1JE9A 1KTZB 1S4YA 1LXGA 1IQ9A 1TXBA 1ZADA 2GOOC 2HLRA 3KFDI 1IDLA 1XT3A 2MUPA 2QJAC 4P7UA 5IMYC 2CTXA 1NYSA 4OM4A 1L4WA 1KXIA 3EVSC 1CVOA 1YWHA 1UG4A 3LAQU 1CTXA 2K3GA 2JQPA 1RGJA 1NORA 1KBTA 1DRSA 5DZ5A 1HAJA 2QJBC 3PLCA 2H64C 2JVEA 2MUOA 1CRFA 1COEA 1LXHA 3HH7A 2BTXA 1F8UB 1KBSA 4AEAA 5EBXA 1CREA 2ABXA 2MJ0A 4RUDA 3VTSA 1HC9A 5DU1A 1HAAA 3U74U 1FSSB 1NTNA 4OM5A 2NBTA 1JBDA 1CDQA 1CODA 1QM7A 2QC1A 1KC4A 1IKCA 1NYUA 1LJZA 2H7ZB 4QTIU 2J8BA 2ERAA 3NEQA 1ERAA 4BDTB 1KFHA 1FRAA 2HLQA 1JGKA 1FASA 5DO6A 1KS6A 1NXBA 1BXPA 3FEVA 1I02A 1HOYA 5IMTD 1CXOA 1M9ZA 3NDSA 1IJCA 1RL5A 2GOOB 1G6MA 1IDGA 4KSNA 1ABTA 2I9BE 1QKDA 2H5FA 6EBXA 2H7ZA 1LSIA 2L5SA 1IDIA 1REWC 4BIKB 4DO8A 1W6BA 1KU6B 2MFAA 4FAOC 2LCRA 1CXNA 2PJYB 3ERAA 2H62D 1MR6A 3EBXA 4HQPF 2H64B 4EY8B 2L03A 1VB0A 1IDHA 1B41B 1TFSA 2UWRA 3NH7A 1NEAA 1TXAA 1ES7B 1PLOA 1CDSA 1LX5B 2CDXA 1MAHF 2X8BB 1CB9A 2LA1A 2MJ4A 1CCQA 1ONJA 2H62C 3BT2U 3BT1U 3U73U 2CRTA 1KBAA 2FD6U 3QB4B 4FAOE 1HC9B 3KFDE 1CHVS 2CRSA 2CCXA 1FF4A 2MHYA 1CDTA 1V6PA 2H8UA 4UY2C 1NTXA 1TGXA 1QKEA 2OFSA 2PJYC 4LFTA 1FFJA 2UX2A 1F94A 2N99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJY A;  2QJ9 C;  1IK8 A;  1ERG A;  1H0J A;  1KL8 A;  4ZQY A;  1FSC A;  4IYE A;  2VLW A;  1BTE A;  4XJJ A;  2BHI A;  1CDR A;  1JE9 A;  1KTZ B;  1S4Y A;  1LXG A;  1IQ9 A;  1TXB A;  1ZAD A;  2GOO C;  2HLR A;  3KFD I;  1IDL A;  1XT3 A;  2MUP A;  2QJA C;  4P7U A;  5IMY C;  2CTX A;  1NYS A;  4OM4 A;  1L4W A;  1KXI A;  3EVS C;  1CVO A;  1YWH A;  1UG4 A;  3LAQ U;  1CTX A;  2K3G A;  2JQP A;  1RGJ A;  1NOR A;  1KBT A;  1DRS A;  5DZ5 A;  1HAJ A;  2QJB C;  3PLC A;  2H64 C;  2JVE A;  2MUO A;  1CRF A;  1COE A;  1LXH A;  3HH7 A;  2BTX A;  1F8U B;  1KBS A;  4AEA A;  5EBX A;  1CRE A;  2ABX A;  2MJ0 A;  4RUD A;  3VTS A;  1HC9 A;  5DU1 A;  1HAA A;  3U74 U;  1FSS B;  1NTN A;  4OM5 A;  2NBT A;  1JBD A;  1CDQ A;  1COD A;  1QM7 A;  2QC1 A;  1KC4 A;  1IKC A;  1NYU A;  1LJZ A;  2H7Z B;  4QTI U;  2J8B A;  2ERA A;  3NEQ A;  1ERA A;  4BDT B;  1KFH A;  1FRA A;  2HLQ A;  1JGK A;  1FAS A;  5DO6 A;  1KS6 A;  1NXB A;  1BXP A;  3FEV A;  1I02 A;  1HOY A;  5IMT D;  1CXO A;  1M9Z A;  3NDS A;  1IJC A;  1RL5 A;  2GOO B;  1G6M A;  1IDG A;  1ABT A;  2I9B E;  1QKD A;  2H5F A;  6EBX A;  2H7Z A;  1LSI A;  2L5S A;  1IDI A;  1REW C;  4BIK B;  4DO8 A;  1W6B A;  1KU6 B;  2MFA A;  4FAO C;  2LCR A;  1CXN A;  2PJY B;  3ERA A;  2H62 D;  1MR6 A;  3EBX A;  4HQP F;  2H64 B;  4EY8 B;  2L03 A;  1VB0 A;  1IDH A;  1B41 B;  1TFS A;  2UWR A;  3NH7 A;  1NEA A;  1TXA A;  1ES7 B;  1PLO A;  1CDS A;  1LX5 B;  2CDX A;  1MAH F;  2X8B B;  1CB9 A;  2LA1 A;  2MJ4 A;  1CCQ A;  1ONJ A;  2H62 C;  3BT2 U;  3BT1 U;  3U73 U;  2CRT A;  1KBA A;  2FD6 U;  3QB4 B;  4FAO E;  1HC9 B;  3KFD E;  1CHV S;  2CRS A;  2CCX A;  1FF4 A;  2MHY A;  1CDT A;  1V6P A;  2H8U A;  4UY2 C;  1NTX A;  1TGX A;  1QKE A;  2OFS A;  2PJY C;  4LFT A;  1FFJ A;  2UX2 A;  1F94 A;  2N99 A; 
#chains in the Genus database with same CATH topology
 2MJY A;  2QJ9 C;  1IK8 A;  1ERG A;  1H0J A;  1KL8 A;  4ZQY A;  1FSC A;  4IYE A;  2VLW A;  1BTE A;  4XJJ A;  2BHI A;  1CDR A;  1JE9 A;  1KTZ B;  1S4Y A;  1LXG A;  1IQ9 A;  1TXB A;  1ZAD A;  2GOO C;  2HLR A;  3KFD I;  1IDL A;  1XT3 A;  2MUP A;  2QJA C;  4P7U A;  5IMY C;  2CTX A;  1NYS A;  4OM4 A;  1L4W A;  1KXI A;  3EVS C;  1CVO A;  1YWH A;  1UG4 A;  3LAQ U;  1CTX A;  2K3G A;  2JQP A;  1RGJ A;  1NOR A;  1KBT A;  1DRS A;  5DZ5 A;  1HAJ A;  2QJB C;  3PLC A;  2H64 C;  2JVE A;  2MUO A;  1CRF A;  1COE A;  1LXH A;  3HH7 A;  2BTX A;  1F8U B;  1KBS A;  4AEA A;  5EBX A;  1CRE A;  2ABX A;  2MJ0 A;  4RUD A;  3VTS A;  1HC9 A;  5DU1 A;  1HAA A;  3U74 U;  1FSS B;  1NTN A;  4OM5 A;  2NBT A;  1JBD A;  1CDQ A;  1COD A;  1QM7 A;  2QC1 A;  1KC4 A;  1IKC A;  1NYU A;  1LJZ A;  2H7Z B;  4QTI U;  2J8B A;  2ERA A;  3NEQ A;  1ERA A;  4BDT B;  1KFH A;  1FRA A;  2HLQ A;  1JGK A;  1FAS A;  5DO6 A;  1KS6 A;  1NXB A;  1BXP A;  3FEV A;  1I02 A;  1HOY A;  5IMT D;  1CXO A;  1M9Z A;  3NDS A;  1IJC A;  1RL5 A;  2GOO B;  1G6M A;  1IDG A;  4KSN A;  1ABT A;  2I9B E;  1QKD A;  2H5F A;  6EBX A;  2H7Z A;  1LSI A;  2L5S A;  1IDI A;  1REW C;  4BIK B;  4DO8 A;  1W6B A;  1KU6 B;  2MFA A;  4FAO C;  2LCR A;  1CXN A;  2PJY B;  3ERA A;  2H62 D;  1MR6 A;  3EBX A;  4HQP F;  2H64 B;  4EY8 B;  2L03 A;  1VB0 A;  1IDH A;  1B41 B;  1TFS A;  2UWR A;  3NH7 A;  1NEA A;  1TXA A;  1ES7 B;  1PLO A;  1CDS A;  1LX5 B;  2CDX A;  1MAH F;  2X8B B;  1CB9 A;  2LA1 A;  2MJ4 A;  1CCQ A;  1ONJ A;  2H62 C;  3BT2 U;  3BT1 U;  3U73 U;  2CRT A;  1KBA A;  2FD6 U;  3QB4 B;  4FAO E;  1HC9 B;  3KFD E;  1CHV S;  2CRS A;  2CCX A;  1FF4 A;  2MHY A;  1CDT A;  1V6P A;  2H8U A;  4UY2 C;  1NTX A;  1TGX A;  1QKE A;  2OFS A;  2PJY C;  4LFT A;  1FFJ A;  2UX2 A;  1F94 A;  2N99 A; 
#chains in the Genus database with same CATH homology
 2MJY A;  2QJ9 C;  1IK8 A;  1ERG A;  1H0J A;  1KL8 A;  4ZQY A;  1FSC A;  4IYE A;  2VLW A;  1BTE A;  4XJJ A;  2BHI A;  1CDR A;  1JE9 A;  1KTZ B;  1S4Y A;  1LXG A;  1IQ9 A;  1TXB A;  1ZAD A;  2GOO C;  2HLR A;  3KFD I;  1IDL A;  1XT3 A;  2MUP A;  2QJA C;  4P7U A;  5IMY C;  2CTX A;  1NYS A;  4OM4 A;  1L4W A;  1KXI A;  3EVS C;  1CVO A;  1YWH A;  1UG4 A;  3LAQ U;  1CTX A;  2K3G A;  2JQP A;  1RGJ A;  1NOR A;  1KBT A;  1DRS A;  5DZ5 A;  1HAJ A;  2QJB C;  3PLC A;  2H64 C;  2JVE A;  2MUO A;  1CRF A;  1COE A;  1LXH A;  3HH7 A;  2BTX A;  1F8U B;  1KBS A;  4AEA A;  5EBX A;  1CRE A;  2ABX A;  2MJ0 A;  4RUD A;  3VTS A;  1HC9 A;  5DU1 A;  1HAA A;  3U74 U;  1FSS B;  1NTN A;  4OM5 A;  2NBT A;  1JBD A;  1CDQ A;  1COD A;  1QM7 A;  2QC1 A;  1KC4 A;  1IKC A;  1NYU A;  1LJZ A;  2H7Z B;  4QTI U;  2J8B A;  2ERA A;  3NEQ A;  1ERA A;  4BDT B;  1KFH A;  1FRA A;  2HLQ A;  1JGK A;  1FAS A;  5DO6 A;  1KS6 A;  1NXB A;  1BXP A;  3FEV A;  1I02 A;  1HOY A;  5IMT D;  1CXO A;  1M9Z A;  3NDS A;  1IJC A;  1RL5 A;  2GOO B;  1G6M A;  1IDG A;  4KSN A;  1ABT A;  2I9B E;  1QKD A;  2H5F A;  6EBX A;  2H7Z A;  1LSI A;  2L5S A;  1IDI A;  1REW C;  4BIK B;  4DO8 A;  1W6B A;  1KU6 B;  2MFA A;  4FAO C;  2LCR A;  1CXN A;  2PJY B;  3ERA A;  2H62 D;  1MR6 A;  3EBX A;  4HQP F;  2H64 B;  4EY8 B;  2L03 A;  1VB0 A;  1IDH A;  1B41 B;  1TFS A;  2UWR A;  3NH7 A;  1NEA A;  1TXA A;  1ES7 B;  1PLO A;  1CDS A;  1LX5 B;  2CDX A;  1MAH F;  2X8B B;  1CB9 A;  2LA1 A;  2MJ4 A;  1CCQ A;  1ONJ A;  2H62 C;  3BT2 U;  3BT1 U;  3U73 U;  2CRT A;  1KBA A;  2FD6 U;  3QB4 B;  4FAO E;  1HC9 B;  3KFD E;  1CHV S;  2CRS A;  2CCX A;  1FF4 A;  2MHY A;  1CDT A;  1V6P A;  2H8U A;  4UY2 C;  1NTX A;  1TGX A;  1QKE A;  2OFS A;  2PJY C;  4LFT A;  1FFJ A;  2UX2 A;  1F94 A;  2N99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...