1BTEA

Crystal structure of the extracellular domain of the type ii activin receptor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
92
Chain Sequence
ETQECLFFNANWERDRTNQTGVEPCYGRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-finger toxin fold for the extracellular ligand-binding domain of the type II activin receptor serine kinase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords PROTEIN (ACTIVIN RECEPTOR TYPE II)
total genus 21
structure length 92
sequence length 96
chains with identical sequence B
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 1998-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1bteA00
2LA1A 3EVSC 1CHVS 2UX2A 4OM4A 1YWHA 2ABXA 2H64B 1LX5B 1M9ZA 2H62C 1NORA 2MFAA 1V6PA 1MR6A 1ABTA 1HOYA 2FD6U 5IMTD 3NH7A 1I02A 5IMYC 1HAAA 1KTZB 1CCQA 1UG4A 1KFHA 2UWRA 1FSSB 1KL8A 3BT2U 1IQ9A 1FASA 5EBXA 1IJCA 1IDHA 3NEQA 4XJJA 1IK8A 2MJYA 2N99A 1TGXA 1FFJA 2MJ0A 2HLQA 2MHYA 2K3GA 1CODA 2PJYC 1LXGA 2PJYB 2GOOB 1CDQA 1COEA 1JGKA 2CRSA 2GOOC 1KC4A 2MUOA 2VLWA 1TFSA 2QJ9C 1CB9A 1DRSA 2L5SA 1ERGA 1REWC 1RL5A 1IDGA 3U74U 1L4WA 2LCRA 1NYUA 3VTSA 1ZADA 2HLRA 4IYEA 1F8UB 2ERAA 1KU6B 1TXAA 1KBSA 1CDSA 1JE9A 2H5FA 2CTXA 2J8BA 1F94A 2QJAC 2MJ4A 1XT3A 1CDTA 1H0JA 2I9BE 2BTXA 4DO8A 2H64C 1NTXA 4EY8B 1KS6A 1BXPA 2OFSA 1CRFA 4AEAA 2CCXA 2L03A 3FEVA 4ZQYA 1CXNA 3LAQU 5DO6A 1FRAA 1BTEA 1QKEA 2CDXA 2H62D 3BT1U 3U73U 4BIKB 1CXOA 1LJZA 1LSIA 1NEAA 1VB0A 1RGJA 2H7ZB 1ERAA 4UY2C 4QTIU 4RUDA 1CVOA 1QKDA 2X8BB 2CRTA 4P7UA 1S4YA 2H7ZA 1LXHA 1HAJA 1QM7A 4FAOE 1MAHF 2MUPA 2NBTA 1ES7B 3QB4B 2JQPA 3PLCA 1CTXA 1IDLA 1ONJA 1W6BA 4OM5A 5DZ5A 1FSCA 1JBDA 6EBXA 1TXBA 1PLOA 2BHIA 1G6MA 1IDIA 1B41B 1HC9B 1CREA 1NYSA 1NXBA 3KFDI 1IKCA 4BDTB 3HH7A 2QC1A 1KBTA 3NDSA 5DU1A 3KFDE 4FAOC 1KXIA 1FF4A 1NTNA 2H8UA 1KBAA 4HQPF 1CDRA 3ERAA 2QJBC 1HC9A 2JVEA 3EBXA 4LFTA
chains in the Genus database with same CATH superfamily
2LA1A 3EVSC 1CHVS 2UX2A 4OM4A 1YWHA 2ABXA 2H64B 1LX5B 1M9ZA 2H62C 1NORA 2MFAA 1V6PA 1MR6A 1ABTA 1HOYA 2FD6U 5IMTD 3NH7A 1I02A 5IMYC 1HAAA 1KTZB 1CCQA 1UG4A 1KFHA 2UWRA 1FSSB 1KL8A 3BT2U 1IQ9A 1FASA 5EBXA 1IJCA 1IDHA 3NEQA 4XJJA 1IK8A 2MJYA 2N99A 1TGXA 1FFJA 2MJ0A 2HLQA 2MHYA 2K3GA 1CODA 2PJYC 1LXGA 2PJYB 2GOOB 1CDQA 1COEA 1JGKA 2CRSA 2GOOC 1KC4A 2MUOA 2VLWA 1TFSA 2QJ9C 1CB9A 1DRSA 2L5SA 1ERGA 1REWC 1RL5A 1IDGA 3U74U 1L4WA 2LCRA 1NYUA 3VTSA 1ZADA 2HLRA 4IYEA 1F8UB 2ERAA 1KU6B 1TXAA 1KBSA 1CDSA 1JE9A 2H5FA 2CTXA 2J8BA 1F94A 2QJAC 2MJ4A 1XT3A 1CDTA 1H0JA 2I9BE 2BTXA 4DO8A 2H64C 1NTXA 4EY8B 1KS6A 1BXPA 2OFSA 1CRFA 4AEAA 2CCXA 2L03A 3FEVA 4ZQYA 1CXNA 3LAQU 5DO6A 1FRAA 1BTEA 1QKEA 2CDXA 2H62D 3BT1U 4KSNA 3U73U 4BIKB 1CXOA 1LJZA 1LSIA 1NEAA 1VB0A 1RGJA 2H7ZB 1ERAA 4UY2C 4QTIU 4RUDA 1CVOA 1QKDA 2X8BB 2CRTA 4P7UA 1S4YA 2H7ZA 1LXHA 1HAJA 1QM7A 4FAOE 1MAHF 2MUPA 2NBTA 1ES7B 3QB4B 2JQPA 3PLCA 1CTXA 1IDLA 1ONJA 1W6BA 4OM5A 5DZ5A 1FSCA 1JBDA 6EBXA 1TXBA 1PLOA 2BHIA 1G6MA 1IDIA 1B41B 1HC9B 1CREA 1NYSA 1NXBA 3KFDI 1IKCA 4BDTB 3HH7A 2QC1A 1KBTA 3NDSA 5DU1A 3KFDE 4FAOC 1KXIA 1FF4A 1NTNA 2H8UA 1KBAA 4HQPF 1CDRA 3ERAA 2QJBC 1HC9A 2JVEA 3EBXA 4LFTA
chains in the Genus database with same CATH topology
2LA1A 3EVSC 1CHVS 2UX2A 4OM4A 1YWHA 2ABXA 2H64B 1LX5B 1M9ZA 2H62C 1NORA 2MFAA 1V6PA 1MR6A 1ABTA 1HOYA 2FD6U 5IMTD 3NH7A 1I02A 5IMYC 1HAAA 1KTZB 1CCQA 1UG4A 1KFHA 2UWRA 1FSSB 1KL8A 3BT2U 1IQ9A 1FASA 5EBXA 1IJCA 1IDHA 3NEQA 4XJJA 1IK8A 2MJYA 2N99A 1TGXA 1FFJA 2MJ0A 2HLQA 2MHYA 2K3GA 1CODA 2PJYC 1LXGA 2PJYB 2GOOB 1CDQA 1COEA 1JGKA 2CRSA 2GOOC 1KC4A 2MUOA 2VLWA 1TFSA 2QJ9C 1CB9A 1DRSA 2L5SA 1ERGA 1REWC 1RL5A 1IDGA 3U74U 1L4WA 2LCRA 1NYUA 3VTSA 1ZADA 2HLRA 4IYEA 1F8UB 2ERAA 1KU6B 1TXAA 1KBSA 1CDSA 1JE9A 2H5FA 2CTXA 2J8BA 1F94A 2QJAC 2MJ4A 1XT3A 1CDTA 1H0JA 2I9BE 2BTXA 4DO8A 2H64C 1NTXA 4EY8B 1KS6A 1BXPA 2OFSA 1CRFA 4AEAA 2CCXA 2L03A 3FEVA 4ZQYA 1CXNA 3LAQU 5DO6A 1FRAA 1BTEA 1QKEA 2CDXA 2H62D 3BT1U 4KSNA 3U73U 4BIKB 1CXOA 1LJZA 1LSIA 1NEAA 1VB0A 1RGJA 2H7ZB 1ERAA 4UY2C 4QTIU 4RUDA 1CVOA 1QKDA 2X8BB 2CRTA 4P7UA 1S4YA 2H7ZA 1LXHA 1HAJA 1QM7A 4FAOE 1MAHF 2MUPA 2NBTA 1ES7B 3QB4B 2JQPA 3PLCA 1CTXA 1IDLA 1ONJA 1W6BA 4OM5A 5DZ5A 1FSCA 1JBDA 6EBXA 1TXBA 1PLOA 2BHIA 1G6MA 1IDIA 1B41B 1HC9B 1CREA 1NYSA 1NXBA 3KFDI 1IKCA 4BDTB 3HH7A 2QC1A 1KBTA 3NDSA 5DU1A 3KFDE 4FAOC 1KXIA 1FF4A 1NTNA 2H8UA 1KBAA 4HQPF 1CDRA 3ERAA 2QJBC 1HC9A 2JVEA 3EBXA 4LFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LA1 A;  3EVS C;  1CHV S;  2UX2 A;  4OM4 A;  1YWH A;  2ABX A;  2H64 B;  1LX5 B;  1M9Z A;  2H62 C;  1NOR A;  2MFA A;  1V6P A;  1MR6 A;  1ABT A;  1HOY A;  2FD6 U;  5IMT D;  3NH7 A;  1I02 A;  5IMY C;  1HAA A;  1KTZ B;  1CCQ A;  1UG4 A;  1KFH A;  2UWR A;  1FSS B;  1KL8 A;  3BT2 U;  1IQ9 A;  1FAS A;  5EBX A;  1IJC A;  1IDH A;  3NEQ A;  4XJJ A;  1IK8 A;  2MJY A;  2N99 A;  1TGX A;  1FFJ A;  2MJ0 A;  2HLQ A;  2MHY A;  2K3G A;  1COD A;  2PJY C;  1LXG A;  2PJY B;  2GOO B;  1CDQ A;  1COE A;  1JGK A;  2CRS A;  2GOO C;  1KC4 A;  2MUO A;  2VLW A;  1TFS A;  2QJ9 C;  1CB9 A;  1DRS A;  2L5S A;  1ERG A;  1REW C;  1RL5 A;  1IDG A;  3U74 U;  1L4W A;  2LCR A;  1NYU A;  3VTS A;  1ZAD A;  2HLR A;  4IYE A;  1F8U B;  2ERA A;  1KU6 B;  1TXA A;  1KBS A;  1CDS A;  1JE9 A;  2H5F A;  2CTX A;  2J8B A;  1F94 A;  2QJA C;  2MJ4 A;  1XT3 A;  1CDT A;  1H0J A;  2I9B E;  2BTX A;  4DO8 A;  2H64 C;  1NTX A;  4EY8 B;  1KS6 A;  1BXP A;  2OFS A;  1CRF A;  4AEA A;  2CCX A;  2L03 A;  3FEV A;  4ZQY A;  1CXN A;  3LAQ U;  5DO6 A;  1FRA A;  1BTE A;  1QKE A;  2CDX A;  2H62 D;  3BT1 U;  3U73 U;  4BIK B;  1CXO A;  1LJZ A;  1LSI A;  1NEA A;  1VB0 A;  1RGJ A;  2H7Z B;  1ERA A;  4UY2 C;  4QTI U;  4RUD A;  1CVO A;  1QKD A;  2X8B B;  2CRT A;  4P7U A;  1S4Y A;  2H7Z A;  1LXH A;  1HAJ A;  1QM7 A;  4FAO E;  1MAH F;  2MUP A;  2NBT A;  1ES7 B;  3QB4 B;  2JQP A;  3PLC A;  1CTX A;  1IDL A;  1ONJ A;  1W6B A;  4OM5 A;  5DZ5 A;  1FSC A;  1JBD A;  6EBX A;  1TXB A;  1PLO A;  2BHI A;  1G6M A;  1IDI A;  1B41 B;  1HC9 B;  1CRE A;  1NYS A;  1NXB A;  3KFD I;  1IKC A;  4BDT B;  3HH7 A;  2QC1 A;  1KBT A;  3NDS A;  5DU1 A;  3KFD E;  4FAO C;  1KXI A;  1FF4 A;  1NTN A;  2H8U A;  1KBA A;  4HQP F;  1CDR A;  3ERA A;  2QJB C;  1HC9 A;  2JVE A;  3EBX A;  4LFT A; 
#chains in the Genus database with same CATH topology
 2LA1 A;  3EVS C;  1CHV S;  2UX2 A;  4OM4 A;  1YWH A;  2ABX A;  2H64 B;  1LX5 B;  1M9Z A;  2H62 C;  1NOR A;  2MFA A;  1V6P A;  1MR6 A;  1ABT A;  1HOY A;  2FD6 U;  5IMT D;  3NH7 A;  1I02 A;  5IMY C;  1HAA A;  1KTZ B;  1CCQ A;  1UG4 A;  1KFH A;  2UWR A;  1FSS B;  1KL8 A;  3BT2 U;  1IQ9 A;  1FAS A;  5EBX A;  1IJC A;  1IDH A;  3NEQ A;  4XJJ A;  1IK8 A;  2MJY A;  2N99 A;  1TGX A;  1FFJ A;  2MJ0 A;  2HLQ A;  2MHY A;  2K3G A;  1COD A;  2PJY C;  1LXG A;  2PJY B;  2GOO B;  1CDQ A;  1COE A;  1JGK A;  2CRS A;  2GOO C;  1KC4 A;  2MUO A;  2VLW A;  1TFS A;  2QJ9 C;  1CB9 A;  1DRS A;  2L5S A;  1ERG A;  1REW C;  1RL5 A;  1IDG A;  3U74 U;  1L4W A;  2LCR A;  1NYU A;  3VTS A;  1ZAD A;  2HLR A;  4IYE A;  1F8U B;  2ERA A;  1KU6 B;  1TXA A;  1KBS A;  1CDS A;  1JE9 A;  2H5F A;  2CTX A;  2J8B A;  1F94 A;  2QJA C;  2MJ4 A;  1XT3 A;  1CDT A;  1H0J A;  2I9B E;  2BTX A;  4DO8 A;  2H64 C;  1NTX A;  4EY8 B;  1KS6 A;  1BXP A;  2OFS A;  1CRF A;  4AEA A;  2CCX A;  2L03 A;  3FEV A;  4ZQY A;  1CXN A;  3LAQ U;  5DO6 A;  1FRA A;  1BTE A;  1QKE A;  2CDX A;  2H62 D;  3BT1 U;  4KSN A;  3U73 U;  4BIK B;  1CXO A;  1LJZ A;  1LSI A;  1NEA A;  1VB0 A;  1RGJ A;  2H7Z B;  1ERA A;  4UY2 C;  4QTI U;  4RUD A;  1CVO A;  1QKD A;  2X8B B;  2CRT A;  4P7U A;  1S4Y A;  2H7Z A;  1LXH A;  1HAJ A;  1QM7 A;  4FAO E;  1MAH F;  2MUP A;  2NBT A;  1ES7 B;  3QB4 B;  2JQP A;  3PLC A;  1CTX A;  1IDL A;  1ONJ A;  1W6B A;  4OM5 A;  5DZ5 A;  1FSC A;  1JBD A;  6EBX A;  1TXB A;  1PLO A;  2BHI A;  1G6M A;  1IDI A;  1B41 B;  1HC9 B;  1CRE A;  1NYS A;  1NXB A;  3KFD I;  1IKC A;  4BDT B;  3HH7 A;  2QC1 A;  1KBT A;  3NDS A;  5DU1 A;  3KFD E;  4FAO C;  1KXI A;  1FF4 A;  1NTN A;  2H8U A;  1KBA A;  4HQP F;  1CDR A;  3ERA A;  2QJB C;  1HC9 A;  2JVE A;  3EBX A;  4LFT A; 
#chains in the Genus database with same CATH homology
 2LA1 A;  3EVS C;  1CHV S;  2UX2 A;  4OM4 A;  1YWH A;  2ABX A;  2H64 B;  1LX5 B;  1M9Z A;  2H62 C;  1NOR A;  2MFA A;  1V6P A;  1MR6 A;  1ABT A;  1HOY A;  2FD6 U;  5IMT D;  3NH7 A;  1I02 A;  5IMY C;  1HAA A;  1KTZ B;  1CCQ A;  1UG4 A;  1KFH A;  2UWR A;  1FSS B;  1KL8 A;  3BT2 U;  1IQ9 A;  1FAS A;  5EBX A;  1IJC A;  1IDH A;  3NEQ A;  4XJJ A;  1IK8 A;  2MJY A;  2N99 A;  1TGX A;  1FFJ A;  2MJ0 A;  2HLQ A;  2MHY A;  2K3G A;  1COD A;  2PJY C;  1LXG A;  2PJY B;  2GOO B;  1CDQ A;  1COE A;  1JGK A;  2CRS A;  2GOO C;  1KC4 A;  2MUO A;  2VLW A;  1TFS A;  2QJ9 C;  1CB9 A;  1DRS A;  2L5S A;  1ERG A;  1REW C;  1RL5 A;  1IDG A;  3U74 U;  1L4W A;  2LCR A;  1NYU A;  3VTS A;  1ZAD A;  2HLR A;  4IYE A;  1F8U B;  2ERA A;  1KU6 B;  1TXA A;  1KBS A;  1CDS A;  1JE9 A;  2H5F A;  2CTX A;  2J8B A;  1F94 A;  2QJA C;  2MJ4 A;  1XT3 A;  1CDT A;  1H0J A;  2I9B E;  2BTX A;  4DO8 A;  2H64 C;  1NTX A;  4EY8 B;  1KS6 A;  1BXP A;  2OFS A;  1CRF A;  4AEA A;  2CCX A;  2L03 A;  3FEV A;  4ZQY A;  1CXN A;  3LAQ U;  5DO6 A;  1FRA A;  1BTE A;  1QKE A;  2CDX A;  2H62 D;  3BT1 U;  4KSN A;  3U73 U;  4BIK B;  1CXO A;  1LJZ A;  1LSI A;  1NEA A;  1VB0 A;  1RGJ A;  2H7Z B;  1ERA A;  4UY2 C;  4QTI U;  4RUD A;  1CVO A;  1QKD A;  2X8B B;  2CRT A;  4P7U A;  1S4Y A;  2H7Z A;  1LXH A;  1HAJ A;  1QM7 A;  4FAO E;  1MAH F;  2MUP A;  2NBT A;  1ES7 B;  3QB4 B;  2JQP A;  3PLC A;  1CTX A;  1IDL A;  1ONJ A;  1W6B A;  4OM5 A;  5DZ5 A;  1FSC A;  1JBD A;  6EBX A;  1TXB A;  1PLO A;  2BHI A;  1G6M A;  1IDI A;  1B41 B;  1HC9 B;  1CRE A;  1NYS A;  1NXB A;  3KFD I;  1IKC A;  4BDT B;  3HH7 A;  2QC1 A;  1KBT A;  3NDS A;  5DU1 A;  3KFD E;  4FAO C;  1KXI A;  1FF4 A;  1NTN A;  2H8U A;  1KBA A;  4HQP F;  1CDR A;  3ERA A;  2QJB C;  1HC9 A;  2JVE A;  3EBX A;  4LFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...