1BTKA

Ph domain and btk motif from bruton's tyrosine kinase mutant r28c
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
169
structure length
160
Chain Sequence
AAVILESIFLKRSQQKKKTSPLNFKKCLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRUTON'S TYROSINE KINASE
publication title Structure of the PH domain and Btk motif from Bruton's tyrosine kinase: molecular explanations for X-linked agammaglobulinaemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 33
structure length 160
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1btkA00
4EMOA 3P7ZA 2ZPYA 4HAUB 1EF1A 2G35A 4F7UP 5DHAB 3O96A 4GMVA 2CY4A 1P5TA 1WG7A 2OTXA 1DYNA 1LW3A 3KY9A 4DX8A 4GN1A 1ZC3B 2DX5A 1WJMA 1QQGA 2P8VA 4HAZB 3WYFB 2K2JA 3DXCA 2J0KA 2H7EA 4IAPA 1ZM0A 2LOXA 2ROVA 1X05A 5CLQB 2ADZA 2CAYA 1NU2A 2DA0A 3DXEA 2DYQA 1TXDA 4WVFB 4YONA 1OY2A 4IFSA 1V61A 3CXBB 3U7DA 3PSCA 3F5RA 2DFKA 1W1DA 1W1HA 3DXDA 3M1IB 2Y8GA 4IOYX 4EJNA 4BBKA 3HK0A 2IFSA 5J3YA 3QWMA 3ODOA 2BCJA 5DI9B 1UPRA 1X1FA 1BWNA 1PFJA 5HE2A 5C79A 1J19A 1X1GA 2DKPA 3MDBC 4NSWA 3RCPA 2E2XA 4KHOA 1MAIA 3AJ4A 3OANA 2RUKB 5D3WA 2Y7BA 4GPTB 5FI0A 3D8EA 5DIFB 1V5MA 2DKQA 1EAZA 2ELAA 1X11A 3FEHA 1FHXA 2AL6A 2YT1A 2Z0PA 2Q13A 4GZUA 2KGXB 3IVFA 2UZRA 5HE3A 4HB3B 2YT0A 1SGHA 1V89A 2HTHB 3KRWA 5EFXA 3X23A 2J0MA 2COAA 2W2XD 2LYDA 2D4QA 1BTNA 5CLLB 2I5CA 3D8FA 2R09A 4A5KA 4DX90 2YSZA 4DBBA 2MFQA 1XKEA 3G9WA 2W2XC 3T06A 1FGYA 5HE0A 1XR0B 1UPQA 3V5WA 4A6FB 1U29A 2UVMA 2M38A 5JHGA 3TFMA 2P0FA 2J0JA 1GC7A 3TO1A 5D3XA 4HB0B 2V76A 5C5BB 5LONB 2P0DA 2D10A 3GYOA 4F7GA 2DN6A 2EMSA 5DHFB 4NY0A 4Z2NA 3SO6A 4PQ0A 1FHOA 2COFA 2UZSA 3ML4A 4HATB 3PVUA 3KZ1A 3N7CA 1V88A 4K2PA 1Y5OA 3SUZA 2L2IA 4KHBB 4CHMA 4ZRKA 1KZGA 2L1CA 3FSSA 1IRSA 1PMSA 2QKLA 5KQ1A 2D2QA 1WGQA 1B55A 2CODA 2I1KA 1P3RA 4CYEA 1DBHA 4MY6A 5JHHA 2EJ8A 1WI1A 1U27A 1I7AA 1W1GA 4F7HA 2N23A 2R0DA 4DXAB 1UNRA 1N3HA 1AWEA 2W2WA 3AU5A 2D9ZA 4KVGB 2OQBA 2P0HA 4XWXA 4HAXB 4ZRJA 4HHVA 1Y19B 1GG3A 3ZVRA 2RNRB 3WA0A 2QKMA 4WJ7A 2RGNB 4K17A 1X86A 4HAWB 2VRWB 4EKUA 4C0AA 2I5FA 1XCGA 1FOEA 4ZRIA 3UZTA 2DYNA 2XQNM 2Y8FA 1ZVRA 1OQNA 1UNQA 1KZ7A 1U5DA 3LJUX 1UEFA 1GC6A 1TQZA 2YF0A 3VOQA 2D11A 5LOPB 4A6KA 1XODA 1V5UA 4B6HA 2HE7A 3QBVB 4HAVB 3HW2B 1MK7B 4GMXB 1FHWA 4HDQA 3ZDTA 3CIKA 2J59M 2D9VA 1ISNA 4D0NB 1SHCA 2NMBA 4KHAA 1DDVA 2RSGA 5FI1A 2LG1A 5KQ4A 2ROZB 5HE1A 4HAYB 2JP2A 2K2UA 2DHIA 2FJLA 3A8QA 1MIXA 2I1JA 1TJ6A 2EC1A 4K81A 2Z0OA 4P7IA 2LOZA 3TW1A 1WVHA 1DROA 1M7EA 3QIJA 1UNPA 5D27A 3SYXA 2GCJA 3NSUA 4HDOA 2N0YA 1BTKA 1MPHA 2H7DA 3A8PA 5KCVA 2CRFA 2VSZA 1NTYA 2VKIA 3PZDA 4KAXB 3F0WA 1QC6A 2D9WA 4CHJA 2D9YA 2IYBA 4A6FA 2COCA 1ZC4B 2MKRA 3MPXA 4Z2MB 2PZ1A 2AEHA 4HB4B 5L81A 3A98B 4PNKA 2X18A 1FGZA 5C5BA 2M14A 3BINA 4L6EA 1OMWA 1U5GA 3KRXA 1EVHA 3ODXA 2EMTA 5JLJB 2D9XA 2ELBA 1DDMA 2K00A 1Z87A 2MDXA 3GYPA 3PVLA 5DH9B 1XD4A 1J0WA 4TYZA 1Q67A 4H8SA 3HQCA 4Y94A 1H4RA 1NTVA 3PVWA 5JP4A 3ULCA 1XX0A 3TVVA 1U5EA 1U5FA 1MIZB 4WSFA 1V5PA 2RVBB 1FAOA 1WJ1A 2YS1A 2MWNB 5D3VA 3BJIA 5J3TA 1I2HA 5C6RA 3P6AA 2KCJA 3PEGA 3ULBA 2YS3A 3PP2A 1AQCA 1MK9B 3AU4A 2YS5A 2DHJA 2RLOA 3PG7A 4A6HA 1P6SA 1MKEA 4TKNA 1KI1B 1M7RA 2LKOA 2GCLA 2GJYA 4MK0A 5J3QA 3U8ZA 2DHKA 3ODWA 1K5DB 4YL8A 3KSYA 1RRPB 2KUPA 2CY5A 2LULA 5D3YA 1DDWA 2DX1A 1LB1A 5C16A 1ZSQA 1RJ2A 1BAKA 3FM8C 4MT7A 1K5GB 4GXBA 3SV1A 4K2OA 3VIAA 1U2BA 3TCAA 1EGXA 5GOWB 2YVCA 3SNHA 2DTCA 2DLWA 1WGUA 1E5WA 1PLSA 2NZ8B 1FB8A 1NI2A 3D8DA 2YRYA 2GS0A 2Z0QA 4HB2B 1H10A
chains in the Genus database with same CATH superfamily
2Z59A 3P7ZA 4EMOA 2ZPYA 4GNKB 4HAUB 1EF1A 2G35A 4F7UP 5DHAB 3O96A 4GMVA 2CY4A 1P5TA 1WG7A 2OTXA 1DYNA 1LW3A 3KY9A 4DX8A 4GN1A 1ZC3B 2DX5A 1WJMA 1QQGA 2P8VA 4HAZB 3WYFB 2K2JA 3DXCA 2J0KA 2H7EA 4IAPA 1ZM0A 2LOXA 2ROVA 1X05A 5CLQB 2ADZA 2CAYA 1NU2A 2DA0A 3DXEA 2NBVA 2DYQA 1TXDA 4WVFB 4YONA 1OY2A 4IFSA 1V61A 3CXBB 3U7DA 3DCXA 3PSCA 3F5RA 2DFKA 1W1DA 1W1HA 3DXDA 3M1IB 2Y8GA 4IOYX 4EJNA 4BBKA 3HK0A 2FJUB 2IFSA 5J3YA 3QWMA 3ODOA 2BCJA 5DI9B 1UPRA 1X1FA 1BWNA 1PFJA 5HE2A 5C79A 1J19A 1X1GA 2DKPA 3MDBC 4NSWA 3RCPA 2E2XA 4KHOA 1MAIA 3AJ4A 3OANA 2RUKB 5D3WA 2Y7BA 4GPTB 5FI0A 3D8EA 5DIFB 1V5MA 2DKQA 1EAZA 2ELAA 1X11A 3FEHA 1ZYIA 1FHXA 3B77A 2AL6A 2YT1A 2Z0PA 2Q13A 5I2SA 4GZUA 2KGXB 3IVFA 2UZRA 5HE3A 4HB3B 2YT0A 1SGHA 1V89A 2HTHB 5LG4B 3KRWA 3FVCA 4DIXA 5EFXA 3X23A 4QJ5B 2J0MA 2COAA 2W2XD 2LYDA 2D4QA 1BTNA 5M4YB 5CLLB 4D6WA 2I5CA 2R2YA 3D8FA 2R09A 4A5KA 4DX90 2YSZA 4DBBA 2MFQA 3A58A 1XKEA 3G9WA 2W2XC 3T06A 1FGYA 5HE0A 1XR0B 1UPQA 2KIGA 3V5WA 4A6FB 1U29A 2UVMA 2M38A 5JHGA 3TFMA 2P0FA 2J0JA 1GC7A 3TO1A 5D3XA 4HB0B 2Z14A 2V76A 5C5BB 5LONB 2P0DA 2D10A 3GYOA 4F7GA 2DN6A 2EMSA 5DHFB 4NY0A 1T77A 4Z2NA 3SO6A 4PQ0A 1FHOA 2COFA 2UZSA 3ML4A 3OHMB 4HATB 3PVUA 3KZ1A 3N7CA 1V88A 4K2PA 1Y5OA 3SUZA 2L2IA 4KHBB 4CHMA 4ZRKA 1KZGA 2L1CA 3FSSA 1IRSA 1PMSA 2QKLA 5KQ1A 2D2QA 1WGQA 1B55A 5I2MA 2CODA 2I1KA 1P3RA 4CYEA 1DBHA 4MY6A 2GUMA 5JHHA 4QXAB 2EJ8A 1WI1A 1U27A 1I7AA 2Z13A 1W1GA 4F7HA 2N23A 2R0DA 4DXAB 1UNRA 1N3HA 1AWEA 2W2WA 3AU5A 2D9ZA 4KVGB 2OQBA 2P0HA 4XWXA 2K49A 4HAXB 4ZRJA 3NWDA 4QJ4B 4HHVA 1Y19B 1GG3A 3ZVRA 2RNRB 3WA0A 2QKMA 3NW8A 4WJ7A 2RGNB 4K17A 1X86A 4HAWB 2VRWB 4EKUA 4C0AA 2I5FA 1XCGA 4QJ3B 1FOEA 4ZRIA 3NWFA 3UZTA 2DYNA 2XQNM 2Y8FA 1ZVRA 1OQNA 1UNQA 1KZ7A 1U5DA 3LJUX 1UEFA 1GC6A 1TQZA 2YF0A 3VOQA 2D11A 4L1RA 5LOPB 4A6KA 1XODA 1V5UA 4B6HA 2HE7A 3QBVB 4HAVB 3HW2B 1MK7B 4GMXB 1FHWA 4HDQA 3ZDTA 3CIKA 2J59M 2D9VA 1ISNA 4CSQA 4D0NB 1SHCA 2NMBA 4KHAA 1DDVA 2RSGA 2KR0A 5FI1A 2LG1A 5KQ4A 2ROZB 5HE1A 4HAYB 2JP2A 2K2UA 1MI1A 2DHIA 2FJLA 3U12A 3A8QA 1MIXA 2I1JA 1TJ6A 2EC1A 4K81A 2Z0OA 4P7IA 2LOZA 3TW1A 1WVHA 1DROA 1M7EA 3QIJA 1UNPA 5D27A 3SYXA 2GCJA 3NSUA 4HDOA 2N0YA 1BTKA 1MPHA 2H7DA 3A8PA 2KUQA 5KCVA 2CRFA 2VSZA 1NTYA 2VKIA 3PZDA 4KAXB 3F0WA 1QC6A 2D9WA 4CHJA 2D9YA 2IYBA 4A6FA 2COCA 1ZC4B 2MKRA 3MPXA 4Z2MB 2PZ1A 2AEHA 4HB4B 5L81A 3HSAA 3A98B 4PNKA 2X18A 1FGZA 5C5BA 2M14A 2Z4DA 4OT1A 2ZKMX 3BINA 4L6EA 1OMWA 1U5GA 3KRXA 1EVHA 3ODXA 2EMTA 5JLJB 2RRFA 2D9XA 2ELBA 1DDMA 2K00A 4KHBA 1Z87A 2MDXA 3GYPA 3PVLA 5DH9B 1XD4A 1J0WA 4TYZA 1Q67A 4H8SA 3HQCA 4Y94A 1H4RA 1NTVA 3PVWA 5JP4A 3ULCA 3NWAA 1XX0A 3TVVA 1U5EA 1U5FA 1MIZB 4WSFA 1V5PA 2RVBB 1FAOA 1WJ1A 2YS1A 2MWNB 5D3VA 3BJIA 5J3TA 1I2HA 5C6RA 3P6AA 2KCJA 3PEGA 4GOUA 3ULBA 2YS3A 3PP2A 1AQCA 1MK9B 3AU4A 2YS5A 2DHJA 2RLOA 3PG7A 4A6HA 1P6SA 1MKEA 2K8EA 5IRSA 4TKNA 2YT2A 1KI1B 1M7RA 2LKOA 2GCLA 2GJYA 4MK0A 5J3QA 3U8ZA 2DHKA 3ODWA 1K5DB 4YL8A 3KSYA 1RRPB 3HIEA 2KUPA 2CY5A 2LULA 5D3YA 1DDWA 2DX1A 1LB1A 5C16A 1ZSQA 1RJ2A 1BAKA 3FM8C 4OSNA 4MT7A 1K5GB 4GXBA 3SV1A 2KIEA 4K2OA 3VIAA 4HSIA 1U2BA 3TCAA 1EGXA 5GOWB 2YVCA 3SNHA 2DTCA 2DLWA 1WGUA 1E5WA 1PLSA 2NZ8B 1FB8A 1NI2A 3D8DA 2YRYA 2GS0A 2Z0QA 4HB2B 1H10A
chains in the Genus database with same CATH topology
4EMOA 3P7ZA 2ZPYA 4HAUB 1EF1A 2G35A 4F7UP 5DHAB 3O96A 4GMVA 2CY4A 1P5TA 1WG7A 2OTXA 1DYNA 1LW3A 3KY9A 4DX8A 4GN1A 1ZC3B 2DX5A 1WJMA 1QQGA 2P8VA 4HAZB 3WYFB 2K2JA 3DXCA 2J0KA 2H7EA 4IAPA 1ZM0A 2LOXA 2ROVA 1X05A 5CLQB 2ADZA 2CAYA 1NU2A 2DA0A 3DXEA 2DYQA 1TXDA 4WVFB 4YONA 1OY2A 4IFSA 1V61A 3CXBB 3U7DA 3PSCA 3F5RA 2DFKA 1W1DA 1W1HA 3DXDA 3M1IB 2Y8GA 4IOYX 4EJNA 4BBKA 3HK0A 2IFSA 5J3YA 3QWMA 3ODOA 2BCJA 5DI9B 1UPRA 1X1FA 1BWNA 1PFJA 5HE2A 5C79A 1J19A 1X1GA 2DKPA 3MDBC 4NSWA 3RCPA 2E2XA 4KHOA 1MAIA 3AJ4A 3OANA 2RUKB 5D3WA 2Y7BA 4GPTB 5FI0A 3D8EA 5DIFB 1V5MA 2DKQA 1EAZA 2ELAA 1X11A 3FEHA 1FHXA 2AL6A 2YT1A 2Z0PA 2Q13A 4GZUA 2KGXB 3IVFA 2UZRA 5HE3A 4HB3B 2YT0A 1SGHA 1V89A 2HTHB 3KRWA 5EFXA 3X23A 2J0MA 2COAA 2W2XD 2LYDA 2D4QA 1BTNA 5CLLB 2I5CA 3D8FA 2R09A 4A5KA 4DX90 2YSZA 4DBBA 2MFQA 1XKEA 3G9WA 2W2XC 3T06A 1FGYA 5HE0A 1XR0B 1UPQA 3V5WA 4A6FB 1U29A 2UVMA 2M38A 5JHGA 3TFMA 2P0FA 2J0JA 1GC7A 3TO1A 5D3XA 4HB0B 2V76A 5C5BB 5LONB 2P0DA 2D10A 3GYOA 4F7GA 2DN6A 2EMSA 5DHFB 4NY0A 4Z2NA 3SO6A 4PQ0A 1FHOA 2COFA 2UZSA 3ML4A 4HATB 3PVUA 3KZ1A 3N7CA 1V88A 4K2PA 1Y5OA 3SUZA 2L2IA 4KHBB 4CHMA 4ZRKA 1KZGA 2L1CA 3FSSA 1IRSA 1PMSA 2QKLA 5KQ1A 2D2QA 1WGQA 1B55A 2CODA 2I1KA 1P3RA 4CYEA 1DBHA 4MY6A 5JHHA 2EJ8A 1WI1A 1U27A 1I7AA 1W1GA 4F7HA 2N23A 2R0DA 4DXAB 1UNRA 1N3HA 1AWEA 2W2WA 3AU5A 2D9ZA 4KVGB 2OQBA 2P0HA 4XWXA 4HAXB 4ZRJA 4HHVA 1Y19B 1GG3A 3ZVRA 2RNRB 3WA0A 2QKMA 4WJ7A 2RGNB 4K17A 1X86A 4HAWB 2VRWB 4EKUA 4C0AA 2I5FA 1XCGA 1FOEA 4ZRIA 3UZTA 2DYNA 2XQNM 2Y8FA 1ZVRA 1OQNA 1UNQA 1KZ7A 1U5DA 3LJUX 1UEFA 1GC6A 1TQZA 2YF0A 3VOQA 2D11A 5LOPB 4A6KA 1XODA 1V5UA 4B6HA 2HE7A 3QBVB 4HAVB 3HW2B 1MK7B 4GMXB 1FHWA 4HDQA 3ZDTA 3CIKA 2J59M 2D9VA 1ISNA 4D0NB 1SHCA 2NMBA 4KHAA 1DDVA 2RSGA 5FI1A 2LG1A 5KQ4A 2ROZB 5HE1A 4HAYB 2JP2A 2K2UA 2DHIA 2FJLA 3A8QA 1MIXA 2I1JA 1TJ6A 2EC1A 4K81A 2Z0OA 4P7IA 2LOZA 3TW1A 1WVHA 1DROA 1M7EA 3QIJA 1UNPA 5D27A 3SYXA 2GCJA 3NSUA 4HDOA 2N0YA 1BTKA 1MPHA 2H7DA 3A8PA 5KCVA 2CRFA 2VSZA 1NTYA 2VKIA 3PZDA 4KAXB 3F0WA 1QC6A 2D9WA 4CHJA 2D9YA 2IYBA 4A6FA 2COCA 1ZC4B 2MKRA 3MPXA 4Z2MB 2PZ1A 2AEHA 4HB4B 5L81A 3A98B 4PNKA 2X18A 1FGZA 5C5BA 2M14A 3BINA 4L6EA 1OMWA 1U5GA 3KRXA 1EVHA 3ODXA 2EMTA 5JLJB 2D9XA 2ELBA 1DDMA 2K00A 1Z87A 2MDXA 3GYPA 3PVLA 5DH9B 1XD4A 1J0WA 4TYZA 1Q67A 4H8SA 3HQCA 4Y94A 1H4RA 1NTVA 3PVWA 5JP4A 3ULCA 1XX0A 3TVVA 1U5EA 1U5FA 1MIZB 4WSFA 1V5PA 2RVBB 1FAOA 1WJ1A 2YS1A 2MWNB 5D3VA 3BJIA 5J3TA 1I2HA 5C6RA 3P6AA 2KCJA 3PEGA 3ULBA 2YS3A 3PP2A 1AQCA 1MK9B 3AU4A 2YS5A 2DHJA 2RLOA 3PG7A 4A6HA 1P6SA 1MKEA 4TKNA 1KI1B 1M7RA 2LKOA 2GCLA 2GJYA 4MK0A 5J3QA 3U8ZA 2DHKA 3ODWA 1K5DB 4YL8A 3KSYA 1RRPB 2KUPA 2CY5A 2LULA 5D3YA 1DDWA 2DX1A 1LB1A 5C16A 1ZSQA 1RJ2A 1BAKA 3FM8C 4MT7A 1K5GB 4GXBA 3SV1A 4K2OA 3VIAA 1U2BA 3TCAA 1EGXA 5GOWB 2YVCA 3SNHA 2DTCA 2DLWA 1WGUA 1E5WA 1PLSA 2NZ8B 1FB8A 1NI2A 3D8DA 2YRYA 2GS0A 2Z0QA 4HB2B 1H10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMO A;  3P7Z A;  2ZPY A;  4HAU B;  1EF1 A;  2G35 A;  4F7U P;  5DHA B;  3O96 A;  4GMV A;  2CY4 A;  1P5T A;  1WG7 A;  2OTX A;  1DYN A;  1LW3 A;  3KY9 A;  4DX8 A;  4GN1 A;  1ZC3 B;  2DX5 A;  1WJM A;  1QQG A;  2P8V A;  4HAZ B;  3WYF B;  2K2J A;  3DXC A;  2J0K A;  2H7E A;  4IAP A;  1ZM0 A;  2LOX A;  2ROV A;  1X05 A;  5CLQ B;  2ADZ A;  2CAY A;  1NU2 A;  2DA0 A;  3DXE A;  2DYQ A;  1TXD A;  4WVF B;  4YON A;  1OY2 A;  4IFS A;  1V61 A;  3CXB B;  3U7D A;  3PSC A;  3F5R A;  2DFK A;  1W1D A;  1W1H A;  3DXD A;  3M1I B;  2Y8G A;  4IOY X;  4EJN A;  4BBK A;  3HK0 A;  2IFS A;  5J3Y A;  3QWM A;  3ODO A;  2BCJ A;  5DI9 B;  1UPR A;  1X1F A;  1BWN A;  1PFJ A;  5HE2 A;  5C79 A;  1J19 A;  1X1G A;  2DKP A;  3MDB C;  4NSW A;  3RCP A;  2E2X A;  4KHO A;  1MAI A;  3AJ4 A;  3OAN A;  2RUK B;  5D3W A;  2Y7B A;  4GPT B;  5FI0 A;  3D8E A;  5DIF B;  1V5M A;  2DKQ A;  1EAZ A;  2ELA A;  1X11 A;  3FEH A;  1FHX A;  2AL6 A;  2YT1 A;  2Z0P A;  2Q13 A;  4GZU A;  2KGX B;  3IVF A;  2UZR A;  5HE3 A;  4HB3 B;  2YT0 A;  1SGH A;  1V89 A;  2HTH B;  3KRW A;  5EFX A;  3X23 A;  2J0M A;  2COA A;  2W2X D;  2LYD A;  2D4Q A;  1BTN A;  5CLL B;  2I5C A;  3D8F A;  2R09 A;  4A5K A;  4DX9 0;  2YSZ A;  4DBB A;  2MFQ A;  1XKE A;  3G9W A;  2W2X C;  3T06 A;  1FGY A;  5HE0 A;  1XR0 B;  1UPQ A;  3V5W A;  4A6F B;  1U29 A;  2UVM A;  2M38 A;  5JHG A;  3TFM A;  2P0F A;  2J0J A;  1GC7 A;  3TO1 A;  5D3X A;  4HB0 B;  2V76 A;  5C5B B;  5LON B;  2P0D A;  2D10 A;  3GYO A;  4F7G A;  2DN6 A;  2EMS A;  5DHF B;  4NY0 A;  4Z2N A;  3SO6 A;  4PQ0 A;  1FHO A;  2COF A;  2UZS A;  3ML4 A;  4HAT B;  3PVU A;  3KZ1 A;  3N7C A;  1V88 A;  4K2P A;  1Y5O A;  3SUZ A;  2L2I A;  4KHB B;  4CHM A;  4ZRK A;  1KZG A;  2L1C A;  3FSS A;  1IRS A;  1PMS A;  2QKL A;  5KQ1 A;  2D2Q A;  1WGQ A;  1B55 A;  2COD A;  2I1K A;  1P3R A;  4CYE A;  1DBH A;  4MY6 A;  5JHH A;  2EJ8 A;  1WI1 A;  1U27 A;  1I7A A;  1W1G A;  4F7H A;  2N23 A;  2R0D A;  4DXA B;  1UNR A;  1N3H A;  1AWE A;  2W2W A;  3AU5 A;  2D9Z A;  4KVG B;  2OQB A;  2P0H A;  4XWX A;  4HAX B;  4ZRJ A;  4HHV A;  1Y19 B;  1GG3 A;  3ZVR A;  2RNR B;  3WA0 A;  2QKM A;  4WJ7 A;  2RGN B;  4K17 A;  1X86 A;  4HAW B;  2VRW B;  4EKU A;  4C0A A;  2I5F A;  1XCG A;  1FOE A;  4ZRI A;  3UZT A;  2DYN A;  2XQN M;  2Y8F A;  1ZVR A;  1OQN A;  1UNQ A;  1KZ7 A;  1U5D A;  3LJU X;  1UEF A;  1GC6 A;  1TQZ A;  2YF0 A;  3VOQ A;  2D11 A;  5LOP B;  4A6K A;  1XOD A;  1V5U A;  4B6H A;  2HE7 A;  3QBV B;  4HAV B;  3HW2 B;  1MK7 B;  4GMX B;  1FHW A;  4HDQ A;  3ZDT A;  3CIK A;  2J59 M;  2D9V A;  1ISN A;  4D0N B;  1SHC A;  2NMB A;  4KHA A;  1DDV A;  2RSG A;  5FI1 A;  2LG1 A;  5KQ4 A;  2ROZ B;  5HE1 A;  4HAY B;  2JP2 A;  2K2U A;  2DHI A;  2FJL A;  3A8Q A;  1MIX A;  2I1J A;  1TJ6 A;  2EC1 A;  4K81 A;  2Z0O A;  4P7I A;  2LOZ A;  3TW1 A;  1WVH A;  1DRO A;  1M7E A;  3QIJ A;  1UNP A;  5D27 A;  3SYX A;  2GCJ A;  3NSU A;  4HDO A;  2N0Y A;  1BTK A;  1MPH A;  2H7D A;  3A8P A;  5KCV A;  2CRF A;  2VSZ A;  1NTY A;  2VKI A;  3PZD A;  4KAX B;  3F0W A;  1QC6 A;  2D9W A;  4CHJ A;  2D9Y A;  2IYB A;  4A6F A;  2COC A;  1ZC4 B;  2MKR A;  3MPX A;  4Z2M B;  2PZ1 A;  2AEH A;  4HB4 B;  5L81 A;  3A98 B;  4PNK A;  2X18 A;  1FGZ A;  5C5B A;  2M14 A;  3BIN A;  4L6E A;  1OMW A;  1U5G A;  3KRX A;  1EVH A;  3ODX A;  2EMT A;  5JLJ B;  2D9X A;  2ELB A;  1DDM A;  2K00 A;  1Z87 A;  2MDX A;  3GYP A;  3PVL A;  5DH9 B;  1XD4 A;  1J0W A;  4TYZ A;  1Q67 A;  4H8S A;  3HQC A;  4Y94 A;  1H4R A;  1NTV A;  3PVW A;  5JP4 A;  3ULC A;  1XX0 A;  3TVV A;  1U5E A;  1U5F A;  1MIZ B;  4WSF A;  1V5P A;  2RVB B;  1FAO A;  1WJ1 A;  2YS1 A;  2MWN B;  5D3V A;  3BJI A;  5J3T A;  1I2H A;  5C6R A;  3P6A A;  2KCJ A;  3PEG A;  3ULB A;  2YS3 A;  3PP2 A;  1AQC A;  1MK9 B;  3AU4 A;  2YS5 A;  2DHJ A;  2RLO A;  3PG7 A;  4A6H A;  1P6S A;  1MKE A;  4TKN A;  1KI1 B;  1M7R A;  2LKO A;  2GCL A;  2GJY A;  4MK0 A;  5J3Q A;  3U8Z A;  2DHK A;  3ODW A;  1K5D B;  4YL8 A;  3KSY A;  1RRP B;  2KUP A;  2CY5 A;  2LUL A;  5D3Y A;  1DDW A;  2DX1 A;  1LB1 A;  5C16 A;  1ZSQ A;  1RJ2 A;  1BAK A;  3FM8 C;  4MT7 A;  1K5G B;  4GXB A;  3SV1 A;  4K2O A;  3VIA A;  1U2B A;  3TCA A;  1EGX A;  5GOW B;  2YVC A;  3SNH A;  2DTC A;  2DLW A;  1WGU A;  1E5W A;  1PLS A;  2NZ8 B;  1FB8 A;  1NI2 A;  3D8D A;  2YRY A;  2GS0 A;  2Z0Q A;  4HB2 B;  1H10 A; 
#chains in the Genus database with same CATH topology
 2Z59 A;  3P7Z A;  4EMO A;  2ZPY A;  4GNK B;  4HAU B;  1EF1 A;  2G35 A;  4F7U P;  5DHA B;  3O96 A;  4GMV A;  2CY4 A;  1P5T A;  1WG7 A;  2OTX A;  1DYN A;  1LW3 A;  3KY9 A;  4DX8 A;  4GN1 A;  1ZC3 B;  2DX5 A;  1WJM A;  1QQG A;  2P8V A;  4HAZ B;  3WYF B;  2K2J A;  3DXC A;  2J0K A;  2H7E A;  4IAP A;  1ZM0 A;  2LOX A;  2ROV A;  1X05 A;  5CLQ B;  2ADZ A;  2CAY A;  1NU2 A;  2DA0 A;  3DXE A;  2NBV A;  2DYQ A;  1TXD A;  4WVF B;  4YON A;  1OY2 A;  4IFS A;  1V61 A;  3CXB B;  3U7D A;  3DCX A;  3PSC A;  3F5R A;  2DFK A;  1W1D A;  1W1H A;  3DXD A;  3M1I B;  2Y8G A;  4IOY X;  4EJN A;  4BBK A;  3HK0 A;  2FJU B;  2IFS A;  5J3Y A;  3QWM A;  3ODO A;  2BCJ A;  5DI9 B;  1UPR A;  1X1F A;  1BWN A;  1PFJ A;  5HE2 A;  5C79 A;  1J19 A;  1X1G A;  2DKP A;  3MDB C;  4NSW A;  3RCP A;  2E2X A;  4KHO A;  1MAI A;  3AJ4 A;  3OAN A;  2RUK B;  5D3W A;  2Y7B A;  4GPT B;  5FI0 A;  3D8E A;  5DIF B;  1V5M A;  2DKQ A;  1EAZ A;  2ELA A;  1X11 A;  3FEH A;  1ZYI A;  1FHX A;  3B77 A;  2AL6 A;  2YT1 A;  2Z0P A;  2Q13 A;  5I2S A;  4GZU A;  2KGX B;  3IVF A;  2UZR A;  5HE3 A;  4HB3 B;  2YT0 A;  1SGH A;  1V89 A;  2HTH B;  5LG4 B;  3KRW A;  3FVC A;  4DIX A;  5EFX A;  3X23 A;  4QJ5 B;  2J0M A;  2COA A;  2W2X D;  2LYD A;  2D4Q A;  1BTN A;  5M4Y B;  5CLL B;  4D6W A;  2I5C A;  2R2Y A;  3D8F A;  2R09 A;  4A5K A;  4DX9 0;  2YSZ A;  4DBB A;  2MFQ A;  3A58 A;  1XKE A;  3G9W A;  2W2X C;  3T06 A;  1FGY A;  5HE0 A;  1XR0 B;  1UPQ A;  2KIG A;  3V5W A;  4A6F B;  1U29 A;  2UVM A;  2M38 A;  5JHG A;  3TFM A;  2P0F A;  2J0J A;  1GC7 A;  3TO1 A;  5D3X A;  4HB0 B;  2Z14 A;  2V76 A;  5C5B B;  5LON B;  2P0D A;  2D10 A;  3GYO A;  4F7G A;  2DN6 A;  2EMS A;  5DHF B;  4NY0 A;  1T77 A;  4Z2N A;  3SO6 A;  4PQ0 A;  1FHO A;  2COF A;  2UZS A;  3ML4 A;  3OHM B;  4HAT B;  3PVU A;  3KZ1 A;  3N7C A;  1V88 A;  4K2P A;  1Y5O A;  3SUZ A;  2L2I A;  4KHB B;  4CHM A;  4ZRK A;  1KZG A;  2L1C A;  3FSS A;  1IRS A;  1PMS A;  2QKL A;  5KQ1 A;  2D2Q A;  1WGQ A;  1B55 A;  5I2M A;  2COD A;  2I1K A;  1P3R A;  4CYE A;  1DBH A;  4MY6 A;  2GUM A;  5JHH A;  4QXA B;  2EJ8 A;  1WI1 A;  1U27 A;  1I7A A;  2Z13 A;  1W1G A;  4F7H A;  2N23 A;  2R0D A;  4DXA B;  1UNR A;  1N3H A;  1AWE A;  2W2W A;  3AU5 A;  2D9Z A;  4KVG B;  2OQB A;  2P0H A;  4XWX A;  2K49 A;  4HAX B;  4ZRJ A;  3NWD A;  4QJ4 B;  4HHV A;  1Y19 B;  1GG3 A;  3ZVR A;  2RNR B;  3WA0 A;  2QKM A;  3NW8 A;  4WJ7 A;  2RGN B;  4K17 A;  1X86 A;  4HAW B;  2VRW B;  4EKU A;  4C0A A;  2I5F A;  1XCG A;  4QJ3 B;  1FOE A;  4ZRI A;  3NWF A;  3UZT A;  2DYN A;  2XQN M;  2Y8F A;  1ZVR A;  1OQN A;  1UNQ A;  1KZ7 A;  1U5D A;  3LJU X;  1UEF A;  1GC6 A;  1TQZ A;  2YF0 A;  3VOQ A;  2D11 A;  4L1R A;  5LOP B;  4A6K A;  1XOD A;  1V5U A;  4B6H A;  2HE7 A;  3QBV B;  4HAV B;  3HW2 B;  1MK7 B;  4GMX B;  1FHW A;  4HDQ A;  3ZDT A;  3CIK A;  2J59 M;  2D9V A;  1ISN A;  4CSQ A;  4D0N B;  1SHC A;  2NMB A;  4KHA A;  1DDV A;  2RSG A;  2KR0 A;  5FI1 A;  2LG1 A;  5KQ4 A;  2ROZ B;  5HE1 A;  4HAY B;  2JP2 A;  2K2U A;  1MI1 A;  2DHI A;  2FJL A;  3U12 A;  3A8Q A;  1MIX A;  2I1J A;  1TJ6 A;  2EC1 A;  4K81 A;  2Z0O A;  4P7I A;  2LOZ A;  3TW1 A;  1WVH A;  1DRO A;  1M7E A;  3QIJ A;  1UNP A;  5D27 A;  3SYX A;  2GCJ A;  3NSU A;  4HDO A;  2N0Y A;  1BTK A;  1MPH A;  2H7D A;  3A8P A;  2KUQ A;  5KCV A;  2CRF A;  2VSZ A;  1NTY A;  2VKI A;  3PZD A;  4KAX B;  3F0W A;  1QC6 A;  2D9W A;  4CHJ A;  2D9Y A;  2IYB A;  4A6F A;  2COC A;  1ZC4 B;  2MKR A;  3MPX A;  4Z2M B;  2PZ1 A;  2AEH A;  4HB4 B;  5L81 A;  3HSA A;  3A98 B;  4PNK A;  2X18 A;  1FGZ A;  5C5B A;  2M14 A;  2Z4D A;  4OT1 A;  2ZKM X;  3BIN A;  4L6E A;  1OMW A;  1U5G A;  3KRX A;  1EVH A;  3ODX A;  2EMT A;  5JLJ B;  2RRF A;  2D9X A;  2ELB A;  1DDM A;  2K00 A;  4KHB A;  1Z87 A;  2MDX A;  3GYP A;  3PVL A;  5DH9 B;  1XD4 A;  1J0W A;  4TYZ A;  1Q67 A;  4H8S A;  3HQC A;  4Y94 A;  1H4R A;  1NTV A;  3PVW A;  5JP4 A;  3ULC A;  3NWA A;  1XX0 A;  3TVV A;  1U5E A;  1U5F A;  1MIZ B;  4WSF A;  1V5P A;  2RVB B;  1FAO A;  1WJ1 A;  2YS1 A;  2MWN B;  5D3V A;  3BJI A;  5J3T A;  1I2H A;  5C6R A;  3P6A A;  2KCJ A;  3PEG A;  4GOU A;  3ULB A;  2YS3 A;  3PP2 A;  1AQC A;  1MK9 B;  3AU4 A;  2YS5 A;  2DHJ A;  2RLO A;  3PG7 A;  4A6H A;  1P6S A;  1MKE A;  2K8E A;  5IRS A;  4TKN A;  2YT2 A;  1KI1 B;  1M7R A;  2LKO A;  2GCL A;  2GJY A;  4MK0 A;  5J3Q A;  3U8Z A;  2DHK A;  3ODW A;  1K5D B;  4YL8 A;  3KSY A;  1RRP B;  3HIE A;  2KUP A;  2CY5 A;  2LUL A;  5D3Y A;  1DDW A;  2DX1 A;  1LB1 A;  5C16 A;  1ZSQ A;  1RJ2 A;  1BAK A;  3FM8 C;  4OSN A;  4MT7 A;  1K5G B;  4GXB A;  3SV1 A;  2KIE A;  4K2O A;  3VIA A;  4HSI A;  1U2B A;  3TCA A;  1EGX A;  5GOW B;  2YVC A;  3SNH A;  2DTC A;  2DLW A;  1WGU A;  1E5W A;  1PLS A;  2NZ8 B;  1FB8 A;  1NI2 A;  3D8D A;  2YRY A;  2GS0 A;  2Z0Q A;  4HB2 B;  1H10 A; 
#chains in the Genus database with same CATH homology
 4EMO A;  3P7Z A;  2ZPY A;  4HAU B;  1EF1 A;  2G35 A;  4F7U P;  5DHA B;  3O96 A;  4GMV A;  2CY4 A;  1P5T A;  1WG7 A;  2OTX A;  1DYN A;  1LW3 A;  3KY9 A;  4DX8 A;  4GN1 A;  1ZC3 B;  2DX5 A;  1WJM A;  1QQG A;  2P8V A;  4HAZ B;  3WYF B;  2K2J A;  3DXC A;  2J0K A;  2H7E A;  4IAP A;  1ZM0 A;  2LOX A;  2ROV A;  1X05 A;  5CLQ B;  2ADZ A;  2CAY A;  1NU2 A;  2DA0 A;  3DXE A;  2DYQ A;  1TXD A;  4WVF B;  4YON A;  1OY2 A;  4IFS A;  1V61 A;  3CXB B;  3U7D A;  3PSC A;  3F5R A;  2DFK A;  1W1D A;  1W1H A;  3DXD A;  3M1I B;  2Y8G A;  4IOY X;  4EJN A;  4BBK A;  3HK0 A;  2IFS A;  5J3Y A;  3QWM A;  3ODO A;  2BCJ A;  5DI9 B;  1UPR A;  1X1F A;  1BWN A;  1PFJ A;  5HE2 A;  5C79 A;  1J19 A;  1X1G A;  2DKP A;  3MDB C;  4NSW A;  3RCP A;  2E2X A;  4KHO A;  1MAI A;  3AJ4 A;  3OAN A;  2RUK B;  5D3W A;  2Y7B A;  4GPT B;  5FI0 A;  3D8E A;  5DIF B;  1V5M A;  2DKQ A;  1EAZ A;  2ELA A;  1X11 A;  3FEH A;  1FHX A;  2AL6 A;  2YT1 A;  2Z0P A;  2Q13 A;  4GZU A;  2KGX B;  3IVF A;  2UZR A;  5HE3 A;  4HB3 B;  2YT0 A;  1SGH A;  1V89 A;  2HTH B;  3KRW A;  5EFX A;  3X23 A;  2J0M A;  2COA A;  2W2X D;  2LYD A;  2D4Q A;  1BTN A;  5CLL B;  2I5C A;  3D8F A;  2R09 A;  4A5K A;  4DX9 0;  2YSZ A;  4DBB A;  2MFQ A;  1XKE A;  3G9W A;  2W2X C;  3T06 A;  1FGY A;  5HE0 A;  1XR0 B;  1UPQ A;  3V5W A;  4A6F B;  1U29 A;  2UVM A;  2M38 A;  5JHG A;  3TFM A;  2P0F A;  2J0J A;  1GC7 A;  3TO1 A;  5D3X A;  4HB0 B;  2V76 A;  5C5B B;  5LON B;  2P0D A;  2D10 A;  3GYO A;  4F7G A;  2DN6 A;  2EMS A;  5DHF B;  4NY0 A;  4Z2N A;  3SO6 A;  4PQ0 A;  1FHO A;  2COF A;  2UZS A;  3ML4 A;  4HAT B;  3PVU A;  3KZ1 A;  3N7C A;  1V88 A;  4K2P A;  1Y5O A;  3SUZ A;  2L2I A;  4KHB B;  4CHM A;  4ZRK A;  1KZG A;  2L1C A;  3FSS A;  1IRS A;  1PMS A;  2QKL A;  5KQ1 A;  2D2Q A;  1WGQ A;  1B55 A;  2COD A;  2I1K A;  1P3R A;  4CYE A;  1DBH A;  4MY6 A;  5JHH A;  2EJ8 A;  1WI1 A;  1U27 A;  1I7A A;  1W1G A;  4F7H A;  2N23 A;  2R0D A;  4DXA B;  1UNR A;  1N3H A;  1AWE A;  2W2W A;  3AU5 A;  2D9Z A;  4KVG B;  2OQB A;  2P0H A;  4XWX A;  4HAX B;  4ZRJ A;  4HHV A;  1Y19 B;  1GG3 A;  3ZVR A;  2RNR B;  3WA0 A;  2QKM A;  4WJ7 A;  2RGN B;  4K17 A;  1X86 A;  4HAW B;  2VRW B;  4EKU A;  4C0A A;  2I5F A;  1XCG A;  1FOE A;  4ZRI A;  3UZT A;  2DYN A;  2XQN M;  2Y8F A;  1ZVR A;  1OQN A;  1UNQ A;  1KZ7 A;  1U5D A;  3LJU X;  1UEF A;  1GC6 A;  1TQZ A;  2YF0 A;  3VOQ A;  2D11 A;  5LOP B;  4A6K A;  1XOD A;  1V5U A;  4B6H A;  2HE7 A;  3QBV B;  4HAV B;  3HW2 B;  1MK7 B;  4GMX B;  1FHW A;  4HDQ A;  3ZDT A;  3CIK A;  2J59 M;  2D9V A;  1ISN A;  4D0N B;  1SHC A;  2NMB A;  4KHA A;  1DDV A;  2RSG A;  5FI1 A;  2LG1 A;  5KQ4 A;  2ROZ B;  5HE1 A;  4HAY B;  2JP2 A;  2K2U A;  2DHI A;  2FJL A;  3A8Q A;  1MIX A;  2I1J A;  1TJ6 A;  2EC1 A;  4K81 A;  2Z0O A;  4P7I A;  2LOZ A;  3TW1 A;  1WVH A;  1DRO A;  1M7E A;  3QIJ A;  1UNP A;  5D27 A;  3SYX A;  2GCJ A;  3NSU A;  4HDO A;  2N0Y A;  1BTK A;  1MPH A;  2H7D A;  3A8P A;  5KCV A;  2CRF A;  2VSZ A;  1NTY A;  2VKI A;  3PZD A;  4KAX B;  3F0W A;  1QC6 A;  2D9W A;  4CHJ A;  2D9Y A;  2IYB A;  4A6F A;  2COC A;  1ZC4 B;  2MKR A;  3MPX A;  4Z2M B;  2PZ1 A;  2AEH A;  4HB4 B;  5L81 A;  3A98 B;  4PNK A;  2X18 A;  1FGZ A;  5C5B A;  2M14 A;  3BIN A;  4L6E A;  1OMW A;  1U5G A;  3KRX A;  1EVH A;  3ODX A;  2EMT A;  5JLJ B;  2D9X A;  2ELB A;  1DDM A;  2K00 A;  1Z87 A;  2MDX A;  3GYP A;  3PVL A;  5DH9 B;  1XD4 A;  1J0W A;  4TYZ A;  1Q67 A;  4H8S A;  3HQC A;  4Y94 A;  1H4R A;  1NTV A;  3PVW A;  5JP4 A;  3ULC A;  1XX0 A;  3TVV A;  1U5E A;  1U5F A;  1MIZ B;  4WSF A;  1V5P A;  2RVB B;  1FAO A;  1WJ1 A;  2YS1 A;  2MWN B;  5D3V A;  3BJI A;  5J3T A;  1I2H A;  5C6R A;  3P6A A;  2KCJ A;  3PEG A;  3ULB A;  2YS3 A;  3PP2 A;  1AQC A;  1MK9 B;  3AU4 A;  2YS5 A;  2DHJ A;  2RLO A;  3PG7 A;  4A6H A;  1P6S A;  1MKE A;  4TKN A;  1KI1 B;  1M7R A;  2LKO A;  2GCL A;  2GJY A;  4MK0 A;  5J3Q A;  3U8Z A;  2DHK A;  3ODW A;  1K5D B;  4YL8 A;  3KSY A;  1RRP B;  2KUP A;  2CY5 A;  2LUL A;  5D3Y A;  1DDW A;  2DX1 A;  1LB1 A;  5C16 A;  1ZSQ A;  1RJ2 A;  1BAK A;  3FM8 C;  4MT7 A;  1K5G B;  4GXB A;  3SV1 A;  4K2O A;  3VIA A;  1U2B A;  3TCA A;  1EGX A;  5GOW B;  2YVC A;  3SNH A;  2DTC A;  2DLW A;  1WGU A;  1E5W A;  1PLS A;  2NZ8 B;  1FB8 A;  1NI2 A;  3D8D A;  2YRY A;  2GS0 A;  2Z0Q A;  4HB2 B;  1H10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...