1BTKA

Ph domain and btk motif from bruton's tyrosine kinase mutant r28c
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
169
structure length
160
Chain Sequence
AAVILESIFLKRSQQKKKTSPLNFKKCLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the PH domain and Btk motif from Bruton's tyrosine kinase: molecular explanations for X-linked agammaglobulinaemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords BRUTON'S TYROSINE KINASE
total genus 33
structure length 160
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1btkA00
1E5WA 1ZC3B 1FHXA 3SUZA 1U29A 2BCJA 1LW3A 3HQCA 2DFKA 3HK0A 2R09A 4DBBA 1MAIA 1RRPB 4GN1A 3BINA 3TVVA 3QBVB 4KHAA 4K81A 3TCAA 4CHMA 1TXDA 5LONB 2Z0PA 2K00A 1UPQA 3MPXA 4A6FB 2K2UA 1XCGA 2W2XC 5CLLB 2MFQA 1V61A 1W1DA 2I5FA 3V5WA 2I5CA 3A8QA 3A8PA 2DA0A 2YRYA 3CXBB 3D8FA 4GPTB 3T06A 2ADZA 5D3WA 1Y19B 3PVUA 1FGYA 2LKOA 4IFSA 2E2XA 3IVFA 1LB1A 1ISNA 1Z87A 4A6HA 2J0JA 3ODXA 1BAKA 4BBKA 2NZ8B 2D2QA 5JLJB 1AWEA 4DX8A 4PQ0A 2RNRB 4XWXA 1OQNA 2DX1A 2AEHA 2COAA 1U2BA 4TYZA 4MT7A 1PMSA 2DN6A 4KVGB 2P0DA 4C0AA 1V88A 1XKEA 1WVHA 2Z0QA 1MKEA 1BTKA 1FB8A 1FHWA 2DHJA 4HDQA 1U27A 1X11A 3UZTA 1XD4A 3D8DA 4HATB 5DI9B 4MY6A 5LOPB 1J0WA 2M38A 4Z2NA 4A5KA 3A98B 2QKLA 2DYNA 4HB2B 3PVLA 2AL6A 1K5GB 5CLQB 5D3XA 1N3HA 2EMSA 5KCVA 2CAYA 1EGXA 2D9WA 2DKPA 2DX5A 4K2OA 3FSSA 2J0MA 3VOQA 2YS1A 4WJ7A 3KRWA 4Y94A 1DROA 3U8ZA 3KRXA 5FI0A 1OY2A 2YSZA 5FI1A 3ULBA 1NI2A 3D8EA 5C5BA 1J19A 1ZVRA 5C5BB 2EMTA 2G35A 2NMBA 4WSFA 3BJIA 5DIFB 1BWNA 2ROZB 4IAPA 2D4QA 2DYQA 5J3QA 5DHFB 1V5MA 1XODA 2YF0A 2YT0A 3WYFB 1DYNA 1X05A 2VRWB 2GCLA 2ELAA 2P0HA 2RGNB 2UVMA 3ODWA 2UZSA 2I1JA 1MK7B 2CY5A 4ZRJA 2DHIA 1U5DA 1DDVA 2I1KA 1X1FA 1GC7A 2DLWA 5C79A 5C16A 3M1IB 3X23A 3ZDTA 5GOWB 1QQGA 2CY4A 4KHOA 2H7EA 1GG3A 3ZVRA 4MK0A 4KHBB 2GCJA 1WG7A 2D9VA 5JHGA 5KQ4A 3WA0A 2Y8GA 1U5EA 5J3TA 3PSCA 2DKQA 4EJNA 5EFXA 2W2XD 3TW1A 1W1GA 2OQBA 4HAZB 1GC6A 2ZPYA 3TFMA 1I7AA 1K5DB 3NSUA 1H10A 1PFJA 2GS0A 4HAWB 1WJ1A 3FM8C 1DBHA 1UEFA 2H7DA 5JP4A 2EJ8A 2M14A 3F0WA 4TKNA 4GMXB 2J59M 4HB3B 3PG7A 1TQZA 4HB4B 2FJLA 1U5FA 3P6AA 1DDWA 4ZRKA 2VKIA 1RJ2A 2W2WA 4PNKA 2R0DA 1X86A 3KY9A 1KZ7A 2CRFA 3SO6A 3QIJA 1NU2A 1UNPA 1U5GA 1QC6A 3HW2B 3PZDA 4KAXB 1NTYA 4GMVA 1DDMA 2LOZA 2YT1A 3P7ZA 3U7DA 3PEGA 2D9ZA 5HE0A 1FOEA 2X18A 1WJMA 2CODA 4CYEA 4EKUA 3AU4A 4GXBA 4HHVA 1M7RA 2P8VA 3SYXA 2JP2A 1MK9B 3MDBC 2RUKB 3KSYA 2J0KA 1WI1A 4D0NB 1XR0B 1OMWA 1V89A 3SV1A 2L1CA 4K2PA 3N7CA 2MDXA 1WGUA 3FEHA 5KQ1A 2RSGA 1Y5OA 3O96A 1UPRA 1IRSA 4YL8A 3ODOA 1EAZA 1Q67A 1AQCA 4NSWA 2DTCA 1ZC4B 1WGQA 2YS5A 1PLSA 2GJYA 1P3RA 5JHHA 3F5RA 2N23A 1XX0A 1W1HA 5C6RA 3PP2A 2Z0OA 1ZSQA 2ROVA 4HAVB 4HB0B 5HE1A 4EMOA 1BTNA 1H4RA 3ULCA 1FHOA 3PVWA 3DXCA 2YVCA 4DX90 4A6KA 1M7EA 4F7HA 1UNQA 4ZRIA 3CIKA 4P7IA 3OANA 4K17A 1NTVA 3QWMA 2ELBA 2UZRA 5DH9B 2RLOA 3GYPA 4IOYX 2LYDA 1KI1B 4DXAB 1KZGA 1V5UA 1V5PA 2COFA 4F7UP 3AU5A 2PZ1A 4A6FA 1MPHA 4YONA 2LG1A 5DHAB 2D9XA 2DHKA 3TO1A 2XQNM 3VIAA 1FAOA 5HE3A 2V76A 4L6EA 2D10A 2HTHB 4F7GA 3G9WA 3RCPA 2QKMA 1FGZA 2D11A 4HDOA 2LULA 2Y7BA 1TJ6A 2IYBA 1P5TA 3KZ1A 3ML4A 3DXEA 1P6SA 2K2JA 2KCJA 2Q13A 4HAXB 2YS3A 2OTXA 4NY0A 2KUPA 2IFSA 2HE7A 2COCA 4GZUA 3GYOA 2D9YA 1ZM0A 1UNRA 2Y8FA 1MIZB 1B55A 2KGXB 2N0YA 4CHJA 4WVFB 5J3YA 4Z2MB 1EVHA 1SGHA 4B6HA 2VSZA 3AJ4A 5D27A 5L81A 2RVBB 5D3YA 2EC1A 1X1GA 2P0FA 5D3VA 4HAYB 1I2HA 1SHCA 5HE2A 2MWNB 3LJUX 2MKRA 2L2IA 3DXDA 2LOXA 3SNHA 4HAUB 1EF1A 1MIXA 4H8SA
chains in the Genus database with same CATH superfamily
1E5WA 1ZC3B 1FHXA 3SUZA 1U29A 2BCJA 1LW3A 3HQCA 2DFKA 3HK0A 2R09A 4DBBA 1MAIA 1RRPB 4GN1A 3BINA 3TVVA 3QBVB 4KHAA 4K81A 3TCAA 4CHMA 1TXDA 5LONB 2Z0PA 2K00A 1UPQA 3MPXA 4A6FB 2K2UA 1XCGA 2Z59A 2KR0A 2W2XC 5CLLB 2MFQA 1V61A 1W1DA 2I5FA 2YT2A 3V5WA 2I5CA 3A8QA 3A8PA 4QJ4B 2DA0A 2YRYA 5IRSA 3CXBB 3D8FA 4GPTB 3T06A 2ADZA 5D3WA 1Y19B 3PVUA 1FGYA 2LKOA 4IFSA 2E2XA 3IVFA 1LB1A 1ISNA 1Z87A 4A6HA 2J0JA 3ODXA 1BAKA 4BBKA 2NZ8B 2D2QA 4HSIA 5JLJB 1AWEA 4DX8A 3HSAA 4PQ0A 2RNRB 4XWXA 2KIEA 5I2SA 1OQNA 2DX1A 2AEHA 2COAA 1U2BA 4TYZA 4MT7A 1PMSA 2DN6A 4KVGB 2P0DA 4C0AA 1V88A 1XKEA 3HIEA 2ZKMX 1WVHA 2Z0QA 1MKEA 1BTKA 1FB8A 1FHWA 2DHJA 2KUQA 4HDQA 1U27A 1X11A 3UZTA 1XD4A 3D8DA 4HATB 5DI9B 3NWFA 4MY6A 5LOPB 1J0WA 2M38A 4Z2NA 4A5KA 3A98B 2QKLA 2DYNA 4HB2B 3PVLA 2AL6A 1K5GB 5CLQB 5D3XA 1N3HA 2EMSA 5KCVA 2CAYA 1EGXA 2D9WA 2DKPA 2DX5A 4K2OA 3FSSA 2J0MA 3VOQA 2YS1A 4WJ7A 3KRWA 4Y94A 4OSNA 1DROA 3U8ZA 3KRXA 5FI0A 1OY2A 2YSZA 5FI1A 3ULBA 1NI2A 3D8EA 5C5BA 3NW8A 1J19A 1ZVRA 3DCXA 2EMTA 5C5BB 2G35A 2NMBA 4WSFA 3BJIA 5DIFB 1BWNA 2ROZB 4IAPA 2D4QA 2DYQA 5J3QA 5DHFB 1V5MA 1XODA 2YF0A 2YT0A 3WYFB 5LG4B 1DYNA 1X05A 2VRWB 2GCLA 2ELAA 2P0HA 2RGNB 2UVMA 3ODWA 2UZSA 2I1JA 1MK7B 2CY5A 4ZRJA 2DHIA 1U5DA 1DDVA 2I1KA 1X1FA 1GC7A 2DLWA 5C79A 5C16A 1MI1A 4GNKB 3M1IB 3X23A 3ZDTA 5GOWB 1T77A 1QQGA 2CY4A 4KHOA 2H7EA 1GG3A 3ZVRA 4MK0A 4KHBB 2GCJA 1WG7A 2D9VA 5JHGA 1ZYIA 5KQ4A 3WA0A 2Y8GA 1U5EA 5J3TA 3PSCA 2DKQA 3U12A 4EJNA 5EFXA 2W2XD 3TW1A 4D6WA 1W1GA 2OQBA 4HAZB 1GC6A 2ZPYA 3NWDA 3TFMA 1I7AA 1K5DB 3NSUA 1H10A 1PFJA 2GS0A 4HAWB 1WJ1A 3FM8C 1DBHA 1UEFA 2H7DA 3FVCA 5JP4A 2EJ8A 2M14A 3F0WA 4TKNA 4CSQA 4GMXB 2J59M 4HB3B 3PG7A 1TQZA 4HB4B 2FJLA 1U5FA 3P6AA 1DDWA 4ZRKA 2VKIA 1RJ2A 2W2WA 4PNKA 2R0DA 5M4YB 1X86A 3KY9A 3OHMB 3NWAA 1KZ7A 2Z4DA 2CRFA 3SO6A 3QIJA 1NU2A 1UNPA 1U5GA 1QC6A 3HW2B 3PZDA 4KAXB 1NTYA 4GMVA 1DDMA 2R2YA 2GUMA 2LOZA 2YT1A 3P7ZA 3U7DA 3PEGA 2D9ZA 5HE0A 1FOEA 2X18A 1WJMA 2CODA 4CYEA 4EKUA 4QXAB 3AU4A 4GXBA 3A58A 4HHVA 1M7RA 2P8VA 3SYXA 2JP2A 1MK9B 3MDBC 2FJUB 2RUKB 3KSYA 2J0KA 1WI1A 4D0NB 1XR0B 4OT1A 1OMWA 1V89A 4GOUA 3SV1A 2L1CA 4K2PA 3N7CA 2MDXA 1WGUA 3FEHA 5KQ1A 2RSGA 1Y5OA 3O96A 4DIXA 1UPRA 1IRSA 4YL8A 2Z14A 3ODOA 1EAZA 1Q67A 1AQCA 4NSWA 2DTCA 1ZC4B 1WGQA 2YS5A 2Z13A 1PLSA 2GJYA 1P3RA 5JHHA 3F5RA 2N23A 5I2MA 1XX0A 1W1HA 5C6RA 3PP2A 2Z0OA 1ZSQA 2ROVA 4HAVB 4HB0B 5HE1A 4EMOA 2KIGA 1BTNA 1H4RA 3ULCA 1FHOA 3PVWA 3DXCA 2YVCA 4DX90 4A6KA 2RRFA 1M7EA 4F7HA 1UNQA 4ZRIA 3CIKA 4P7IA 3OANA 4K17A 1NTVA 3QWMA 2ELBA 2UZRA 5DH9B 2RLOA 3GYPA 4IOYX 2LYDA 1KI1B 4DXAB 1KZGA 1V5UA 1V5PA 4KHBA 2COFA 2K8EA 4F7UP 3AU5A 2PZ1A 4A6FA 1MPHA 4YONA 2LG1A 5DHAB 2D9XA 2DHKA 2K49A 3TO1A 2XQNM 3VIAA 2NBVA 1FAOA 5HE3A 2V76A 4L6EA 2D10A 2HTHB 4F7GA 3G9WA 3RCPA 2QKMA 1FGZA 2D11A 4HDOA 2LULA 2Y7BA 1TJ6A 2IYBA 1P5TA 3KZ1A 3ML4A 3DXEA 1P6SA 2K2JA 2KCJA 2Q13A 4HAXB 2YS3A 2OTXA 4NY0A 2KUPA 2IFSA 2HE7A 2COCA 4GZUA 3GYOA 2D9YA 1ZM0A 1UNRA 4L1RA 4QJ3B 2Y8FA 1MIZB 1B55A 2KGXB 2N0YA 4CHJA 4QJ5B 4WVFB 5J3YA 4Z2MB 1EVHA 1SGHA 4B6HA 2VSZA 3AJ4A 5D27A 5L81A 2RVBB 5D3YA 2EC1A 1X1GA 2P0FA 5D3VA 4HAYB 1I2HA 1SHCA 3B77A 5HE2A 2MWNB 3LJUX 2MKRA 2L2IA 3DXDA 2LOXA 3SNHA 4HAUB 1EF1A 1MIXA 4H8SA
chains in the Genus database with same CATH topology
1E5WA 1ZC3B 1FHXA 3SUZA 1U29A 2BCJA 1LW3A 3HQCA 2DFKA 3HK0A 2R09A 4DBBA 1MAIA 1RRPB 4GN1A 3BINA 3TVVA 3QBVB 4KHAA 4K81A 3TCAA 4CHMA 1TXDA 5LONB 2Z0PA 2K00A 1UPQA 3MPXA 4A6FB 2K2UA 1XCGA 2W2XC 5CLLB 2MFQA 1V61A 1W1DA 2I5FA 3V5WA 2I5CA 3A8QA 3A8PA 2DA0A 2YRYA 3CXBB 3D8FA 4GPTB 3T06A 2ADZA 5D3WA 1Y19B 3PVUA 1FGYA 2LKOA 4IFSA 2E2XA 3IVFA 1LB1A 1ISNA 1Z87A 4A6HA 2J0JA 3ODXA 1BAKA 4BBKA 2NZ8B 2D2QA 5JLJB 1AWEA 4DX8A 4PQ0A 2RNRB 4XWXA 1OQNA 2DX1A 2AEHA 2COAA 1U2BA 4TYZA 4MT7A 1PMSA 2DN6A 4KVGB 2P0DA 4C0AA 1V88A 1XKEA 1WVHA 2Z0QA 1MKEA 1BTKA 1FB8A 1FHWA 2DHJA 4HDQA 1U27A 1X11A 3UZTA 1XD4A 3D8DA 4HATB 5DI9B 4MY6A 5LOPB 1J0WA 2M38A 4Z2NA 4A5KA 3A98B 2QKLA 2DYNA 4HB2B 3PVLA 2AL6A 1K5GB 5CLQB 5D3XA 1N3HA 2EMSA 5KCVA 2CAYA 1EGXA 2D9WA 2DKPA 2DX5A 4K2OA 3FSSA 2J0MA 3VOQA 2YS1A 4WJ7A 3KRWA 4Y94A 1DROA 3U8ZA 3KRXA 5FI0A 1OY2A 2YSZA 5FI1A 3ULBA 1NI2A 3D8EA 5C5BA 1J19A 1ZVRA 5C5BB 2EMTA 2G35A 2NMBA 4WSFA 3BJIA 5DIFB 1BWNA 2ROZB 4IAPA 2D4QA 2DYQA 5J3QA 5DHFB 1V5MA 1XODA 2YF0A 2YT0A 3WYFB 1DYNA 1X05A 2VRWB 2GCLA 2ELAA 2P0HA 2RGNB 2UVMA 3ODWA 2UZSA 2I1JA 1MK7B 2CY5A 4ZRJA 2DHIA 1U5DA 1DDVA 2I1KA 1X1FA 1GC7A 2DLWA 5C79A 5C16A 3M1IB 3X23A 3ZDTA 5GOWB 1QQGA 2CY4A 4KHOA 2H7EA 1GG3A 3ZVRA 4MK0A 4KHBB 2GCJA 1WG7A 2D9VA 5JHGA 5KQ4A 3WA0A 2Y8GA 1U5EA 5J3TA 3PSCA 2DKQA 4EJNA 5EFXA 2W2XD 3TW1A 1W1GA 2OQBA 4HAZB 1GC6A 2ZPYA 3TFMA 1I7AA 1K5DB 3NSUA 1H10A 1PFJA 2GS0A 4HAWB 1WJ1A 3FM8C 1DBHA 1UEFA 2H7DA 5JP4A 2EJ8A 2M14A 3F0WA 4TKNA 4GMXB 2J59M 4HB3B 3PG7A 1TQZA 4HB4B 2FJLA 1U5FA 3P6AA 1DDWA 4ZRKA 2VKIA 1RJ2A 2W2WA 4PNKA 2R0DA 1X86A 3KY9A 1KZ7A 2CRFA 3SO6A 3QIJA 1NU2A 1UNPA 1U5GA 1QC6A 3HW2B 3PZDA 4KAXB 1NTYA 4GMVA 1DDMA 2LOZA 2YT1A 3P7ZA 3U7DA 3PEGA 2D9ZA 5HE0A 1FOEA 2X18A 1WJMA 2CODA 4CYEA 4EKUA 3AU4A 4GXBA 4HHVA 1M7RA 2P8VA 3SYXA 2JP2A 1MK9B 3MDBC 2RUKB 3KSYA 2J0KA 1WI1A 4D0NB 1XR0B 1OMWA 1V89A 3SV1A 2L1CA 4K2PA 3N7CA 2MDXA 1WGUA 3FEHA 5KQ1A 2RSGA 1Y5OA 3O96A 1UPRA 1IRSA 4YL8A 3ODOA 1EAZA 1Q67A 1AQCA 4NSWA 2DTCA 1ZC4B 1WGQA 2YS5A 1PLSA 2GJYA 1P3RA 5JHHA 3F5RA 2N23A 1XX0A 1W1HA 5C6RA 3PP2A 2Z0OA 1ZSQA 2ROVA 4HAVB 4HB0B 5HE1A 4EMOA 1BTNA 1H4RA 3ULCA 1FHOA 3PVWA 3DXCA 2YVCA 4DX90 4A6KA 1M7EA 4F7HA 1UNQA 4ZRIA 3CIKA 4P7IA 3OANA 4K17A 1NTVA 3QWMA 2ELBA 2UZRA 5DH9B 2RLOA 3GYPA 4IOYX 2LYDA 1KI1B 4DXAB 1KZGA 1V5UA 1V5PA 2COFA 4F7UP 3AU5A 2PZ1A 4A6FA 1MPHA 4YONA 2LG1A 5DHAB 2D9XA 2DHKA 3TO1A 2XQNM 3VIAA 1FAOA 5HE3A 2V76A 4L6EA 2D10A 2HTHB 4F7GA 3G9WA 3RCPA 2QKMA 1FGZA 2D11A 4HDOA 2LULA 2Y7BA 1TJ6A 2IYBA 1P5TA 3KZ1A 3ML4A 3DXEA 1P6SA 2K2JA 2KCJA 2Q13A 4HAXB 2YS3A 2OTXA 4NY0A 2KUPA 2IFSA 2HE7A 2COCA 4GZUA 3GYOA 2D9YA 1ZM0A 1UNRA 2Y8FA 1MIZB 1B55A 2KGXB 2N0YA 4CHJA 4WVFB 5J3YA 4Z2MB 1EVHA 1SGHA 4B6HA 2VSZA 3AJ4A 5D27A 5L81A 2RVBB 5D3YA 2EC1A 1X1GA 2P0FA 5D3VA 4HAYB 1I2HA 1SHCA 5HE2A 2MWNB 3LJUX 2MKRA 2L2IA 3DXDA 2LOXA 3SNHA 4HAUB 1EF1A 1MIXA 4H8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E5W A;  1ZC3 B;  1FHX A;  3SUZ A;  1U29 A;  2BCJ A;  1LW3 A;  3HQC A;  2DFK A;  3HK0 A;  2R09 A;  4DBB A;  1MAI A;  1RRP B;  4GN1 A;  3BIN A;  3TVV A;  3QBV B;  4KHA A;  4K81 A;  3TCA A;  4CHM A;  1TXD A;  5LON B;  2Z0P A;  2K00 A;  1UPQ A;  3MPX A;  4A6F B;  2K2U A;  1XCG A;  2W2X C;  5CLL B;  2MFQ A;  1V61 A;  1W1D A;  2I5F A;  3V5W A;  2I5C A;  3A8Q A;  3A8P A;  2DA0 A;  2YRY A;  3CXB B;  3D8F A;  4GPT B;  3T06 A;  2ADZ A;  5D3W A;  1Y19 B;  3PVU A;  1FGY A;  2LKO A;  4IFS A;  2E2X A;  3IVF A;  1LB1 A;  1ISN A;  1Z87 A;  4A6H A;  2J0J A;  3ODX A;  1BAK A;  4BBK A;  2NZ8 B;  2D2Q A;  5JLJ B;  1AWE A;  4DX8 A;  4PQ0 A;  2RNR B;  4XWX A;  1OQN A;  2DX1 A;  2AEH A;  2COA A;  1U2B A;  4TYZ A;  4MT7 A;  1PMS A;  2DN6 A;  4KVG B;  2P0D A;  4C0A A;  1V88 A;  1XKE A;  1WVH A;  2Z0Q A;  1MKE A;  1BTK A;  1FB8 A;  1FHW A;  2DHJ A;  4HDQ A;  1U27 A;  1X11 A;  3UZT A;  1XD4 A;  3D8D A;  4HAT B;  5DI9 B;  4MY6 A;  5LOP B;  1J0W A;  2M38 A;  4Z2N A;  4A5K A;  3A98 B;  2QKL A;  2DYN A;  4HB2 B;  3PVL A;  2AL6 A;  1K5G B;  5CLQ B;  5D3X A;  1N3H A;  2EMS A;  5KCV A;  2CAY A;  1EGX A;  2D9W A;  2DKP A;  2DX5 A;  4K2O A;  3FSS A;  2J0M A;  3VOQ A;  2YS1 A;  4WJ7 A;  3KRW A;  4Y94 A;  1DRO A;  3U8Z A;  3KRX A;  5FI0 A;  1OY2 A;  2YSZ A;  5FI1 A;  3ULB A;  1NI2 A;  3D8E A;  5C5B A;  1J19 A;  1ZVR A;  5C5B B;  2EMT A;  2G35 A;  2NMB A;  4WSF A;  3BJI A;  5DIF B;  1BWN A;  2ROZ B;  4IAP A;  2D4Q A;  2DYQ A;  5J3Q A;  5DHF B;  1V5M A;  1XOD A;  2YF0 A;  2YT0 A;  3WYF B;  1DYN A;  1X05 A;  2VRW B;  2GCL A;  2ELA A;  2P0H A;  2RGN B;  2UVM A;  3ODW A;  2UZS A;  2I1J A;  1MK7 B;  2CY5 A;  4ZRJ A;  2DHI A;  1U5D A;  1DDV A;  2I1K A;  1X1F A;  1GC7 A;  2DLW A;  5C79 A;  5C16 A;  3M1I B;  3X23 A;  3ZDT A;  5GOW B;  1QQG A;  2CY4 A;  4KHO A;  2H7E A;  1GG3 A;  3ZVR A;  4MK0 A;  4KHB B;  2GCJ A;  1WG7 A;  2D9V A;  5JHG A;  5KQ4 A;  3WA0 A;  2Y8G A;  1U5E A;  5J3T A;  3PSC A;  2DKQ A;  4EJN A;  5EFX A;  2W2X D;  3TW1 A;  1W1G A;  2OQB A;  4HAZ B;  1GC6 A;  2ZPY A;  3TFM A;  1I7A A;  1K5D B;  3NSU A;  1H10 A;  1PFJ A;  2GS0 A;  4HAW B;  1WJ1 A;  3FM8 C;  1DBH A;  1UEF A;  2H7D A;  5JP4 A;  2EJ8 A;  2M14 A;  3F0W A;  4TKN A;  4GMX B;  2J59 M;  4HB3 B;  3PG7 A;  1TQZ A;  4HB4 B;  2FJL A;  1U5F A;  3P6A A;  1DDW A;  4ZRK A;  2VKI A;  1RJ2 A;  2W2W A;  4PNK A;  2R0D A;  1X86 A;  3KY9 A;  1KZ7 A;  2CRF A;  3SO6 A;  3QIJ A;  1NU2 A;  1UNP A;  1U5G A;  1QC6 A;  3HW2 B;  3PZD A;  4KAX B;  1NTY A;  4GMV A;  1DDM A;  2LOZ A;  2YT1 A;  3P7Z A;  3U7D A;  3PEG A;  2D9Z A;  5HE0 A;  1FOE A;  2X18 A;  1WJM A;  2COD A;  4CYE A;  4EKU A;  3AU4 A;  4GXB A;  4HHV A;  1M7R A;  2P8V A;  3SYX A;  2JP2 A;  1MK9 B;  3MDB C;  2RUK B;  3KSY A;  2J0K A;  1WI1 A;  4D0N B;  1XR0 B;  1OMW A;  1V89 A;  3SV1 A;  2L1C A;  4K2P A;  3N7C A;  2MDX A;  1WGU A;  3FEH A;  5KQ1 A;  2RSG A;  1Y5O A;  3O96 A;  1UPR A;  1IRS A;  4YL8 A;  3ODO A;  1EAZ A;  1Q67 A;  1AQC A;  4NSW A;  2DTC A;  1ZC4 B;  1WGQ A;  2YS5 A;  1PLS A;  2GJY A;  1P3R A;  5JHH A;  3F5R A;  2N23 A;  1XX0 A;  1W1H A;  5C6R A;  3PP2 A;  2Z0O A;  1ZSQ A;  2ROV A;  4HAV B;  4HB0 B;  5HE1 A;  4EMO A;  1BTN A;  1H4R A;  3ULC A;  1FHO A;  3PVW A;  3DXC A;  2YVC A;  4DX9 0;  4A6K A;  1M7E A;  4F7H A;  1UNQ A;  4ZRI A;  3CIK A;  4P7I A;  3OAN A;  4K17 A;  1NTV A;  3QWM A;  2ELB A;  2UZR A;  5DH9 B;  2RLO A;  3GYP A;  4IOY X;  2LYD A;  1KI1 B;  4DXA B;  1KZG A;  1V5U A;  1V5P A;  2COF A;  4F7U P;  3AU5 A;  2PZ1 A;  4A6F A;  1MPH A;  4YON A;  2LG1 A;  5DHA B;  2D9X A;  2DHK A;  3TO1 A;  2XQN M;  3VIA A;  1FAO A;  5HE3 A;  2V76 A;  4L6E A;  2D10 A;  2HTH B;  4F7G A;  3G9W A;  3RCP A;  2QKM A;  1FGZ A;  2D11 A;  4HDO A;  2LUL A;  2Y7B A;  1TJ6 A;  2IYB A;  1P5T A;  3KZ1 A;  3ML4 A;  3DXE A;  1P6S A;  2K2J A;  2KCJ A;  2Q13 A;  4HAX B;  2YS3 A;  2OTX A;  4NY0 A;  2KUP A;  2IFS A;  2HE7 A;  2COC A;  4GZU A;  3GYO A;  2D9Y A;  1ZM0 A;  1UNR A;  2Y8F A;  1MIZ B;  1B55 A;  2KGX B;  2N0Y A;  4CHJ A;  4WVF B;  5J3Y A;  4Z2M B;  1EVH A;  1SGH A;  4B6H A;  2VSZ A;  3AJ4 A;  5D27 A;  5L81 A;  2RVB B;  5D3Y A;  2EC1 A;  1X1G A;  2P0F A;  5D3V A;  4HAY B;  1I2H A;  1SHC A;  5HE2 A;  2MWN B;  3LJU X;  2MKR A;  2L2I A;  3DXD A;  2LOX A;  3SNH A;  4HAU B;  1EF1 A;  1MIX A;  4H8S A; 
#chains in the Genus database with same CATH topology
 1E5W A;  1ZC3 B;  1FHX A;  3SUZ A;  1U29 A;  2BCJ A;  1LW3 A;  3HQC A;  2DFK A;  3HK0 A;  2R09 A;  4DBB A;  1MAI A;  1RRP B;  4GN1 A;  3BIN A;  3TVV A;  3QBV B;  4KHA A;  4K81 A;  3TCA A;  4CHM A;  1TXD A;  5LON B;  2Z0P A;  2K00 A;  1UPQ A;  3MPX A;  4A6F B;  2K2U A;  1XCG A;  2Z59 A;  2KR0 A;  2W2X C;  5CLL B;  2MFQ A;  1V61 A;  1W1D A;  2I5F A;  2YT2 A;  3V5W A;  2I5C A;  3A8Q A;  3A8P A;  4QJ4 B;  2DA0 A;  2YRY A;  5IRS A;  3CXB B;  3D8F A;  4GPT B;  3T06 A;  2ADZ A;  5D3W A;  1Y19 B;  3PVU A;  1FGY A;  2LKO A;  4IFS A;  2E2X A;  3IVF A;  1LB1 A;  1ISN A;  1Z87 A;  4A6H A;  2J0J A;  3ODX A;  1BAK A;  4BBK A;  2NZ8 B;  2D2Q A;  4HSI A;  5JLJ B;  1AWE A;  4DX8 A;  3HSA A;  4PQ0 A;  2RNR B;  4XWX A;  2KIE A;  5I2S A;  1OQN A;  2DX1 A;  2AEH A;  2COA A;  1U2B A;  4TYZ A;  4MT7 A;  1PMS A;  2DN6 A;  4KVG B;  2P0D A;  4C0A A;  1V88 A;  1XKE A;  3HIE A;  2ZKM X;  1WVH A;  2Z0Q A;  1MKE A;  1BTK A;  1FB8 A;  1FHW A;  2DHJ A;  2KUQ A;  4HDQ A;  1U27 A;  1X11 A;  3UZT A;  1XD4 A;  3D8D A;  4HAT B;  5DI9 B;  3NWF A;  4MY6 A;  5LOP B;  1J0W A;  2M38 A;  4Z2N A;  4A5K A;  3A98 B;  2QKL A;  2DYN A;  4HB2 B;  3PVL A;  2AL6 A;  1K5G B;  5CLQ B;  5D3X A;  1N3H A;  2EMS A;  5KCV A;  2CAY A;  1EGX A;  2D9W A;  2DKP A;  2DX5 A;  4K2O A;  3FSS A;  2J0M A;  3VOQ A;  2YS1 A;  4WJ7 A;  3KRW A;  4Y94 A;  4OSN A;  1DRO A;  3U8Z A;  3KRX A;  5FI0 A;  1OY2 A;  2YSZ A;  5FI1 A;  3ULB A;  1NI2 A;  3D8E A;  5C5B A;  3NW8 A;  1J19 A;  1ZVR A;  3DCX A;  2EMT A;  5C5B B;  2G35 A;  2NMB A;  4WSF A;  3BJI A;  5DIF B;  1BWN A;  2ROZ B;  4IAP A;  2D4Q A;  2DYQ A;  5J3Q A;  5DHF B;  1V5M A;  1XOD A;  2YF0 A;  2YT0 A;  3WYF B;  5LG4 B;  1DYN A;  1X05 A;  2VRW B;  2GCL A;  2ELA A;  2P0H A;  2RGN B;  2UVM A;  3ODW A;  2UZS A;  2I1J A;  1MK7 B;  2CY5 A;  4ZRJ A;  2DHI A;  1U5D A;  1DDV A;  2I1K A;  1X1F A;  1GC7 A;  2DLW A;  5C79 A;  5C16 A;  1MI1 A;  4GNK B;  3M1I B;  3X23 A;  3ZDT A;  5GOW B;  1T77 A;  1QQG A;  2CY4 A;  4KHO A;  2H7E A;  1GG3 A;  3ZVR A;  4MK0 A;  4KHB B;  2GCJ A;  1WG7 A;  2D9V A;  5JHG A;  1ZYI A;  5KQ4 A;  3WA0 A;  2Y8G A;  1U5E A;  5J3T A;  3PSC A;  2DKQ A;  3U12 A;  4EJN A;  5EFX A;  2W2X D;  3TW1 A;  4D6W A;  1W1G A;  2OQB A;  4HAZ B;  1GC6 A;  2ZPY A;  3NWD A;  3TFM A;  1I7A A;  1K5D B;  3NSU A;  1H10 A;  1PFJ A;  2GS0 A;  4HAW B;  1WJ1 A;  3FM8 C;  1DBH A;  1UEF A;  2H7D A;  3FVC A;  5JP4 A;  2EJ8 A;  2M14 A;  3F0W A;  4TKN A;  4CSQ A;  4GMX B;  2J59 M;  4HB3 B;  3PG7 A;  1TQZ A;  4HB4 B;  2FJL A;  1U5F A;  3P6A A;  1DDW A;  4ZRK A;  2VKI A;  1RJ2 A;  2W2W A;  4PNK A;  2R0D A;  5M4Y B;  1X86 A;  3KY9 A;  3OHM B;  3NWA A;  1KZ7 A;  2Z4D A;  2CRF A;  3SO6 A;  3QIJ A;  1NU2 A;  1UNP A;  1U5G A;  1QC6 A;  3HW2 B;  3PZD A;  4KAX B;  1NTY A;  4GMV A;  1DDM A;  2R2Y A;  2GUM A;  2LOZ A;  2YT1 A;  3P7Z A;  3U7D A;  3PEG A;  2D9Z A;  5HE0 A;  1FOE A;  2X18 A;  1WJM A;  2COD A;  4CYE A;  4EKU A;  4QXA B;  3AU4 A;  4GXB A;  3A58 A;  4HHV A;  1M7R A;  2P8V A;  3SYX A;  2JP2 A;  1MK9 B;  3MDB C;  2FJU B;  2RUK B;  3KSY A;  2J0K A;  1WI1 A;  4D0N B;  1XR0 B;  4OT1 A;  1OMW A;  1V89 A;  4GOU A;  3SV1 A;  2L1C A;  4K2P A;  3N7C A;  2MDX A;  1WGU A;  3FEH A;  5KQ1 A;  2RSG A;  1Y5O A;  3O96 A;  4DIX A;  1UPR A;  1IRS A;  4YL8 A;  2Z14 A;  3ODO A;  1EAZ A;  1Q67 A;  1AQC A;  4NSW A;  2DTC A;  1ZC4 B;  1WGQ A;  2YS5 A;  2Z13 A;  1PLS A;  2GJY A;  1P3R A;  5JHH A;  3F5R A;  2N23 A;  5I2M A;  1XX0 A;  1W1H A;  5C6R A;  3PP2 A;  2Z0O A;  1ZSQ A;  2ROV A;  4HAV B;  4HB0 B;  5HE1 A;  4EMO A;  2KIG A;  1BTN A;  1H4R A;  3ULC A;  1FHO A;  3PVW A;  3DXC A;  2YVC A;  4DX9 0;  4A6K A;  2RRF A;  1M7E A;  4F7H A;  1UNQ A;  4ZRI A;  3CIK A;  4P7I A;  3OAN A;  4K17 A;  1NTV A;  3QWM A;  2ELB A;  2UZR A;  5DH9 B;  2RLO A;  3GYP A;  4IOY X;  2LYD A;  1KI1 B;  4DXA B;  1KZG A;  1V5U A;  1V5P A;  4KHB A;  2COF A;  2K8E A;  4F7U P;  3AU5 A;  2PZ1 A;  4A6F A;  1MPH A;  4YON A;  2LG1 A;  5DHA B;  2D9X A;  2DHK A;  2K49 A;  3TO1 A;  2XQN M;  3VIA A;  2NBV A;  1FAO A;  5HE3 A;  2V76 A;  4L6E A;  2D10 A;  2HTH B;  4F7G A;  3G9W A;  3RCP A;  2QKM A;  1FGZ A;  2D11 A;  4HDO A;  2LUL A;  2Y7B A;  1TJ6 A;  2IYB A;  1P5T A;  3KZ1 A;  3ML4 A;  3DXE A;  1P6S A;  2K2J A;  2KCJ A;  2Q13 A;  4HAX B;  2YS3 A;  2OTX A;  4NY0 A;  2KUP A;  2IFS A;  2HE7 A;  2COC A;  4GZU A;  3GYO A;  2D9Y A;  1ZM0 A;  1UNR A;  4L1R A;  4QJ3 B;  2Y8F A;  1MIZ B;  1B55 A;  2KGX B;  2N0Y A;  4CHJ A;  4QJ5 B;  4WVF B;  5J3Y A;  4Z2M B;  1EVH A;  1SGH A;  4B6H A;  2VSZ A;  3AJ4 A;  5D27 A;  5L81 A;  2RVB B;  5D3Y A;  2EC1 A;  1X1G A;  2P0F A;  5D3V A;  4HAY B;  1I2H A;  1SHC A;  3B77 A;  5HE2 A;  2MWN B;  3LJU X;  2MKR A;  2L2I A;  3DXD A;  2LOX A;  3SNH A;  4HAU B;  1EF1 A;  1MIX A;  4H8S A; 
#chains in the Genus database with same CATH homology
 1E5W A;  1ZC3 B;  1FHX A;  3SUZ A;  1U29 A;  2BCJ A;  1LW3 A;  3HQC A;  2DFK A;  3HK0 A;  2R09 A;  4DBB A;  1MAI A;  1RRP B;  4GN1 A;  3BIN A;  3TVV A;  3QBV B;  4KHA A;  4K81 A;  3TCA A;  4CHM A;  1TXD A;  5LON B;  2Z0P A;  2K00 A;  1UPQ A;  3MPX A;  4A6F B;  2K2U A;  1XCG A;  2W2X C;  5CLL B;  2MFQ A;  1V61 A;  1W1D A;  2I5F A;  3V5W A;  2I5C A;  3A8Q A;  3A8P A;  2DA0 A;  2YRY A;  3CXB B;  3D8F A;  4GPT B;  3T06 A;  2ADZ A;  5D3W A;  1Y19 B;  3PVU A;  1FGY A;  2LKO A;  4IFS A;  2E2X A;  3IVF A;  1LB1 A;  1ISN A;  1Z87 A;  4A6H A;  2J0J A;  3ODX A;  1BAK A;  4BBK A;  2NZ8 B;  2D2Q A;  5JLJ B;  1AWE A;  4DX8 A;  4PQ0 A;  2RNR B;  4XWX A;  1OQN A;  2DX1 A;  2AEH A;  2COA A;  1U2B A;  4TYZ A;  4MT7 A;  1PMS A;  2DN6 A;  4KVG B;  2P0D A;  4C0A A;  1V88 A;  1XKE A;  1WVH A;  2Z0Q A;  1MKE A;  1BTK A;  1FB8 A;  1FHW A;  2DHJ A;  4HDQ A;  1U27 A;  1X11 A;  3UZT A;  1XD4 A;  3D8D A;  4HAT B;  5DI9 B;  4MY6 A;  5LOP B;  1J0W A;  2M38 A;  4Z2N A;  4A5K A;  3A98 B;  2QKL A;  2DYN A;  4HB2 B;  3PVL A;  2AL6 A;  1K5G B;  5CLQ B;  5D3X A;  1N3H A;  2EMS A;  5KCV A;  2CAY A;  1EGX A;  2D9W A;  2DKP A;  2DX5 A;  4K2O A;  3FSS A;  2J0M A;  3VOQ A;  2YS1 A;  4WJ7 A;  3KRW A;  4Y94 A;  1DRO A;  3U8Z A;  3KRX A;  5FI0 A;  1OY2 A;  2YSZ A;  5FI1 A;  3ULB A;  1NI2 A;  3D8E A;  5C5B A;  1J19 A;  1ZVR A;  5C5B B;  2EMT A;  2G35 A;  2NMB A;  4WSF A;  3BJI A;  5DIF B;  1BWN A;  2ROZ B;  4IAP A;  2D4Q A;  2DYQ A;  5J3Q A;  5DHF B;  1V5M A;  1XOD A;  2YF0 A;  2YT0 A;  3WYF B;  1DYN A;  1X05 A;  2VRW B;  2GCL A;  2ELA A;  2P0H A;  2RGN B;  2UVM A;  3ODW A;  2UZS A;  2I1J A;  1MK7 B;  2CY5 A;  4ZRJ A;  2DHI A;  1U5D A;  1DDV A;  2I1K A;  1X1F A;  1GC7 A;  2DLW A;  5C79 A;  5C16 A;  3M1I B;  3X23 A;  3ZDT A;  5GOW B;  1QQG A;  2CY4 A;  4KHO A;  2H7E A;  1GG3 A;  3ZVR A;  4MK0 A;  4KHB B;  2GCJ A;  1WG7 A;  2D9V A;  5JHG A;  5KQ4 A;  3WA0 A;  2Y8G A;  1U5E A;  5J3T A;  3PSC A;  2DKQ A;  4EJN A;  5EFX A;  2W2X D;  3TW1 A;  1W1G A;  2OQB A;  4HAZ B;  1GC6 A;  2ZPY A;  3TFM A;  1I7A A;  1K5D B;  3NSU A;  1H10 A;  1PFJ A;  2GS0 A;  4HAW B;  1WJ1 A;  3FM8 C;  1DBH A;  1UEF A;  2H7D A;  5JP4 A;  2EJ8 A;  2M14 A;  3F0W A;  4TKN A;  4GMX B;  2J59 M;  4HB3 B;  3PG7 A;  1TQZ A;  4HB4 B;  2FJL A;  1U5F A;  3P6A A;  1DDW A;  4ZRK A;  2VKI A;  1RJ2 A;  2W2W A;  4PNK A;  2R0D A;  1X86 A;  3KY9 A;  1KZ7 A;  2CRF A;  3SO6 A;  3QIJ A;  1NU2 A;  1UNP A;  1U5G A;  1QC6 A;  3HW2 B;  3PZD A;  4KAX B;  1NTY A;  4GMV A;  1DDM A;  2LOZ A;  2YT1 A;  3P7Z A;  3U7D A;  3PEG A;  2D9Z A;  5HE0 A;  1FOE A;  2X18 A;  1WJM A;  2COD A;  4CYE A;  4EKU A;  3AU4 A;  4GXB A;  4HHV A;  1M7R A;  2P8V A;  3SYX A;  2JP2 A;  1MK9 B;  3MDB C;  2RUK B;  3KSY A;  2J0K A;  1WI1 A;  4D0N B;  1XR0 B;  1OMW A;  1V89 A;  3SV1 A;  2L1C A;  4K2P A;  3N7C A;  2MDX A;  1WGU A;  3FEH A;  5KQ1 A;  2RSG A;  1Y5O A;  3O96 A;  1UPR A;  1IRS A;  4YL8 A;  3ODO A;  1EAZ A;  1Q67 A;  1AQC A;  4NSW A;  2DTC A;  1ZC4 B;  1WGQ A;  2YS5 A;  1PLS A;  2GJY A;  1P3R A;  5JHH A;  3F5R A;  2N23 A;  1XX0 A;  1W1H A;  5C6R A;  3PP2 A;  2Z0O A;  1ZSQ A;  2ROV A;  4HAV B;  4HB0 B;  5HE1 A;  4EMO A;  1BTN A;  1H4R A;  3ULC A;  1FHO A;  3PVW A;  3DXC A;  2YVC A;  4DX9 0;  4A6K A;  1M7E A;  4F7H A;  1UNQ A;  4ZRI A;  3CIK A;  4P7I A;  3OAN A;  4K17 A;  1NTV A;  3QWM A;  2ELB A;  2UZR A;  5DH9 B;  2RLO A;  3GYP A;  4IOY X;  2LYD A;  1KI1 B;  4DXA B;  1KZG A;  1V5U A;  1V5P A;  2COF A;  4F7U P;  3AU5 A;  2PZ1 A;  4A6F A;  1MPH A;  4YON A;  2LG1 A;  5DHA B;  2D9X A;  2DHK A;  3TO1 A;  2XQN M;  3VIA A;  1FAO A;  5HE3 A;  2V76 A;  4L6E A;  2D10 A;  2HTH B;  4F7G A;  3G9W A;  3RCP A;  2QKM A;  1FGZ A;  2D11 A;  4HDO A;  2LUL A;  2Y7B A;  1TJ6 A;  2IYB A;  1P5T A;  3KZ1 A;  3ML4 A;  3DXE A;  1P6S A;  2K2J A;  2KCJ A;  2Q13 A;  4HAX B;  2YS3 A;  2OTX A;  4NY0 A;  2KUP A;  2IFS A;  2HE7 A;  2COC A;  4GZU A;  3GYO A;  2D9Y A;  1ZM0 A;  1UNR A;  2Y8F A;  1MIZ B;  1B55 A;  2KGX B;  2N0Y A;  4CHJ A;  4WVF B;  5J3Y A;  4Z2M B;  1EVH A;  1SGH A;  4B6H A;  2VSZ A;  3AJ4 A;  5D27 A;  5L81 A;  2RVB B;  5D3Y A;  2EC1 A;  1X1G A;  2P0F A;  5D3V A;  4HAY B;  1I2H A;  1SHC A;  5HE2 A;  2MWN B;  3LJU X;  2MKR A;  2L2I A;  3DXD A;  2LOX A;  3SNH A;  4HAU B;  1EF1 A;  1MIX A;  4H8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...