1BTNA

Structure of the binding site for inositol phosphates in a ph domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
b'MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-SPECTRIN
molecule tags Signal transduction protein
source organism Mus musculus
publication title Structure of the binding site for inositol phosphates in a PH domain.
pubmed rcsb
total genus 26
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1995-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1btnA00
3F0WA 2EMTA 1BTNA 2KUPA 4KVGB 3A98B 4EMOA 2IYBA 2DX5A 5KCVA 4IAPA 1EGXA 4A6KA 3FSSA 2DKQA 3DXDA 4EKUA 2V76A 3PVWA 4KHOA 5HE3A 3KSYA 4CHMA 2L1CA 3PP2A 5C6RA 2MFQA 2IFSA 3ULCA 1EVHA 1MPHA 2LYDA 1V5UA 3QIJA 4Z2MB 3O96A 5KQ4A 4MK0A 5JHHA 2AL6A 1FOEA 1P5TA 2P0DA 4HAVB 1MKEA 1W1HA 2RNRB 2Z0PA 1FHOA 1XX0A 1V5MA 2ELBA 1MIZB 2Y8GA 5DHAB 1DYNA 3WYFB 2CY5A 1K5DB 1X11A 3SV1A 5L81A 2X18A 1X1GA 5FI0A 1MK7B 2DFKA 2G35A 2RUKB 3TW1A 5HE0A 2I1JA 3GYPA 3SYXA 3PSCA 4TYZA 3SNHA 1WJ1A 2P8VA 3FEHA 4MT7A 4HAWB 4Z2NA 3DXCA 2RSGA 4HDQA 1V5PA 4MY6A 2LOZA 1FHWA 1BTKA 1KZGA 2DHIA 2D9WA 1U5DA 1E5WA 2YS3A 3AJ4A 4ZRKA 1IRSA 1N3HA 5HE2A 5CLLB 1DBHA 2NZ8B 2YT1A 3F5RA 5DI9B 2KGXB 2DN6A 2J0JA 1UNRA 1AWEA 2CAYA 2H7EA 2H7DA 4DX90 4GZUA 4A5KA 1Y19B 4PQ0A 2DX1A 4F7GA 3PG7A 2K2UA 2YS5A 2I5FA 4WJ7A 4L6EA 2LKOA 4YONA 5FI1A 1WGQA 2CY4A 2FJLA 5JP4A 2YT0A 2I5CA 3KY9A 1Y5OA 4NSWA 4HATB 1SHCA 2YS1A 3PVLA 4A6FA 3UZTA 2MDXA 5CLQB 1P6SA 1NTVA 1XKEA 2NMBA 2R0DA 1U29A 3FM8C 4WSFA 1ISNA 5LONB 3OANA 2W2XD 3BINA 4ZRIA 4ZRJA 1GC6A 1BWNA 4K17A 2GS0A 1MIXA 5J3YA 2D11A 2QKMA 4YL8A 1ZSQA 1M7RA 4HAYB 3QBVB 4HB3B 5DHFB 3SO6A 1I7AA 2K2JA 1FAOA 1QC6A 4GPTB 1OY2A 3CXBB 4GMVA 5J3TA 1U27A 1OMWA 4NY0A 2D4QA 1LW3A 2YVCA 2ROVA 3NSUA 5D3XA 1Q67A 2OTXA 1I2HA 4HB2B 4DXAB 5DH9B 4CYEA 1RJ2A 1XD4A 4F7UP 3ML4A 3U8ZA 2ZPYA 1J0WA 1UEFA 1ZC3B 4GXBA 4K2OA 2VSZA 3HK0A 4DBBA 1PFJA 1UPRA 1TQZA 2EJ8A 1X86A 2P0HA 5GOWB 1WGUA 2D10A 2W2XC 4K2PA 5JHGA 1ZVRA 3TCAA 2AEHA 3HW2B 1NU2A 3KZ1A 2RVBB 3LJUX 3IVFA 2RGNB 2DKPA 2BCJA 2Y7BA 2JP2A 2PZ1A 1FB8A 4Y94A 5HE1A 5C5BB 1TJ6A 4GN1A 1FGZA 2VRWB 3D8EA 4F7HA 3MPXA 2GJYA 1Z87A 1UPQA 3QWMA 1GC7A 3KRXA 4D0NB 3X23A 1ZM0A 4BBKA 1K5GB 1KZ7A 2Z0OA 2CRFA 2Q13A 3P6AA 3U7DA 1FGYA 2UZSA 3KRWA 2ELAA 3PZDA 3VOQA 3T06A 3AU5A 3D8DA 1X05A 4B6HA 2DHKA 2D9XA 2M38A 2LOXA 2D2QA 4DX8A 2XQNM 5J3QA 2LG1A 1W1GA 3P7ZA 1B55A 3BJIA 4EJNA 4HAZB 1SGHA 2Y8FA 2COFA 4IFSA 2N23A 1WG7A 2M14A 1PLSA 4KHAA 5DIFB 2DA0A 2K00A 3PVUA 4K81A 5C79A 4HB4B 1U5GA 2DYNA 1V61A 1U5EA 3ZVRA 3CIKA 1U5FA 1BAKA 1EF1A 4KHBB 2YSZA 1DDWA 3DXEA 1QQGA 2J0KA 2D9VA 2YF0A 1DROA 1AQCA 2COCA 1DDMA 3D8FA 5EFXA 1H10A 1EAZA 4H8SA 4HB0B 2EMSA 2DYQA 2N0YA 2COAA 1MK9B 5JLJB 2R09A 3TVVA 3ODOA 1GG3A 2MWNB 3ODWA 2ROZB 1M7EA 4WVFB 2D9ZA 5LOPB 1WI1A 1MAIA 3A8QA 1DDVA 4HAUB 4XWXA 2Z0QA 3ZDTA 1P3RA 1X1FA 3RCPA 2DLWA 3AU4A 1PMSA 3SUZA 2RLOA 4P7IA 3V5WA 4A6HA 1XR0B 2HTHB 4GMXB 2J59M 1WVHA 5D3YA 1H4RA 3MDBC 1XCGA 2CODA 1J19A 1XODA 4HAXB 5C5BA 2J0MA 1RRPB 2UZRA 4A6FB 1NI2A 2HE7A 4CHJA 2KCJA 2GCLA 5D3WA 3ULBA 3WA0A 1TXDA 3HQCA 1V89A 3GYOA 4HDOA 2I1KA 1NTYA 3A8PA 2MKRA 1UNQA 1LB1A 2L2IA 2LULA 2ADZA 5D27A 3G9WA 2DHJA 1KI1B 1V88A 4IOYX 3M1IB 4HHVA 2E2XA 2D9YA 1OQNA 5D3VA 3TFMA 3TO1A 2EC1A 3N7CA 2W2WA 2UVMA 2GCJA 1U2BA 1WJMA 4TKNA 4KAXB 2QKLA 1UNPA 1FHXA 5C16A 3PEGA 2OQBA 2YRYA 4PNKA 2DTCA 1ZC4B 2VKIA 1W1DA 3ODXA 5KQ1A 4C0AA 2P0FA 3VIAA
chains in the Genus database with same CATH superfamily
3F0WA 2EMTA 1BTNA 2KUPA 4KVGB 3A98B 4EMOA 2IYBA 2DX5A 5KCVA 4IAPA 4KHBA 1EGXA 4A6KA 3FSSA 2DKQA 3DXDA 4EKUA 2V76A 3PVWA 4KHOA 5HE3A 3KSYA 4CHMA 2L1CA 3PP2A 5C6RA 2MFQA 2IFSA 3ULCA 1EVHA 1MPHA 2LYDA 1V5UA 3QIJA 4Z2MB 3O96A 5KQ4A 4MK0A 4D6WA 5JHHA 2AL6A 1FOEA 1ZYIA 1P5TA 2P0DA 4HAVB 1MKEA 1W1HA 2RNRB 2Z0PA 1FHOA 1XX0A 1V5MA 2ELBA 1MIZB 2Y8GA 4OSNA 5DHAB 1DYNA 3WYFB 2CY5A 1K5DB 1X11A 3SV1A 5L81A 2X18A 1X1GA 5FI0A 1MK7B 2KR0A 2DFKA 2G35A 2RUKB 3TW1A 5HE0A 2I1JA 3GYPA 3SYXA 3PSCA 4TYZA 3SNHA 1WJ1A 2P8VA 3FEHA 4MT7A 4HAWB 4Z2NA 3DXCA 5I2SA 2RSGA 4HDQA 1V5PA 4MY6A 3B77A 2LOZA 1FHWA 1BTKA 1KZGA 2DHIA 2D9WA 1U5DA 1E5WA 2YS3A 3AJ4A 4ZRKA 4HSIA 1IRSA 1N3HA 4QJ3B 4QXAB 5HE2A 5CLLB 1DBHA 2NZ8B 2YT1A 3F5RA 5DI9B 2KGXB 2DN6A 2J0JA 1UNRA 1AWEA 2CAYA 2H7EA 2H7DA 4DX90 4GZUA 4A5KA 2RRFA 1Y19B 4PQ0A 2DX1A 4F7GA 3PG7A 2K2UA 2YS5A 4GNKB 2I5FA 4WJ7A 4L6EA 2LKOA 4YONA 5FI1A 1WGQA 2CY4A 2GUMA 2FJLA 5JP4A 2YT0A 2I5CA 3KY9A 1Y5OA 2KUQA 4NSWA 4HATB 1SHCA 2YS1A 3PVLA 4A6FA 3UZTA 2MDXA 5CLQB 1P6SA 1NTVA 1XKEA 2NMBA 2R0DA 1U29A 3FM8C 4DIXA 5LG4B 2NBVA 4WSFA 1ISNA 2Z4DA 5LONB 3A58A 2Z59A 3OANA 2W2XD 3BINA 4ZRIA 3NWFA 4ZRJA 2Z13A 1GC6A 1BWNA 4K17A 2GS0A 1MIXA 5J3YA 2D11A 2QKMA 4YL8A 1ZSQA 2YT2A 1M7RA 4HAYB 3QBVB 4HB3B 4OT1A 5DHFB 3SO6A 1I7AA 2K2JA 1FAOA 1QC6A 4GPTB 1OY2A 3CXBB 4GOUA 4GMVA 5J3TA 1U27A 1OMWA 4NY0A 2D4QA 1LW3A 2YVCA 2ROVA 2ZKMX 3NSUA 5D3XA 1Q67A 2OTXA 1I2HA 4HB2B 4DXAB 5DH9B 4CYEA 1RJ2A 3FVCA 1XD4A 4F7UP 3ML4A 3U8ZA 2ZPYA 1J0WA 1UEFA 1ZC3B 4GXBA 4K2OA 2VSZA 3HK0A 4DBBA 1PFJA 1UPRA 3NWDA 1TQZA 2EJ8A 1X86A 2P0HA 5GOWB 1WGUA 2D10A 2W2XC 4K2PA 5JHGA 1ZVRA 3TCAA 2AEHA 3HW2B 1NU2A 1T77A 3KZ1A 2RVBB 3LJUX 3IVFA 2RGNB 3DCXA 2DKPA 2BCJA 2Y7BA 2JP2A 2PZ1A 1FB8A 4Y94A 5HE1A 5C5BB 1TJ6A 1MI1A 4GN1A 1FGZA 2VRWB 3D8EA 4F7HA 3MPXA 2GJYA 1Z87A 1UPQA 3QWMA 1GC7A 3OHMB 3KRXA 4QJ4B 4D0NB 2K8EA 3X23A 1ZM0A 4BBKA 1K5GB 1KZ7A 2Z0OA 2CRFA 2Q13A 3P6AA 3U7DA 1FGYA 2UZSA 3KRWA 2ELAA 3PZDA 3VOQA 3T06A 3AU5A 3D8DA 1X05A 4B6HA 2DHKA 2D9XA 2M38A 2LOXA 2D2QA 4DX8A 2XQNM 5J3QA 2LG1A 4L1RA 1W1GA 3P7ZA 1B55A 3HIEA 3BJIA 4EJNA 4HAZB 1SGHA 2Y8FA 2COFA 4IFSA 2KIEA 2N23A 1WG7A 2M14A 1PLSA 4KHAA 5DIFB 2DA0A 2K00A 3PVUA 4K81A 5C79A 2K49A 4HB4B 1U5GA 2DYNA 1V61A 1U5EA 3ZVRA 3CIKA 1U5FA 1BAKA 1EF1A 4KHBB 2YSZA 1DDWA 3DXEA 1QQGA 2J0KA 2D9VA 2YF0A 1DROA 1AQCA 4QJ5B 3U12A 2COCA 1DDMA 3D8FA 5EFXA 2R2YA 1H10A 2FJUB 1EAZA 4H8SA 4HB0B 2EMSA 2DYQA 2N0YA 2COAA 1MK9B 5M4YB 5JLJB 2R09A 3TVVA 3HSAA 3ODOA 1GG3A 2MWNB 3ODWA 2ROZB 5IRSA 1M7EA 4WVFB 2D9ZA 5LOPB 1WI1A 1MAIA 3A8QA 1DDVA 4HAUB 4XWXA 2Z0QA 3ZDTA 1P3RA 1X1FA 5I2MA 3RCPA 2DLWA 3AU4A 1PMSA 3SUZA 2RLOA 4P7IA 3V5WA 4A6HA 1XR0B 2KIGA 2Z14A 2HTHB 4GMXB 2J59M 1WVHA 5D3YA 1H4RA 3MDBC 1XCGA 2CODA 1J19A 1XODA 4HAXB 3NWAA 5C5BA 2J0MA 1RRPB 2UZRA 4A6FB 1NI2A 2HE7A 4CHJA 2KCJA 2GCLA 5D3WA 3NW8A 3ULBA 3WA0A 1TXDA 3HQCA 1V89A 3GYOA 4HDOA 2I1KA 1NTYA 3A8PA 2MKRA 4CSQA 1UNQA 1LB1A 2L2IA 2LULA 2ADZA 5D27A 3G9WA 2DHJA 1KI1B 1V88A 3M1IB 4IOYX 4HHVA 2E2XA 2D9YA 1OQNA 5D3VA 3TFMA 3TO1A 2EC1A 3N7CA 2W2WA 2UVMA 2GCJA 1U2BA 1WJMA 4TKNA 4KAXB 2QKLA 1UNPA 1FHXA 5C16A 3PEGA 2OQBA 2YRYA 4PNKA 2DTCA 1ZC4B 2VKIA 1W1DA 3ODXA 5KQ1A 4C0AA 2P0FA 3VIAA
chains in the Genus database with same CATH topology
3F0WA 2EMTA 1BTNA 2KUPA 4KVGB 3A98B 4EMOA 2IYBA 2DX5A 5KCVA 4IAPA 1EGXA 4A6KA 3FSSA 2DKQA 3DXDA 4EKUA 2V76A 3PVWA 4KHOA 5HE3A 3KSYA 4CHMA 2L1CA 3PP2A 5C6RA 2MFQA 2IFSA 3ULCA 1EVHA 1MPHA 2LYDA 1V5UA 3QIJA 4Z2MB 3O96A 5KQ4A 4MK0A 5JHHA 2AL6A 1FOEA 1P5TA 2P0DA 4HAVB 1MKEA 1W1HA 2RNRB 2Z0PA 1FHOA 1XX0A 1V5MA 2ELBA 1MIZB 2Y8GA 5DHAB 1DYNA 3WYFB 2CY5A 1K5DB 1X11A 3SV1A 5L81A 2X18A 1X1GA 5FI0A 1MK7B 2DFKA 2G35A 2RUKB 3TW1A 5HE0A 2I1JA 3GYPA 3SYXA 3PSCA 4TYZA 3SNHA 1WJ1A 2P8VA 3FEHA 4MT7A 4HAWB 4Z2NA 3DXCA 2RSGA 4HDQA 1V5PA 4MY6A 2LOZA 1FHWA 1BTKA 1KZGA 2DHIA 2D9WA 1U5DA 1E5WA 2YS3A 3AJ4A 4ZRKA 1IRSA 1N3HA 5HE2A 5CLLB 1DBHA 2NZ8B 2YT1A 3F5RA 5DI9B 2KGXB 2DN6A 2J0JA 1UNRA 1AWEA 2CAYA 2H7EA 2H7DA 4DX90 4GZUA 4A5KA 1Y19B 4PQ0A 2DX1A 4F7GA 3PG7A 2K2UA 2YS5A 2I5FA 4WJ7A 4L6EA 2LKOA 4YONA 5FI1A 1WGQA 2CY4A 2FJLA 5JP4A 2YT0A 2I5CA 3KY9A 1Y5OA 4NSWA 4HATB 1SHCA 2YS1A 3PVLA 4A6FA 3UZTA 2MDXA 5CLQB 1P6SA 1NTVA 1XKEA 2NMBA 2R0DA 1U29A 3FM8C 4WSFA 1ISNA 5LONB 3OANA 2W2XD 3BINA 4ZRIA 4ZRJA 1GC6A 1BWNA 4K17A 2GS0A 1MIXA 5J3YA 2D11A 2QKMA 4YL8A 1ZSQA 1M7RA 4HAYB 3QBVB 4HB3B 5DHFB 3SO6A 1I7AA 2K2JA 1FAOA 1QC6A 4GPTB 1OY2A 3CXBB 4GMVA 5J3TA 1U27A 1OMWA 4NY0A 2D4QA 1LW3A 2YVCA 2ROVA 3NSUA 5D3XA 1Q67A 2OTXA 1I2HA 4HB2B 4DXAB 5DH9B 4CYEA 1RJ2A 1XD4A 4F7UP 3ML4A 3U8ZA 2ZPYA 1J0WA 1UEFA 1ZC3B 4GXBA 4K2OA 2VSZA 3HK0A 4DBBA 1PFJA 1UPRA 1TQZA 2EJ8A 1X86A 2P0HA 5GOWB 1WGUA 2D10A 2W2XC 4K2PA 5JHGA 1ZVRA 3TCAA 2AEHA 3HW2B 1NU2A 3KZ1A 2RVBB 3LJUX 3IVFA 2RGNB 2DKPA 2BCJA 2Y7BA 2JP2A 2PZ1A 1FB8A 4Y94A 5HE1A 5C5BB 1TJ6A 4GN1A 1FGZA 2VRWB 3D8EA 4F7HA 3MPXA 2GJYA 1Z87A 1UPQA 3QWMA 1GC7A 3KRXA 4D0NB 3X23A 1ZM0A 4BBKA 1K5GB 1KZ7A 2Z0OA 2CRFA 2Q13A 3P6AA 3U7DA 1FGYA 2UZSA 3KRWA 2ELAA 3PZDA 3VOQA 3T06A 3AU5A 3D8DA 1X05A 4B6HA 2DHKA 2D9XA 2M38A 2LOXA 2D2QA 4DX8A 2XQNM 5J3QA 2LG1A 1W1GA 3P7ZA 1B55A 3BJIA 4EJNA 4HAZB 1SGHA 2Y8FA 2COFA 4IFSA 2N23A 1WG7A 2M14A 1PLSA 4KHAA 5DIFB 2DA0A 2K00A 3PVUA 4K81A 5C79A 4HB4B 1U5GA 2DYNA 1V61A 1U5EA 3ZVRA 3CIKA 1U5FA 1BAKA 1EF1A 4KHBB 2YSZA 1DDWA 3DXEA 1QQGA 2J0KA 2D9VA 2YF0A 1DROA 1AQCA 2COCA 1DDMA 3D8FA 5EFXA 1H10A 1EAZA 4H8SA 4HB0B 2EMSA 2DYQA 2N0YA 2COAA 1MK9B 5JLJB 2R09A 3TVVA 3ODOA 1GG3A 2MWNB 3ODWA 2ROZB 1M7EA 4WVFB 2D9ZA 5LOPB 1WI1A 1MAIA 3A8QA 1DDVA 4HAUB 4XWXA 2Z0QA 3ZDTA 1P3RA 1X1FA 3RCPA 2DLWA 3AU4A 1PMSA 3SUZA 2RLOA 4P7IA 3V5WA 4A6HA 1XR0B 2HTHB 4GMXB 2J59M 1WVHA 5D3YA 1H4RA 3MDBC 1XCGA 2CODA 1J19A 1XODA 4HAXB 5C5BA 2J0MA 1RRPB 2UZRA 4A6FB 1NI2A 2HE7A 4CHJA 2KCJA 2GCLA 5D3WA 3ULBA 3WA0A 1TXDA 3HQCA 1V89A 3GYOA 4HDOA 2I1KA 1NTYA 3A8PA 2MKRA 1UNQA 1LB1A 2L2IA 2LULA 2ADZA 5D27A 3G9WA 2DHJA 1KI1B 1V88A 4IOYX 3M1IB 4HHVA 2E2XA 2D9YA 1OQNA 5D3VA 3TFMA 3TO1A 2EC1A 3N7CA 2W2WA 2UVMA 2GCJA 1U2BA 1WJMA 4TKNA 4KAXB 2QKLA 1UNPA 1FHXA 5C16A 3PEGA 2OQBA 2YRYA 4PNKA 2DTCA 1ZC4B 2VKIA 1W1DA 3ODXA 5KQ1A 4C0AA 2P0FA 3VIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0W A;  2EMT A;  1BTN A;  2KUP A;  4KVG B;  3A98 B;  4EMO A;  2IYB A;  2DX5 A;  5KCV A;  4IAP A;  1EGX A;  4A6K A;  3FSS A;  2DKQ A;  3DXD A;  4EKU A;  2V76 A;  3PVW A;  4KHO A;  5HE3 A;  3KSY A;  4CHM A;  2L1C A;  3PP2 A;  5C6R A;  2MFQ A;  2IFS A;  3ULC A;  1EVH A;  1MPH A;  2LYD A;  1V5U A;  3QIJ A;  4Z2M B;  3O96 A;  5KQ4 A;  4MK0 A;  5JHH A;  2AL6 A;  1FOE A;  1P5T A;  2P0D A;  4HAV B;  1MKE A;  1W1H A;  2RNR B;  2Z0P A;  1FHO A;  1XX0 A;  1V5M A;  2ELB A;  1MIZ B;  2Y8G A;  5DHA B;  1DYN A;  3WYF B;  2CY5 A;  1K5D B;  1X11 A;  3SV1 A;  5L81 A;  2X18 A;  1X1G A;  5FI0 A;  1MK7 B;  2DFK A;  2G35 A;  2RUK B;  3TW1 A;  5HE0 A;  2I1J A;  3GYP A;  3SYX A;  3PSC A;  4TYZ A;  3SNH A;  1WJ1 A;  2P8V A;  3FEH A;  4MT7 A;  4HAW B;  4Z2N A;  3DXC A;  2RSG A;  4HDQ A;  1V5P A;  4MY6 A;  2LOZ A;  1FHW A;  1BTK A;  1KZG A;  2DHI A;  2D9W A;  1U5D A;  1E5W A;  2YS3 A;  3AJ4 A;  4ZRK A;  1IRS A;  1N3H A;  5HE2 A;  5CLL B;  1DBH A;  2NZ8 B;  2YT1 A;  3F5R A;  5DI9 B;  2KGX B;  2DN6 A;  2J0J A;  1UNR A;  1AWE A;  2CAY A;  2H7E A;  2H7D A;  4DX9 0;  4GZU A;  4A5K A;  1Y19 B;  4PQ0 A;  2DX1 A;  4F7G A;  3PG7 A;  2K2U A;  2YS5 A;  2I5F A;  4WJ7 A;  4L6E A;  2LKO A;  4YON A;  5FI1 A;  1WGQ A;  2CY4 A;  2FJL A;  5JP4 A;  2YT0 A;  2I5C A;  3KY9 A;  1Y5O A;  4NSW A;  4HAT B;  1SHC A;  2YS1 A;  3PVL A;  4A6F A;  3UZT A;  2MDX A;  5CLQ B;  1P6S A;  1NTV A;  1XKE A;  2NMB A;  2R0D A;  1U29 A;  3FM8 C;  4WSF A;  1ISN A;  5LON B;  3OAN A;  2W2X D;  3BIN A;  4ZRI A;  4ZRJ A;  1GC6 A;  1BWN A;  4K17 A;  2GS0 A;  1MIX A;  5J3Y A;  2D11 A;  2QKM A;  4YL8 A;  1ZSQ A;  1M7R A;  4HAY B;  3QBV B;  4HB3 B;  5DHF B;  3SO6 A;  1I7A A;  2K2J A;  1FAO A;  1QC6 A;  4GPT B;  1OY2 A;  3CXB B;  4GMV A;  5J3T A;  1U27 A;  1OMW A;  4NY0 A;  2D4Q A;  1LW3 A;  2YVC A;  2ROV A;  3NSU A;  5D3X A;  1Q67 A;  2OTX A;  1I2H A;  4HB2 B;  4DXA B;  5DH9 B;  4CYE A;  1RJ2 A;  1XD4 A;  4F7U P;  3ML4 A;  3U8Z A;  2ZPY A;  1J0W A;  1UEF A;  1ZC3 B;  4GXB A;  4K2O A;  2VSZ A;  3HK0 A;  4DBB A;  1PFJ A;  1UPR A;  1TQZ A;  2EJ8 A;  1X86 A;  2P0H A;  5GOW B;  1WGU A;  2D10 A;  2W2X C;  4K2P A;  5JHG A;  1ZVR A;  3TCA A;  2AEH A;  3HW2 B;  1NU2 A;  3KZ1 A;  2RVB B;  3LJU X;  3IVF A;  2RGN B;  2DKP A;  2BCJ A;  2Y7B A;  2JP2 A;  2PZ1 A;  1FB8 A;  4Y94 A;  5HE1 A;  5C5B B;  1TJ6 A;  4GN1 A;  1FGZ A;  2VRW B;  3D8E A;  4F7H A;  3MPX A;  2GJY A;  1Z87 A;  1UPQ A;  3QWM A;  1GC7 A;  3KRX A;  4D0N B;  3X23 A;  1ZM0 A;  4BBK A;  1K5G B;  1KZ7 A;  2Z0O A;  2CRF A;  2Q13 A;  3P6A A;  3U7D A;  1FGY A;  2UZS A;  3KRW A;  2ELA A;  3PZD A;  3VOQ A;  3T06 A;  3AU5 A;  3D8D A;  1X05 A;  4B6H A;  2DHK A;  2D9X A;  2M38 A;  2LOX A;  2D2Q A;  4DX8 A;  2XQN M;  5J3Q A;  2LG1 A;  1W1G A;  3P7Z A;  1B55 A;  3BJI A;  4EJN A;  4HAZ B;  1SGH A;  2Y8F A;  2COF A;  4IFS A;  2N23 A;  1WG7 A;  2M14 A;  1PLS A;  4KHA A;  5DIF B;  2DA0 A;  2K00 A;  3PVU A;  4K81 A;  5C79 A;  4HB4 B;  1U5G A;  2DYN A;  1V61 A;  1U5E A;  3ZVR A;  3CIK A;  1U5F A;  1BAK A;  1EF1 A;  4KHB B;  2YSZ A;  1DDW A;  3DXE A;  1QQG A;  2J0K A;  2D9V A;  2YF0 A;  1DRO A;  1AQC A;  2COC A;  1DDM A;  3D8F A;  5EFX A;  1H10 A;  1EAZ A;  4H8S A;  4HB0 B;  2EMS A;  2DYQ A;  2N0Y A;  2COA A;  1MK9 B;  5JLJ B;  2R09 A;  3TVV A;  3ODO A;  1GG3 A;  2MWN B;  3ODW A;  2ROZ B;  1M7E A;  4WVF B;  2D9Z A;  5LOP B;  1WI1 A;  1MAI A;  3A8Q A;  1DDV A;  4HAU B;  4XWX A;  2Z0Q A;  3ZDT A;  1P3R A;  1X1F A;  3RCP A;  2DLW A;  3AU4 A;  1PMS A;  3SUZ A;  2RLO A;  4P7I A;  3V5W A;  4A6H A;  1XR0 B;  2HTH B;  4GMX B;  2J59 M;  1WVH A;  5D3Y A;  1H4R A;  3MDB C;  1XCG A;  2COD A;  1J19 A;  1XOD A;  4HAX B;  5C5B A;  2J0M A;  1RRP B;  2UZR A;  4A6F B;  1NI2 A;  2HE7 A;  4CHJ A;  2KCJ A;  2GCL A;  5D3W A;  3ULB A;  3WA0 A;  1TXD A;  3HQC A;  1V89 A;  3GYO A;  4HDO A;  2I1K A;  1NTY A;  3A8P A;  2MKR A;  1UNQ A;  1LB1 A;  2L2I A;  2LUL A;  2ADZ A;  5D27 A;  3G9W A;  2DHJ A;  1KI1 B;  1V88 A;  4IOY X;  3M1I B;  4HHV A;  2E2X A;  2D9Y A;  1OQN A;  5D3V A;  3TFM A;  3TO1 A;  2EC1 A;  3N7C A;  2W2W A;  2UVM A;  2GCJ A;  1U2B A;  1WJM A;  4TKN A;  4KAX B;  2QKL A;  1UNP A;  1FHX A;  5C16 A;  3PEG A;  2OQB A;  2YRY A;  4PNK A;  2DTC A;  1ZC4 B;  2VKI A;  1W1D A;  3ODX A;  5KQ1 A;  4C0A A;  2P0F A;  3VIA A; 
#chains in the Genus database with same CATH topology
 3F0W A;  2EMT A;  1BTN A;  2KUP A;  4KVG B;  3A98 B;  4EMO A;  2IYB A;  2DX5 A;  5KCV A;  4IAP A;  4KHB A;  1EGX A;  4A6K A;  3FSS A;  2DKQ A;  3DXD A;  4EKU A;  2V76 A;  3PVW A;  4KHO A;  5HE3 A;  3KSY A;  4CHM A;  2L1C A;  3PP2 A;  5C6R A;  2MFQ A;  2IFS A;  3ULC A;  1EVH A;  1MPH A;  2LYD A;  1V5U A;  3QIJ A;  4Z2M B;  3O96 A;  5KQ4 A;  4MK0 A;  4D6W A;  5JHH A;  2AL6 A;  1FOE A;  1ZYI A;  1P5T A;  2P0D A;  4HAV B;  1MKE A;  1W1H A;  2RNR B;  2Z0P A;  1FHO A;  1XX0 A;  1V5M A;  2ELB A;  1MIZ B;  2Y8G A;  4OSN A;  5DHA B;  1DYN A;  3WYF B;  2CY5 A;  1K5D B;  1X11 A;  3SV1 A;  5L81 A;  2X18 A;  1X1G A;  5FI0 A;  1MK7 B;  2KR0 A;  2DFK A;  2G35 A;  2RUK B;  3TW1 A;  5HE0 A;  2I1J A;  3GYP A;  3SYX A;  3PSC A;  4TYZ A;  3SNH A;  1WJ1 A;  2P8V A;  3FEH A;  4MT7 A;  4HAW B;  4Z2N A;  3DXC A;  5I2S A;  2RSG A;  4HDQ A;  1V5P A;  4MY6 A;  3B77 A;  2LOZ A;  1FHW A;  1BTK A;  1KZG A;  2DHI A;  2D9W A;  1U5D A;  1E5W A;  2YS3 A;  3AJ4 A;  4ZRK A;  4HSI A;  1IRS A;  1N3H A;  4QJ3 B;  4QXA B;  5HE2 A;  5CLL B;  1DBH A;  2NZ8 B;  2YT1 A;  3F5R A;  5DI9 B;  2KGX B;  2DN6 A;  2J0J A;  1UNR A;  1AWE A;  2CAY A;  2H7E A;  2H7D A;  4DX9 0;  4GZU A;  4A5K A;  2RRF A;  1Y19 B;  4PQ0 A;  2DX1 A;  4F7G A;  3PG7 A;  2K2U A;  2YS5 A;  4GNK B;  2I5F A;  4WJ7 A;  4L6E A;  2LKO A;  4YON A;  5FI1 A;  1WGQ A;  2CY4 A;  2GUM A;  2FJL A;  5JP4 A;  2YT0 A;  2I5C A;  3KY9 A;  1Y5O A;  2KUQ A;  4NSW A;  4HAT B;  1SHC A;  2YS1 A;  3PVL A;  4A6F A;  3UZT A;  2MDX A;  5CLQ B;  1P6S A;  1NTV A;  1XKE A;  2NMB A;  2R0D A;  1U29 A;  3FM8 C;  4DIX A;  5LG4 B;  2NBV A;  4WSF A;  1ISN A;  2Z4D A;  5LON B;  3A58 A;  2Z59 A;  3OAN A;  2W2X D;  3BIN A;  4ZRI A;  3NWF A;  4ZRJ A;  2Z13 A;  1GC6 A;  1BWN A;  4K17 A;  2GS0 A;  1MIX A;  5J3Y A;  2D11 A;  2QKM A;  4YL8 A;  1ZSQ A;  2YT2 A;  1M7R A;  4HAY B;  3QBV B;  4HB3 B;  4OT1 A;  5DHF B;  3SO6 A;  1I7A A;  2K2J A;  1FAO A;  1QC6 A;  4GPT B;  1OY2 A;  3CXB B;  4GOU A;  4GMV A;  5J3T A;  1U27 A;  1OMW A;  4NY0 A;  2D4Q A;  1LW3 A;  2YVC A;  2ROV A;  2ZKM X;  3NSU A;  5D3X A;  1Q67 A;  2OTX A;  1I2H A;  4HB2 B;  4DXA B;  5DH9 B;  4CYE A;  1RJ2 A;  3FVC A;  1XD4 A;  4F7U P;  3ML4 A;  3U8Z A;  2ZPY A;  1J0W A;  1UEF A;  1ZC3 B;  4GXB A;  4K2O A;  2VSZ A;  3HK0 A;  4DBB A;  1PFJ A;  1UPR A;  3NWD A;  1TQZ A;  2EJ8 A;  1X86 A;  2P0H A;  5GOW B;  1WGU A;  2D10 A;  2W2X C;  4K2P A;  5JHG A;  1ZVR A;  3TCA A;  2AEH A;  3HW2 B;  1NU2 A;  1T77 A;  3KZ1 A;  2RVB B;  3LJU X;  3IVF A;  2RGN B;  3DCX A;  2DKP A;  2BCJ A;  2Y7B A;  2JP2 A;  2PZ1 A;  1FB8 A;  4Y94 A;  5HE1 A;  5C5B B;  1TJ6 A;  1MI1 A;  4GN1 A;  1FGZ A;  2VRW B;  3D8E A;  4F7H A;  3MPX A;  2GJY A;  1Z87 A;  1UPQ A;  3QWM A;  1GC7 A;  3OHM B;  3KRX A;  4QJ4 B;  4D0N B;  2K8E A;  3X23 A;  1ZM0 A;  4BBK A;  1K5G B;  1KZ7 A;  2Z0O A;  2CRF A;  2Q13 A;  3P6A A;  3U7D A;  1FGY A;  2UZS A;  3KRW A;  2ELA A;  3PZD A;  3VOQ A;  3T06 A;  3AU5 A;  3D8D A;  1X05 A;  4B6H A;  2DHK A;  2D9X A;  2M38 A;  2LOX A;  2D2Q A;  4DX8 A;  2XQN M;  5J3Q A;  2LG1 A;  4L1R A;  1W1G A;  3P7Z A;  1B55 A;  3HIE A;  3BJI A;  4EJN A;  4HAZ B;  1SGH A;  2Y8F A;  2COF A;  4IFS A;  2KIE A;  2N23 A;  1WG7 A;  2M14 A;  1PLS A;  4KHA A;  5DIF B;  2DA0 A;  2K00 A;  3PVU A;  4K81 A;  5C79 A;  2K49 A;  4HB4 B;  1U5G A;  2DYN A;  1V61 A;  1U5E A;  3ZVR A;  3CIK A;  1U5F A;  1BAK A;  1EF1 A;  4KHB B;  2YSZ A;  1DDW A;  3DXE A;  1QQG A;  2J0K A;  2D9V A;  2YF0 A;  1DRO A;  1AQC A;  4QJ5 B;  3U12 A;  2COC A;  1DDM A;  3D8F A;  5EFX A;  2R2Y A;  1H10 A;  2FJU B;  1EAZ A;  4H8S A;  4HB0 B;  2EMS A;  2DYQ A;  2N0Y A;  2COA A;  1MK9 B;  5M4Y B;  5JLJ B;  2R09 A;  3TVV A;  3HSA A;  3ODO A;  1GG3 A;  2MWN B;  3ODW A;  2ROZ B;  5IRS A;  1M7E A;  4WVF B;  2D9Z A;  5LOP B;  1WI1 A;  1MAI A;  3A8Q A;  1DDV A;  4HAU B;  4XWX A;  2Z0Q A;  3ZDT A;  1P3R A;  1X1F A;  5I2M A;  3RCP A;  2DLW A;  3AU4 A;  1PMS A;  3SUZ A;  2RLO A;  4P7I A;  3V5W A;  4A6H A;  1XR0 B;  2KIG A;  2Z14 A;  2HTH B;  4GMX B;  2J59 M;  1WVH A;  5D3Y A;  1H4R A;  3MDB C;  1XCG A;  2COD A;  1J19 A;  1XOD A;  4HAX B;  3NWA A;  5C5B A;  2J0M A;  1RRP B;  2UZR A;  4A6F B;  1NI2 A;  2HE7 A;  4CHJ A;  2KCJ A;  2GCL A;  5D3W A;  3NW8 A;  3ULB A;  3WA0 A;  1TXD A;  3HQC A;  1V89 A;  3GYO A;  4HDO A;  2I1K A;  1NTY A;  3A8P A;  2MKR A;  4CSQ A;  1UNQ A;  1LB1 A;  2L2I A;  2LUL A;  2ADZ A;  5D27 A;  3G9W A;  2DHJ A;  1KI1 B;  1V88 A;  3M1I B;  4IOY X;  4HHV A;  2E2X A;  2D9Y A;  1OQN A;  5D3V A;  3TFM A;  3TO1 A;  2EC1 A;  3N7C A;  2W2W A;  2UVM A;  2GCJ A;  1U2B A;  1WJM A;  4TKN A;  4KAX B;  2QKL A;  1UNP A;  1FHX A;  5C16 A;  3PEG A;  2OQB A;  2YRY A;  4PNK A;  2DTC A;  1ZC4 B;  2VKI A;  1W1D A;  3ODX A;  5KQ1 A;  4C0A A;  2P0F A;  3VIA A; 
#chains in the Genus database with same CATH homology
 3F0W A;  2EMT A;  1BTN A;  2KUP A;  4KVG B;  3A98 B;  4EMO A;  2IYB A;  2DX5 A;  5KCV A;  4IAP A;  1EGX A;  4A6K A;  3FSS A;  2DKQ A;  3DXD A;  4EKU A;  2V76 A;  3PVW A;  4KHO A;  5HE3 A;  3KSY A;  4CHM A;  2L1C A;  3PP2 A;  5C6R A;  2MFQ A;  2IFS A;  3ULC A;  1EVH A;  1MPH A;  2LYD A;  1V5U A;  3QIJ A;  4Z2M B;  3O96 A;  5KQ4 A;  4MK0 A;  5JHH A;  2AL6 A;  1FOE A;  1P5T A;  2P0D A;  4HAV B;  1MKE A;  1W1H A;  2RNR B;  2Z0P A;  1FHO A;  1XX0 A;  1V5M A;  2ELB A;  1MIZ B;  2Y8G A;  5DHA B;  1DYN A;  3WYF B;  2CY5 A;  1K5D B;  1X11 A;  3SV1 A;  5L81 A;  2X18 A;  1X1G A;  5FI0 A;  1MK7 B;  2DFK A;  2G35 A;  2RUK B;  3TW1 A;  5HE0 A;  2I1J A;  3GYP A;  3SYX A;  3PSC A;  4TYZ A;  3SNH A;  1WJ1 A;  2P8V A;  3FEH A;  4MT7 A;  4HAW B;  4Z2N A;  3DXC A;  2RSG A;  4HDQ A;  1V5P A;  4MY6 A;  2LOZ A;  1FHW A;  1BTK A;  1KZG A;  2DHI A;  2D9W A;  1U5D A;  1E5W A;  2YS3 A;  3AJ4 A;  4ZRK A;  1IRS A;  1N3H A;  5HE2 A;  5CLL B;  1DBH A;  2NZ8 B;  2YT1 A;  3F5R A;  5DI9 B;  2KGX B;  2DN6 A;  2J0J A;  1UNR A;  1AWE A;  2CAY A;  2H7E A;  2H7D A;  4DX9 0;  4GZU A;  4A5K A;  1Y19 B;  4PQ0 A;  2DX1 A;  4F7G A;  3PG7 A;  2K2U A;  2YS5 A;  2I5F A;  4WJ7 A;  4L6E A;  2LKO A;  4YON A;  5FI1 A;  1WGQ A;  2CY4 A;  2FJL A;  5JP4 A;  2YT0 A;  2I5C A;  3KY9 A;  1Y5O A;  4NSW A;  4HAT B;  1SHC A;  2YS1 A;  3PVL A;  4A6F A;  3UZT A;  2MDX A;  5CLQ B;  1P6S A;  1NTV A;  1XKE A;  2NMB A;  2R0D A;  1U29 A;  3FM8 C;  4WSF A;  1ISN A;  5LON B;  3OAN A;  2W2X D;  3BIN A;  4ZRI A;  4ZRJ A;  1GC6 A;  1BWN A;  4K17 A;  2GS0 A;  1MIX A;  5J3Y A;  2D11 A;  2QKM A;  4YL8 A;  1ZSQ A;  1M7R A;  4HAY B;  3QBV B;  4HB3 B;  5DHF B;  3SO6 A;  1I7A A;  2K2J A;  1FAO A;  1QC6 A;  4GPT B;  1OY2 A;  3CXB B;  4GMV A;  5J3T A;  1U27 A;  1OMW A;  4NY0 A;  2D4Q A;  1LW3 A;  2YVC A;  2ROV A;  3NSU A;  5D3X A;  1Q67 A;  2OTX A;  1I2H A;  4HB2 B;  4DXA B;  5DH9 B;  4CYE A;  1RJ2 A;  1XD4 A;  4F7U P;  3ML4 A;  3U8Z A;  2ZPY A;  1J0W A;  1UEF A;  1ZC3 B;  4GXB A;  4K2O A;  2VSZ A;  3HK0 A;  4DBB A;  1PFJ A;  1UPR A;  1TQZ A;  2EJ8 A;  1X86 A;  2P0H A;  5GOW B;  1WGU A;  2D10 A;  2W2X C;  4K2P A;  5JHG A;  1ZVR A;  3TCA A;  2AEH A;  3HW2 B;  1NU2 A;  3KZ1 A;  2RVB B;  3LJU X;  3IVF A;  2RGN B;  2DKP A;  2BCJ A;  2Y7B A;  2JP2 A;  2PZ1 A;  1FB8 A;  4Y94 A;  5HE1 A;  5C5B B;  1TJ6 A;  4GN1 A;  1FGZ A;  2VRW B;  3D8E A;  4F7H A;  3MPX A;  2GJY A;  1Z87 A;  1UPQ A;  3QWM A;  1GC7 A;  3KRX A;  4D0N B;  3X23 A;  1ZM0 A;  4BBK A;  1K5G B;  1KZ7 A;  2Z0O A;  2CRF A;  2Q13 A;  3P6A A;  3U7D A;  1FGY A;  2UZS A;  3KRW A;  2ELA A;  3PZD A;  3VOQ A;  3T06 A;  3AU5 A;  3D8D A;  1X05 A;  4B6H A;  2DHK A;  2D9X A;  2M38 A;  2LOX A;  2D2Q A;  4DX8 A;  2XQN M;  5J3Q A;  2LG1 A;  1W1G A;  3P7Z A;  1B55 A;  3BJI A;  4EJN A;  4HAZ B;  1SGH A;  2Y8F A;  2COF A;  4IFS A;  2N23 A;  1WG7 A;  2M14 A;  1PLS A;  4KHA A;  5DIF B;  2DA0 A;  2K00 A;  3PVU A;  4K81 A;  5C79 A;  4HB4 B;  1U5G A;  2DYN A;  1V61 A;  1U5E A;  3ZVR A;  3CIK A;  1U5F A;  1BAK A;  1EF1 A;  4KHB B;  2YSZ A;  1DDW A;  3DXE A;  1QQG A;  2J0K A;  2D9V A;  2YF0 A;  1DRO A;  1AQC A;  2COC A;  1DDM A;  3D8F A;  5EFX A;  1H10 A;  1EAZ A;  4H8S A;  4HB0 B;  2EMS A;  2DYQ A;  2N0Y A;  2COA A;  1MK9 B;  5JLJ B;  2R09 A;  3TVV A;  3ODO A;  1GG3 A;  2MWN B;  3ODW A;  2ROZ B;  1M7E A;  4WVF B;  2D9Z A;  5LOP B;  1WI1 A;  1MAI A;  3A8Q A;  1DDV A;  4HAU B;  4XWX A;  2Z0Q A;  3ZDT A;  1P3R A;  1X1F A;  3RCP A;  2DLW A;  3AU4 A;  1PMS A;  3SUZ A;  2RLO A;  4P7I A;  3V5W A;  4A6H A;  1XR0 B;  2HTH B;  4GMX B;  2J59 M;  1WVH A;  5D3Y A;  1H4R A;  3MDB C;  1XCG A;  2COD A;  1J19 A;  1XOD A;  4HAX B;  5C5B A;  2J0M A;  1RRP B;  2UZR A;  4A6F B;  1NI2 A;  2HE7 A;  4CHJ A;  2KCJ A;  2GCL A;  5D3W A;  3ULB A;  3WA0 A;  1TXD A;  3HQC A;  1V89 A;  3GYO A;  4HDO A;  2I1K A;  1NTY A;  3A8P A;  2MKR A;  1UNQ A;  1LB1 A;  2L2I A;  2LUL A;  2ADZ A;  5D27 A;  3G9W A;  2DHJ A;  1KI1 B;  1V88 A;  4IOY X;  3M1I B;  4HHV A;  2E2X A;  2D9Y A;  1OQN A;  5D3V A;  3TFM A;  3TO1 A;  2EC1 A;  3N7C A;  2W2W A;  2UVM A;  2GCJ A;  1U2B A;  1WJM A;  4TKN A;  4KAX B;  2QKL A;  1UNP A;  1FHX A;  5C16 A;  3PEG A;  2OQB A;  2YRY A;  4PNK A;  2DTC A;  1ZC4 B;  2VKI A;  1W1D A;  3ODX A;  5KQ1 A;  4C0A A;  2P0F A;  3VIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...