1BTNA

Structure of the binding site for inositol phosphates in a ph domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-SPECTRIN
publication title Structure of the binding site for inositol phosphates in a PH domain.
pubmed rcsb
source organism Mus musculus
molecule tags Signal transduction protein
total genus 26
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1995-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1btnA00
2CY5A 4A6KA 4HAUB 3ULCA 1U29A 1X11A 1DDWA 1U5GA 2DTCA 2RGNB 3A8PA 1KI1B 3BINA 1Y19B 1ZC3B 2COCA 4GN1A 3DXEA 2V76A 3V5WA 2IYBA 2ROVA 1K5GB 5DH9B 1MPHA 4PNKA 1ZC4B 1WJMA 1XODA 2COFA 2N23A 5D3YA 1ISNA 2ZPYA 2D2QA 1FHWA 2YT0A 3KY9A 2CAYA 1X1FA 2AL6A 2XQNM 1UNPA 2LOXA 1M7RA 4ZRJA 2N0YA 4DX90 3SYXA 1BTKA 2RVBB 5HE2A 3MPXA 2MKRA 1DBHA 4HB4B 1W1GA 1AQCA 2LULA 4CYEA 1H10A 2DFKA 5FI1A 3ZVRA 1UEFA 3ODOA 2QKLA 1KZ7A 2P0DA 1SHCA 2D9YA 3A8QA 2G35A 2HE7A 4HB0B 1SGHA 2I5FA 3TCAA 2J0MA 1MIZB 4HB3B 4TKNA 3NSUA 5DHAB 1FHXA 4PQ0A 4HATB 1V89A 1AWEA 4KHBB 4GXBA 2NZ8B 1XR0B 4WSFA 2YS1A 5JHGA 5JLJB 1MK9B 4B6HA 1OY2A 3VOQA 3LJUX 4Y94A 5KCVA 2DKQA 1U5EA 2GCJA 5D27A 2FJLA 5J3YA 4YONA 2H7DA 3KRWA 3TVVA 2I5CA 5CLQB 3AJ4A 4HDQA 4HAVB 4K2OA 1XX0A 5FI0A 4CHMA 1WG7A 2KGXB 3ZDTA 4KHOA 2HTHB 3F0WA 1NI2A 3X23A 2KCJA 5C5BA 2D9XA 4Z2MB 4H8SA 3D8DA 3QIJA 3U8ZA 1FOEA 5C16A 4EKUA 3KSYA 2DHKA 4WVFB 2P0FA 3QWMA 3TFMA 3SUZA 2QKMA 2W2XC 1P5TA 2VKIA 1GC7A 1NTVA 2Z0QA 4HAWB 5DIFB 1EVHA 4GPTB 1BWNA 1U27A 1FGYA 2J0JA 2DKPA 2NMBA 5D3XA 2D4QA 2CRFA 1V61A 5C6RA 3HW2B 5HE3A 1N3HA 4NSWA 4A6FA 2OTXA 3PVUA 1LB1A 1V5PA 5KQ1A 3TW1A 3GYPA 2YS5A 1X86A 1OMWA 3PP2A 1NTYA 3VIAA 3TO1A 2GS0A 3PVWA 1V5UA 4HHVA 2W2XD 4F7UP 3QBVB 3RCPA 2I1KA 1E5WA 1KZGA 3PEGA 2KUPA 3CXBB 2VRWB 1K5DB 2MDXA 1Q67A 4MT7A 1GC6A 1TQZA 2ELBA 2GJYA 4A6HA 3HK0A 3AU5A 4A5KA 3CIKA 1DROA 1FHOA 1ZSQA 2H7EA 1B55A 5D3WA 3O96A 5HE1A 3A98B 3KRXA 1FAOA 2ROZB 1Y5OA 1X05A 1MKEA 5L81A 1DYNA 3UZTA 5HE0A 1MAIA 2DX1A 1DDMA 1DDVA 3WA0A 2K00A 1PLSA 2GCLA 4Z2NA 2DYNA 1EGXA 4NY0A 3P6AA 1RJ2A 3ML4A 3PZDA 4DBBA 1QC6A 4K2PA 4MY6A 2Z0PA 2YT1A 1BAKA 1P6SA 2Q13A 2CY4A 4MK0A 3FSSA 4EMOA 2RUKB 3M1IB 3PVLA 2ADZA 1UNRA 2K2UA 2UVMA 1UNQA 3ODWA 2EMSA 2RLOA 1OQNA 1FGZA 2DYQA 2DLWA 2MFQA 1EAZA 1TJ6A 2P0HA 2YF0A 2YS3A 1NU2A 1V5MA 2M14A 2UZRA 5EFXA 4DX8A 1I7AA 2Y8FA 1H4RA 1U2BA 1XKEA 2E2XA 4GMXB 4CHJA 2EC1A 2LOZA 2X18A 3FM8C 1U5DA 2DN6A 2D9VA 4IOYX 3SO6A 5C5BB 1EF1A 2M38A 2LYDA 3SNHA 4GMVA 4YL8A 1J19A 3DXDA 2D10A 2YRYA 2DHIA 1WI1A 1MIXA 2J59M 5J3QA 4EJNA 2UZSA 3AU4A 3DXCA 2R0DA 4D0NB 5J3TA 2Y8GA 1PFJA 1XD4A 1UPQA 1ZM0A 3BJIA 2DX5A 1P3RA 2J0KA 4KHAA 3G9WA 1XCGA 4KVGB 3ODXA 1BTNA 2P8VA 2COAA 2D9ZA 1V88A 4A6FB 5LONB 1FB8A 2D11A 5CLLB 4C0AA 2LG1A 4DXAB 1IRSA 1ZVRA 1U5FA 1I2HA 2BCJA 1M7EA 3GYOA 2ELAA 1GG3A 3OANA 3T06A 3ULBA 4GZUA 4ZRKA 3WYFB 3PG7A 2VSZA 4IFSA 2YSZA 5KQ4A 4F7GA 4HAXB 2CODA 2D9WA 2EMTA 4K17A 1WGQA 1WVHA 4WJ7A 2I1JA 3D8FA 3IVFA 5GOWB 1Z87A 1J0WA 1WJ1A 2W2WA 5C79A 4F7HA 2YVCA 2R09A 3F5RA 4HAYB 1UPRA 1TXDA 5DHFB 4XWXA 2DHJA 1MK7B 2AEHA 2LKOA 4TYZA 2EJ8A 5DI9B 3N7CA 4IAPA 4K81A 3HQCA 4HAZB 2IFSA 4P7IA 5D3VA 2Y7BA 3D8EA 1W1DA 2MWNB 2Z0OA 4L6EA 2L2IA 1QQGA 5LOPB 4KAXB 1PMSA 1RRPB 3U7DA 2PZ1A 5JHHA 3KZ1A 2JP2A 4HDOA 3FEHA 2RNRB 3P7ZA 2OQBA 1LW3A 2K2JA 2RSGA 1WGUA 2DA0A 2L1CA 3MDBC 4BBKA 1W1HA 1X1GA 4ZRIA 5JP4A 3PSCA 4HB2B 3SV1A
chains in the Genus database with same CATH superfamily
4D6WA 3FVCA 2K49A 2CY5A 4A6KA 4HAUB 3ULCA 1U29A 1X11A 3DCXA 1DDWA 1U5GA 2DTCA 2RGNB 3A8PA 1KI1B 3BINA 1Y19B 1ZC3B 2COCA 4GN1A 3DXEA 2V76A 3V5WA 2IYBA 2ROVA 1K5GB 5DH9B 1MPHA 4PNKA 1ZC4B 1WJMA 1XODA 2COFA 2N23A 5D3YA 1ISNA 2ZPYA 2D2QA 1FHWA 2YT0A 3KY9A 2CAYA 1X1FA 2AL6A 2XQNM 1UNPA 2LOXA 1M7RA 4ZRJA 2N0YA 4GNKB 4DX90 3SYXA 1BTKA 2RVBB 5HE2A 3MPXA 2MKRA 4QXAB 1DBHA 2Z4DA 4HB4B 1W1GA 1AQCA 2LULA 4CYEA 1H10A 2DFKA 5FI1A 3ZVRA 1UEFA 3ODOA 2QKLA 1KZ7A 2P0DA 1SHCA 2D9YA 3A8QA 2G35A 2HE7A 4HB0B 1SGHA 2I5FA 3TCAA 2J0MA 1MIZB 4HB3B 4TKNA 3NSUA 5DHAB 1FHXA 4PQ0A 4HATB 1V89A 1AWEA 4KHBB 4GXBA 2NZ8B 1XR0B 4WSFA 2YS1A 4OT1A 5JHGA 5JLJB 1MK9B 4GOUA 4B6HA 1OY2A 3VOQA 3LJUX 4Y94A 5KCVA 2DKQA 1U5EA 3NW8A 2GCJA 5D27A 2FJLA 5J3YA 4YONA 2H7DA 3KRWA 3TVVA 2I5CA 5CLQB 3AJ4A 4HDQA 4HAVB 4K2OA 1XX0A 5FI0A 4CHMA 1WG7A 2KGXB 5I2MA 3ZDTA 4KHOA 2HTHB 3F0WA 1NI2A 3X23A 2KCJA 5C5BA 2D9XA 4Z2MB 4H8SA 3D8DA 3QIJA 3U8ZA 1FOEA 5C16A 4EKUA 3KSYA 2DHKA 4WVFB 2P0FA 3QWMA 3TFMA 3SUZA 2QKMA 2W2XC 1P5TA 2VKIA 1GC7A 1NTVA 2Z0QA 4HAWB 4L1RA 5DIFB 1EVHA 4GPTB 1BWNA 1U27A 1FGYA 2J0JA 3U12A 2DKPA 2NMBA 5D3XA 2D4QA 2CRFA 1V61A 2KIGA 5C6RA 3HW2B 5HE3A 1N3HA 4NSWA 4A6FA 2OTXA 3PVUA 4QJ5B 1LB1A 1V5PA 5KQ1A 3TW1A 3GYPA 2K8EA 2YS5A 1X86A 1OMWA 3PP2A 1NTYA 3VIAA 4DIXA 3TO1A 2GS0A 3PVWA 1V5UA 4HHVA 2W2XD 4F7UP 2NBVA 2Z14A 3QBVB 3RCPA 2I1KA 1E5WA 1KZGA 4HSIA 3PEGA 2KUPA 3CXBB 2VRWB 2KUQA 1K5DB 2MDXA 1Q67A 4MT7A 1GC6A 1TQZA 2ELBA 2GJYA 5M4YB 4A6HA 3HK0A 3AU5A 4A5KA 3CIKA 1DROA 1FHOA 1ZSQA 2H7EA 1B55A 5D3WA 3O96A 4KHBA 5HE1A 3A98B 3KRXA 1FAOA 2ROZB 1Y5OA 1X05A 1MKEA 5L81A 1DYNA 3UZTA 5HE0A 1MAIA 2DX1A 1DDMA 1DDVA 3WA0A 2K00A 1PLSA 2GCLA 2KIEA 4Z2NA 4CSQA 2DYNA 1EGXA 4NY0A 3P6AA 1RJ2A 2FJUB 3ML4A 3PZDA 4DBBA 1QC6A 4K2PA 4MY6A 2Z0PA 2YT1A 1BAKA 1P6SA 2Q13A 2CY4A 4MK0A 3FSSA 4EMOA 2RUKB 3M1IB 3PVLA 5IRSA 4QJ3B 2ADZA 1UNRA 2K2UA 2UVMA 1UNQA 3ODWA 2EMSA 2GUMA 2RLOA 1MI1A 1OQNA 3OHMB 1FGZA 2DYQA 2P0HA 2DLWA 1EAZA 1TJ6A 2MFQA 2YF0A 2YS3A 1NU2A 4OSNA 5LG4B 1V5MA 2M14A 2UZRA 5EFXA 4DX8A 1I7AA 2Y8FA 1H4RA 1U2BA 1XKEA 2E2XA 4GMXB 4CHJA 2EC1A 2LOZA 2X18A 3FM8C 1U5DA 2DN6A 2D9VA 4IOYX 2Z59A 4QJ4B 3SO6A 5C5BB 1EF1A 2M38A 2LYDA 3SNHA 4GMVA 4YL8A 1J19A 3DXDA 2D10A 2YRYA 2DHIA 1WI1A 1MIXA 2J59M 5J3QA 4EJNA 2UZSA 5I2SA 3AU4A 3DXCA 2R0DA 4D0NB 5J3TA 2Y8GA 1PFJA 1XD4A 1UPQA 1ZM0A 3BJIA 2R2YA 2DX5A 1P3RA 2J0KA 4KHAA 3G9WA 1XCGA 4KVGB 3ODXA 1BTNA 2P8VA 2COAA 2D9ZA 1V88A 4A6FB 5LONB 1FB8A 2D11A 5CLLB 2Z13A 4C0AA 2LG1A 4DXAB 1IRSA 1ZVRA 1U5FA 1I2HA 2BCJA 1M7EA 3GYOA 2ELAA 1GG3A 3A58A 3OANA 3T06A 3ULBA 4GZUA 4ZRKA 3WYFB 3PG7A 2VSZA 4IFSA 2YSZA 5KQ4A 4F7GA 4HAXB 2CODA 2D9WA 2EMTA 4K17A 1WGQA 3NWDA 1WVHA 2ZKMX 4WJ7A 2I1JA 3D8FA 3IVFA 3B77A 5GOWB 1Z87A 1J0WA 1WJ1A 2W2WA 5C79A 4F7HA 2YVCA 2R09A 3F5RA 4HAYB 1UPRA 1TXDA 5DHFB 4XWXA 2DHJA 1MK7B 2AEHA 2LKOA 4TYZA 2EJ8A 5DI9B 3N7CA 3NWAA 4IAPA 4K81A 3HSAA 3HQCA 3NWFA 4HAZB 2IFSA 4P7IA 5D3VA 2Y7BA 3D8EA 1W1DA 2MWNB 2Z0OA 4L6EA 2L2IA 1T77A 1QQGA 5LOPB 4KAXB 1PMSA 1RRPB 3U7DA 2PZ1A 3HIEA 2KR0A 2RRFA 5JHHA 3KZ1A 2JP2A 4HDOA 3FEHA 2RNRB 3P7ZA 2OQBA 1LW3A 2K2JA 2RSGA 1WGUA 2DA0A 2YT2A 2L1CA 3MDBC 4BBKA 1ZYIA 1W1HA 1X1GA 4ZRIA 5JP4A 3PSCA 4HB2B 3SV1A
chains in the Genus database with same CATH topology
2CY5A 4A6KA 4HAUB 3ULCA 1U29A 1X11A 1DDWA 1U5GA 2DTCA 2RGNB 3A8PA 1KI1B 3BINA 1Y19B 1ZC3B 2COCA 4GN1A 3DXEA 2V76A 3V5WA 2IYBA 2ROVA 1K5GB 5DH9B 1MPHA 4PNKA 1ZC4B 1WJMA 1XODA 2COFA 2N23A 5D3YA 1ISNA 2ZPYA 2D2QA 1FHWA 2YT0A 3KY9A 2CAYA 1X1FA 2AL6A 2XQNM 1UNPA 2LOXA 1M7RA 4ZRJA 2N0YA 4DX90 3SYXA 1BTKA 2RVBB 5HE2A 3MPXA 2MKRA 1DBHA 4HB4B 1W1GA 1AQCA 2LULA 4CYEA 1H10A 2DFKA 5FI1A 3ZVRA 1UEFA 3ODOA 2QKLA 1KZ7A 2P0DA 1SHCA 2D9YA 3A8QA 2G35A 2HE7A 4HB0B 1SGHA 2I5FA 3TCAA 2J0MA 1MIZB 4HB3B 4TKNA 3NSUA 5DHAB 1FHXA 4PQ0A 4HATB 1V89A 1AWEA 4KHBB 4GXBA 2NZ8B 1XR0B 4WSFA 2YS1A 5JHGA 5JLJB 1MK9B 4B6HA 1OY2A 3VOQA 3LJUX 4Y94A 5KCVA 2DKQA 1U5EA 2GCJA 5D27A 2FJLA 5J3YA 4YONA 2H7DA 3KRWA 3TVVA 2I5CA 5CLQB 3AJ4A 4HDQA 4HAVB 4K2OA 1XX0A 5FI0A 4CHMA 1WG7A 2KGXB 3ZDTA 4KHOA 2HTHB 3F0WA 1NI2A 3X23A 2KCJA 5C5BA 2D9XA 4Z2MB 4H8SA 3D8DA 3QIJA 3U8ZA 1FOEA 5C16A 4EKUA 3KSYA 2DHKA 4WVFB 2P0FA 3QWMA 3TFMA 3SUZA 2QKMA 2W2XC 1P5TA 2VKIA 1GC7A 1NTVA 2Z0QA 4HAWB 5DIFB 1EVHA 4GPTB 1BWNA 1U27A 1FGYA 2J0JA 2DKPA 2NMBA 5D3XA 2D4QA 2CRFA 1V61A 5C6RA 3HW2B 5HE3A 1N3HA 4NSWA 4A6FA 2OTXA 3PVUA 1LB1A 1V5PA 5KQ1A 3TW1A 3GYPA 2YS5A 1X86A 1OMWA 3PP2A 1NTYA 3VIAA 3TO1A 2GS0A 3PVWA 1V5UA 4HHVA 2W2XD 4F7UP 3QBVB 3RCPA 2I1KA 1E5WA 1KZGA 3PEGA 2KUPA 3CXBB 2VRWB 1K5DB 2MDXA 1Q67A 4MT7A 1GC6A 1TQZA 2ELBA 2GJYA 4A6HA 3HK0A 3AU5A 4A5KA 3CIKA 1DROA 1FHOA 1ZSQA 2H7EA 1B55A 5D3WA 3O96A 5HE1A 3A98B 3KRXA 1FAOA 2ROZB 1Y5OA 1X05A 1MKEA 5L81A 1DYNA 3UZTA 5HE0A 1MAIA 2DX1A 1DDMA 1DDVA 3WA0A 2K00A 1PLSA 2GCLA 4Z2NA 2DYNA 1EGXA 4NY0A 3P6AA 1RJ2A 3ML4A 3PZDA 4DBBA 1QC6A 4K2PA 4MY6A 2Z0PA 2YT1A 1BAKA 1P6SA 2Q13A 2CY4A 4MK0A 3FSSA 4EMOA 2RUKB 3M1IB 3PVLA 2ADZA 1UNRA 2K2UA 2UVMA 1UNQA 3ODWA 2EMSA 2RLOA 1OQNA 1FGZA 2DYQA 2DLWA 2MFQA 1EAZA 1TJ6A 2P0HA 2YF0A 2YS3A 1NU2A 1V5MA 2M14A 2UZRA 5EFXA 4DX8A 1I7AA 2Y8FA 1H4RA 1U2BA 1XKEA 2E2XA 4GMXB 4CHJA 2EC1A 2LOZA 2X18A 3FM8C 1U5DA 2DN6A 2D9VA 4IOYX 3SO6A 5C5BB 1EF1A 2M38A 2LYDA 3SNHA 4GMVA 4YL8A 1J19A 3DXDA 2D10A 2YRYA 2DHIA 1WI1A 1MIXA 2J59M 5J3QA 4EJNA 2UZSA 3AU4A 3DXCA 2R0DA 4D0NB 5J3TA 2Y8GA 1PFJA 1XD4A 1UPQA 1ZM0A 3BJIA 2DX5A 1P3RA 2J0KA 4KHAA 3G9WA 1XCGA 4KVGB 3ODXA 1BTNA 2P8VA 2COAA 2D9ZA 1V88A 4A6FB 5LONB 1FB8A 2D11A 5CLLB 4C0AA 2LG1A 4DXAB 1IRSA 1ZVRA 1U5FA 1I2HA 2BCJA 1M7EA 3GYOA 2ELAA 1GG3A 3OANA 3T06A 3ULBA 4GZUA 4ZRKA 3WYFB 3PG7A 2VSZA 4IFSA 2YSZA 5KQ4A 4F7GA 4HAXB 2CODA 2D9WA 2EMTA 4K17A 1WGQA 1WVHA 4WJ7A 2I1JA 3D8FA 3IVFA 5GOWB 1Z87A 1J0WA 1WJ1A 2W2WA 5C79A 4F7HA 2YVCA 2R09A 3F5RA 4HAYB 1UPRA 1TXDA 5DHFB 4XWXA 2DHJA 1MK7B 2AEHA 2LKOA 4TYZA 2EJ8A 5DI9B 3N7CA 4IAPA 4K81A 3HQCA 4HAZB 2IFSA 4P7IA 5D3VA 2Y7BA 3D8EA 1W1DA 2MWNB 2Z0OA 4L6EA 2L2IA 1QQGA 5LOPB 4KAXB 1PMSA 1RRPB 3U7DA 2PZ1A 5JHHA 3KZ1A 2JP2A 4HDOA 3FEHA 2RNRB 3P7ZA 2OQBA 1LW3A 2K2JA 2RSGA 1WGUA 2DA0A 2L1CA 3MDBC 4BBKA 1W1HA 1X1GA 4ZRIA 5JP4A 3PSCA 4HB2B 3SV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY5 A;  4A6K A;  4HAU B;  3ULC A;  1U29 A;  1X11 A;  1DDW A;  1U5G A;  2DTC A;  2RGN B;  3A8P A;  1KI1 B;  3BIN A;  1Y19 B;  1ZC3 B;  2COC A;  4GN1 A;  3DXE A;  2V76 A;  3V5W A;  2IYB A;  2ROV A;  1K5G B;  5DH9 B;  1MPH A;  4PNK A;  1ZC4 B;  1WJM A;  1XOD A;  2COF A;  2N23 A;  5D3Y A;  1ISN A;  2ZPY A;  2D2Q A;  1FHW A;  2YT0 A;  3KY9 A;  2CAY A;  1X1F A;  2AL6 A;  2XQN M;  1UNP A;  2LOX A;  1M7R A;  4ZRJ A;  2N0Y A;  4DX9 0;  3SYX A;  1BTK A;  2RVB B;  5HE2 A;  3MPX A;  2MKR A;  1DBH A;  4HB4 B;  1W1G A;  1AQC A;  2LUL A;  4CYE A;  1H10 A;  2DFK A;  5FI1 A;  3ZVR A;  1UEF A;  3ODO A;  2QKL A;  1KZ7 A;  2P0D A;  1SHC A;  2D9Y A;  3A8Q A;  2G35 A;  2HE7 A;  4HB0 B;  1SGH A;  2I5F A;  3TCA A;  2J0M A;  1MIZ B;  4HB3 B;  4TKN A;  3NSU A;  5DHA B;  1FHX A;  4PQ0 A;  4HAT B;  1V89 A;  1AWE A;  4KHB B;  4GXB A;  2NZ8 B;  1XR0 B;  4WSF A;  2YS1 A;  5JHG A;  5JLJ B;  1MK9 B;  4B6H A;  1OY2 A;  3VOQ A;  3LJU X;  4Y94 A;  5KCV A;  2DKQ A;  1U5E A;  2GCJ A;  5D27 A;  2FJL A;  5J3Y A;  4YON A;  2H7D A;  3KRW A;  3TVV A;  2I5C A;  5CLQ B;  3AJ4 A;  4HDQ A;  4HAV B;  4K2O A;  1XX0 A;  5FI0 A;  4CHM A;  1WG7 A;  2KGX B;  3ZDT A;  4KHO A;  2HTH B;  3F0W A;  1NI2 A;  3X23 A;  2KCJ A;  5C5B A;  2D9X A;  4Z2M B;  4H8S A;  3D8D A;  3QIJ A;  3U8Z A;  1FOE A;  5C16 A;  4EKU A;  3KSY A;  2DHK A;  4WVF B;  2P0F A;  3QWM A;  3TFM A;  3SUZ A;  2QKM A;  2W2X C;  1P5T A;  2VKI A;  1GC7 A;  1NTV A;  2Z0Q A;  4HAW B;  5DIF B;  1EVH A;  4GPT B;  1BWN A;  1U27 A;  1FGY A;  2J0J A;  2DKP A;  2NMB A;  5D3X A;  2D4Q A;  2CRF A;  1V61 A;  5C6R A;  3HW2 B;  5HE3 A;  1N3H A;  4NSW A;  4A6F A;  2OTX A;  3PVU A;  1LB1 A;  1V5P A;  5KQ1 A;  3TW1 A;  3GYP A;  2YS5 A;  1X86 A;  1OMW A;  3PP2 A;  1NTY A;  3VIA A;  3TO1 A;  2GS0 A;  3PVW A;  1V5U A;  4HHV A;  2W2X D;  4F7U P;  3QBV B;  3RCP A;  2I1K A;  1E5W A;  1KZG A;  3PEG A;  2KUP A;  3CXB B;  2VRW B;  1K5D B;  2MDX A;  1Q67 A;  4MT7 A;  1GC6 A;  1TQZ A;  2ELB A;  2GJY A;  4A6H A;  3HK0 A;  3AU5 A;  4A5K A;  3CIK A;  1DRO A;  1FHO A;  1ZSQ A;  2H7E A;  1B55 A;  5D3W A;  3O96 A;  5HE1 A;  3A98 B;  3KRX A;  1FAO A;  2ROZ B;  1Y5O A;  1X05 A;  1MKE A;  5L81 A;  1DYN A;  3UZT A;  5HE0 A;  1MAI A;  2DX1 A;  1DDM A;  1DDV A;  3WA0 A;  2K00 A;  1PLS A;  2GCL A;  4Z2N A;  2DYN A;  1EGX A;  4NY0 A;  3P6A A;  1RJ2 A;  3ML4 A;  3PZD A;  4DBB A;  1QC6 A;  4K2P A;  4MY6 A;  2Z0P A;  2YT1 A;  1BAK A;  1P6S A;  2Q13 A;  2CY4 A;  4MK0 A;  3FSS A;  4EMO A;  2RUK B;  3M1I B;  3PVL A;  2ADZ A;  1UNR A;  2K2U A;  2UVM A;  1UNQ A;  3ODW A;  2EMS A;  2RLO A;  1OQN A;  1FGZ A;  2DYQ A;  2DLW A;  2MFQ A;  1EAZ A;  1TJ6 A;  2P0H A;  2YF0 A;  2YS3 A;  1NU2 A;  1V5M A;  2M14 A;  2UZR A;  5EFX A;  4DX8 A;  1I7A A;  2Y8F A;  1H4R A;  1U2B A;  1XKE A;  2E2X A;  4GMX B;  4CHJ A;  2EC1 A;  2LOZ A;  2X18 A;  3FM8 C;  1U5D A;  2DN6 A;  2D9V A;  4IOY X;  3SO6 A;  5C5B B;  1EF1 A;  2M38 A;  2LYD A;  3SNH A;  4GMV A;  4YL8 A;  1J19 A;  3DXD A;  2D10 A;  2YRY A;  2DHI A;  1WI1 A;  1MIX A;  2J59 M;  5J3Q A;  4EJN A;  2UZS A;  3AU4 A;  3DXC A;  2R0D A;  4D0N B;  5J3T A;  2Y8G A;  1PFJ A;  1XD4 A;  1UPQ A;  1ZM0 A;  3BJI A;  2DX5 A;  1P3R A;  2J0K A;  4KHA A;  3G9W A;  1XCG A;  4KVG B;  3ODX A;  1BTN A;  2P8V A;  2COA A;  2D9Z A;  1V88 A;  4A6F B;  5LON B;  1FB8 A;  2D11 A;  5CLL B;  4C0A A;  2LG1 A;  4DXA B;  1IRS A;  1ZVR A;  1U5F A;  1I2H A;  2BCJ A;  1M7E A;  3GYO A;  2ELA A;  1GG3 A;  3OAN A;  3T06 A;  3ULB A;  4GZU A;  4ZRK A;  3WYF B;  3PG7 A;  2VSZ A;  4IFS A;  2YSZ A;  5KQ4 A;  4F7G A;  4HAX B;  2COD A;  2D9W A;  2EMT A;  4K17 A;  1WGQ A;  1WVH A;  4WJ7 A;  2I1J A;  3D8F A;  3IVF A;  5GOW B;  1Z87 A;  1J0W A;  1WJ1 A;  2W2W A;  5C79 A;  4F7H A;  2YVC A;  2R09 A;  3F5R A;  4HAY B;  1UPR A;  1TXD A;  5DHF B;  4XWX A;  2DHJ A;  1MK7 B;  2AEH A;  2LKO A;  4TYZ A;  2EJ8 A;  5DI9 B;  3N7C A;  4IAP A;  4K81 A;  3HQC A;  4HAZ B;  2IFS A;  4P7I A;  5D3V A;  2Y7B A;  3D8E A;  1W1D A;  2MWN B;  2Z0O A;  4L6E A;  2L2I A;  1QQG A;  5LOP B;  4KAX B;  1PMS A;  1RRP B;  3U7D A;  2PZ1 A;  5JHH A;  3KZ1 A;  2JP2 A;  4HDO A;  3FEH A;  2RNR B;  3P7Z A;  2OQB A;  1LW3 A;  2K2J A;  2RSG A;  1WGU A;  2DA0 A;  2L1C A;  3MDB C;  4BBK A;  1W1H A;  1X1G A;  4ZRI A;  5JP4 A;  3PSC A;  4HB2 B;  3SV1 A; 
#chains in the Genus database with same CATH topology
 4D6W A;  3FVC A;  2K49 A;  2CY5 A;  4A6K A;  4HAU B;  3ULC A;  1U29 A;  1X11 A;  3DCX A;  1DDW A;  1U5G A;  2DTC A;  2RGN B;  3A8P A;  1KI1 B;  3BIN A;  1Y19 B;  1ZC3 B;  2COC A;  4GN1 A;  3DXE A;  2V76 A;  3V5W A;  2IYB A;  2ROV A;  1K5G B;  5DH9 B;  1MPH A;  4PNK A;  1ZC4 B;  1WJM A;  1XOD A;  2COF A;  2N23 A;  5D3Y A;  1ISN A;  2ZPY A;  2D2Q A;  1FHW A;  2YT0 A;  3KY9 A;  2CAY A;  1X1F A;  2AL6 A;  2XQN M;  1UNP A;  2LOX A;  1M7R A;  4ZRJ A;  2N0Y A;  4GNK B;  4DX9 0;  3SYX A;  1BTK A;  2RVB B;  5HE2 A;  3MPX A;  2MKR A;  4QXA B;  1DBH A;  2Z4D A;  4HB4 B;  1W1G A;  1AQC A;  2LUL A;  4CYE A;  1H10 A;  2DFK A;  5FI1 A;  3ZVR A;  1UEF A;  3ODO A;  2QKL A;  1KZ7 A;  2P0D A;  1SHC A;  2D9Y A;  3A8Q A;  2G35 A;  2HE7 A;  4HB0 B;  1SGH A;  2I5F A;  3TCA A;  2J0M A;  1MIZ B;  4HB3 B;  4TKN A;  3NSU A;  5DHA B;  1FHX A;  4PQ0 A;  4HAT B;  1V89 A;  1AWE A;  4KHB B;  4GXB A;  2NZ8 B;  1XR0 B;  4WSF A;  2YS1 A;  4OT1 A;  5JHG A;  5JLJ B;  1MK9 B;  4GOU A;  4B6H A;  1OY2 A;  3VOQ A;  3LJU X;  4Y94 A;  5KCV A;  2DKQ A;  1U5E A;  3NW8 A;  2GCJ A;  5D27 A;  2FJL A;  5J3Y A;  4YON A;  2H7D A;  3KRW A;  3TVV A;  2I5C A;  5CLQ B;  3AJ4 A;  4HDQ A;  4HAV B;  4K2O A;  1XX0 A;  5FI0 A;  4CHM A;  1WG7 A;  2KGX B;  5I2M A;  3ZDT A;  4KHO A;  2HTH B;  3F0W A;  1NI2 A;  3X23 A;  2KCJ A;  5C5B A;  2D9X A;  4Z2M B;  4H8S A;  3D8D A;  3QIJ A;  3U8Z A;  1FOE A;  5C16 A;  4EKU A;  3KSY A;  2DHK A;  4WVF B;  2P0F A;  3QWM A;  3TFM A;  3SUZ A;  2QKM A;  2W2X C;  1P5T A;  2VKI A;  1GC7 A;  1NTV A;  2Z0Q A;  4HAW B;  4L1R A;  5DIF B;  1EVH A;  4GPT B;  1BWN A;  1U27 A;  1FGY A;  2J0J A;  3U12 A;  2DKP A;  2NMB A;  5D3X A;  2D4Q A;  2CRF A;  1V61 A;  2KIG A;  5C6R A;  3HW2 B;  5HE3 A;  1N3H A;  4NSW A;  4A6F A;  2OTX A;  3PVU A;  4QJ5 B;  1LB1 A;  1V5P A;  5KQ1 A;  3TW1 A;  3GYP A;  2K8E A;  2YS5 A;  1X86 A;  1OMW A;  3PP2 A;  1NTY A;  3VIA A;  4DIX A;  3TO1 A;  2GS0 A;  3PVW A;  1V5U A;  4HHV A;  2W2X D;  4F7U P;  2NBV A;  2Z14 A;  3QBV B;  3RCP A;  2I1K A;  1E5W A;  1KZG A;  4HSI A;  3PEG A;  2KUP A;  3CXB B;  2VRW B;  2KUQ A;  1K5D B;  2MDX A;  1Q67 A;  4MT7 A;  1GC6 A;  1TQZ A;  2ELB A;  2GJY A;  5M4Y B;  4A6H A;  3HK0 A;  3AU5 A;  4A5K A;  3CIK A;  1DRO A;  1FHO A;  1ZSQ A;  2H7E A;  1B55 A;  5D3W A;  3O96 A;  4KHB A;  5HE1 A;  3A98 B;  3KRX A;  1FAO A;  2ROZ B;  1Y5O A;  1X05 A;  1MKE A;  5L81 A;  1DYN A;  3UZT A;  5HE0 A;  1MAI A;  2DX1 A;  1DDM A;  1DDV A;  3WA0 A;  2K00 A;  1PLS A;  2GCL A;  2KIE A;  4Z2N A;  4CSQ A;  2DYN A;  1EGX A;  4NY0 A;  3P6A A;  1RJ2 A;  2FJU B;  3ML4 A;  3PZD A;  4DBB A;  1QC6 A;  4K2P A;  4MY6 A;  2Z0P A;  2YT1 A;  1BAK A;  1P6S A;  2Q13 A;  2CY4 A;  4MK0 A;  3FSS A;  4EMO A;  2RUK B;  3M1I B;  3PVL A;  5IRS A;  4QJ3 B;  2ADZ A;  1UNR A;  2K2U A;  2UVM A;  1UNQ A;  3ODW A;  2EMS A;  2GUM A;  2RLO A;  1MI1 A;  1OQN A;  3OHM B;  1FGZ A;  2DYQ A;  2P0H A;  2DLW A;  1EAZ A;  1TJ6 A;  2MFQ A;  2YF0 A;  2YS3 A;  1NU2 A;  4OSN A;  5LG4 B;  1V5M A;  2M14 A;  2UZR A;  5EFX A;  4DX8 A;  1I7A A;  2Y8F A;  1H4R A;  1U2B A;  1XKE A;  2E2X A;  4GMX B;  4CHJ A;  2EC1 A;  2LOZ A;  2X18 A;  3FM8 C;  1U5D A;  2DN6 A;  2D9V A;  4IOY X;  2Z59 A;  4QJ4 B;  3SO6 A;  5C5B B;  1EF1 A;  2M38 A;  2LYD A;  3SNH A;  4GMV A;  4YL8 A;  1J19 A;  3DXD A;  2D10 A;  2YRY A;  2DHI A;  1WI1 A;  1MIX A;  2J59 M;  5J3Q A;  4EJN A;  2UZS A;  5I2S A;  3AU4 A;  3DXC A;  2R0D A;  4D0N B;  5J3T A;  2Y8G A;  1PFJ A;  1XD4 A;  1UPQ A;  1ZM0 A;  3BJI A;  2R2Y A;  2DX5 A;  1P3R A;  2J0K A;  4KHA A;  3G9W A;  1XCG A;  4KVG B;  3ODX A;  1BTN A;  2P8V A;  2COA A;  2D9Z A;  1V88 A;  4A6F B;  5LON B;  1FB8 A;  2D11 A;  5CLL B;  2Z13 A;  4C0A A;  2LG1 A;  4DXA B;  1IRS A;  1ZVR A;  1U5F A;  1I2H A;  2BCJ A;  1M7E A;  3GYO A;  2ELA A;  1GG3 A;  3A58 A;  3OAN A;  3T06 A;  3ULB A;  4GZU A;  4ZRK A;  3WYF B;  3PG7 A;  2VSZ A;  4IFS A;  2YSZ A;  5KQ4 A;  4F7G A;  4HAX B;  2COD A;  2D9W A;  2EMT A;  4K17 A;  1WGQ A;  3NWD A;  1WVH A;  2ZKM X;  4WJ7 A;  2I1J A;  3D8F A;  3IVF A;  3B77 A;  5GOW B;  1Z87 A;  1J0W A;  1WJ1 A;  2W2W A;  5C79 A;  4F7H A;  2YVC A;  2R09 A;  3F5R A;  4HAY B;  1UPR A;  1TXD A;  5DHF B;  4XWX A;  2DHJ A;  1MK7 B;  2AEH A;  2LKO A;  4TYZ A;  2EJ8 A;  5DI9 B;  3N7C A;  3NWA A;  4IAP A;  4K81 A;  3HSA A;  3HQC A;  3NWF A;  4HAZ B;  2IFS A;  4P7I A;  5D3V A;  2Y7B A;  3D8E A;  1W1D A;  2MWN B;  2Z0O A;  4L6E A;  2L2I A;  1T77 A;  1QQG A;  5LOP B;  4KAX B;  1PMS A;  1RRP B;  3U7D A;  2PZ1 A;  3HIE A;  2KR0 A;  2RRF A;  5JHH A;  3KZ1 A;  2JP2 A;  4HDO A;  3FEH A;  2RNR B;  3P7Z A;  2OQB A;  1LW3 A;  2K2J A;  2RSG A;  1WGU A;  2DA0 A;  2YT2 A;  2L1C A;  3MDB C;  4BBK A;  1ZYI A;  1W1H A;  1X1G A;  4ZRI A;  5JP4 A;  3PSC A;  4HB2 B;  3SV1 A; 
#chains in the Genus database with same CATH homology
 2CY5 A;  4A6K A;  4HAU B;  3ULC A;  1U29 A;  1X11 A;  1DDW A;  1U5G A;  2DTC A;  2RGN B;  3A8P A;  1KI1 B;  3BIN A;  1Y19 B;  1ZC3 B;  2COC A;  4GN1 A;  3DXE A;  2V76 A;  3V5W A;  2IYB A;  2ROV A;  1K5G B;  5DH9 B;  1MPH A;  4PNK A;  1ZC4 B;  1WJM A;  1XOD A;  2COF A;  2N23 A;  5D3Y A;  1ISN A;  2ZPY A;  2D2Q A;  1FHW A;  2YT0 A;  3KY9 A;  2CAY A;  1X1F A;  2AL6 A;  2XQN M;  1UNP A;  2LOX A;  1M7R A;  4ZRJ A;  2N0Y A;  4DX9 0;  3SYX A;  1BTK A;  2RVB B;  5HE2 A;  3MPX A;  2MKR A;  1DBH A;  4HB4 B;  1W1G A;  1AQC A;  2LUL A;  4CYE A;  1H10 A;  2DFK A;  5FI1 A;  3ZVR A;  1UEF A;  3ODO A;  2QKL A;  1KZ7 A;  2P0D A;  1SHC A;  2D9Y A;  3A8Q A;  2G35 A;  2HE7 A;  4HB0 B;  1SGH A;  2I5F A;  3TCA A;  2J0M A;  1MIZ B;  4HB3 B;  4TKN A;  3NSU A;  5DHA B;  1FHX A;  4PQ0 A;  4HAT B;  1V89 A;  1AWE A;  4KHB B;  4GXB A;  2NZ8 B;  1XR0 B;  4WSF A;  2YS1 A;  5JHG A;  5JLJ B;  1MK9 B;  4B6H A;  1OY2 A;  3VOQ A;  3LJU X;  4Y94 A;  5KCV A;  2DKQ A;  1U5E A;  2GCJ A;  5D27 A;  2FJL A;  5J3Y A;  4YON A;  2H7D A;  3KRW A;  3TVV A;  2I5C A;  5CLQ B;  3AJ4 A;  4HDQ A;  4HAV B;  4K2O A;  1XX0 A;  5FI0 A;  4CHM A;  1WG7 A;  2KGX B;  3ZDT A;  4KHO A;  2HTH B;  3F0W A;  1NI2 A;  3X23 A;  2KCJ A;  5C5B A;  2D9X A;  4Z2M B;  4H8S A;  3D8D A;  3QIJ A;  3U8Z A;  1FOE A;  5C16 A;  4EKU A;  3KSY A;  2DHK A;  4WVF B;  2P0F A;  3QWM A;  3TFM A;  3SUZ A;  2QKM A;  2W2X C;  1P5T A;  2VKI A;  1GC7 A;  1NTV A;  2Z0Q A;  4HAW B;  5DIF B;  1EVH A;  4GPT B;  1BWN A;  1U27 A;  1FGY A;  2J0J A;  2DKP A;  2NMB A;  5D3X A;  2D4Q A;  2CRF A;  1V61 A;  5C6R A;  3HW2 B;  5HE3 A;  1N3H A;  4NSW A;  4A6F A;  2OTX A;  3PVU A;  1LB1 A;  1V5P A;  5KQ1 A;  3TW1 A;  3GYP A;  2YS5 A;  1X86 A;  1OMW A;  3PP2 A;  1NTY A;  3VIA A;  3TO1 A;  2GS0 A;  3PVW A;  1V5U A;  4HHV A;  2W2X D;  4F7U P;  3QBV B;  3RCP A;  2I1K A;  1E5W A;  1KZG A;  3PEG A;  2KUP A;  3CXB B;  2VRW B;  1K5D B;  2MDX A;  1Q67 A;  4MT7 A;  1GC6 A;  1TQZ A;  2ELB A;  2GJY A;  4A6H A;  3HK0 A;  3AU5 A;  4A5K A;  3CIK A;  1DRO A;  1FHO A;  1ZSQ A;  2H7E A;  1B55 A;  5D3W A;  3O96 A;  5HE1 A;  3A98 B;  3KRX A;  1FAO A;  2ROZ B;  1Y5O A;  1X05 A;  1MKE A;  5L81 A;  1DYN A;  3UZT A;  5HE0 A;  1MAI A;  2DX1 A;  1DDM A;  1DDV A;  3WA0 A;  2K00 A;  1PLS A;  2GCL A;  4Z2N A;  2DYN A;  1EGX A;  4NY0 A;  3P6A A;  1RJ2 A;  3ML4 A;  3PZD A;  4DBB A;  1QC6 A;  4K2P A;  4MY6 A;  2Z0P A;  2YT1 A;  1BAK A;  1P6S A;  2Q13 A;  2CY4 A;  4MK0 A;  3FSS A;  4EMO A;  2RUK B;  3M1I B;  3PVL A;  2ADZ A;  1UNR A;  2K2U A;  2UVM A;  1UNQ A;  3ODW A;  2EMS A;  2RLO A;  1OQN A;  1FGZ A;  2DYQ A;  2DLW A;  2MFQ A;  1EAZ A;  1TJ6 A;  2P0H A;  2YF0 A;  2YS3 A;  1NU2 A;  1V5M A;  2M14 A;  2UZR A;  5EFX A;  4DX8 A;  1I7A A;  2Y8F A;  1H4R A;  1U2B A;  1XKE A;  2E2X A;  4GMX B;  4CHJ A;  2EC1 A;  2LOZ A;  2X18 A;  3FM8 C;  1U5D A;  2DN6 A;  2D9V A;  4IOY X;  3SO6 A;  5C5B B;  1EF1 A;  2M38 A;  2LYD A;  3SNH A;  4GMV A;  4YL8 A;  1J19 A;  3DXD A;  2D10 A;  2YRY A;  2DHI A;  1WI1 A;  1MIX A;  2J59 M;  5J3Q A;  4EJN A;  2UZS A;  3AU4 A;  3DXC A;  2R0D A;  4D0N B;  5J3T A;  2Y8G A;  1PFJ A;  1XD4 A;  1UPQ A;  1ZM0 A;  3BJI A;  2DX5 A;  1P3R A;  2J0K A;  4KHA A;  3G9W A;  1XCG A;  4KVG B;  3ODX A;  1BTN A;  2P8V A;  2COA A;  2D9Z A;  1V88 A;  4A6F B;  5LON B;  1FB8 A;  2D11 A;  5CLL B;  4C0A A;  2LG1 A;  4DXA B;  1IRS A;  1ZVR A;  1U5F A;  1I2H A;  2BCJ A;  1M7E A;  3GYO A;  2ELA A;  1GG3 A;  3OAN A;  3T06 A;  3ULB A;  4GZU A;  4ZRK A;  3WYF B;  3PG7 A;  2VSZ A;  4IFS A;  2YSZ A;  5KQ4 A;  4F7G A;  4HAX B;  2COD A;  2D9W A;  2EMT A;  4K17 A;  1WGQ A;  1WVH A;  4WJ7 A;  2I1J A;  3D8F A;  3IVF A;  5GOW B;  1Z87 A;  1J0W A;  1WJ1 A;  2W2W A;  5C79 A;  4F7H A;  2YVC A;  2R09 A;  3F5R A;  4HAY B;  1UPR A;  1TXD A;  5DHF B;  4XWX A;  2DHJ A;  1MK7 B;  2AEH A;  2LKO A;  4TYZ A;  2EJ8 A;  5DI9 B;  3N7C A;  4IAP A;  4K81 A;  3HQC A;  4HAZ B;  2IFS A;  4P7I A;  5D3V A;  2Y7B A;  3D8E A;  1W1D A;  2MWN B;  2Z0O A;  4L6E A;  2L2I A;  1QQG A;  5LOP B;  4KAX B;  1PMS A;  1RRP B;  3U7D A;  2PZ1 A;  5JHH A;  3KZ1 A;  2JP2 A;  4HDO A;  3FEH A;  2RNR B;  3P7Z A;  2OQB A;  1LW3 A;  2K2J A;  2RSG A;  1WGU A;  2DA0 A;  2L1C A;  3MDB C;  4BBK A;  1W1H A;  1X1G A;  4ZRI A;  5JP4 A;  3PSC A;  4HB2 B;  3SV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...