1BTXA

Episelection: novel ki ~nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Episelection: novel Ki approximately nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btxA02
1BUIA 1RTFB 2GD4B 2G4UA 3N7OA 3SV8A 2OQUA 2GT7A 4XBDA 1C5VA 1GMHG 2CHAC 2KAIA 4GPGA 2XBYA 3R3GB 1CHOF 4DURA 1H9IE 1ZZZA 3KQBA 5DP7A 2OC7A 3LGYA 4TY6A 2A7JA 2F9VA 1SL3A 1A0HB 1AZ8A 1A0JA 4CHAC 1MBQA 1GJBB 1XXDA 2Q6FA 1MCTA 2A32A 2ZDMA 4X8UH 4XOJA 2Z9KA 1HAZB 1P0SH 3WY8A 4YM9A 6GCHF 3ELAH 3PMBB 1ELAA 1VGCC 1O5GH 3GY8A 1K1IA 4WXVA 3A8DA 1O38A 2K1QA 1AKSB 2FESH 2P59A 1HJ9A 3A7TA 3M35A 3ZVDA 2ODPA 4XSKU 2FM2A 2HGTH 1GI9B 4NA9H 2H9HA 1OKXA 2UUYA 2BLOA 1MCVA 5A0BA 1GBMA 3U1IB 5FAHA 1GHAF 1BTZA 1ZJDA 2BVXH 4Q7XA 1O39A 1ESTA 1K1PA 1G32B 1O32A 1P9SA 4INKA 1XM1A 1DWCH 1V3XA 1BIOA 4CRGA 1ETRH 3TGKE 1BTWA 1W7XH 1GBEA 1LQEA 1SGPE 2WPLS 1D3PB 1GJ9B 5EW1H 1TPAE 1ORFA 1GCTC 2V35A 2WPJS 3T62A 1L4ZA 1OX1A 2JETC 2PGQB 2H5CA 4INLA 3SJ8A 3MHWU 2HPQH 2Y6TA 1HAPH 2ZTYA 2BY5X 3PYHA 1LHEH 1IQMA 2M5TA 4Z6AH 1O2VA 2PSYA 2G51A 2GCHG 3TGJE 1AFEH 5FPSA 2OXSA 1V2QT 2G5VA 1VITG 4X1PU 1ACBE 1DS2E 1AUJA 4AGKA 4B2AA 5J4SA 1EZQA 3SJOA 2BHGA 1W0YH 1Z8IB 2B7DH 1AWHB 4B71A 4FXGH 1WQVH 3SHCH 4K8BA 1UK4A 2ZTXA 5PTPA 1GDQA 8KME2 2HRVA 3KF2A 1K9OE 1LKBA 2A0QB 4AORA 1QTFA 4MNYA 2TGAA 1KDQA 1QB9A 1L0ZA 2ZKSA 1VITF 5C5NA 1XUGA 1JOUB 4DVAU 1DANH 1DLKB 1SOZA 3UPEA 5F6MA 1SGTA 4IS5A 3GCNA 4K2YA 5C1XA 2EEKA 3UUZA 3RXEA 2FWWA 1NN6A 3LT3A 2HOBA 3LGTA 4WMFA 8ESTE 3P70B 3F9HA 3U1JB 3MU5A 4A92A 1CBWB 1G3CA 1AGJA 2ZC9H 1PPEE 2RDLA 2ZHQH 4FUIA 3SNAA 1OWKA 2W26A 3LH1A 3RU4T 2AGIX 1UVTH 2ZHDA 3B8JA 1EPTC 1HIAA 2ANWA 4H42U 3UNSA 3G01A 9ESTA 4D7GA 3HGNA 4X6NA 4LK4A 1IQIA 4WF8A 1HNEE 2FTLE 3VXFH 1WSSH 1X7AC 1NROH 1GMDF 1NO9H 4XFQA 3MU8A 4Y0YE 1GI5A 1HLTH 3L3TA 5TCAA 3SV6A 3TPIZ 1UCYK 2GTBA 4CBNA 2Y5FA 1FY3A 2STBE 1UTLM 2HNTF 1SR5C 3S9AA 1VZQH 1MTWA 3VGCC 1UVUH 1W13U 1GI7B 1Z7KA 6GCHG 3GY4A 1XVMA 7GCHF 2FLRH 3SUGA 2Z3DA 1EX3A 4JYVH 2EI6A 1V2KT 2H2ZA 3PLPA 4D76A 5DGJA 4ZHAA 4OS4A 3W95A 5GDSH 2FP7B 1GMCG 1FJSA 1HAGE 2J4IA 1U6QA 2O8LA 1UJ1A 2SGEE 3MWIU 4JZ1A 1ZHPA 1J16A 3M7TA 3EAJA 1ANDA 1T4UH 2OC1A 3MNSA 1YCPM 1AN1E 3T25A 1Q3XA 4Y76A 1EP5A 1W7GH 1J15A 2R9PA 2FOEA 1KDQB 3M5MA 2NU4E 1GJCB 2LNCA 2V3HH 1ELCA 1C1MA 3ZZCA 2FDAA 4X8VH 5AF9H 1MQ5A 4FUBA 1DWDH 4M7GA 4X1RU 1A4WH 4SGBE 1C1PA 1TOMH 1V2PT 1TBRH 1DY9A 2V3OH 1C5OH 4ABBA 2VVUA 1SB1H 4ZHLU 2WV4A 2ZGBH 1GHWH 4IGDA 2PFEA 4HI3A 1BTHH 2HNTE 4IN2A 1O34A 1P2IA 1DXWA 5FBIA 2V6NA 1LPKB 1CGIE 1TRNA 3H5CB 5L2YH 1GI8B 3QZQA 1CQQA 8GCHG 5DP8A 2H5DA 2C3SA 1C9PA 4A1VA 1KLJH 1P01A 1VGCB 2VINA 3E0NB 1QIXB 3URCA 1CE5A 2GCHF 5E8EH 1Y3VA 1GBFA 4O3UA 2CF9H 1HYLA 2TRMA 2G8TA 1VITH 1Y3YA 2VNTA 3TH2H 2AFQB 5K0HA 2VGCC 2FEQH 1EZXC 2J9NA 5EW2H 1B0EA 4NFFA 1K22H 1AVGH 1GG6C 3A8AA 3MMGA 3QTOH 1QA7A 2XC5A 1GCTB 1DM4B 1LQDB 2DE8A 3M3SA 1C5SA 2GVFA 1T8MA 4ZKNU 1O3IA 4YT7H 1K28D 4AG1A 3A80A 4K3JA 2NU1E 2R2WU 3EDXB 3SNDA 4BNRA 1A1RA 2G4TA 3UY9A 3GYLB 1T31A 1MAYA 3PLKA 1B5GH 2B9LA 4OS7A 1O3EA 4GCHG 4R0IA 1OWEA 1UCYE 1TRYA 4WMEA 5CMXH 5T6DA 1O2LA 2XW9A 4JCNA 4ISIH 2GMTB 4BTTB 3LGVA 1GI3A 1GL0E 3EGKH 5EPNA 1TRMA 1MD7A 1FY8E 1P03A 1O2KA 2BZAA 1G30B 3LU9B 3SU6A 3M5OA 1TX7A 3URDA 2CJIA 1LO6A 2PKAA 3BTDE 1UVOA 2R0KA 1JIRA 2PKSB 3BTTE 2H6MA 3S69A 1BZXE 2IPHA 4MPUA 4O3TA 5FPTA 3BTKE 1FLEE 1LMWB 3M7QA 2WPHS 4I8GA 1BRAA 2ZDAH 1C4Y2 2NU3E 1P11E 3SV7A 3RC5A 2WV5A 1C1UH 1TGNA 1WAYB 1GBIA 3ATLA 1Z1IA 3LDXH 3MH6A 1TALA 4AN7A 1FIWA 4F49A 1G37A 3DFLA 1FQ3A 1HUTH 2J95A 2ZZUH 1O3LA 3RXLA 3R0FA 1IHTH 1RXPA 3LOXA 4E06H 3MNXA 3FP6E 5A8ZA 1TGCA 3P95A 1KSNA 1ZMLA 2QY0B 3TJUA 1SHYA 1OSSA 1D4PB 1RTLA 1HRTH 2PW8H 2R3YA 3Q77A 4R8TB 2F91A 2SGQE 1PFXC 3W94A 1ZR0A 1TMTH 2BD5A 3KQDA 1UO6A 3BEUA 3EA8A 3AAVA 3ZVAA 1C1TA 1MD8A 1DLEA 1C4V2 1C1VH 1DX5M 1FIZA 1O35A 1ID5H 1NFWA 1QNJA 1DFPA 3UR6A 1SLVB 3ODDA 4K1TA 1P57B 3MH5A 5FCKA 2QN5T 4QT8C 4DJZB 5JB8S 1K1LA 4Q2KA 2Z9IA 2W7UA 5DP4A 2BY8X 1AE8H 4DT7B 1ARBA 3LGUA 4GCHF 2F9BH 3FANA 4I31A 4I8LA 2H9EH 1C5XB 1SGFG 1W2KH 4Y8ZA 4ZAEA 4AGJA 1NY22 2GKVE 1O2GH 3SUFA 3K6YA 1BTUA 3BTGE 1O5DH 1SQOA 4CH2B 4H6TA 3MU0A 1O3HA 1WYKA 1PQ5A 1SG8B 3RMMH 3MO9A 2TGDA 3HATH 5HGGA 2BDAA 2OBQA 3VXEH 1YLDA 4UD9H 2ANYA 1O2XA 4AZ2B 1IAUA 1C5WB 1GJAB 1O3KA 4JMYA 1XKAC 2Z9LA 4X1SU 3E3TA 1V2WT 1SGFA 1NU9A 1BCUH 4Q7YA 3BEIB 3QTVH 2ANKH 1HAOH 3VB6A 1O2YA 1KLIH 5JB9S 1NRNH 3A7YA 2CMYA 1GBDA 4ABDA 5CHAB 1EPTA 1WV7H 3V3MA 3PWCA 5JBAS 4FU7A 1SGDE 5FBEA 5ESBA 5JYIA 1SQAA 3SU1A 1AD8H 7LPRA 4A1XA 3RXQA 1GJ7B 4FUHA 4WVPE 4HZHA 2QC2A 5GCHG 4ISOA 1NRPH 1YLCA 3DT0H 4MG3A 4KP0A 3GY5A 1YBWA 3A7ZA 1JRSA 1EKBB 3GDVA 1GCDA 1EAUA 4Z0KA 2P94A 3I78A 2F83A 3OYPA 1BMLA 2GGVB 5EQRA 1GHXH 3TVJB 1DUAA 1QQUA 3M3VA 1EOJA 1EAWA 1QRZA 3LPRA 2ZGHA 3BF6H 3A86A 2ZNKH 2BXTH 1S5SA 2ZCLP 3K9XB 1OP0A 1VJAU 1F0SA 4AFUA 4UEHH 3CS0A 5LPFA 2ZI2H 2OQ5A 1BQYA 4YOJA 1GVKB 3RU4D 3SUEA 2A7HA 4WH8A 1DSUA 3GCHC 4BAOB 2ZECA 5IYTA 2JH5D 1FI8A 4B73A 2XWAA 1TNGA 3F6UH 1AY6H 4DGJA 4MPWA 1BHXB 3O8BA 1FN8A 3AAUA 1C2LA 2F9PA 4CRBA 2UWOA 3UWIA 1AWFH 3QGNB 1WBGB 3VEQB 2GZ7A 2QCYA 3QLPH 5DP3A 3RU4E 4I8JA 1FDPA 4B1TA 1O2QA 3TK9A 1S0QA 1TYNA 1CSOE 1MU8B 5A0AE 1YF4A 2PWXA 2BM2A 1JRTA 2ZU1A 1QL9A 1ZJKA 2ZPQA 5J4QA 1FAXA 1TIOA 1JBUH 5T6FA 3DHKH 4FUGA 3A89A 2A7CA 1G3BA 3VGCB 1S6FA 3RXVA 2SGDE 2JKHA 4AFQA 2QV1A 3Q3KA 1CVWH 4FU8A 1LHDH 1IQFA 1YCPK 1SSXA 3S7HB 1O3PB 2XXLA 1ELVA 2PUXB 1HAHH 1ZSKA 3RUOA 3ZZ5A 4H4FA 5T3HA 1TPPA 3HK6B 2J92A 3E1XB 1SQTA 2A5IA 2VVCA 1MKWH 1F0UA 5DPAA 4FU9A 1C5ZB 3QUMP 4UFDH 3AW0A 2VWMA 5ETXA 2AMDA 1MBMA 1SMFE 1T8OA 1W10U 4X2YA 2SNVA 1EJAA 4I33A 1LVYA 1FUJA 3A8BA 3TNTA 4U2WA 2VWOA 3UTUH 1AQ7A 1NTPA 1QBNA 1L1JA 1VCPA 1A5IA 1PQ7A 4X2XA 4I8KA 1AVWA 1C1QA 4KTSA 2PTCE 1MMJN 1FV9A 1XUFA 1MKXK 1D6WA 1MU6B 1XUKA 4X6OA 2BQ6B 1TQ0B 3U98H 3T27A 1L4DA 3ODFA 3NWUA 4ZROA 1C5UA 2ZGCA 3VB7A 2HLCA 1F2SE 2WPKS 5TCCA 2ODYB 2VB0A 4NFEA 2UUJB 3SJKA 4LZ4B 1A5HA 5E2OA 4UFGH 1XUHA 3QGJA 3NCLA 1NC6A 1GHAG 4Q7ZA 1GMCF 2ZDKA 3VPKA 2ZU3A 5C67A 1DSTA 3QO6A 2NU2E 1SGYE 3NPSA 1TB6H 4X1QU 1ESAA 2QF3A 2QGRA 1Q2WA 4OS2A 1TOCB 1K2I1 2ZGXH 5AHGH 3KEEA 3PTNA 1M9UA 2GP9B 1ETTH 1ZRKA 2Z3CA 3NK8A 2W7SA 1W12U 1CA8B 2P3FH 1IHSH 2D8WA 3RXBA 1BTXA 4B74A 1EAIA 1SGIB 5C1YA 1RGQA 3F68H 1E35B 1O2SA 1W14U 1UCYH 3SORA 1Y59T 1HJ8A 1TMUH 1RFNA 2FX6A 1AU8A 2ZQ2A 3ENSB 1DXPA 5GPIB 1GJ4H 2R2MB 4WMDA 4ABJA 1P3EA 1S0RA 1CHOG 3TK5A 4CR9A 3PTBA 1GMHF 4XE4A 1FY4A 2AIPA 3TITA 1GPZA 1FAKH 3KCGH 5AFZH 3BV9B 2AEIH 3ZV8A 1Z8GA 2BDIA 2P8OC 1W11U 2QXHA 5FX6A 5A0CA 2Q1JA 1GJDB 3ZZ7A 2OCVB 5SGAE 1F5KU 2R0LA 1CA0C 5I25A 3P17H 4TPIZ 4K5ZA 1J17T 3OTJE 1C2GA 3STJA 3HPTB 1RS0A 1MZAA 2FOAA 1D3QB 5BPEA 1P09A 2BD2A 4IMZA 4ABEA 3RXGA 3PWBA 2ZFRH 4D9QA 2CXVA 1O2UA 4AG2A 4CRAA 1BMMH 4GHTA 1YPHC 1SGQE 1O2TA 1HJAC 2FOMB 2A4QA 2AS9A 1BHXF 1HAXB 5DG6A 1OXGA 1K1JA 1O3OA 2UWLA 3GDSA 3RM0H 2ZHWH 2PSXA 3LKWA 3ZYEA 3QDZB 3LONA 1P2NA 4BTIB 3UREA 2ZU5A 1W0ZU 3P8GA 1P2JA 4ZHMU 3MI4A 3ZYDA 2STAE 2PUQH 4AX9H 3MO3A 1F5RA 1P12E 1CT4E 2A5AA 3UQOA 1EASA 4BAQB 1OP2A 2C4FH 2ZFSA 2HALA 2YNBA 2C8WB 3S9CA 5EPYA 1EZSC 1KY9A 2AYWA 1C2JA 3K6ZA 3GYMA 2ZFQH 1MAXA 4BXWA 1Y3WA 1ZSLA 2SGPE 3RXTA 2NWNA 1AVXA 2FOGA 2FO9A 1O3GA 2PLXA 5G4BA 1P06A 1SI5H 4NSVA 1ELTA 4CH8B 4Y0ZE 2R3UA 4MPVA 4K1EA 4Y8XA 1YP9A 3BIVH 1XX9A 3UNRA 4NIWA 3ZZDA 1P10A 4A6LA 2ALVA 2FOCA 3RC6A 4IMQA 2Z9GA 5F8TA 3V7TA 1GHBF 2EI8A 1DICA 4Y11E 4THNH 2FXRA 3TJOA 4IW4E 1AB9B 1BRCE 3A81A 2BD3A 1O5EH 2PR3A 3FP7E 4X6MA 1FY5A 1WTGH 4VGCB 4Y8YA 1HV7A 2XNIA 1GBBA 4X8TH 3Q76A 1F92A 2Z94A 2XBWA 4J1YA 1JMOH 2SGAA 3KHVA 4X1NU 2TIOA 3L6PA 4NCYA 2SNWA 4BAMB 2Y7ZA 3BG8A 1O31A 2C8ZB 1J9CH 3C1KA 3UNQA 2VU8E 2GV7A 1C2IA 2OP9A 5DP9A 1PPCE 2BDBA 1INCA 4NZQA 4BXSA 1B7XB 3ZZ9A 1KXBA 3HKIB 3TGIE 2A5KA 1O2ZA 3IWMA 2XCNA 1ELEE 1QJ6B 1EJNA 1O36A 1PJPA 2RCEA 3QX5H 2PGBB 1WU1A 2ALPA 2JH6D 3MU1A 4NWLA 2C8XB 2A1DB 1DPOA 4YZUA 1NT1A 1OS8A 3LJOA 4HFPB 3RXFA 4AYVB 1SGEE 1O3BA 3IG6B 4CRFA 2GV6A 3LJJA 3HK3B 1H9HE 3H7OA 4Y10E 1G3EA 2P95A 1QCPA 4OGYA 3KN2A 2ANMH 2VH6A 1ANEA 4FUCA 2Y7XA 1HJAB 1TABE 4BANB 2ZCKP 4E7NA 3EE0B 1BRBE 1NFYA 3BTHE 1V2JT 3MNBA 5JBBS 2G5NA 3KGPA 1EZUC 1NS3A 2FIRH 4NA8A 4TY7A 2J38A 5EQQA 2TGPZ 1P8VC 4YESB 1N8OB 3RXUA 1QRXA 4K60A 1MTSA 5A2MH 2SFAA 1S84A 1SOTA 3K2UA 3O8RA 1TGTA 1WUNH 3LGWA 1FMGA 1YPMH 3M36A 1AHTH 1V2RT 4GLYA 4TYDA 3HGPA 3SI3H 3Q3YA 1K21H 4YLQH 2ZP0H 3NUMA 1D6RA 2XBXA 3M7UA 2G81E 2F9OA 2FI5E 3SGQE 3SBKA 1SLUB 1XXFA 1S81A 3ITIA 4PROA 2BD8A 3DFJA 1MUEB 3U8TH 4NWKA 3U69H 4ABGA 1NESE 1LPGB 1YKTA 2AH4X 1SFIA 2ZTZA 1C2FA 1K1NA 5EOKA 3ZVFA 3ZVBA 2WPIS 1KTSB 3BSQA 1GJ8B 3AW1A 3ZZ3A 3F9FA 4CR5A 3T2NA 3A83A 3ZVGA 1QB1A 4D8NA 3E8LA 3T29A 1FNIA 1XMNB 1Y8TA 2A2XH 5C20A 2J94A 1NU7B 2BD4A 2BX3A 1Y5BT 4FVDA 4FVBA 1QFKH 3GCTF 1OWJA 2OD3B 2P3UB 2PTNA 4A5TS 1CHGA 2WINI 1KXEA 3BTWE 3GCTG 1YM0A 2A4GA 1UMAH 2EI7A 4Y79A 5ESTE 1QQ4A 2VWNA 1THRH 3A7WA 1GL1A 2BMGB 3T26A 5CE1A 5HM9A 1ZPBA 2H9TH 3SGBE 1EPTB 1N6XA 4ASHA 2TBSA 1DY8A 3P8OA 1GVLA 1D3DB 1QBVH 1NZQH 1QJ7B 2UWPA 4FUEA 1WTHD 1C5LH 1F0TA 1V6DA 1MH0A 1AIXH 1GGDB 3GY3A 1TAWA 4GSOA 1HB0B 2Q6DA 3BTQE 3LC5A 1CGJE 3GCHB 3RXDA 1ARCA 2EA3A 1LVMA 1AFQB 1V2LT 2RA0A 1O2MA 3F9EA 4I8HA 5FXLA 3ZZ4A 1OWIA 1DDJA 1O2PA 3NZIA 4NIVA 5LPEA 5EU8A 1HXEH 3RM2H 1SGRE 2GDEH 2ZFFH 5BRRE 5E0GA 2JH0D 3P8NA 2QA9E 3T5FH 3ATWA 1MKWK 4ZH8A 4DW2U 4JZEH 4DCDA 1EATA 1PYTD 1EAXA 3QK1A 1DT2A 1C2KA 1P04A 2FI3E 1C5NH 1L1NA 3JZ2B 2D1JA 1TX6A 1EB1H 3MNCA 1BBRH 1ZGIA 1UVSH 2VJ1A 1N6YA 4JK5A 1PPFE 4AYYB 5LH8A 5A8XA 1FONA 1N1LA 1CO7E 2VIDA 4FUDA 4LXBH 4Y7AA 1SFQB 1DOJA 3ZVEA 5DJ7A 3ZZ8A 2F9NA 2BDGA 1ZGVA 2PKSC 2VH0A 1MZDA 1S82A 2BLQA 3RMLH 1IQEA 3RXRA 3OY6U 1V2UT 2ILNA 2ZO3H 3EYDA 4B75A 4VGCC 4UDWH 1EJMA 1A61H 1C2EA 3KQEA 5EXNA 2Y5HA 2OC8A 3A87A 1HAIH 2XC4A 4FUJA 4MPXA 3GCOA 3SU4A 1GJ6A 2ZFPH 1JIMA 1ABIH 3M3TA 1AO5A 3BTFE 1GI6A 1O3CA 2XBVA 3D62A 1O3FA 2ZCHP 2O8UA 4ISNA 1EQ9A 1D3TB 1Q31A 2G52A 2ZHEH 4CREA 5K7RA 1VR1H 1BB0B 2Z7FE 4JZDH 4K1SA 2WUCA 1PPBH 2VVVA 5HXFA 3RMOH 1K1MA 3K65B 1HBTH 3SZNA 1BJUA 5CHAC 1ESBA 1LPZB 1RIWC 1V2ST 1TNHA 2QAAA 2QIQA 4YO9A 3BIUH 3E91A 2ZHFH 2HVXA 1YPHE 3U8RH 1B0FA 3GY6A 2XTTB 1ELFA 4JZFH 3SNBA 1ABJH 2VIOA 5F03A 4A1TA 1BMNH 3FZDA 4UE7H 1L2EA 1C5QA 1ZLRA 3E16B 3SU3A 1HAYB 1C1WH 1Y3UA 1GHBG 1EOLA 1GWAA 2W3IA 4ZKSU 1WCZA 4O9VA 3RDZA 2BVSH 4TPYA 3SNEA 3MH4A 2H1UA 4U01A 1A3EH 1BOQA 2A4OA 1ZTJA 1MTNB 1BMAA 1V2NT 4OS6A 1TBZH 3A8CA 1T32A 1TX8A 2YNAA 1TNJA 1XUIA 1GBLA 2C93B 4IC5A 1GBTA 1F5LA 3Q00A 4ZMAH 1C5YB 1HIAB 1KYNA 3BEFB 1H8IH 2FOBA 2OBOA 1A7SA 4ZXYH 1EUFA 2A45B 4DIIH 3V0XA 3ZVCA 1O5FH 3FZZA 1QR3E 1H8DH 1SC8U 2W5EA 2YOLA 4ABAA 4CRDA 3BN9A 1WQSA 2AERH 1C1NA 1ZOMA 3B23B 4RSPA 3ZZ6A 1BBRE 1S6HA 2XYAA 3RXKA 1KXFA 3AVZA 3SW2B 1T7CA 4X2WA 2WUBA 1PPHE 4Q80A 4BTUB 1V2OT 4MLFB 1YGCH 2QYIA 1GMDG 1UVPA 1XUJA 2IJOB 1MTUA 2O8TA 4NIXA 1SLXB 1TNIA 2GDDA 2P8OB 3RLYH 2OC0A 1S85A 1Z8RA 3H7TA 4GUXA 1V2VT 1KXDA 2RG3A 3SNCA 3ZZAA 2DUCA 4DY7B 3U9AH 1E36B 1ZPCA 3A82A 4KTUA 4WXIA 2FYQA 1P2MA 2FS9A 3TJVA 5FCRA 1TGSZ 2QXGA 2FYRA 1V2TT 3GICB 1TA6A 2J2UA 1NFXA 2I6SA 4INHA 4FUFA 3S0NA 3VFEA 2A4RA 4D9RA 1TQ7B 4SGAE 5C3NA 1P2KA 2BY6X 3RXAA 1P2OA 2FMJA 5GWZA 3SO3A 3ATKA 4RKOB 4DG4A 1C5TA 1TPOA 1O2JA 2P93A 4ISLA 4ZKOU 2AGEX 2PKAB 2Z9JA 1C5RA 1QL8A 4IBLH 4UFFH 4JYUH 7GCHG 1YPEH 2CGAA 3RXIA 2BX4A 4X8SH 4E7RG 2FX4A 1C9TA 1GBHA 2QXJA 1TA2A 4Y71A 3D65E 1SPJA 3DA9B 3EA9A 1LKAA 1LVBA 5H4IB 1H9LB 2ZQ1A 2O9QA 5EG4A 2ZPRA 2D26C 3FVFB 3KQCA 1HFDA 3TNSA 1C2DA 1UTOA 3U8OH 1RTKA 2BY9X 3KL6A 2TPIZ 2ASUB 3SHAH 2GZ8A 2CV3A 4DIHH 2FZZA 2VGCB 5F8XA 1CA0B 1W3CA 5DP6A 3A7VA 4Y7BA 1LTOA 1UTQA 5JBCS 4D7FA 3TU7H 3M5NA 1KLTA 2XRCA 1E37B 3VB3A 1C1SA 5L2ZH 4BOHA 4NZLA 2BY7X 1UHBB 3ATIA 1DWEH 4OS1A 4NG9H 3VB4A 1OOKB 2P3TB 5HMAA 4MDSA 1NPMA 2ZIQH 3QZRA 5E0HA 1TGBA 4WH6A 3SQEE 1GJ5H 1QY6A 1P2QA 3B9FH 2BD9A 2V0BA 3MU4A 1HXFH 1QRWA 1QJ1B 2OINA 1VJ9U 5DP5A 2GCTC 3RC4A 2A31A 4ABHA 1O3NA 4ABIA 4J2YB 1E38B 4ZXXH 3MOCA 1PQAA 2ODQA 1TPSA 4GAWA 5C5OA 4RN6A 1AUTC 5GXPA 1EB2A 1Z71A 3P92A 3TJNA 3I77A 1MTNC 2GZ9A 2ZDVH 3OSYA 1GBKA 1QURH 2BZ6H 3RXPA 3RXMA 2BTCE 1D9IA 2OTVA 1BJVA 2Y80A 5LGOA 8LPRA 2ZFTA 4MVNA 5DKMA 4TWYA 2PHBA 4HTCH 2ZGJA 3PLBA 3PV4A 1PPZA 3TIUA 1Y3XA 2HPPH 1C5MD 1P9UA 2VIVA 4ZUHA 1XKBC 4XBCA 5FPYA 2UUKB 1OP8A 1LVOA 1C2MA 1G2LA 5B6OA 1DUEA 2P16A 2BOKA 4O97A 4B2BA 5C2ZA 1OYTH 1G2MA 4UONA 5HM2A 1C1RA 5EXLA 3PMHB 1IQJA 1G3DA 3BG4B 2SGFE 3MYWA 1JXPA 2CHAB 2I6QA 3ATMA 1QBOA 1IQGA 3RLWH 1BTYA 2ESTE 2BDHA 1T8LA 4X2VA 1WOFA 1THSH 2EC9H 2Y82A 1W8BH 1BRUP 2GMTC 3RXOA 3MFJA 1HAVB 4I7YH 1PQ8A 3LIWA 1J14A 3TH4H 1SGNE 5C1UA 1YC0A 3BTEE 1VCQA 1DE7H 1C1OA 3GDUA 4TWWA 3RXCA 1NRQH 2BDCA 1PPGE 1AMHA 3QWCH 4NGAH 3FFGA 2GCTB 3MTYA 1SBWA 1XVOA 1TONA 2QF0A 3D49H 4XDEA 3PM3A 5FHTA 2BYAX 2IN2A 2B5TB 3M5LA 4WWYA 2RA3A 2OUAA 1YPJH 4Y6DA 1AZZA 1TNLA 1SVPA 1OWDA 5EQSA 2FOFA 3TK6A 2BQWB 2AIQA 1O2IA 2B8OH 1IQNA 3OU0A 1P3CA 2WYGA 4H6SB 1E34B 1ZSJA 2BQ7B 2BD7A 3D23A 3GY2A 1FY1A 1GI4A 1Z8JB 2XC0A 5F8ZA 3UR9A 1O2OA 4LZ1H 1A0LA 1F7ZA 1ELBA 3TLOA 1BA8B 1RJXB 2GT8A 1LHCH 1A3BH 2AMPA 1O2NA 4GVUA 4AB9A 4HGCA 1KXAA 1ZHMA 4WJG2 1C5PA 3A84A 4MNVA 1IQLA 7ESTE 3ZZBA 4MTBA 1KXCA 5TJXA 1CBWC 1E0FD 1OWHA 2D2DA 1FPCH 1J8AA 1NM6A 5T6GA 3SU0A 1O0DH 3O8CA 1ZRBA 3SJ9A 3P8FA 4MQAA 4ISHH 4NA7A 5AFYH 2BOHB 5EXMA 1L1GA 1V2MT 5GCHF 3RXJA 1BITA 2FLBH 1HCGA 5GIBA 4A7IB 3I29A 1O3DA 4CHAB 1HDTH 3E90B 5I46H 5FX5A 3E0PB 4B2CA 2G00A 1OYQA 1G9IE 4BAKB 5GJ4B 2ZDNA 2ZG0H 5HYOA 5E2PA 5E0JA 2KAIB 3RXSA 1CT0E 3SUDA 2Y5GA 1Z1JA 3L33A 1YPKH 3UWJH 1GHYH 1ANCA 1UK2A 3LGIA 3Q3XA 1N8OC 4MNXA 1O33A 3RXHA 3TH3H 3OX7U 1ZYOA 3E6PH 3OY5U 5DK1A 1VCWA 3PROA 3STIA 3CENA 2BDYA 4KTCA 2HWLB 1HAVA 5EODA 3F1SB 4ESTE 2JETB 2CN0H 1UK3A 1O3JA 1AB9C 2PV9B 4LOYH 1YPGH 3BG4C 1YCPH 1KTTB 9LPRA 2VWLA 1FN6A 4YLUA 5JDUB 3SV2H 1GDUA 3GOVB 1H1BA 3MH7A 3RP2A 2ZEBA 3M61U 2O8MA 2XCFA 4AB8A 2VIPA 2ZWLH 1DWBH 1YPLH 3DD2H 1ZMJA 2BB4A 1TLDA 2F9UA 2G55A 1FPHH 2FTMA 2CF8H 5JPMH 4O03A 4XBBA 4K8YA 4E05H 4YOGA 1EXFA 3DUXH 1HGTH 4B76A 1A2CH 3IITA 2BLVA 1GBCA 1Z6JH 4DOQA 2Z3EA 1BT7A 3PO1C 4ZKRU 1GHZA 2THFB 5DO4H 3A7XA 2UUFB 5LPRA 1NFUA 2Z6BD 3KNXA 1SHHB 1O5CB 2DE9A 1GBAA 2BXUH 1EP6A 1O30A 3PO1B 3S7KB 4AFSA 5ABWA 3QN7A 3O8DA 3MO6A 3PMJA 2FOHA 4JYTA 1O37A 3CS7A 6LPRA 2AGGX 1RD3B 2ZDLA 1KIGH 3V13A 3M37A 1F0RA 1FXYA 3SOSA 4KELA 1T8NA 5L6NH 1LHGH 3P6ZB 5A8YA 1LDTT 3LH3A 2BVRH 2WYJA 2ULLA 1BDAA 3RMNH 1QHRB 1TMBH 1YYY1 2VIWA 2ZU2A 3KIDU 3T28A 4ABFA 4CRCA 4JK6A 4IN1A 4K69A 1FZZA 4JZIA 1IQHA 1MKXH 1ZTLA 4OGXA 2AMQA 1UTPA 2IOTA 3UOPA 1SGCA 1H4WA 3PB1E 1MQ6A 4NSYA 3PMAB 4GHQA 1ELGA 1ELDE 2ZA5A 4YOIA 1TBQH 1OPHB 3EQ0H 2B0FA 1UTJA 1UTKA 3SV9A 3SJIA 2NU0E 1HPGA 1IQKA 1BTPA 1TNKA 7KMEH 3UFAA 1QGFA 3S9BA 1MTVA 1Y5AT 1O5BB 1P05A 1CU1A 1GHVH 6CHAB 1ANBA 2A2QH 1QA0A 1QL7A 3F9GA 2WPMS 1GI0A 2ZF0H 3ESTA 1S83A 1Z6EA 1O3MA 4YT6H 4RKJB 3HKJB 3EA7A 2J34A 5L30H 1K1OA 1IOEA 2FS8A 1UHBA 1AKSA 2C8YB 1QB6A 1A46H 3ZV9A 3V12A 2FPZA 2C90B 3SQHE 1O3AA 1T4VH 1TWXB 4KGAA 4CBOA 3A85A 1P02A 4AFZA 4F4OC 1GG6B 1JWTA 3A88A 1UTMA 2ZU4A 1THPB 4OS5A 2Q6GA 1G36A 1CGHA 3SN8A 3BTME 1BBRK 1GVZA 4I32A 3NKKA 2VIQA 3UQVA 4WY3A 1RRKA 1C4U2 4MNWA 2HNTC 3GISB 3SU2A 1C2HA 2GX4A 3UOUA 1PYTC 1O2RA 2O8WA 1TFXA 1DVAH 1LCYA 1DITH 1ZTKA 2F3CE 8GCHF 5EGMA 1GBJA 1SLWB 3GY7A 3SU5A 5AVDA 2LPRA 1UTNA 3VB5A 3NXPA 1AI8H 1RIWB 3SI4H 5IDKA 4X6PA 4AOQA 3FP8E 2ZPSA 4U32A 1GI1A 1O2WA 3C27B 5A09A 1ZPZA 2TGTA 3FAOA 4UFEH 3LC3A 3UIRA 2OLGA 6CHAC 1NRSH 1O5AB 1LHFH 1ETSH 4KKDA 2QXIA 1GDNA 3AASA 4X0WU 2BLWA 2XWBI 1CT2E 1A5GH 2FODA 2W3KA 1NRRH 2Y81A 1AFQC 4YTAA 4U30A 3SGAE 3JZ1B 1O2HA 1AE5A 1ZMNA 1ZHRA 1TE0A 5JBTA 1GGDC 1Y5UT 4BAHB 2FI4E 4NIYA 4IC6A 3CP7A 6ESTA 1GI2A
chains in the Genus database with same CATH superfamily
1BUIA 1RTFB 5C0UA 2GD4B 2G4UA 3N7OA 3SV8A 2OQUA 2GT7A 4XBDA 1C5VA 1GMHG 2CHAC 2KAIA 4GPGA 2XBYA 3R3GB 1CHOF 4DURA 1H9IE 1ZZZA 3KQBA 5DP7A 2HLDD 2OC7A 3LGYA 4TY6A 2A7JA 2F9VA 1SL3A 2IPQX 1A0HB 1AZ8A 1A0JA 4CHAC 1MBQA 1GJBB 1XXDA 2Q6FA 1MCTA 2A32A 2ZDMA 4X8UH 4XOJA 2Z9KA 1HAZB 1P0SH 3WY8A 4YM9A 6GCHF 3ELAH 3PMBB 1ELAA 1VGCC 2L6OA 1O5GH 3GY8A 1K1IA 4WXVA 3A8DA 2WZQA 1O38A 2K1QA 2KM0A 1AKSB 2FESH 2P59A 1HJ9A 3A7TA 3M35A 3ZVDA 2RDEA 2ODPA 4XSKU 2FM2A 2HGTH 4OM9A 1YLNA 1GI9B 4NA9H 2H9HA 1OKXA 2UUYA 2BLOA 1MCVA 5A0BA 1GBMA 3U1IB 3U28C 5FAHA 2M2AA 1GHAF 1BTZA 1ZJDA 2BVXH 4Q7XA 1O39A 1ESTA 1K1PA 1G32B 1O32A 1P9SA 4F48B 4INKA 1XM1A 1DWCH 5HIZA 1V3XA 1BIOA 4CRGA 1ETRH 3TGKE 1BTWA 1W7XH 1GBEA 2YMSD 1LQEA 1SGPE 2WPLS 1D3PB 1GJ9B 5EW1H 1TPAE 1ORFA 1GCTC 2V35A 2WPJS 3T62A 1L4ZA 1OX1A 2IJD1 2JETC 2PGQB 2H5CA 4INLA 3SJ8A 3MHWU 2HPQH 2Y6TA 1HAPH 2ZTYA 2BY5X 3PYHA 1LHEH 1IQMA 2M5TA 4Z6AH 1O2VA 2PSYA 2G51A 2GCHG 3TGJE 1AFEH 5FPSA 1QZ8A 2OXSA 1V2QT 2G5VA 1VITG 4X1PU 1ACBE 1DS2E 1AUJA 4AGKA 4B2AA 5J4SA 1EZQA 3SJOA 2BHGA 1W0YH 1Z8IB 2B7DH 1AWHB 4B71A 4FXGH 1WQVH 3SHCH 4K8BA 1UK4A 2ZTXA 5PTPA 1GDQA 8KME2 2HRVA 3KF2A 1K9OE 1LKBA 2A0QB 4AORA 1QTFA 4MNYA 3ZIAD 2TGAA 1KDQA 1QB9A 1L0ZA 2ZKSA 1VITF 5C5NA 1XUGA 1JOUB 4DVAU 1DANH 1DLKB 1SOZA 3UPEA 5F6MA 1SGTA 4IS5A 3GCNA 4K2YA 5C1XA 2EEKA 3UUZA 3RXEA 2FWWA 1NN6A 3LT3A 2HOBA 3LGTA 4WMFA 8ESTE 3P70B 1K0HA 3F9HA 3U1JB 3MU5A 4A92A 1CBWB 1G3CA 1AGJA 1S6LA 2ZC9H 4YXWD 1PPEE 2RDLA 2ZHQH 2WHXA 4FUIA 2WV9A 3SNAA 1OWKA 2W26A 3LH1A 3RU4T 2AGIX 1UVTH 2ZHDA 2OK5A 3B8JA 3NRLA 1EPTC 1HIAA 2ANWA 4H42U 3UNSA 3G01A 9ESTA 4D7GA 3HGNA 4X6NA 4LK4A 1IQIA 4WF8A 1HNEE 2FTLE 3VXFH 1WSSH 1X7AC 1NROH 1GMDF 4AC9A 1NO9H 4XFQA 3MU8A 4Y0YE 1GI5A 1HLTH 3L3TA 5TCAA 3SV6A 3TPIZ 1UCYK 2GTBA 4CBNA 2Y5FA 1FY3A 2STBE 1UTLM 2HNTF 1SR5C 3S9AA 1VZQH 1MTWA 3VGCC 1UVUH 1W13U 1GI7B 1Z7KA 6GCHG 3GY4A 1XVMA 7GCHF 2FLRH 3SUGA 2Z3DA 1EX3A 4JYVH 2EI6A 1V2KT 2H2ZA 3PLPA 4D76A 5DGJA 4ZHAA 4OS4A 4FETA 5GDSH 3W95A 2FP7B 1GMCG 1FJSA 1HAGE 2J4IA 1U6QA 2O8LA 1UJ1A 2SGEE 3MWIU 4JZ1A 1ZHPA 1J16A 3M7TA 3EAJA 1ANDA 1T4UH 2OC1A 3MNSA 1YCPM 1AN1E 3T25A 1Q3XA 4Y76A 1EP5A 1W7GH 1J15A 2R9PA 2FOEA 3WW7A 1KDQB 3M5MA 2NU4E 1GJCB 2LNCA 2V3HH 1ELCA 1C1MA 3ZZCA 2FDAA 4X8VH 4FOUC 5AF9H 1MQ5A 4FUBA 1DWDH 4M7GA 4X1RU 1A4WH 4SGBE 1C1PA 1TOMH 1V2PT 1TBRH 1DY9A 2V3OH 1C5OH 4ABBA 2VVUA 1SB1H 4ZHLU 2WV4A 2ZGBH 1GHWH 5C0TA 4IGDA 2PFEA 4HI3A 5FL7D 1BTHH 2HNTE 4IN2A 1O34A 1P2IA 1DXWA 5FBIA 2KZ4A 2V6NA 1LPKB 1CGIE 1TRNA 3H5CB 5L2YH 1GI8B 3QZQA 1CQQA 8GCHG 5DP8A 2H5DA 2C3SA 1C9PA 4A1VA 1KLJH 1P01A 1VGCB 2VINA 3E0NB 1QIXB 3URCA 1CE5A 2GCHF 5E8EH 1Y3VA 3N7EA 1GBFA 4O3UA 2CF9H 1HYLA 2TRMA 2G8TA 1VITH 1Y3YA 2VNTA 3TH2H 2AFQB 5K0HA 2VGCC 2FEQH 1EZXC 2J9NA 5EW2H 1B0EA 4NFFA 1K22H 1AVGH 1GG6C 3A8AA 3MMGA 3QTOH 1QA7A 1GCTB 1DM4B 2XC5A 1LQDB 2DE8A 3M3SA 2LELA 1C5SA 2GVFA 1T8MA 4ZKNU 1O3IA 4YT7H 1K28D 4AG1A 3A80A 4K3JA 2NU1E 2R2WU 3EDXB 3SNDA 4BNRA 1A1RA 2G4TA 3UY9A 3GYLB 1T31A 1MAYA 3PLKA 1B5GH 2B9LA 4OS7A 1O3EA 4GCHG 4R0IA 1OWEA 1UCYE 1TRYA 4WMEA 5CMXH 5T6DA 1O2LA 2XW9A 4JCNA 4ISIH 2GMTB 4BTTB 3LGVA 1GI3A 1GL0E 3EGKH 5EPNA 1TRMA 1MD7A 5IK2D 1FY8E 1P03A 1O2KA 2BZAA 1G30B 3LU9B 3SU6A 3M5OA 1TX7A 3OTPA 2KCOA 3URDA 2CJIA 3EE7A 1LO6A 2PKAA 4M9FA 3BTDE 1UVOA 2R0KA 1JIRA 2PKSB 3BTTE 2H6MA 3S69A 4Z1MD 1BZXE 2IPHA 4MPUA 5KEDA 1EFRD 4O3TA 5FPTA 3BTKE 1FLEE 1LMWB 3M7QA 2WPHS 4I8GA 1BRAA 2ZDAH 1C4Y2 2NU3E 1P11E 3SYJA 3SV7A 2KR7A 3RC5A 2WV5A 1C1UH 1TGNA 1WAYB 1GBIA 3ATLA 1Z1IA 3LDXH 3MH6A 1TALA 4AN7A 1FIWA 4F49A 1G37A 3DFLA 1FQ3A 1HUTH 2J95A 2ZZUH 1O3LA 3RXLA 3R0FA 1IHTH 1RXPA 3LOXA 4E06H 1YWUA 3MNXA 3FP6E 5A8ZA 1TGCA 3P95A 1KSNA 1ZMLA 2QY0B 3TJUA 1SHYA 1OSSA 1D4PB 1RTLA 1HRTH 2PW8H 2R3YA 3Q77A 4R8TB 2F91A 2SGQE 1PFXC 3W94A 1ZR0A 1TMTH 4B6EA 2BD5A 3KQDA 1UO6A 3BEUA 3EA8A 3AAVA 3ZVAA 1C1TA 1MD8A 1DLEA 1C4V2 1C1VH 1DX5M 1FIZA 1O35A 1ID5H 1NFWA 1QNJA 1DFPA 3UR6A 1SLVB 3ODDA 4K1TA 1P57B 3MH5A 5FCKA 2QN5T 4QT8C 4DJZB 2J97A 5JB8S 1K1LA 4Q2KA 2Z9IA 2W7UA 5DP4A 2BY8X 1AE8H 4Q63A 4DT7B 1ARBA 3LGUA 4GCHF 2F9BH 3FANA 4I31A 4I8LA 2H9EH 1C5XB 4TT3D 1SGFG 1W2KH 4Y8ZA 4ZAEA 4AGJA 1NY22 2GKVE 1O2GH 3SUFA 3K6YA 1BTUA 3BTGE 1O5DH 1SQOA 4CH2B 4H6TA 5EIYA 3MU0A 1O3HA 1WYKA 1PQ5A 1SG8B 3RMMH 3MO9A 2TGDA 3HATH 5HGGA 2BDAA 1E1RD 2OBQA 3VXEH 1YLDA 4UD9H 2ANYA 1O2XA 4AZ2B 1IAUA 1C5WB 1GJAB 1O3KA 4JMYA 1XKAC 2Z9LA 4X1SU 3E3TA 1V2WT 1SGFA 1NU9A 1BCUH 4Q7YA 1FX0B 3BEIB 3QTVH 2ANKH 1HAOH 3VB6A 1O2YA 1KLIH 5JB9S 1NRNH 4XRNA 3A7YA 2CMYA 1GBDA 4ABDA 5CHAB 1EPTA 1WV7H 3V3MA 3PWCA 5JBAS 4FU7A 1SGDE 5FBEA 5ESBA 5JYIA 1SQAA 3SU1A 2LP6A 1AD8H 3F2FA 7LPRA 4RT0A 4A1XA 3RXQA 1GJ7B 4FUHA 3FOAA 4WVPE 4HZHA 2QC2A 5GCHG 4ISOA 1NRPH 1YLCA 3DT0H 4MG3A 4KP0A 3GY5A 1YBWA 3A7ZA 1JRSA 1EKBB 3GDVA 4XD7D 1GCDA 1EAUA 4Z0KA 2P94A 3I78A 2F83A 3OYPA 5HKKD 1BMLA 2GGVB 5EQRA 1GHXH 3TVJB 1DUAA 1QQUA 3M3VA 1EOJA 1EAWA 1QRZA 3LPRA 2ZGHA 3BF6H 3A86A 2ZNKH 2BXTH 1S5SA 2ZCLP 3K9XB 1OP0A 1VJAU 1F0SA 4AFUA 4UEHH 3CS0A 5LPFA 2ZI2H 2OQ5A 1BQYA 4YOJA 1GVKB 3RU4D 3SUEA 2A7HA 4WH8A 1DSUA 3GCHC 1KMHB 4BAOB 2ZECA 5IYTA 2JH5D 1FI8A 3DCLA 4B73A 2XWAA 1TNGA 3F6UH 1AY6H 4DGJA 4MPWA 1BHXB 3O8BA 1FN8A 3AAUA 1C2LA 2F9PA 4CRBA 2UWOA 3UWIA 1AWFH 3QGNB 1WBGB 3VEQB 2GZ7A 2QCYA 3QLPH 2QE7D 5DP3A 3RU4E 3N99A 1FDPA 4I8JA 4B1TA 1O2QA 3TK9A 1S0QA 1TYNA 1CSOE 1MU8B 5A0AE 1YF4A 2PWXA 2BM2A 1JRTA 2ZU1A 1QL9A 1ZJKA 2ZPQA 5J4QA 1FAXA 1TIOA 1JBUH 5T6FA 3DHKH 4FUGA 3UB0A 3A89A 2A7CA 1G3BA 3VGCB 1S6FA 3RXVA 2SGDE 2JKHA 4AFQA 2QV1A 3Q3KA 1CVWH 4ACBA 4FU8A 1LHDH 1IQFA 1YCPK 1SSXA 3S7HB 1O3PB 2XXLA 1ELVA 2HVYB 2PUXB 1HAHH 3DSPA 1ZSKA 3RUOA 3ZZ5A 4H4FA 5T3HA 1TPPA 3HK6B 4ASUD 2J92A 3E1XB 1SQTA 4Q4LA 2A5IA 2VVCA 1MKWH 1F0UA 5DPAA 4FU9A 1C5ZB 3QUMP 4UFDH 3AW0A 3OEED 2VWMA 5ETXA 2V7QD 2AMDA 1MBMA 1SMFE 1T8OA 1W10U 4X2YA 2SNVA 1EJAA 2K8IA 4I33A 1LVYA 1FUJA 3F2HA 3A8BA 3TNTA 4U2WA 2VWOA 3UTUH 1AQ7A 1NTPA 1QBNA 2PP6A 1L1JA 1VCPA 1A5IA 1PQ7A 4X2XA 4I8KA 1AVWA 1C1QA 4KTSA 2PTCE 1MMJN 1FV9A 1XUFA 1MKXK 1D6WA 1MU6B 1XUKA 4X6OA 2BQ6B 1TQ0B 3U98H 3T27A 1L4DA 3ODFA 3NWUA 4ZROA 1C5UA 2ZGCA 3VB7A 2HLCA 1F2SE 2WPKS 5DN6D 5TCCA 2ODYB 2VB0A 4NFEA 2UUJB 3SJKA 4LZ4B 1A5HA 5E2OA 4UFGH 2RFKC 1XUHA 3QGJA 3NCLA 1NC6A 1GHAG 4Q7ZA 1GMCF 2ZDKA 3VPKA 2ZU3A 5C67A 1DSTA 3F0OA 2NU2E 3QO6A 3MQKC 1SGYE 3NPSA 1TB6H 4X1QU 1ESAA 2QF3A 3H09A 2QGRA 1Q2WA 4OS2A 1TOCB 1K2I1 2ZGXH 5AHGH 3KEEA 3PTNA 1M9UA 2GP9B 1ETTH 1ZRKA 2W6JD 2Z3CA 3NK8A 3F0PA 2W7SA 1W12U 1CA8B 2P3FH 1IHSH 2D8WA 3RXBA 1BTXA 4B74A 1EAIA 1SGIB 5C1YA 5GNDA 1RGQA 3F68H 1E35B 3KYFA 1O2SA 1W14U 1UCYH 3SORA 1Y59T 5EJLA 1HJ8A 1TMUH 1RFNA 2FX6A 1VKYA 1AU8A 2ZQ2A 3ENSB 1DXPA 5GPIB 2KCAA 1GJ4H 2R2MB 4WMDA 4ABJA 1P3EA 1S0RA 1CHOG 3TK5A 4CR9A 3PTBA 1GMHF 4XE4A 1FY4A 2AIPA 3TITA 1GPZA 1FAKH 3KCGH 5AFZH 3BV9B 2AEIH 3DSOA 2JIZD 3ZV8A 1Z8GA 2BDIA 2P8OC 1W11U 2QXHA 5FX6A 5A0CA 2Q1JA 1GJDB 3ZZ7A 2OCVB 5SGAE 1F5KU 2R0LA 1CA0C 5I25A 3P17H 4TPIZ 4K5ZA 1J17T 3OTJE 1C2GA 3STJA 3HPTB 1RS0A 1MZAA 2FOAA 1D3QB 5BPEA 1P09A 2BD2A 4IMZA 2F4LA 4ABEA 3RXGA 3PWBA 2ZFRH 4D9QA 2CXVA 1O2UA 4AG2A 4CRAA 1BMMH 4GHTA 1YPHC 1SGQE 1O2TA 1HJAC 2FOMB 2A4QA 2AS9A 1BHXF 1HAXB 5DG6A 1OXGA 1K1JA 1O3OA 2QF4A 2UWLA 3GDSA 3RM0H 2ZHWH 2PSXA 3LKWA 3ZYEA 3QDZB 3LONA 1P2NA 4BTIB 3UREA 2ZU5A 1W0ZU 3P8GA 1P2JA 4ZHMU 3MI4A 3ZYDA 2STAE 2PUQH 4AX9H 3MO3A 1F5RA 1P12E 1CT4E 2A5AA 3UQOA 1EASA 3OE7D 4BAQB 1OP2A 2C4FH 2ZFSA 2HALA 2YNBA 2C8WB 3VG8A 3S9CA 5EPYA 1EZSC 1KY9A 2AYWA 1C2JA 3K6ZA 3GYMA 2ZFQH 1MAXA 2XOKD 4BXWA 1Y3WA 1ZSLA 2SGPE 3RXTA 2NWNA 1AVXA 2FOGA 2FO9A 1O3GA 2PLXA 5G4BA 1P06A 1SI5H 4NSVA 1ELTA 4CH8B 4Y0ZE 2R3UA 4MPVA 4K1EA 4Y8XA 1YP9A 3BIVH 1XX9A 3UNRA 4NIWA 3ZZDA 1P10A 4A6LA 2ALVA 2FOCA 3RC6A 4IMQA 2Z9GA 5F8TA 3V7TA 1GHBF 2EI8A 1DICA 4Y11E 4THNH 2FXRA 3TJOA 4IW4E 1AB9B 1BRCE 3A81A 2BD3A 4F55A 1O5EH 2PR3A 3FP7E 4X6MA 1FY5A 1WTGH 4VGCB 4Y8YA 1HV7A 1GBBA 2XNIA 4X8TH 3Q76A 1F92A 2Z94A 2XBWA 4J1YA 1JMOH 2SGAA 3KHVA 4X1NU 2TIOA 3L6PA 4NCYA 2SNWA 4BAMB 2Y7ZA 3BG8A 1O31A 2C8ZB 1J9CH 3C1KA 3UNQA 2VU8E 2GV7A 1C2IA 2OP9A 5DP9A 1PPCE 2BDBA 1INCA 4NZQA 4BXSA 1B7XB 3OFND 3ZZ9A 1KXBA 3HKIB 3TGIE 2A5KA 1O2ZA 3IWMA 2XCNA 1ELEE 1QJ6B 1EJNA 1O36A 1PJPA 2RCEA 3QX5H 2PGBB 1WU1A 2ALPA 2JH6D 3MU1A 4NWLA 2C8XB 2A1DB 1DPOA 4YZUA 1NT1A 1OS8A 3LJOA 4HFPB 3RXFA 4AYVB 1SGEE 1O3BA 3IG6B 4CRFA 2GV6A 3LJJA 3HK3B 1H9HE 3H7OA 4Y10E 1G3EA 2P95A 1QCPA 4OGYA 3KN2A 2ANMH 2VH6A 1W0JD 1ANEA 4FUCA 2Y7XA 1HJAB 1TABE 4BANB 2ZCKP 4E7NA 3EE0B 1BRBE 1NFYA 3BTHE 1V2JT 3MNBA 5JBBS 2G5NA 3KGPA 1EZUC 1NS3A 2FIRH 4NA8A 4TY7A 2J38A 5EQQA 2TGPZ 1P8VC 4YESB 1N8OB 3RXUA 1QRXA 4K60A 1MTSA 5A2MH 2SFAA 1S84A 1SOTA 3K2UA 3O8RA 1TGTA 1WUNH 3LGWA 1FMGA 1YPMH 3M36A 1AHTH 1V2RT 4GLYA 2QF5A 4TYDA 3HGPA 3SI3H 3Q3YA 1K21H 4YLQH 2ZP0H 3NUMA 1D6RA 2XBXA 1WXRA 2EY4C 3M7UA 2G81E 2F9OA 2FI5E 3SGQE 3SBKA 1SLUB 1XXFA 1S81A 2CK3D 3ITIA 4PROA 2BD8A 3DFJA 1MUEB 3U8TH 4NWKA 3U69H 4ABGA 1NESE 1LPGB 1YKTA 2AH4X 1SFIA 2ZTZA 1C2FA 3GS9A 1K1NA 5EOKA 3ZVFA 3ZVBA 2WPIS 1KTSB 3BSQA 1GJ8B 3AW1A 3ZZ3A 3F9FA 4CR5A 3T2NA 3A83A 3ZVGA 1QB1A 4D8NA 3E8LA 3T29A 1FNIA 1XMNB 1Y8TA 2A2XH 5C20A 2J94A 1NU7B 2BD4A 2BX3A 1Y5BT 4FVDA 4FVBA 1QFKH 3GCTF 1OWJA 2OD3B 2P3UB 2PTNA 4A5TS 1CHGA 2WINI 1KXEA 3BTWE 3GCTG 1YM0A 2A4GA 1UMAH 2EI7A 4Y79A 5ESTE 1QQ4A 2VWNA 1THRH 3A7WA 1GL1A 2BMGB 3T26A 5CE1A 5HM9A 1ZPBA 2H9TH 3SGBE 1EPTB 4I86A 1N6XA 4ASHA 2TBSA 1DY8A 3P8OA 1GVLA 1D3DB 1QBVH 1NZQH 1QJ7B 2UWPA 1SKYE 1WTHD 4FUEA 1C5LH 1F0TA 1V6DA 1MH0A 1AIXH 1GGDB 3GY3A 1TAWA 4ZCNA 4GSOA 1HB0B 2Q6DA 3BTQE 3LC5A 1CGJE 3GCHB 3RXDA 1ARCA 2EA3A 1LVMA 1AFQB 1V2LT 2RA0A 1O2MA 3F9EA 4I8HA 5FXLA 2JDID 3ZZ4A 1OWIA 1DDJA 1O2PA 3NZIA 4NIVA 5LPEA 5EU8A 1HXEH 3RM2H 1SGRE 2GDEH 3WWFA 2ZFFH 5BRRE 5E0GA 2JH0D 3P8NA 2QA9E 3T5FH 3ATWA 1MKWK 4ZH8A 4DW2U 4JZEH 4DCDA 1EATA 1PYTD 1EAXA 3QK1A 1DT2A 1C2KA 1P04A 2FI3E 1C5NH 1L1NA 3JZ2B 2D1JA 1TX6A 1EB1H 3MNCA 1BBRH 1ZGIA 1UVSH 2VJ1A 1N6YA 4JK5A 1PPFE 4AYYB 5LH8A 5A8XA 1FONA 1N1LA 4P02A 1CO7E 2VIDA 4FUDA 4LXBH 4Y7AA 1SFQB 1DOJA 3ZVEA 1NBMD 5DJ7A 3ZZ8A 2F9NA 2BDGA 1ZGVA 2PKSC 2VH0A 1MZDA 1S82A 2BLQA 3RMLH 1IQEA 3RXRA 4P00A 3OY6U 1V2UT 2ILNA 2ZO3H 3EYDA 4B75A 4VGCC 4UDWH 1E79D 1EJMA 1A61H 1C2EA 3KQEA 5EXNA 2EQNA 2OC8A 2Y5HA 3A87A 1HAIH 2XC4A 1NBME 4FUJA 3GCOA 4MPXA 3SU4A 1GJ6A 2ZFPH 1JIMA 1ABIH 3M3TA 1AO5A 3BTFE 1GI6A 1O3CA 2XBVA 3D62A 1O3FA 2ZCHP 2O8UA 4ISNA 1EQ9A 1D3TB 3KYGA 3WWBA 1Q31A 2G52A 2ZHEH 4CREA 5K7RA 1VR1H 1BB0B 2Z7FE 4JZDH 4K1SA 2WUCA 1PPBH 2VVVA 5F53A 5HXFA 3RMOH 1K1MA 3K65B 5EJZA 1HBTH 3SZNA 1BJUA 5CHAC 1ESBA 1LPZB 1YY3A 1RIWC 1V2ST 1TNHA 2KCYA 2QAAA 2QIQA 4YO9A 4RT1A 3BIUH 3E91A 2ZHFH 2HVXA 1YPHE 3U8RH 1B0FA 3GY6A 2XTTB 1ELFA 4JZFH 3SNBA 1ABJH 2VIOA 3KQ5A 5F03A 4A1TA 1BMNH 3FZDA 4UE7H 1L2EA 1BMFD 1C5QA 1ZLRA 3E16B 3SU3A 1HAYB 1C1WH 3DSGA 1Y3UA 1GHBG 1EOLA 1GWAA 2W3IA 4ZKSU 1WCZA 4O9VA 3RDZA 2BVSH 4TPYA 3SNEA 3MH4A 2H1UA 4U01A 1A3EH 1BOQA 2A4OA 1ZTJA 1MTNB 1BMAA 1V2NT 2YMSC 3OEHD 4OS6A 1TBZH 1OHHD 3A8CA 1T32A 1TX8A 2YNAA 1TNJA 1XUIA 1GBLA 2C93B 4IC5A 1GBTA 1F5LA 1UW7A 2J5UA 3Q00A 4ZMAH 1C5YB 1HIAB 1KYNA 3BEFB 1H8IH 2FOBA 2OBOA 1A7SA 4ZXYH 1EUFA 2A45B 4DIIH 3V0XA 3ZVCA 1O5FH 3FZZA 1QR3E 1H8DH 1SC8U 2W5EA 2YOLA 4ABAA 4CRDA 3BN9A 1WQSA 2AERH 1C1NA 1ZOMA 3B23B 4RSPA 3ZZ6A 1BBRE 1S6HA 2XYAA 3RXKA 1KXFA 3AVZA 3SW2B 1T7CA 2VBCA 5C94A 4X2WA 2WUBA 1PPHE 3OAAD 4Q80A 4BTUB 1V2OT 4MLFB 1YGCH 2QYIA 1GMDG 2WPDD 1UVPA 1XUJA 2IJOB 1MTUA 2O8TA 4NIXA 1SLXB 1TNIA 2GDDA 2P8OB 3RLYH 2XNDD 3CNRA 2OC0A 1S85A 1Z8RA 3H7TA 4GUXA 1V2VT 1KXDA 2RG3A 3SNCA 3ZZAA 2DUCA 4DY7B 3F3BA 3U9AH 1E36B 3W1EA 1ZPCA 2JJ1D 3A82A 4KTUA 4WXIA 2FYQA 1P2MA 2FS9A 3TJVA 5FCRA 1TGSZ 2QXGA 2FYRA 1V2TT 3GICB 1TA6A 2J2UA 1NFXA 2I6SA 4INHA 4FUFA 3S0NA 3VFEA 2A4RA 4D9RA 1TQ7B 4SGAE 5C3NA 1P2KA 2BY6X 3RXAA 1P2OA 2FMJA 5GWZA 3SO3A 3ATKA 4RKOB 4DG4A 1C5TA 1TPOA 1O2JA 2P93A 4ISLA 4ZKOU 2AGEX 2PKAB 2Z9JA 1C5RA 1WDIA 1QL8A 4IBLH 4UFFH 4JYUH 7GCHG 1YPEH 2CGAA 3RXIA 2BX4A 4X8SH 4E7RG 2FX4A 1C9TA 1GBHA 2QXJA 1TA2A 4Y71A 3D65E 1SPJA 3DA9B 3EA9A 1LKAA 1LVBA 5H4IB 1H9LB 2ZQ1A 2O9QA 5EG4A 2ZPRA 2D26C 3FVFB 1E1QD 5B6LA 3KQCA 1HFDA 3TNSA 1C2DA 1UTOA 3U8OH 1W0KD 1RTKA 2BY9X 3KL6A 2TPIZ 5DSFA 2ASUB 3SHAH 2GZ8A 2CV3A 4DIHH 2FZZA 2VGCB 5F8XA 1CA0B 1W3CA 5DP6A 3A7VA 4Y7BA 1LTOA 1UTQA 5JBCS 2J98B 4D7FA 3TU7H 3M5NA 1KLTA 2XRCA 1E37B 3VB3A 1C1SA 5L2ZH 4BOHA 4NZLA 2BY7X 1UHBB 3ATIA 1DWEH 4OS1A 4NG9H 3VB4A 1OOKB 2P3TB 5HMAA 4MDSA 1NPMA 2AHME 2ZIQH 3QZRA 5E0HA 1TGBA 4WH6A 3SQEE 1GJ5H 1QY6A 1P2QA 3B9FH 2BD9A 2V0BA 3MU4A 1HXFH 1QRWA 1QJ1B 2OINA 1VJ9U 5DP5A 2GCTC 3RC4A 2A31A 4ABHA 1O3NA 1SQRA 3FKSD 1E38B 4J2YB 4ABIA 5T1VA 4B6FA 4ZXXH 3MOCA 1PQAA 1MABB 2ODQA 1TPSA 4HG6A 4GAWA 5C5OA 4RN6A 1AUTC 5GXPA 1EB2A 1Z71A 3P92A 3PRBA 3TJNA 3I77A 1MTNC 2GZ9A 2ZDVH 3OSYA 1GBKA 1QURH 2BZ6H 3RXPA 3RXMA 2BTCE 1D9IA 3PV5A 2OTVA 1BJVA 2Y80A 5LGOA 8LPRA 2ZFTA 4RI0A 4MVNA 5DKMA 4TWYA 2PHBA 4HTCH 2ZGJA 3PLBA 5CHBA 3PV4A 1PPZA 3TIUA 1Y3XA 2HPPH 1C5MD 1P9UA 2VIVA 4ZUHA 1XKBC 4ACAA 4XBCA 5FPYA 2UUKB 1OP8A 1LVOA 1C2MA 1G2LA 5B6OA 1DUEA 2P16A 2BOKA 4O97A 4B2BA 5C2ZA 1OYTH 1G2MA 4UONA 5HM2A 1C1RA 5EXLA 3FO8D 3PMHB 1IQJA 1G3DA 2K0QA 3BG4B 2SGFE 3MYWA 1JXPA 2CHAB 2I6QA 2W6ID 3ATMA 1QBOA 1IQGA 3RLWH 1BTYA 2ESTE 2BDHA 1T8LA 4X2VA 1WOFA 1THSH 2EC9H 2Y82A 2V3MA 1W8BH 1BRUP 2GMTC 3RXOA 3MFJA 1HAVB 4I7YH 1PQ8A 3LIWA 2GJGA 1J14A 3TH4H 1SGNE 5C1UA 1YC0A 3BTEE 1VCQA 1DE7H 1C1OA 3GDUA 4TWWA 3RXCA 1NRQH 2BDCA 1PPGE 1AMHA 3QWCH 4NGAH 3AK5A 3FFGA 2GCTB 2F43B 3MTYA 1SBWA 1XVOA 1TONA 2QF0A 3D49H 4XDEA 3PM3A 5FHTA 2BYAX 2IN2A 2B5TB 3M5LA 4WWYA 2RA3A 2OUAA 1YPJH 4Y6DA 1AZZA 1TNLA 1SVPA 1OWDA 3PRDA 5EQSA 2FOFA 3TK6A 2BQWB 2AIQA 1O2IA 2B8OH 1IQNA 3OU0A 1P3CA 2WYGA 4H6SB 5EJ1A 1E34B 1ZSJA 2BQ7B 2BD7A 3D23A 3GY2A 1FY1A 1GI4A 1Z8JB 2XC0A 5F8ZA 3UR9A 1O2OA 2L74A 4LZ1H 1A0LA 1F7ZA 1ELBA 3TLOA 1BA8B 1RJXB 2GT8A 1LHCH 5CDFE 1H8ED 1A3BH 2AMPA 1O2NA 4GVUA 4AB9A 4HGCA 1KXAA 1ZHMA 4WJG2 1C5PA 3A84A 4MNVA 1IQLA 7ESTE 3ZZBA 4MTBA 1KXCA 5TJXA 3FN8A 1CBWC 1E0FD 1OWHA 2D2DA 1FPCH 1J8AA 1NM6A 5T6GA 3SU0A 1O0DH 3O8CA 1ZRBA 3SJ9A 3P8FA 4MQAA 4ISHH 4NA7A 5AFYH 2BOHB 5EXMA 1L1GA 1V2MT 5GCHF 3RXJA 1BITA 2FLBH 1HCGA 5GIBA 1H8HD 4A7IB 3I29A 1O3DA 4CHAB 1HDTH 3E90B 5I46H 5FX5A 5C17A 3E0PB 4B2CA 2G00A 1OYQA 1G9IE 4BAKB 5GJ4B 2ZDNA 2ZG0H 5HYOA 5E2PA 5E0JA 2KAIB 3RXSA 1CT0E 3SUDA 2Y5GA 1Z1JA 3L33A 1YPKH 3UWJH 1GHYH 1ANCA 1UK2A 3LGIA 3Q3XA 1N8OC 4MNXA 1O33A 3RXHA 3TH3H 3OX7U 2YMSB 1ZYOA 3E6PH 3OY5U 5DK1A 1VCWA 3PROA 3STIA 3CENA 2BDYA 4KTCA 2HWLB 1HAVA 5EODA 3F1SB 4ESTE 2JETB 2CN0H 1UK3A 1O3JA 2KFWA 1AB9C 2PV9B 4LOYH 1YPGH 3BG4C 1YCPH 1KTTB 9LPRA 2VWLA 1FN6A 4YLUA 5JDUB 3SV2H 1GDUA 3GOVB 1H1BA 3MH7A 3RP2A 2ZEBA 3M61U 2O8MA 2XCFA 4AB8A 2VIPA 2ZWLH 1DWBH 3SZEA 1YPLH 3DD2H 1ZMJA 2BB4A 1TLDA 2F9UA 2G55A 1FPHH 2FTMA 4TSFD 2CF8H 5JPMH 4O03A 4XBBA 4K8YA 4E05H 4YOGA 1EXFA 3DUXH 1HGTH 3PV2A 4B76A 1A2CH 3IITA 2BLVA 1GBCA 1Z6JH 4DOQA 2Z3EA 1BT7A 3PO1C 4ZKRU 1GHZA 2THFB 5DO4H 3A7XA 2UUFB 5LPRA 1NFUA 2Z6BD 3KNXA 1SHHB 1O5CB 2DE9A 1GBAA 2BXUH 1EP6A 1O30A 3PO1B 3S7KB 4AFSA 5ABWA 3QN7A 3O8DA 3MO6A 3PMJA 2FOHA 4JYTA 1O37A 2J98A 3CS7A 6LPRA 2AGGX 1RD3B 2ZDLA 1KIGH 3V13A 3M37A 1F0RA 1FXYA 3SOSA 4KELA 1T8NA 5L6NH 1LHGH 3P6ZB 5A8YA 1LDTT 3LH3A 2BVRH 2WYJA 2ULLA 1BDAA 3RMNH 1QHRB 1TMBH 1YYY1 2VIWA 2ZU2A 3KIDU 3T28A 4ABFA 4CRCA 4JK6A 4IN1A 4K69A 1FZZA 4JZIA 1IQHA 1MKXH 1ZTLA 4OGXA 2AMQA 1UTPA 5KECA 2IOTA 3UOPA 1SGCA 1H4WA 3PB1E 1MQ6A 4NSYA 3PMAB 4GHQA 1ELGA 1ELDE 2ZA5A 4YOIA 1TBQH 1OPHB 3EQ0H 2B0FA 1UTJA 1UTKA 3SV9A 3SJIA 2NU0E 1HPGA 1IQKA 1BTPA 1TNKA 3N7DA 7KMEH 3UFAA 1QGFA 3S9BA 1MTVA 1Y5AT 1O5BB 1P05A 1CU1A 1GHVH 6CHAB 2WSSD 1ANBA 2A2QH 1QA0A 1QL7A 3F9GA 2WPMS 1GI0A 2ZF0H 3ESTA 1S83A 1Z6EA 1O3MA 4YT6H 4RKJB 3HKJB 3EA7A 2J34A 5L30H 1K1OA 1IOEA 2FS8A 1UHBA 1AKSA 2C8YB 1QB6A 1A46H 3ZV9A 3V12A 2FPZA 2C90B 3SQHE 1O3AA 1T4VH 1TWXB 4KGAA 4CBOA 3A85A 1P02A 4AFZA 4F4OC 1GG6B 5HIYA 1JWTA 3A88A 1UTMA 2ZU4A 1THPB 4OS5A 2Q6GA 1G36A 2KX4A 1CGHA 3SN8A 3BTME 1BBRK 1GVZA 4I32A 3NKKA 2VIQA 3UQVA 4WY3A 1RRKA 1C4U2 4MNWA 2HNTC 3GISB 5KGOA 3SU2A 1C2HA 2GX4A 3UOUA 1PYTC 1O2RA 2O8WA 1TFXA 1DVAH 1LCYA 1DITH 1ZTKA 2F3CE 8GCHF 5EGMA 1GBJA 1SLWB 3GY7A 3SU5A 5AVDA 2LPRA 1UTNA 3VB5A 3NXPA 1AI8H 1RIWB 3SI4H 5IDKA 4X6PA 4AOQA 3FP8E 2ZPSA 4U32A 1GI1A 1O2WA 3C27B 5A09A 1ZPZA 2TGTA 3FAOA 4UFEH 3LC3A 3UIRA 2OLGA 6CHAC 1NRSH 1O5AB 1LHFH 1ETSH 4KKDA 2QXIA 1GDNA 1COWD 3AASA 4X0WU 2JJ2D 3UAIC 2BLWA 2XWBI 4DT4A 1CT2E 1A5GH 2FODA 2KCPA 2W3KA 1NRRH 3F2GA 2Y81A 1AFQC 4YTAA 4U30A 3SGAE 3JZ1B 1O2HA 1AE5A 1ZMNA 1ZHRA 1TE0A 5JBTA 1GGDC 1Y5UT 4BAHB 2FI4E 4NIYA 4IC6A 3CP7A 6ESTA 1GI2A
chains in the Genus database with same CATH topology
1BUIA 1RTFB 2GD4B 2G4UA 3N7OA 3SV8A 2OQUA 2GT7A 4XBDA 1C5VA 1GMHG 2CHAC 2KAIA 4GPGA 2XBYA 3R3GB 1CHOF 4DURA 1H9IE 1ZZZA 3KQBA 5DP7A 2OC7A 3LGYA 4TY6A 2A7JA 2F9VA 1SL3A 1A0HB 1AZ8A 1A0JA 4CHAC 1MBQA 1GJBB 1XXDA 2Q6FA 1MCTA 2A32A 2ZDMA 4X8UH 4XOJA 2Z9KA 1HAZB 1P0SH 3WY8A 4YM9A 6GCHF 3ELAH 3PMBB 1ELAA 1VGCC 1O5GH 3GY8A 1K1IA 4WXVA 3A8DA 1O38A 2K1QA 1AKSB 2FESH 2P59A 1HJ9A 3A7TA 3M35A 3ZVDA 2ODPA 4XSKU 2FM2A 2HGTH 1GI9B 4NA9H 2H9HA 1OKXA 2UUYA 2BLOA 1MCVA 5A0BA 1GBMA 3U1IB 5FAHA 1GHAF 1BTZA 1ZJDA 2BVXH 4Q7XA 1O39A 1ESTA 1K1PA 1G32B 1O32A 1P9SA 4INKA 1XM1A 1DWCH 1V3XA 1BIOA 4CRGA 1ETRH 3TGKE 1BTWA 1W7XH 1GBEA 1LQEA 1SGPE 2WPLS 1D3PB 1GJ9B 5EW1H 1TPAE 1ORFA 1GCTC 2V35A 2WPJS 3T62A 1L4ZA 1OX1A 2JETC 2PGQB 2H5CA 4INLA 3SJ8A 3MHWU 2HPQH 2Y6TA 1HAPH 2ZTYA 2BY5X 3PYHA 1LHEH 1IQMA 2M5TA 4Z6AH 1O2VA 2PSYA 2G51A 2GCHG 3TGJE 1AFEH 5FPSA 2OXSA 1V2QT 2G5VA 1VITG 4X1PU 1ACBE 1DS2E 1AUJA 4AGKA 4B2AA 5J4SA 1EZQA 3SJOA 2BHGA 1W0YH 1Z8IB 2B7DH 1AWHB 4B71A 4FXGH 1WQVH 3SHCH 4K8BA 1UK4A 2ZTXA 5PTPA 1GDQA 8KME2 2HRVA 3KF2A 1K9OE 1LKBA 2A0QB 4AORA 1QTFA 4MNYA 2TGAA 1KDQA 1QB9A 1L0ZA 2ZKSA 1VITF 5C5NA 1XUGA 1JOUB 4DVAU 1DANH 1DLKB 1SOZA 3UPEA 5F6MA 1SGTA 4IS5A 3GCNA 4K2YA 5C1XA 2EEKA 3UUZA 3RXEA 2FWWA 1NN6A 3LT3A 2HOBA 3LGTA 4WMFA 8ESTE 3P70B 3F9HA 3U1JB 3MU5A 4A92A 1CBWB 1G3CA 1AGJA 2ZC9H 1PPEE 2RDLA 2ZHQH 4FUIA 3SNAA 1OWKA 2W26A 3LH1A 3RU4T 2AGIX 1UVTH 2ZHDA 3B8JA 1EPTC 1HIAA 2ANWA 4H42U 3UNSA 3G01A 9ESTA 4D7GA 3HGNA 4X6NA 4LK4A 1IQIA 4WF8A 1HNEE 2FTLE 3VXFH 1WSSH 1X7AC 1NROH 1GMDF 1NO9H 4XFQA 3MU8A 4Y0YE 1GI5A 1HLTH 3L3TA 5TCAA 3SV6A 3TPIZ 1UCYK 2GTBA 4CBNA 2Y5FA 1FY3A 2STBE 1UTLM 2HNTF 1SR5C 3S9AA 1VZQH 1MTWA 3VGCC 1UVUH 1W13U 1GI7B 1Z7KA 6GCHG 3GY4A 1XVMA 7GCHF 2FLRH 3SUGA 2Z3DA 1EX3A 4JYVH 2EI6A 1V2KT 2H2ZA 3PLPA 4D76A 5DGJA 4ZHAA 4OS4A 3W95A 5GDSH 2FP7B 1GMCG 1FJSA 1HAGE 2J4IA 1U6QA 2O8LA 1UJ1A 2SGEE 3MWIU 4JZ1A 1ZHPA 1J16A 3M7TA 3EAJA 1ANDA 1T4UH 2OC1A 3MNSA 1YCPM 1AN1E 3T25A 1Q3XA 4Y76A 1EP5A 1W7GH 1J15A 2R9PA 2FOEA 1KDQB 3M5MA 2NU4E 1GJCB 2LNCA 2V3HH 1ELCA 1C1MA 3ZZCA 2FDAA 4X8VH 5AF9H 1MQ5A 4FUBA 1DWDH 4M7GA 4X1RU 1A4WH 4SGBE 1C1PA 1TOMH 1V2PT 1TBRH 1DY9A 2V3OH 1C5OH 4ABBA 2VVUA 1SB1H 4ZHLU 2WV4A 2ZGBH 1GHWH 4IGDA 2PFEA 4HI3A 1BTHH 2HNTE 4IN2A 1O34A 1P2IA 1DXWA 5FBIA 2V6NA 1LPKB 1CGIE 1TRNA 3H5CB 5L2YH 1GI8B 3QZQA 1CQQA 8GCHG 5DP8A 2H5DA 2C3SA 1C9PA 4A1VA 1KLJH 1P01A 1VGCB 2VINA 3E0NB 1QIXB 3URCA 1CE5A 2GCHF 5E8EH 1Y3VA 1GBFA 4O3UA 2CF9H 1HYLA 2TRMA 2G8TA 1VITH 1Y3YA 2VNTA 3TH2H 2AFQB 5K0HA 2VGCC 2FEQH 1EZXC 2J9NA 5EW2H 1B0EA 4NFFA 1K22H 1AVGH 1GG6C 3A8AA 3MMGA 3QTOH 1QA7A 2XC5A 1GCTB 1DM4B 1LQDB 2DE8A 3M3SA 1C5SA 2GVFA 1T8MA 4ZKNU 1O3IA 4YT7H 1K28D 4AG1A 3A80A 4K3JA 2NU1E 2R2WU 3EDXB 3SNDA 4BNRA 1A1RA 2G4TA 3UY9A 3GYLB 1T31A 1MAYA 3PLKA 1B5GH 2B9LA 4OS7A 1O3EA 4GCHG 4R0IA 1OWEA 1UCYE 1TRYA 4WMEA 5CMXH 5T6DA 1O2LA 2XW9A 4JCNA 4ISIH 2GMTB 4BTTB 3LGVA 1GI3A 1GL0E 3EGKH 5EPNA 1TRMA 1MD7A 1FY8E 1P03A 1O2KA 2BZAA 1G30B 3LU9B 3SU6A 3M5OA 1TX7A 3URDA 2CJIA 1LO6A 2PKAA 3BTDE 1UVOA 2R0KA 1JIRA 2PKSB 3BTTE 2H6MA 3S69A 1BZXE 2IPHA 4MPUA 4O3TA 5FPTA 3BTKE 1FLEE 1LMWB 3M7QA 2WPHS 4I8GA 1BRAA 2ZDAH 1C4Y2 2NU3E 1P11E 3SV7A 3RC5A 2WV5A 1C1UH 1TGNA 1WAYB 1GBIA 3ATLA 1Z1IA 3LDXH 3MH6A 1TALA 4AN7A 1FIWA 4F49A 1G37A 3DFLA 1FQ3A 1HUTH 2J95A 2ZZUH 1O3LA 3RXLA 3R0FA 1IHTH 1RXPA 3LOXA 4E06H 3MNXA 3FP6E 5A8ZA 1TGCA 3P95A 1KSNA 1ZMLA 2QY0B 3TJUA 1SHYA 1OSSA 1D4PB 1RTLA 1HRTH 2PW8H 2R3YA 3Q77A 4R8TB 2F91A 2SGQE 1PFXC 3W94A 1ZR0A 1TMTH 2BD5A 3KQDA 1UO6A 3BEUA 3EA8A 3AAVA 3ZVAA 1C1TA 1MD8A 1DLEA 1C4V2 1C1VH 1DX5M 1FIZA 1O35A 1ID5H 1NFWA 1QNJA 1DFPA 3UR6A 1SLVB 3ODDA 4K1TA 1P57B 3MH5A 5FCKA 2QN5T 4QT8C 4DJZB 5JB8S 1K1LA 4Q2KA 2Z9IA 2W7UA 5DP4A 2BY8X 1AE8H 4DT7B 1ARBA 3LGUA 4GCHF 2F9BH 3FANA 4I31A 4I8LA 2H9EH 1C5XB 1SGFG 1W2KH 4Y8ZA 4ZAEA 4AGJA 1NY22 2GKVE 1O2GH 3SUFA 3K6YA 1BTUA 3BTGE 1O5DH 1SQOA 4CH2B 4H6TA 3MU0A 1O3HA 1WYKA 1PQ5A 1SG8B 3RMMH 3MO9A 2TGDA 3HATH 5HGGA 2BDAA 2OBQA 3VXEH 1YLDA 4UD9H 2ANYA 1O2XA 4AZ2B 1IAUA 1C5WB 1GJAB 1O3KA 4JMYA 1XKAC 2Z9LA 4X1SU 3E3TA 1V2WT 1SGFA 1NU9A 1BCUH 4Q7YA 3BEIB 3QTVH 2ANKH 1HAOH 3VB6A 1O2YA 1KLIH 5JB9S 1NRNH 3A7YA 2CMYA 1GBDA 4ABDA 5CHAB 1EPTA 1WV7H 3V3MA 3PWCA 5JBAS 4FU7A 1SGDE 5FBEA 5ESBA 5JYIA 1SQAA 3SU1A 1AD8H 7LPRA 4A1XA 3RXQA 1GJ7B 4FUHA 4WVPE 4HZHA 2QC2A 5GCHG 4ISOA 1NRPH 1YLCA 3DT0H 4MG3A 4KP0A 3GY5A 1YBWA 3A7ZA 1JRSA 1EKBB 3GDVA 1GCDA 1EAUA 4Z0KA 2P94A 3I78A 2F83A 3OYPA 1BMLA 2GGVB 5EQRA 1GHXH 3TVJB 1DUAA 1QQUA 3M3VA 1EOJA 1EAWA 1QRZA 3LPRA 2ZGHA 3BF6H 3A86A 2ZNKH 2BXTH 1S5SA 2ZCLP 3K9XB 1OP0A 1VJAU 1F0SA 4AFUA 4UEHH 3CS0A 5LPFA 2ZI2H 2OQ5A 1BQYA 4YOJA 1GVKB 3RU4D 3SUEA 2A7HA 4WH8A 1DSUA 3GCHC 4BAOB 2ZECA 5IYTA 2JH5D 1FI8A 4B73A 2XWAA 1TNGA 3F6UH 1AY6H 4DGJA 4MPWA 1BHXB 3O8BA 1FN8A 3AAUA 1C2LA 2F9PA 4CRBA 2UWOA 3UWIA 1AWFH 3QGNB 1WBGB 3VEQB 2GZ7A 2QCYA 3QLPH 5DP3A 3RU4E 4I8JA 1FDPA 4B1TA 1O2QA 3TK9A 1S0QA 1TYNA 1CSOE 1MU8B 5A0AE 1YF4A 2PWXA 2BM2A 1JRTA 2ZU1A 1QL9A 1ZJKA 2ZPQA 5J4QA 1FAXA 1TIOA 1JBUH 5T6FA 3DHKH 4FUGA 3A89A 2A7CA 1G3BA 3VGCB 1S6FA 3RXVA 2SGDE 2JKHA 4AFQA 2QV1A 3Q3KA 1CVWH 4FU8A 1LHDH 1IQFA 1YCPK 1SSXA 3S7HB 1O3PB 2XXLA 1ELVA 2PUXB 1HAHH 1ZSKA 3RUOA 3ZZ5A 4H4FA 5T3HA 1TPPA 3HK6B 2J92A 3E1XB 1SQTA 2A5IA 2VVCA 1MKWH 1F0UA 5DPAA 4FU9A 1C5ZB 3QUMP 4UFDH 3AW0A 2VWMA 5ETXA 2AMDA 1MBMA 1SMFE 1T8OA 1W10U 4X2YA 2SNVA 1EJAA 4I33A 1LVYA 1FUJA 3A8BA 3TNTA 4U2WA 2VWOA 3UTUH 1AQ7A 1NTPA 1QBNA 1L1JA 1VCPA 1A5IA 1PQ7A 4X2XA 4I8KA 1AVWA 1C1QA 4KTSA 2PTCE 1MMJN 1FV9A 1XUFA 1MKXK 1D6WA 1MU6B 1XUKA 4X6OA 2BQ6B 1TQ0B 3U98H 3T27A 1L4DA 3ODFA 3NWUA 4ZROA 1C5UA 2ZGCA 3VB7A 2HLCA 1F2SE 2WPKS 5TCCA 2ODYB 2VB0A 4NFEA 2UUJB 3SJKA 4LZ4B 1A5HA 5E2OA 4UFGH 1XUHA 3QGJA 3NCLA 1NC6A 1GHAG 4Q7ZA 1GMCF 2ZDKA 3VPKA 2ZU3A 5C67A 1DSTA 3QO6A 2NU2E 1SGYE 3NPSA 1TB6H 4X1QU 1ESAA 2QF3A 2QGRA 1Q2WA 4OS2A 1TOCB 1K2I1 2ZGXH 5AHGH 3KEEA 3PTNA 1M9UA 2GP9B 1ETTH 1ZRKA 2Z3CA 3NK8A 2W7SA 1W12U 1CA8B 2P3FH 1IHSH 2D8WA 3RXBA 1BTXA 4B74A 1EAIA 1SGIB 5C1YA 1RGQA 3F68H 1E35B 1O2SA 1W14U 1UCYH 3SORA 1Y59T 1HJ8A 1TMUH 1RFNA 2FX6A 1AU8A 2ZQ2A 3ENSB 1DXPA 5GPIB 1GJ4H 2R2MB 4WMDA 4ABJA 1P3EA 1S0RA 1CHOG 3TK5A 4CR9A 3PTBA 1GMHF 4XE4A 1FY4A 2AIPA 3TITA 1GPZA 1FAKH 3KCGH 5AFZH 3BV9B 2AEIH 3ZV8A 1Z8GA 2BDIA 2P8OC 1W11U 2QXHA 5FX6A 5A0CA 2Q1JA 1GJDB 3ZZ7A 2OCVB 5SGAE 1F5KU 2R0LA 1CA0C 5I25A 3P17H 4TPIZ 4K5ZA 1J17T 3OTJE 1C2GA 3STJA 3HPTB 1RS0A 1MZAA 2FOAA 1D3QB 5BPEA 1P09A 2BD2A 4IMZA 4ABEA 3RXGA 3PWBA 2ZFRH 4D9QA 2CXVA 1O2UA 4AG2A 4CRAA 1BMMH 4GHTA 1YPHC 1SGQE 1O2TA 1HJAC 2FOMB 2A4QA 2AS9A 1BHXF 1HAXB 5DG6A 1OXGA 1K1JA 1O3OA 2UWLA 3GDSA 3RM0H 2ZHWH 2PSXA 3LKWA 3ZYEA 3QDZB 3LONA 1P2NA 4BTIB 3UREA 2ZU5A 1W0ZU 3P8GA 1P2JA 4ZHMU 3MI4A 3ZYDA 2STAE 2PUQH 4AX9H 3MO3A 1F5RA 1P12E 1CT4E 2A5AA 3UQOA 1EASA 4BAQB 1OP2A 2C4FH 2ZFSA 2HALA 2YNBA 2C8WB 3S9CA 5EPYA 1EZSC 1KY9A 2AYWA 1C2JA 3K6ZA 3GYMA 2ZFQH 1MAXA 4BXWA 1Y3WA 1ZSLA 2SGPE 3RXTA 2NWNA 1AVXA 2FOGA 2FO9A 1O3GA 2PLXA 5G4BA 1P06A 1SI5H 4NSVA 1ELTA 4CH8B 4Y0ZE 2R3UA 4MPVA 4K1EA 4Y8XA 1YP9A 3BIVH 1XX9A 3UNRA 4NIWA 3ZZDA 1P10A 4A6LA 2ALVA 2FOCA 3RC6A 4IMQA 2Z9GA 5F8TA 3V7TA 1GHBF 2EI8A 1DICA 4Y11E 4THNH 2FXRA 3TJOA 4IW4E 1AB9B 1BRCE 3A81A 2BD3A 1O5EH 2PR3A 3FP7E 4X6MA 1FY5A 1WTGH 4VGCB 4Y8YA 1HV7A 2XNIA 1GBBA 4X8TH 3Q76A 1F92A 2Z94A 2XBWA 4J1YA 1JMOH 2SGAA 3KHVA 4X1NU 2TIOA 3L6PA 4NCYA 2SNWA 4BAMB 2Y7ZA 3BG8A 1O31A 2C8ZB 1J9CH 3C1KA 3UNQA 2VU8E 2GV7A 1C2IA 2OP9A 5DP9A 1PPCE 2BDBA 1INCA 4NZQA 4BXSA 1B7XB 3ZZ9A 1KXBA 3HKIB 3TGIE 2A5KA 1O2ZA 3IWMA 2XCNA 1ELEE 1QJ6B 1EJNA 1O36A 1PJPA 2RCEA 3QX5H 2PGBB 1WU1A 2ALPA 2JH6D 3MU1A 4NWLA 2C8XB 2A1DB 1DPOA 4YZUA 1NT1A 1OS8A 3LJOA 4HFPB 3RXFA 4AYVB 1SGEE 1O3BA 3IG6B 4CRFA 2GV6A 3LJJA 3HK3B 1H9HE 3H7OA 4Y10E 1G3EA 2P95A 1QCPA 4OGYA 3KN2A 2ANMH 2VH6A 1ANEA 4FUCA 2Y7XA 1HJAB 1TABE 4BANB 2ZCKP 4E7NA 3EE0B 1BRBE 1NFYA 3BTHE 1V2JT 3MNBA