1BTYA

Crystal structure of beta-trypsin in complex with benzamidine
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Episelection: novel Ki approximately nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btyA02
4X8VH 3MOCA 1DXWA 1GBCA 2ODYB 1YKTA 2TGAA 3Q3XA 4ISHH 4X0WU 3P95A 4F4OC 4X2VA 2Y80A 3SZNA 1OS8A 4FUGA 4X2WA 2WPKS 1FONA 1LQEA 1W10U 2FM2A 5LPRA 1IQLA 1LMWB 2B8OH 2VH6A 2FESH 2Y82A 3IG6B 1GI9B 1C2KA 1C5YB 1VCPA 3RXEA 5BPEA 5EU8A 1CT4E 1GJ9B 2UWLA 3RXGA 4ABAA 2Y81A 1ANDA 1C1UH 1XVMA 2PSYA 1TX8A 2W5EA 2GZ7A 2FDAA 4THNH 1TNKA 3CS7A 2HVXA 3PB1E 1C2IA 2JETC 1JRTA 4MTBA 2QXJA 1GHAF 1IQNA 4YZUA 3P70B 1VZQH 3TK9A 3RMOH 1T8MA 2Z3CA 3S7HB 3P6ZB 1AFQB 2BDAA 5A0AE 2BVRH 2ANWA 4YT7H 1VITG 3SU2A 1BTPA 1C5NH 1OWEA 1UTMA 3N7OA 2ZZUH 2GMTC 1GBBA 3FP6E 4IN2A 5GCHG 1PQAA 2J34A 2EA3A 5LPEA 1IQMA 4DG4A 1T8NA 1ACBE 3M35A 1FN8A 3LH3A 1DLKB 1SB1H 3KEEA 1GJAB 2BD5A 2PKAB 1O2SA 1IHTH 1PPZA 2BM2A 3F1SB 2W3IA 3K6YA 4YOGA 1HAYB 4UFGH 4ISOA 6GCHG 1UK3A 4JZFH 4BTUB 2VH0A 1A5IA 4IS5A 3P8OA 3BTME 4Q7ZA 5DP3A 1BBRE 1P2QA 2BHGA 4FUDA 1GHVH 1WTGH 4TYDA 3ZVAA 5JBTA 3GISB 1GJBB 2AMDA 4SGBE 1TNHA 3ZZCA 1UVOA 1YM0A 4Y7BA 1ZR0A 2ZFFH 4CRFA 3DHKH 3PMJA 1N8OB 1UCYH 3Q00A 1ETRH 4E7RG 1QHRB 3TJUA 4JYTA 3PO1C 3SJ8A 1ELVA 3TGKE 1BMNH 1K1PA 1TBRH 4DIIH 1MD7A 2A7CA 3UFAA 5TCCA 3TJVA 3M3SA 5FCRA 3EAJA 1V2JT 2TGDA 5EODA 1O2NA 4JZ1A 1GCTC 5JBAS 3GCTG 3BEIB 2R2MB 1UHBA 2ZCLP 4MVNA 1WOFA 1QJ6B 1EOLA 4U30A 1ZHMA 4NGAH 2TGTA 7LPRA 1HGTH 3TNSA 1XUKA 1O2LA 1SGTA 4X6NA 1UVUH 3RXDA 3BF6H 2ZHDA 1P11E 1H8IH 2FOCA 4ZXXH 5FBIA 1BB0B 1VJAU 1TWXB 4X1PU 1WQVH 4DT7B 4F49A 2A5IA 1ZGIA 2D2DA 1MCTA 2AERH 1Y5UT 1N1LA 1WU1A 4WXIA 2ZTXA 3SJOA 3EE0B 3MU0A 2OC0A 1MTUA 1A7SA 3MU4A 4ABEA 4FVBA 2J2UA 2BZAA 3D23A 1AKSB 2CGAA 2H9EH 1MBMA 1Y3VA 2BQWB 1AMHA 2W7UA 3U8OH 4NIYA 3GY7A 6CHAC 2AYWA 2Q6FA 3V3MA 1P8VC 5C5NA 3ZV9A 2ZU2A 2TBSA 1YF4A 1H9LB 1A5GH 1GJ4H 1A0LA 5DO4H 1YP9A 1C2LA 2Q6GA 4I33A 1GJ5H 1TNLA 2XC5A 2QN5T 1IQIA 3SI4H 1EXFA 1BDAA 2XBVA 5DP6A 1QJ1B 1Y3WA 1SFIA 3B8JA 1QBNA 2P16A 4QT8C 1C1TA 1CHOG 2GVFA 1LPKB 1O0DH 1SSXA 1SGRE 4MPXA 1V2WT 2SNWA 2QF3A 1KXAA 1GJ8B 4AG1A 2QXHA 1FI8A 1GI2A 3Q3KA 4ABJA 3PV4A 4HI3A 1NRRH 2XW9A 3NKKA 3SUDA 1NRSH 4E05H 3QGNB 4AYVB 3P8FA 3HKIB 2P8OC 1SMFE 1XXDA 3MTYA 2NU3E 3SV8A 1GWAA 2FXRA 1FNIA 1TLDA 3SHCH 2V35A 1GI5A 1GMDF 2Y5FA 1ANCA 2A2QH 1SR5C 1UTJA 4GCHF 3SORA 1TRYA 1RIWC 2AIPA 4XFQA 3SGQE 1JBUH 1AZ8A 4DIHH 2GP9B 1F92A 1DY9A 1H8DH 2O8WA 1K21H 3M61U 5E2OA 4MDSA 1VITH 1FDPA 3A86A 1TMBH 2DE9A 4IC6A 4LK4A 3ZZ7A 4OS7A 1OYTH 3A8AA 3B23B 3GDUA 3MO9A 1GI0A 1C2DA 1ELDE 2AFQB 1O3LA 1DOJA 3B9FH 4CRCA 4BAHB 3MU5A 2GCTC 3QDZB 2GKVE 1P01A 2ZGXH 1BMMH 2TGPZ 4X6MA 2ZC9H 2JETB 2WV4A 5IDKA 1LVMA 2O8MA 1GHZA 2PWXA 1B7XB 5EQRA 1C5MD 1ZSJA 4WVPE 1HJ8A 3M7QA 3STJA 3H5CB 1O30A 5A8ZA 4VGCC 2VB0A 1ZGVA 1IQGA 3FP7E 2AH4X 1SGIB 1YPHC 4CRGA 3U1JB 3RDZA 3NXPA 8ESTE 2Z6BD 4U32A 1UK2A 5A0CA 2A32A 5A2MH 1BT7A 4KTCA 1ZMJA 1O2ZA 1GDNA 2BY5X 3RXIA 1Z8IB 1S0RA 3O8RA 3RM2H 1ID5H 3EA7A 2LPRA 3BEFB 3NK8A 2V0BA 2PGQB 2PKSC 1Q31A 1OSSA 4BTTB 2VNTA 1O3BA 1QQUA 2PSXA 2J38A 4AX9H 4I8LA 4X8UH 1MAXA 1YLCA 1B5GH 1OOKB 1SGQE 2XYAA 3NWUA 1T4VH 1LHCH 3A82A 3GICB 1TX6A 2ZGCA 4YO9A 1FZZA 1L4DA 2H9HA 3M5MA 1ELGA 5K0HA 1MCVA 4Y8XA 4AZ2B 1GCTB 1DFPA 1YBWA 1NS3A 1P04A 1DLEA 1TQ7B 1KXFA 1Z8RA 2BD4A 3M37A 2BVXH 1VCWA 4XBBA 2RG3A 4K60A 3SQEE 3M3VA 4Y10E 1PQ8A 5GIBA 1YYY1 2FMJA 4YESB 2P93A 1MD8A 1RFNA 1AUTC 2HWLB 2ZDMA 1L4ZA 4X6PA 2BDCA 1DICA 4BTIB 4CR5A 2C3SA 2SNVA 4TPYA 4B2CA 1EAXA 1O5EH 2Z7FE 2BY7X 4O03A 3GY8A 3D49H 1UHBB 4A92A 3RXFA 3O8CA 1RTLA 2ZHFH 3RXPA 1VITF 1ELEE 3MNCA 2FYRA 1BBRK 4I31A 1C4U2 1K1JA 4MPUA 1NROH 3SI3H 5GCHF 1EJAA 4ZKNU 1GDUA 1HDTH 2EC9H 1TNJA 3UOPA 6CHAB 1C5XB 3KQDA 1OWKA 3BSQA 1C5SA 1GL0E 3EA9A 1W7GH 6GCHF 2C8ZB 1N8OC 1O2KA 3RMMH 3UNSA 2NU1E 5I25A 2NU0E 2F9OA 2Z9LA 3SV9A 1QB9A 3SW2B 3L6PA 3SU1A 2J92A 1ZZZA 3MNSA 2QV1A 3RXOA 4UFDH 2SGPE 4ZUHA 4B1TA 1O2PA 1C1MA 5T3HA 1O2YA 1QA0A 1DUAA 3U8RH 1B0EA 5FX5A 3LT3A 4ZH8A 1EKBB 1DT2A 1LPGB 1UTKA 4AFQA 3ESTA 5GDSH 2A4GA 1HPGA 3RXMA 1V2KT 2ANMH 1AD8H 1TX7A 3VB7A 3RU4T 4DURA 1T8OA 3BTWE 4GCHG 3MNBA 1O3FA 2FTLE 1TBZH 1F0RA 3A7VA 1GPZA 1GHYH 1JXPA 5FCKA 2P8OB 3GCTF 5DG6A 4CBNA 1C5RA 1MTVA 2OP9A 4AFZA 1TPSA 4LZ1H 1G9IE 1FY5A 1E34B 1ARCA 1GHWH 2WPLS 1TRNA 1J16A 4NA8A 2B5TB 1P3EA 1NRPH 1P9SA 3A7WA 3MH7A 1RIWB 2OD3B 1GCDA 1WSSH 3TLOA 4Y0YE 5E8EH 1C5TA 4K5ZA 1J9CH 1ELAA 1KDQA 2ZI2H 3KGPA 4NSYA 2V3HH 2CV3A 3WY8A 1AWHB 4XE4A 1JRSA 1LVYA 2ESTE 4NFFA 1HRTH 1ZRKA 3Q76A 1NPMA 2F9BH 1QBVH 3LKWA 1L0ZA 1AWFH 5GXPA 1A0JA 3W94A 5AFZH 2GCTB 2FP7B 1FY1A 2P95A 2FO9A 3RXQA 5JB9S 1GJDB 1QRWA 2ZDVH 1DXPA 5AVDA 2AMQA 1CU1A 3QZRA 2A2XH 2XCFA 1TGSZ 1Z6JH 2FX4A 3LU9B 1AO5A 2VIQA 1BJVA 5A8YA 1F5KU 1P2NA 3MH6A 2ZP0H 3RXBA 3UY9A 1G32B 1XXFA 4LZ4B 1CGHA 1FLEE 2Z3EA 2F9NA 2ILNA 3E90B 1WUNH 4VGCB 1GG6C 2H9TH 1XM1A 4D9QA 1S6FA 3MU8A 1S83A 1TALA 4JZEH 1LTOA 1CHOF 2FOFA 2STBE 4PROA 3NCLA 1YPKH 1SGYE 4FU7A 3TJNA 3W95A 4UE7H 4IGDA 3VB3A 1BHXB 1C2GA 1MAYA 4XBDA 3T28A 4KELA 5C1YA 3PLBA 2ZHEH 2HPPH 3CP7A 3K9XB 2HALA 2OINA 3KQCA 3UR6A 7GCHF 4KTUA 1O5DH 2VIOA 3OTJE 2ZPRA 2XRCA 4ZMAH 1DANH 3LGVA 1V2MT 2OC7A 2PKSB 4ZKSU 3SJ9A 1B0FA 2Z9JA 1AVWA 3E91A 5EW2H 4FXGH 3D65E 3R3GB 3ITIA 8GCHG 2WINI 2ZCKP 3BG4C 2Z9GA 1DSTA 1KTSB 1EB2A 1GL1A 4Q7YA 1FUJA 1KSNA 1V3XA 1NO9H 4INKA 3L3TA 3QTOH 4AG2A 3KIDU 1P09A 2ZU5A 1W3CA 4AB9A 1P12E 1V2RT 1Z8GA 2IPHA 1SQOA 2BOKA 5LPFA 1C1QA 4AFSA 2BY8X 2A31A 4D9RA 1HJAC 1WQSA 4K1SA 1A61H 2BQ6B 5F8ZA 3U9AH 3RXVA 1W7XH 1QL7A 4R0IA 1TGBA 1SL3A 2QA9E 4ZHAA 3GDSA 1V2PT 3H7TA 3T25A 2GCHG 2O8TA 4X8SH 3SGBE 1LVBA 2XWBI 3LIWA 3RXRA 1MTSA 1WYKA 3MHWU 5EG4A 4NWLA 1AVXA 2BD8A 2Y7XA 3SV7A 2QXIA 3QLPH 2C8YB 5HMAA 2VWOA 3GY2A 3TITA 3A81A 3A84A 4AGJA 1OX1A 1PYTD 1SGPE 1IOEA 1ETSH 3GY5A 5FHTA 1C2EA 3ZVFA 1K28D 1OYQA 2TPIZ 2F83A 4CH2B 3LJOA 4K8YA 4X8TH 3Q77A 5F8XA 2ZFPH 1KIGH 1V2QT 2GD4B 1X7AC 3VPKA 2QF0A 1HV7A 1QFKH 1BBRH 1QURH 1P05A 2XTTB 3U8TH 1QCPA 1SG8B 3HATH 1OP2A 3V12A 4A6LA 2F91A 2FI3E 1DSUA 3BG8A 3DD2H 4JZDH 1THSH 4OS4A 1K2I1 3SOSA 4FUFA 4UONA 4NIXA 1DITH 3V0XA 2CHAC 4Z6AH 1TONA 4YLQH 3TVJB 1BTYA 2YOLA 2QCYA 4K8BA 3A8DA 3ATMA 4GHTA 4CHAB 2VIDA 4OS5A 2FOMB 3LGTA 4OGXA 3HK3B 1LQDB 3ZZ8A 3AASA 3S9CA 5FX6A 3G01A 1NY22 5HM9A 2BQ7B 1ANEA 1ELCA 4WJG2 1CQQA 3HGPA 3PMBB 3SV2H 3A85A 1W2KH 1C9PA 4GPGA 2PTNA 1G2MA 1OP0A 5E0GA 1FAKH 3F6UH 1VJ9U 1ZOMA 2YNBA 2FODA 2P3FH 3BIUH 3RC6A 4WH8A 4U2WA 1TB6H 3U69H 1GVKB 1O3NA 1EAUA 2ZDNA 1BITA 1ELTA 3ODDA 1JMOH 3VB5A 3ZZ9A 1ZHRA 1JWTA 4XOJA 1SLWB 4TY6A 4AYYB 5JBCS 2C93B 5C3NA 2UWPA 4WMDA 4BNRA 3ZVBA 4AN7A 1RGQA 5L2YH 2A4QA 9ESTA 3RXJA 3RXSA 2PR3A 4H42U 1O31A 4GUXA 2ASUB 1XUGA 4AORA 4GLYA 4ESTE 4MNWA 4WMEA 4JMYA 4JK6A 3F9GA 4X2YA 1BRBE 1S81A 1D3TB 3RLYH 1N6YA 1MZAA 3LONA 3JZ1B 1Y3XA 1EPTA 5C5OA 1FMGA 5CHAC 1GBTA 1N6XA 4MLFB 4X6OA 2D8WA 4Y71A 5EXNA 2Z3DA 1KDQB 1OPHB 1V2NT 1CA0C 1SOZA 4KGAA 2QXGA 1L1GA 1GI1A 4CBOA 3TH2H 4DOQA 1HAGE 2P59A 1F0UA 1HIAA 3CENA 5F03A 1THRH 1GG6B 4HZHA 1QL8A 1IHSH 3SJKA 1SQAA 1A2CH 1O3IA 1P9UA 2WPJS 4Y6DA 1EPTC 7GCHG 2PTCE 1V2ST 3S9BA 1A46H 3PM3A 1BTHH 1RJXB 1SC8U 1ZMLA 3QN7A 1ABJH 9LPRA 2ZO3H 1LKAA 2OTVA 4FUEA 1HXFH 1JIMA 5TCAA 1Z7KA 3L33A 3EYDA 4NIVA 5GPIB 1KXBA 1O37A 3O8BA 3FP8E 4Y11E 1O2GH 5E0HA 5CE1A 1C1NA 2GT8A 2UUJB 5SGAE 2HNTE 1V2LT 3NUMA 3BIVH 4Q7XA 4Z0KA 3M3TA 1D9IA 1K22H 3RP2A 5JB8S 3DFJA 4SGAE 3UWIA 4RN6A 5FXLA 1ZMNA 2ZG0H 4AB8A 3BG4B 5E2PA 3V13A 3T2NA 4J2YB 1SGFA 3ZV8A 1O3JA 3IITA 3SU0A 1GHBF 1O3HA 1BTZA 1C5WB 2WYJA 4M7GA 1C1VH 2ZFRH 3PMHB 4GAWA 5J4QA 1QJ7B 1ZSKA 1AUJA 1YPLH 1C4Y2 1MH0A 4K1TA 1P2KA 4X1QU 1LCYA 1HJAB 1XUFA 1O5CB 1OWIA 3FFGA 3MI4A 2GZ9A 2BLOA 4NZQA 2CF9H 3R0FA 4ABBA 1O3DA 3GY4A 1GBAA 2OQ5A 4DJZB 2G55A 2PHBA 2G00A 1SPJA 2CF8H 3UWJH 4KTSA 1GJCB 4O3TA 3E0PB 4NFEA 4IMZA 3BTGE 1AE5A 2ZF0H 3F9EA 3DUXH 1ZSLA 3ZZAA 3RXCA 1Q3XA 1H9HE 3GDVA 4CH8B 1SHYA 3P8NA 5EQQA 1Y3YA 1AB9C 2FTMA 1HB0B 1FN6A 2GV7A 3GCNA 1AZZA 2SFAA 4DGJA 1FAXA 4CREA 4ZROA 1LHEH 3ZVCA 4XBCA 3RXKA 1GI6A 1NC6A 2C8XB 1FIZA 1O3AA 1ZLRA 4B75A 3A83A 1V6DA 3ODFA 3SNDA 1GGDB 1P03A 5FBEA 1M9UA 1GJ7B 4OS1A 5EXMA 1EJMA 1EZUC 3SHAH 3VFEA 2IJOB 3MFJA 1HLTH 1BZXE 5FAHA 4K3JA 1LHFH 3F68H 1AI8H 2THFB 3RXUA 3GCOA 1QIXB 2CHAB 2FYQA 1ELBA 3BTTE 2EI7A 4D8NA 1TQ0B 6ESTA 1MMJN 3TH3H 1ZPZA 2XBXA 2ZQ1A 1FXYA 3KQEA 2W26A 1VGCB 1FV9A 4BAKB 1O3KA 1K1IA 8GCHF 1S5SA 1MUEB 2PGBB 1EUFA 1Z8JB 1E0FD 4MNXA 3ZZDA 1EATA 1BRAA 2QIQA 1ZPBA 3RMLH 2ZPSA 4GSOA 1W8BH 2BLWA 3SNCA 1CGIE 1OWJA 3LC3A 2I6QA 4H6TA 1TE0A 3SQHE 2BD2A 4RKOB 2BVSH 1SVPA 1A1RA 1C1PA 1BRCE 4Y79A 4YOIA 1AIXH 5DPAA 2XXLA 1GBIA 4ZAEA 1HUTH 2OC8A 2PKAA 1PPEE 3ZVDA 1C1WH 1GMHF 5LGOA 1BMLA 1SGDE 1CE5A 1YCPH 3T29A 1G36A 2OXSA 2ZPQA 3SNEA 3DT0H 2FEQH 4JCNA 1GI8B 2PFEA 3URDA 1HAPH 4CRDA 5DK1A 5DP5A 4D7GA 2BD7A 3STIA 4IN1A 3QX5H 3RC5A 1ESTA 2UWOA 2GCHF 2DUCA 1INCA 1O2UA 4MNYA 1DWCH 1GI3A 1KY9A 1GBDA 2G81E 1WTHD 2H1UA 1HAVA 3E3TA 1G3EA 1YLDA 4TWWA 1GVLA 3P8GA 2FOAA 2ZEBA 2J4IA 2ZGJA 3RUOA 1P0SH 1O2WA 4JYVH 2NU2E 3UOUA 1TGNA 2O8UA 5CHAB 1PPCE 1ZJKA 3S9AA 2O8LA 1SGEE 3QWCH 1OWDA 1GJ6A 1Z71A 1FY4A 4CHAC 3T26A 2ANYA 3RM0H 1O2QA 1CA0B 2WUCA 1VR1H 3BTKE 5A09A 1AVGH 2F3CE 2IOTA 3QO6A 3ZZ6A 3BEUA 2H6MA 1OKXA 3ELAH 2J94A 1WCZA 2ZECA 1TPOA 4INLA 2R3UA 5EOKA 1H1BA 1QTFA 4OGYA 2FLBH 4K1EA 2ODQA 2A4RA 1EPTB 4HTCH 4Y8ZA 1TA6A 1HAXB 5DGJA 5K7RA 1C5QA 1G2LA 1ZTKA 3UTUH 4K69A 1UTQA 1XKAC 3EGKH 1AKSA 5AHGH 1TOMH 1UVTH 2RCEA 2Y5HA 2G8TA 3SU3A 4I7YH 4X1NU 3DA9B 1NZQH 7ESTE 1G3DA 1HIAB 3GY6A 2EEKA 1MQ5A 1H9IE 4I8JA 1GHBG 1NFXA 2PUXB 2FOEA 1LHDH 3ZZ3A 1O2RA 5L30H 4J1YA 3OU0A 2W7SA 1D6WA 1NRNH 1LKBA 1FJSA 1OXGA 2BDHA 1MZDA 2VU8E 1SLVB 1QQ4A 4ABDA 3MH5A 1J14A 1LVOA 3FAOA 1SGFG 2PLXA 1ANBA 3ATLA 3U1IB 4ZXYH 3RXHA 1D3DB 3A8CA 3A7TA 3HK6B 3SGAE 3S7KB 1Y59T 3TGIE 1C5VA 1CT2E 4FUCA 2OBOA 1P2MA 3AAUA 5JYIA 2BY9X 3PLPA 8LPRA 2QGRA 4YLUA 3KF2A 1SFQB 2OQUA 1PPHE 3T62A 1W12U 3LC5A 2UUKB 6LPRA 1RS0A 1C1OA 1RXPA 5AFYH 1TNIA 5C1XA 3I78A 2R0LA 1GBFA 2UUFB 2ZFSA 1O33A 1IQFA 3TK5A 1GI7B 4NA9H 1YGCH 1F5LA 1AB9B 4NIWA 1O2MA 1T31A 2VVUA 5HM2A 1EOJA 2FX6A 1YPJH 4GVUA 1DE7H 4X1RU 2P3UB 2O9QA 1MKWK 1GI4A 1FY3A 5DP8A 2FI5E 2K1QA 2Z94A 3SN8A 1QR3E 5EQSA 3UNQA 1DWEH 3PYHA 4ASHA 1HAOH 1C1SA 2BLQA 3P92A 1P02A 2F9PA 3KCGH 4X1SU 1XUJA 1Z1IA 3NZIA 3SNAA 1HCGA 1S84A 4ABGA 2BDGA 1C2FA 4O3UA 1YPEH 2HRVA 4OS2A 2ALPA 4TWYA 2VVVA 2KAIA 2B0FA 1T8LA 4IC5A 1EQ9A 1ABIH 3M5NA 2GGVB 1O3CA 1DVAH 3UREA 2XNIA 4O9VA 2JH5D 2ANKH 3GYLB 3E1XB 1XX9A 1O3PB 1XVOA 2AMPA 4AGKA 5AF9H 3LGWA 4WH6A 2VIPA 1BCUH 2BY6X 1NESE 1GMHG 5GJ4B 4HFPB 1PPFE 4FUBA 2ZDKA 2BDBA 1HAIH 1C2MA 2ZTZA 3K6ZA 1NFYA 1V2VT 1Y3UA 4A1VA 2VGCC 3CS0A 1E37B 2QC2A 1BIOA 2RA3A 1L2EA 5FPSA 1BUIA 1ZPCA 4FUIA 3TJOA 1AU8A 1Z1JA 1O3EA 1TYNA 4NWKA 2A7HA 1EZQA 2FS8A 4JZIA 1C1RA 3MU1A 1K1OA 2J9NA 3MNXA 2C4FH 1HAHH 5E0JA 4GHQA 1GHXH 3LGUA 1KLJH 2F9UA 5ETXA 1U6QA 5FPTA 1TABE 1BQYA 1OP8A 2OUAA 1TNGA 1P10A 1GVZA 2P94A 3HGNA 4ISNA 2FZZA 4TPIZ 1H4WA 1GGDC 1S85A 4RKJB 1V2UT 2WYGA 2EI6A 3URCA 3EQ0H 2R2WU 1RD3B 2PV9B 2VJ1A 3MH4A 2AIQA 5C67A 3A87A 1AQ7A 1BA8B 2LNCA 1Y8TA 4Y7AA 1TOCB 4YTAA 1C2HA 4AOQA 2VWLA 1BTWA 1O36A 1CT0E 1KXDA 2CXVA 1A5HA 5JBBS 3BTQE 1Q2WA 4H4FA 4ABIA 4CRAA 5L6NH 1UCYE 4A5TS 2ZCHP 4U01A 5DP9A 1SGNE 3QZQA 5C2ZA 1SLXB 1AY6H 1K1MA 4WMFA 1UK4A 3MMGA 3K2UA 3UQOA 1O3OA 1O3GA 1CHGA 3UIRA 4ISIH 1VGCC 1S0QA 2FWWA 3UR9A 1QY6A 1G37A 3FANA 1HAVB 3SUFA 3AAVA 2FLRH 2XC4A 1ZTLA 2RDLA 3OY6U 1UTOA 4CRBA 1YCPK 1P57B 4NZLA 5T6FA 4E06H 1W0YH 4IBLH 3DFLA 1KXCA 5A8XA 1IQHA 4KP0A 4INHA 1V2OT 1YC0A 4I32A 1T32A 2Z9IA 3BTHE 3Q3YA 3RXLA 2M5TA 4WY3A 2QY0B 1PPBH 2AEIH 3FZDA 1LHGH 4B71A 1GMCF 2A5KA 4YM9A 1MTNC 1KYNA 1SBWA 1KLIH 1ZTJA 1J17T 4H6SB 4BAQB 1RTFB 5A0BA 3VGCB 1YPHE 2BYAX 1Y5BT 3TU7H 4NCYA 5ABWA 5GWZA 1O2TA 1K9OE 1MKXK 4ZKOU 5DKMA 3SUEA 5TJXA 2BOHB 4A7IB 1P3CA 2VVCA 1QA7A 3VXEH 1W13U 4WWYA 2SGFE 4Y76A 1L1NA 2XBWA 1TA2A 1TGCA 2OCVB 5C20A 1DWDH 2G52A 2BTCE 1QBOA 1EASA 4ABHA 4ISLA 1E38B 2BXTH 5EPNA 4LXBH 1G30B 3TIUA 5JDUB 2D26C 5ESBA 1EZXC 2JH0D 2AGIX 1WV7H 4Q2KA 1GBKA 3V7TA 2WPMS 3A89A 3E16B 3KQBA 3PWBA 7KMEH 1F0TA 2NU4E 5BRRE 1ZYOA 5F6MA 2C8WB 3TNTA 4MG3A 3UNRA 1EAWA 2GDEH 3A8BA 3LDXH 2SGEE 2ZU3A 1QRXA 1J15A 2WV5A 1F2SE 2ZA5A 2ZGBH 3SNBA 1HYLA 3ZZ5A 1JIRA 2CMYA 1O5BB 2A45B 2A1DB 1C2JA 3RU4D 3SU4A 3P17H 1O2XA 1L1JA 4MNVA 4A1XA 3E6PH 4FU8A 3ATKA 3GYMA 2C90B 2HLCA 1TBQH 1KTTB 2I6SA 1UMAH 3S0NA 3ZVGA 3C27B 1CSOE 1S82A 2XC0A 4Y8YA 3SV6A 1TAWA 5DP4A 1UO6A 2GV6A 3KL6A 3EA8A 1BOQA 3VXFH 4DW2U 5EGMA 1XKBC 3BTDE 1O3MA 1O34A 1XUHA 3GY3A 3MO3A 3M5LA 3BTFE 1MQ6A 2ZU1A 4BAOB 1GDQA 1MKWH 4MQAA 3KN2A 1IQEA 1W0ZU 1C5ZB 2GX4A 3LPRA 3D62A 3TGJE 1HAZB 3E8LA 4Q80A 4IMQA 2BLVA 1FPHH 2TIOA 2ZQ2A 1EAIA 4NSVA 3T5FH 2PW8H 4RSPA 2P3TB 2VIWA 4D76A 4BAMB 1DWBH 3GCHC 3SBKA 3SJIA 3T27A 2R9PA 1TFXA 2QYIA 2B7DH 1DX5M 1DS2E 2Z9KA 1GHAG 1AE8H 3ATWA 4UD9H 2Y5GA 1O39A 2Y7ZA 3KNXA 1P2JA 2QAAA 2KAIB 3JZ2B 2ZFTA 2W3KA 3U98H 2VGCB 1BJUA 4BOHA 3F9FA 1ZJDA 3PROA 4FUJA 3I77A 1KLTA 1PQ5A 3O8DA 1E36B 2SGQE 1W14U 1EX3A 2R3YA 4AFUA 3QUMP 1WAYB 1T4UH 4XDEA 1D6RA 2CN0H 1GBLA 2JH6D 1TGTA 4I8GA 4MPVA 2ZFQH 3M7UA 3RXAA 3A7XA 1SQTA 2V3OH 4TY7A 1O2IA 3MWIU 1FY8E 2VWNA 3QK1A 2GZ8A 1EP5A 2SGAA 2GMTB 2R0KA 1HFDA 1CBWC 1DY8A 2YNAA 1LPZB 3QTVH 3A80A 4A1TA 2Q1JA 2BXUH 3E0NB 1BTUA 4NG9H 5FPYA 2G5VA 4OS6A 1D3PB 1DM4B 2ULLA 1BHXF 1O35A 1SHHB 4B2BA 2H5DA 1NU9A 1C9TA 1TPAE 4MPWA 4B2AA 1SLUB 1TMUH 1IQKA 5DP7A 2OLGA 3BV9B 2FOBA 2VINA 1EB1H 4IW4E 1ZHPA 3H7OA 2GT7A 1IQJA 3SO3A 1D4PB 3ZZ4A 3S69A 1EZSC 1A0HB 1JOUB 1C5PA 4BXSA 1HJ9A 4DY7B 2G4TA 2ZHWH 1NFUA 3M36A 2FOHA 3TK6A 1P2OA 1C5UA 2XCNA 5EXLA 1NTPA 1UVSH 3PO1B 2BB4A 4XSKU 4CR9A 2ZDLA 2VIVA 1GMCG 3ZYEA 2DE8A 1SGCA 1TRMA 1Y5AT 4K2YA 2BDIA 1NFWA 1MBQA 1CA8B 3UUZA 1AFEH 1J8AA 1PFXC 3LOXA 1DUEA 1CO7E 3RXTA 1VCQA 5CMXH 1O2HA 5EW1H 4WXVA 5PTPA 4YOJA 1OWHA 2UUYA 4X2XA 3A7ZA 1A3BH 3GOVB 1SI5H 4B73A 1SOTA 1O38A 3PWCA 4ZKRU 5F8TA 1O2JA 1P2IA 1MTNB 3OSYA 1PQ7A 1DDJA 2XWAA 1LDTT 2ZGHA 1AFQC 1K1NA 2BX4A 5C1UA 4BANB 1ZRBA 1QB6A 4KKDA 1TMTH 4B74A 1NU7B 1A3EH 1D3QB 5DJ7A 2H2ZA 1NM6A 1MU8B 3PTBA 1IAUA 1UTNA 1LO6A 2HNTF 3HPTB 4HGCA 2A4OA 3AVZA 3OY5U 4FVDA 5I46H 1XUIA 4UDWH 1A4WH 1BRUP 2HNTC 3EDXB 2HPQH 1MTWA 3PMAB 4O97A 1MKXH 2ZTYA 4DVAU 4D7FA 3NPSA 3C1KA 2ZWLH 3K65B 3F9HA 2SGDE 3BN9A 3AW0A 3SUGA 1NRQH 4UEHH 1QRZA 1O2OA 1UCYK 3A88A 3RC4A 1BTXA 1PPGE 2WUBA 3LGYA 3FVFB 1C5OH 5HYOA 8KME2 5T6GA 1KXEA 4FU9A 1E35B 4YT6H 5HXFA 3MYWA 5J4SA 1EJNA 4Y0ZE 5ESTE 1G3BA 4ZHLU 2Y6TA 4FUHA 3VB6A 1WBGB 2ALVA 3I29A 4I8HA 2A7JA 2BD3A 3M5OA 1ETTH 4ABFA 3RU4E 3LGIA 2ZU4A 1AN1E 3LJJA 2RA0A 1RRKA 1THPB 4B76A 3RLWH 1O5AB 5L2ZH 5JPMH 3ZVEA 1UVPA 3HKJB 1QL9A 2CJIA 3QGJA 3RMNH 5B6OA 4R8TB 2AS9A 5LH8A 1F0SA 1NN6A 1UTLM 2AGGX 3OYPA 1ESBA 1HNEE 2V6NA 1GMDG 2ZDAH 2BMGB 1RTKA 3VGCC 2G51A 1CGJE 3TPIZ 2FI4E 1PYTC 1EP6A 1GBHA 1S6HA 4E7NA 2FPZA 2HGTH 1QGFA 4UFEH 1T7CA 2ZHQH 2H5CA 1G3CA 3KHVA 2ZNKH 4LOYH 1CVWH 1AGJA 1K1LA 2Q6DA 1C4V2 2J95A 2FOGA 1BMAA 2BDYA 1P06A 3A7YA 3UPEA 3VB4A 1UJ1A 2FS9A 2EI8A 2WPHS 5EPYA 3M7TA 2BD9A 2ODPA 2XBYA 3IWMA 1W11U 5T6DA 3SU5A 2BZ6H 2A0QB 1O5FH 3MO6A 2STAE 2GTBA 3GCHB 5HGGA 1HXEH 2HOBA 4DCDA 1ELFA 1V2TT 2NWNA 2B9LA 2BX3A 1F5RA 1FPCH 1F7ZA 2A5AA 2JKHA 2G4UA 1UTPA 4UFFH 1HBTH 3FZZA 4JYUH 1YPGH 3TH4H 1QB1A 3ATIA 1FQ3A 1ORFA 3AW1A 1ESAA 4JK5A 2FIRH 1PJPA 3SU6A 2ZKSA 1GBMA 1XMNB 1O2VA 2G5NA 2WPIS 3BTEE 2ZIQH 2AGEX 3OX7U 4NA7A 3VEQB 4ZHMU 1GBJA 1FIWA 1MU6B 3PTNA 4WF8A 1GBEA 3UQVA 1ARBA 1NT1A 1YCPM 4I8KA 1TPPA 1YPMH 1CBWB 5IYTA 3ZYDA 1O32A 2VWMA 2D1JA 5H4IB 5G4BA 2PUQH 1AHTH 1C5LH 1TIOA 3ZZBA 3LH1A 1QNJA 1Z6EA 3PLKA 4BXWA 2TRMA 1O5GH 3ENSB 1DPOA 2GDDA 2F9VA 2OBQA 2IN2A 2OC1A
chains in the Genus database with same CATH superfamily
4X8VH 3MOCA 1DXWA 1GBCA 2ODYB 1YKTA 2TGAA 2KFWA 3Q3XA 4ISHH 4X0WU 3P95A 4F4OC 4X2VA 2Y80A 3SZNA 2HVYB 1OS8A 4FUGA 4X2WA 4XRNA 2WPKS 1FONA 1LQEA 1W10U 2FM2A 5LPRA 1IQLA 1LMWB 2B8OH 2VH6A 2FESH 2Y82A 3IG6B 1GI9B 2W6ID 1C2KA 1C5YB 1VCPA 3RXEA 5BPEA 5EU8A 2J97A 1BMFD 1CT4E 1GJ9B 2UWLA 3RXGA 4ABAA 2Y81A 1ANDA 1C1UH 1XVMA 2PSYA 1TX8A 2W5EA 2GZ7A 2J98B 2FDAA 4THNH 1TNKA 3CS7A 2HVXA 3PB1E 1C2IA 2JETC 1JRTA 4MTBA 2QXJA 1GHAF 1IQNA 3OEED 4YZUA 3P70B 1VZQH 3TK9A 3RMOH 1T8MA 2Z3CA 3S7HB 3P6ZB 3SYJA 1AFQB 1W0KD 2BDAA 5A0AE 2BVRH 2ANWA 4YT7H 1VITG 3SU2A 1BTPA 1C5NH 1OWEA 1UTMA 3AK5A 3N7OA 2ZZUH 2GMTC 1GBBA 3FP6E 4IN2A 5GCHG 1PQAA 2JJ2D 2J34A 2EA3A 5LPEA 1IQMA 4DG4A 1T8NA 1ACBE 3M35A 1FN8A 3LH3A 1DLKB 1SB1H 3KEEA 1GJAB 3N99A 2BD5A 2PKAB 1O2SA 1IHTH 1PPZA 2BM2A 3F1SB 2W3IA 3K6YA 4YOGA 1HAYB 4UFGH 4ISOA 6GCHG 1UK3A 4JZFH 4BTUB 2VH0A 1A5IA 4IS5A 3P8OA 3BTME 4RI0A 4Q7ZA 5DP3A 1BBRE 1P2QA 2BHGA 4FUDA 1GHVH 1WTGH 2XNDD 4TYDA 3ZVAA 5JBTA 3GISB 1GJBB 2AMDA 4SGBE 1TNHA 3ZZCA 1UVOA 1YM0A 4Y7BA 1ZR0A 2ZFFH 4CRFA 3DHKH 3PMJA 1N8OB 1UCYH 3Q00A 1ETRH 4E7RG 1QHRB 1COWD 3TJUA 4JYTA 3PO1C 3SJ8A 1ELVA 3TGKE 1BMNH 1K1PA 1TBRH 4DIIH 1MD7A 2A7CA 3UFAA 5TCCA 3TJVA 3F3BA 3M3SA 5FCRA 3EAJA 1V2JT 2TGDA 5EODA 1O2NA 4JZ1A 4B6EA 1GCTC 5JBAS 3GCTG 3BEIB 2R2MB 1UHBA 2ZCLP 4MVNA 1WOFA 1QJ6B 1EOLA 4U30A 1ZHMA 4NGAH 2TGTA 7LPRA 2EY4C 1HGTH 3TNSA 1XUKA 1O2LA 1SGTA 4X6NA 1UVUH 3RXDA 2K0QA 3BF6H 2ZHDA 1P11E 1H8IH 2FOCA 2GJGA 4ZXXH 5FBIA 1BB0B 1VJAU 1TWXB 4X1PU 1WQVH 4DT7B 4F49A 2A5IA 1ZGIA 2D2DA 1MCTA 2AERH 1Y5UT 1N1LA 3FKSD 1WU1A 4WXIA 2ZTXA 3SJOA 3EE0B 3MU0A 2OC0A 1MTUA 1A7SA 3MU4A 4ABEA 4FVBA 2J2UA 4B6FA 2BZAA 3D23A 1AKSB 2CGAA 2H9EH 1VKYA 1MBMA 1Y3VA 2BQWB 1AMHA 4Q4LA 2W7UA 3U8OH 4NIYA 2LELA 3GY7A 6CHAC 2AYWA 2Q6FA 3V3MA 1P8VC 5C5NA 3ZV9A 2ZU2A 2TBSA 1YF4A 1H9LB 1A5GH 1GJ4H 1A0LA 5DO4H 1YP9A 1C2LA 2Q6GA 4I33A 1GJ5H 1TNLA 2XC5A 2QN5T 1IQIA 3SI4H 1EXFA 1BDAA 2XBVA 5DP6A 1QJ1B 1Y3WA 1SFIA 3B8JA 1QBNA 2P16A 4QT8C 1C1TA 1CHOG 2GVFA 1LPKB 1O0DH 1SSXA 1SGRE 4MPXA 5IK2D 1V2WT 2SNWA 2QF3A 1KXAA 1GJ8B 4AG1A 2QXHA 3SZEA 5HKKD 1FI8A 1GI2A 3Q3KA 4ABJA 3PV4A 4HI3A 1NRRH 2XW9A 3NKKA 3SUDA 1NRSH 4E05H 3QGNB 4AYVB 3P8FA 3HKIB 2P8OC 1SMFE 1XXDA 3MTYA 2NU3E 3SV8A 1GWAA 2FXRA 2RFKC 1FNIA 3WW7A 1TLDA 3SHCH 2V35A 1GI5A 1GMDF 2Y5FA 1ANCA 2A2QH 1SR5C 1UTJA 4GCHF 3SORA 1TRYA 1RIWC 2AIPA 4XFQA 3SGQE 1JBUH 1AZ8A 4DIHH 2GP9B 1F92A 1DY9A 1H8DH 2O8WA 1K21H 3M61U 5E2OA 4MDSA 4F48B 1VITH 1FDPA 3A86A 1TMBH 2DE9A 4IC6A 2KM0A 4LK4A 3ZZ7A 4OS7A 1OYTH 3A8AA 3B23B 3GDUA 3MO9A 1GI0A 1C2DA 1ELDE 2AFQB 1O3LA 1DOJA 3B9FH 4CRCA 4BAHB 3MU5A 2GCTC 3QDZB 2GKVE 1P01A 3WWFA 2ZGXH 3PV5A 1BMMH 2TGPZ 4X6MA 2ZC9H 2JETB 2WV4A 3EE7A 5IDKA 1LVMA 2KZ4A 2O8MA 1GHZA 2PWXA 1B7XB 5EQRA 1C5MD 1ZSJA 4WVPE 1HJ8A 3M7QA 3STJA 3H5CB 4ZCNA 1O30A 3UB0A 4VGCC 5A8ZA 2VB0A 1ZGVA 1IQGA 3FP7E 2AH4X 1SGIB 1YPHC 4CRGA 3U1JB 3RDZA 3NXPA 8ESTE 2Z6BD 2JIZD 5C17A 4U32A 1UK2A 5A0CA 2A32A 5A2MH 1BT7A 4KTCA 1ZMJA 1O2ZA 1GDNA 2BY5X 5HIZA 3RXIA 1Z8IB 1S0RA 3O8RA 3RM2H 5KEDA 1ID5H 3EA7A 2LPRA 3BEFB 3NK8A 2V0BA 2PGQB 2PKSC 1Q31A 1OSSA 4BTTB 2VNTA 1O3BA 1QQUA 2PSXA 2J38A 4AX9H 4I8LA 4X8UH 1MAXA 1YLCA 1B5GH 1OOKB 1SGQE 2XYAA 3NWUA 3ZIAD 1T4VH 1LHCH 3A82A 3GICB 1TX6A 2ZGCA 4YO9A 1FZZA 1L4DA 2H9HA 3M5MA 1ELGA 5K0HA 1MCVA 4Y8XA 4AZ2B 1GCTB 1DFPA 1YBWA 1NS3A 1P04A 1DLEA 1TQ7B 1KXFA 1Z8RA 2BD4A 3M37A 2BVXH 1VCWA 1E79D 4XBBA 2RG3A 4K60A 3SQEE 3M3VA 4Y10E 1PQ8A 5GIBA 1YYY1 2FMJA 4YESB 2P93A 2V3MA 1MD8A 1RFNA 1AUTC 2HWLB 2ZDMA 1L4ZA 4X6PA 2BDCA 1DICA 4BTIB 4CR5A 2C3SA 2SNVA 4TPYA 4B2CA 1EAXA 1O5EH 2Z7FE 2BY7X 4O03A 3GY8A 3D49H 1UHBB 4A92A 3RXFA 3O8CA 1RTLA 2ZHFH 3RXPA 1VITF 1ELEE 3MNCA 2FYRA 1BBRK 4I31A 1C4U2 1K1JA 4MPUA 1NROH 3SI3H 5GCHF 1EJAA 1E1QD 1GDUA 4ZKNU 1HDTH 2EC9H 1TNJA 3UOPA 6CHAB 1C5XB 3KQDA 1OWKA 3BSQA 1C5SA 1GL0E 3EA9A 1W7GH 1S6LA 2KCAA 6GCHF 2C8ZB 1N8OC 1O2KA 3RMMH 3UNSA 2NU1E 5I25A 2NU0E 2F9OA 2L74A 2Z9LA 3SV9A 1QB9A 3SW2B 3L6PA 3SU1A 1YWUA 2J92A 1ZZZA 3MNSA 2QV1A 3RXOA 2YMSD 4UFDH 2SGPE 4ZUHA 4B1TA 1O2PA 1C1MA 5T3HA 1O2YA 1QA0A 1DUAA 3U8RH 1B0EA 5FX5A 3LT3A 4ZH8A 1EKBB 1DT2A 1LPGB 1UTKA 4AFQA 3ESTA 5GDSH 5CDFE 2A4GA 1HPGA 1FX0B 3RXMA 1V2KT 2ANMH 1AD8H 1TX7A 3VB7A 3RU4T 4DURA 1T8OA 3BTWE 4GCHG 3MNBA 1O3FA 2FTLE 1TBZH 1F0RA 3A7VA 1GPZA 1GHYH 1JXPA 5FCKA 2P8OB 3GCTF 5DG6A 4CBNA 1C5RA 1MTVA 1E1RD 2OP9A 4AFZA 1TPSA 4LZ1H 1G9IE 1FY5A 1E34B 1ARCA 1GHWH 2WPLS 1TRNA 1J16A 4NA8A 2B5TB 2XOKD 1P3EA 1NRPH 1P9SA 3A7WA 3MH7A 3WWBA 1RIWB 2OD3B 1GCDA 1WSSH 3TLOA 4Y0YE 5T1VA 5E8EH 1C5TA 4K5ZA 1J9CH 1ELAA 1KDQA 2ZI2H 3KGPA 3KYGA 4NSYA 2V3HH 2CV3A 3WY8A 1AWHB 4XE4A 1JRSA 1LVYA 2ESTE 4NFFA 1HRTH 1ZRKA 3Q76A 1NPMA 2F9BH 1QBVH 3LKWA 1L0ZA 1AWFH 5GXPA 1A0JA 2LP6A 3W94A 5AFZH 2GCTB 2FP7B 1FY1A 2P95A 2FO9A 3RXQA 5JB9S 1GJDB 1QRWA 2ZDVH 1DXPA 5AVDA 2AMQA 1CU1A 3QZRA 2A2XH 2XCFA 1TGSZ 1Z6JH 2FX4A 3LU9B 1AO5A 2VIQA 1BJVA 5A8YA 1F5KU 1P2NA 3MH6A 2ZP0H 3RXBA 3UY9A 1G32B 1XXFA 4LZ4B 1CGHA 1FLEE 2Z3EA 2F9NA 2ILNA 3E90B 1WUNH 4VGCB 1GG6C 2H9TH 1XM1A 4D9QA 1S6FA 3MU8A 1S83A 1TALA 4JZEH 1LTOA 1CHOF 2FOFA 2STBE 4PROA 3NCLA 1YPKH 1SGYE 4FU7A 3TJNA 3W95A 1KMHB 4UE7H 4IGDA 3VB3A 1BHXB 1C2GA 1MAYA 4XBDA 2AHME 4KELA 3T28A 5C1YA 3PLBA 2ZHEH 2HPPH 3CP7A 3K9XB 2HALA 2OINA 3KQCA 3UR6A 7GCHF 4M9FA 4KTUA 1O5DH 2VIOA 3OTJE 2ZPRA 2XRCA 4ZMAH 1DANH 3LGVA 1V2MT 2OC7A 2PKSB 4ZKSU 3SJ9A 1B0FA 2Z9JA 1AVWA 3E91A 5EW2H 4FXGH 3D65E 3R3GB 3ITIA 8GCHG 2WINI 2ZCKP 3BG4C 4TT3D 2Z9GA 1DSTA 1KTSB 1EB2A 1GL1A 4Q7YA 1FUJA 1KSNA 1V3XA 1EFRD 1NO9H 2EQNA 4INKA 3L3TA 3QTOH 4AG2A 3KIDU 1P09A 2ZU5A 1W3CA 4AB9A 1P12E 2J5UA 1V2RT 1Z8GA 2IPHA 1SQOA 2BOKA 5LPFA 1C1QA 4AFSA 2BY8X 2A31A 4D9RA 1HJAC 1WQSA 4K1SA 1A61H 2BQ6B 5F8ZA 3U9AH 2WSSD 1W7XH 3RXVA 1QL7A 4R0IA 1TGBA 1SL3A 2QA9E 4ZHAA 3GDSA 1V2PT 3H7TA 3T25A 2GCHG 2O8TA 4X8SH 3SGBE 1LVBA 2XWBI 3GS9A 3LIWA 3RXRA 1MTSA 1WYKA 3MHWU 5EG4A 4NWLA 1AVXA 2BD8A 2Y7XA 3N7DA 3SV7A 2QXIA 3QLPH 2C8YB 5HMAA 2VWOA 3GY2A 3TITA 3A81A 3A84A 4AGJA 1OX1A 1PYTD 1SGPE 1IOEA 1ETSH 3GY5A 5FHTA 1C2EA 3ZVFA 1K28D 1OYQA 2TPIZ 2F83A 4CH2B 3LJOA 4K8YA 4X8TH 3Q77A 5F8XA 2ZFPH 1KIGH 1V2QT 2GD4B 1X7AC 3VPKA 2QF0A 1HV7A 1QFKH 1BBRH 1QURH 1P05A 2XTTB 3U8TH 1QCPA 1SG8B 3HATH 1OP2A 3V12A 4A6LA 2F91A 2FI3E 1DSUA 3BG8A 3DD2H 4JZDH 1THSH 4OS4A 1K2I1 3SOSA 4FUFA 4UONA 4NIXA 1DITH 3V0XA 2CHAC 4Z6AH 1TONA 4YLQH 3TVJB 1BTYA 2YOLA 2QCYA 5DSFA 2OK5A 4K8BA 3A8DA 3ATMA 4GHTA 4CHAB 2VIDA 4OS5A 2FOMB 3LGTA 4OGXA 3HK3B 1LQDB 1W0JD 3ZZ8A 3AASA 3S9CA 5FX6A 3G01A 1NY22 5HM9A 2BQ7B 1ANEA 1ELCA 4WJG2 1CQQA 3HGPA 3PMBB 3SV2H 3A85A 1W2KH 5EIYA 1C9PA 4GPGA 2PTNA 3F2HA 1G2MA 1OP0A 5E0GA 1FAKH 3F6UH 1VJ9U 2JDID 1ZOMA 2YNBA 2FODA 2P3FH 3BIUH 3RC6A 4WH8A 4U2WA 1TB6H 3U69H 1GVKB 2JJ1D 1O3NA 1EAUA 3F0OA 2ZDNA 1BITA 1ELTA 3ODDA 1JMOH 3VB5A 3ZZ9A 1ZHRA 1JWTA 4XOJA 1SLWB 4TY6A 4AYYB 5JBCS 2C93B 5C3NA 2UWPA 4WMDA 4BNRA 3ZVBA 4AN7A 1RGQA 5L2YH 2A4QA 9ESTA 3RXJA 3RXSA 2PR3A 4H42U 1O31A 4GUXA 2ASUB 1XUGA 4AC9A 4AORA 4GLYA 4ESTE 4MNWA 4WMEA 4JMYA 4JK6A 1SKYE 3F9GA 4X2YA 1BRBE 1S81A 1D3TB 3RLYH 1N6YA 1MZAA 3LONA 3JZ1B 1Y3XA 3PV2A 1EPTA 5C5OA 1FMGA 5CHAC 1GBTA 1N6XA 4MLFB 4X6OA 2D8WA 4Y71A 5EXNA 2Z3DA 1KDQB 1OPHB 1V2NT 1CA0C 1SOZA 4KGAA 2QXGA 1L1GA 1GI1A 4CBOA 3TH2H 4DOQA 1HAGE 2P59A 1F0UA 1HIAA 3CENA 5F03A 1THRH 1GG6B 4HZHA 1QL8A 1IHSH 3SJKA 3OEHD 1SQAA 1A2CH 1O3IA 1P9UA 5CHBA 2WPJS 4Y6DA 5C0UA 1EPTC 7GCHG 2PTCE 3PRBA 1V2ST 3S9BA 3OAAD 1A46H 3PM3A 1BTHH 1RJXB 1SC8U 1ZMLA 3QN7A 1ABJH 9LPRA 2ZO3H 1LKAA 2OTVA 4FUEA 1HXFH 1JIMA 3DSOA 5TCAA 1Z7KA 3L33A 3EYDA 4NIVA 5GPIB 1KXBA 1O37A 1K0HA 3O8BA 3FP8E 4Y11E 1O2GH 5E0HA 5CE1A 1C1NA 2GT8A 2UUJB 5SGAE 2HNTE 1V2LT 3NUMA 3BIVH 4Q7XA 4Z0KA 3M3TA 1D9IA 1K22H 3RP2A 5JB8S 3DFJA 4SGAE 2KCPA 3UWIA 4RN6A 5FXLA 1ZMNA 2ZG0H 4AB8A 3BG4B 5E2PA 3V13A 3T2NA 4J2YB 1SGFA 3ZV8A 1O3JA 3KYFA 3IITA 3SU0A 1GHBF 1O3HA 2L6OA 1BTZA 1C5WB 2WYJA 4M7GA 1C1VH 2ZFRH 3PMHB 4GAWA 4F55A 5J4QA 1OHHD 1QJ7B 1ZSKA 1AUJA 1YPLH 3CNRA 1C4Y2 1MH0A 4K1TA 1P2KA 3VG8A 4X1QU 1LCYA 1HJAB 1XUFA 1O5CB 1OWIA 3FFGA 3MI4A 2GZ9A 2BLOA 4NZQA 2CF9H 3R0FA 4ABBA 1O3DA 3GY4A 1GBAA 2OQ5A 4DJZB 2G55A 2PHBA 2G00A 1SPJA 2CF8H 3UWJH 4KTSA 1GJCB 4O3TA 3E0PB 4NFEA 4IMZA 3BTGE 1AE5A 2ZF0H 3F9EA 3DUXH 1ZSLA 3ZZAA 3RXCA 1Q3XA 1H9HE 3GDVA 4CH8B 1SHYA 3P8NA 5EQQA 1Y3YA 1AB9C 2FTMA 1HB0B 1FN6A 2GV7A 3GCNA 1AZZA 2SFAA 4DGJA 4FETA 1FAXA 4CREA 4ZROA 1LHEH 3ZVCA 4XBCA 3RXKA 1GI6A 1NC6A 2C8XB 1FIZA 1O3AA 1ZLRA 4B75A 3A83A 1V6DA 3ODFA 3SNDA 1GGDB 1P03A 5FBEA 1M9UA 1GJ7B 4OS1A 5EXMA 1EJMA 1EZUC 3SHAH 3VFEA 2IJOB 3MFJA 1HLTH 1BZXE 5FAHA 4K3JA 1LHFH 3F68H 1AI8H 2THFB 3RXUA 1WXRA 3GCOA 1QIXB 2CHAB 2FYQA 1ELBA 3BTTE 2EI7A 5C0TA 4D8NA 2J98A 1TQ0B 6ESTA 1MMJN 3TH3H 1ZPZA 4ACAA 2XBXA 2ZQ1A 1FXYA 3KQEA 2W26A 1VGCB 1FV9A 4BAKB 1O3KA 1K1IA 8GCHF 1S5SA 1MUEB 2PGBB 1EUFA 1Z8JB 1E0FD 4MNXA 3ZZDA 1EATA 1BRAA 2QIQA 1ZPBA 3RMLH 2ZPSA 4GSOA 1W8BH 2BLWA 3SNCA 2KR7A 1CGIE 1OWJA 3LC3A 2I6QA 4H6TA 1TE0A 3SQHE 2BD2A 4RKOB 2BVSH 1SVPA 1A1RA 1C1PA 1BRCE 4Y79A 4YOIA 1AIXH 5DPAA 2XXLA 1GBIA 3H09A 4ZAEA 1HUTH 2OC8A 2PKAA 1PPEE 3ZVDA 1C1WH 1GMHF 5DN6D 5LGOA 1BMLA 1SGDE 1CE5A 1YCPH 3T29A 1G36A 4TSFD 2OXSA 2ZPQA 3SNEA 3DT0H 2FEQH 4JCNA 1GI8B 2PFEA 3URDA 1HAPH 4CRDA 5DK1A 5DP5A 3N7EA 2BD7A 3STIA 4D7GA 4IN1A 3QX5H 4P02A 3RC5A 1YY3A 1ESTA 2UWOA 2GCHF 2DUCA 1INCA 1O2UA 4MNYA 4RT0A 1DWCH 1GI3A 1KY9A 1GBDA 2G81E 1WTHD 2H1UA 1HAVA 3E3TA 1G3EA 1YLDA 4TWWA 1GVLA 3P8GA 2FOAA 2ZEBA 2J4IA 2ZGJA 3RUOA 1P0SH 1O2WA 4JYVH 2NU2E 3UOUA 1TGNA 2O8UA 5CHAB 1PPCE 1ZJKA 3S9AA 2O8LA 1SGEE 3QWCH 1OWDA 1GJ6A 1Z71A 1FY4A 4CHAC 3T26A 2ANYA 3RM0H 1O2QA 1CA0B 2WUCA 1VR1H 3BTKE 5A09A 1AVGH 2F3CE 2IOTA 3QO6A 3ZZ6A 3BEUA 2H6MA 1OKXA 3ELAH 5EJLA 1SQRA 2J94A 1WCZA 2ZECA 1TPOA 4INLA 2R3UA 5EOKA 1H1BA 1QTFA 4OGYA 4P00A 2FLBH 4K1EA 2ODQA 2A4RA 1EPTB 4HTCH 4Y8ZA 1TA6A 1HAXB 5DGJA 5K7RA 1C5QA 1G2LA 1ZTKA 3UTUH 4K69A 1UTQA 3NRLA 1XKAC 3EGKH 1AKSA 5AHGH 1TOMH 1UVTH 2RCEA 2Y5HA 2G8TA 3SU3A 4I7YH 4X1NU 3DA9B 1NZQH 7ESTE 1G3DA 1HIAB 3GY6A 2EEKA 1MQ5A 1H9IE 4I8JA 1GHBG 1NFXA 2PUXB 2FOEA 1LHDH 3ZZ3A 1O2RA 5EJ1A 2HLDD 5L30H 4J1YA 3F2FA 3OU0A 2W7SA 1D6WA 1NRNH 4XD7D 1LKBA 1FJSA 1OXGA 2BDHA 1MZDA 2VU8E 1SLVB 1QQ4A 4ABDA 3MH5A 2IJD1 1J14A 1LVOA 3FAOA 1SGFG 2PLXA 1ANBA 3ATLA 3U1IB 4ZXYH 3RXHA 1D3DB 3A8CA 3A7TA 3HK6B 3SGAE 3S7KB 1Y59T 3TGIE 1C5VA 1CT2E 4FUCA 5EJZA 2OBOA 1P2MA 3AAUA 5JYIA 2BY9X 3PLPA 8LPRA 2QGRA 4YLUA 3KF2A 1SFQB 2OQUA 1PPHE 3T62A 1W12U 3LC5A 2UUKB 6LPRA 1RS0A 1C1OA 1RXPA 5AFYH 4RT1A 1H8ED 1TNIA 3OFND 5C1XA 3I78A 2R0LA 1GBFA 2UUFB 2ZFSA 1O33A 1IQFA 3TK5A 1GI7B 4NA9H 1YGCH 1F5LA 1AB9B 4NIWA 1O2MA 1T31A 2VVUA 5HM2A 5GNDA 1EOJA 2FX6A 1YPJH 4GVUA 1DE7H 4X1RU 2P3UB 2O9QA 1MKWK 1GI4A 1FY3A 5DP8A 2FI5E 2K1QA 2Z94A 3SN8A 1QR3E 5EQSA 3UNQA 1DWEH 3PYHA 4ASHA 1HAOH 1C1SA 2BLQA 3U28C 2RDEA 3P92A 5FL7D 1P02A 2F9PA 3KCGH 4X1SU 1XUJA 3OE7D 1Z1IA 3NZIA 3SNAA 1HCGA 1S84A 4ABGA 2BDGA 1C2FA 4O3UA 3FO8D 1YPEH 4FOUC 2HRVA 4OS2A 2ALPA 4TWYA 1QZ8A 2KAIA 2VVVA 2B0FA 1T8LA 4IC5A 1EQ9A 1ABIH 2PP6A 3M5NA 2GGVB 1O3CA 1DVAH 1H8HD 3UREA 2XNIA 4O9VA 2JH5D 2ANKH 3GYLB 3E1XB 1XX9A 1O3PB 1XVOA 2AMPA 3OTPA 4AGKA 5AF9H 3LGWA 4WH6A 2VIPA 1BCUH 2V7QD 2BY6X 1NESE 1GMHG 5GJ4B 4HFPB 1PPFE 4FUBA 3DSPA 2ZDKA 2BDBA 2QE7D 1HAIH 1C2MA 2ZTZA 3K6ZA 1NFYA 1V2VT 1Y3UA 4A1VA 2VGCC 3CS0A 1E37B 1MABB 1BIOA 2QC2A 2RA3A 1L2EA 5FPSA 1BUIA 1ZPCA 4FUIA 3TJOA 1AU8A 3UAIC 1Z1JA 1O3EA 1TYNA 4NWKA 4OM9A 2A7HA 1EZQA 2FS8A 4JZIA 1C1RA 3MU1A 1K1OA 2M2AA 2J9NA 3MNXA 5KECA 2C4FH 1HAHH 5E0JA 4GHQA 1GHXH 2KCYA 3LGUA 1KLJH 2F9UA 5ETXA 1U6QA 5FPTA 1TABE 1BQYA 1OP8A 2OUAA 1TNGA 1P10A 1GVZA 2P94A 3HGNA 4ISNA 2FZZA 4TPIZ 2IPQX 1H4WA 1GGDC 1S85A 4RKJB 1V2UT 2WYGA 2EI6A 3URCA 3EQ0H 2R2WU 1RD3B 2PV9B 2VJ1A 3MH4A 2AIQA 5C67A 3A87A 1AQ7A 1BA8B 2LNCA 1Y8TA 4Y7AA 1TOCB 4YTAA 1C2HA 4AOQA 2VWLA 1BTWA 1O36A 1CT0E 1KXDA 2CXVA 1A5HA 5JBBS 3BTQE 1Q2WA 4H4FA 5KGOA 4ABIA 4CRAA 5L6NH 2QF4A 1UCYE 4A5TS 2ZCHP 4U01A 5DP9A 1SGNE 3QZQA 5C2ZA 1SLXB 1AY6H 1K1MA 4WMFA 1UK4A 3MMGA 3K2UA 3UQOA 1O3OA 1O3GA 1CHGA 3F0PA 3UIRA 4ISIH 1VGCC 1WDIA 1S0QA 2FWWA 3UR9A 1QY6A 1G37A 3FANA 4Q63A 1HAVB 3SUFA 3AAVA 2FLRH 2XC4A 1ZTLA 2RDLA 2WV9A 3OY6U 1UTOA 4CRBA 1YCPK 1P57B 4NZLA 5T6FA 4E06H 1W0YH 4IBLH 1NBMD 3DFLA 1KXCA 5A8XA 1IQHA 4KP0A 4INHA 1V2OT 1YC0A 4I32A 1T32A 2Z9IA 3BTHE 3Q3YA 3RXLA 2M5TA 4WY3A 2QY0B 1PPBH 2AEIH 3FZDA 1LHGH 4B71A 1GMCF 2A5KA 4YM9A 1MTNC 1KYNA 1SBWA 1KLIH 1ZTJA 1J17T 4H6SB 4BAQB 1RTFB 3MQKC 5A0BA 3VGCB 1YPHE 2BYAX 1Y5BT 3TU7H 4NCYA 5ABWA 2CK3D 5GWZA 1O2TA 1K9OE 1MKXK 4ZKOU 5DKMA 3SUEA 5TJXA 2BOHB 4A7IB 1P3CA 2VVCA 1QA7A 3VXEH 1W13U 4WWYA 2SGFE 4Y76A 1L1NA 2XBWA 1TA2A 1TGCA 2OCVB 5C20A 1DWDH 2G52A 2BTCE 1QBOA 1EASA 4ABHA 4ISLA 1E38B 2BXTH 5EPNA 4LXBH 1G30B 3TIUA 5JDUB 2D26C 5ESBA 1EZXC 2JH0D 2AGIX 1WV7H 4Q2KA 1GBKA 3V7TA 5B6LA 4ASUD 2WPMS 3A89A 2WHXA 3E16B 3KQBA 3PWBA 7KMEH 1F0TA 2NU4E 5BRRE 1ZYOA 5F6MA 2C8WB 3TNTA 4MG3A 3UNRA 1EAWA 2GDEH 3A8BA 3LDXH 2SGEE 2ZU3A 3PRDA 1QRXA 1J15A 2WV5A 1F2SE 2ZA5A 2ZGBH 3SNBA 1HYLA 4I86A 3ZZ5A 1JIRA 2CMYA 1O5BB 2A45B 2A1DB 1C2JA 3RU4D 3SU4A 3FOAA 3P17H 1O2XA 1L1JA 4MNVA 4A1XA 3E6PH 4FU8A 3ATKA 3GYMA 2C90B 2HLCA 3W1EA 1TBQH 1KTTB 2I6SA 1UMAH 3S0NA 3ZVGA 3C27B 1CSOE 1S82A 2XC0A 4Y8YA 3SV6A 1TAWA 5DP4A 1UO6A 2GV6A 3KL6A 3EA8A 1BOQA 3KQ5A 3VXFH 4DW2U 5EGMA 1XKBC 3BTDE 1O3MA 1O34A 1XUHA 3GY3A 3MO3A 3M5LA 3BTFE 1MQ6A 2ZU1A 4BAOB 1GDQA 1MKWH 4MQAA 3KN2A 1IQEA 4DT4A 1W0ZU 1C5ZB 2GX4A 3LPRA 3D62A 3TGJE 1HAZB 3E8LA 4Q80A 4IMQA 2BLVA 1FPHH 2TIOA 2ZQ2A 1EAIA 4NSVA 3T5FH 2PW8H 4RSPA 2P3TB 2VIWA 4D76A 4BAMB 1DWBH 3GCHC 3SBKA 3SJIA 3T27A 2R9PA 1TFXA 2QYIA 2YMSC 2B7DH 2WPDD 1DX5M 1DS2E 2Z9KA 1GHAG 1AE8H 3ATWA 4UD9H 2Y5GA 1O39A 2Y7ZA 3KNXA 1P2JA 2QAAA 2KAIB 3JZ2B 2ZFTA 2W3KA 3U98H 2VGCB 1BJUA 4BOHA 3F9FA 1ZJDA 3PROA 4FUJA 3I77A 1KLTA 1PQ5A 3O8DA 1E36B 2SGQE 1W14U 1EX3A 2R3YA 4AFUA 3QUMP 1WAYB 1T4UH 4XDEA 1D6RA 2CN0H 2VBCA 1GBLA 2JH6D 1TGTA 4I8GA 4MPVA 2ZFQH 3M7UA 3RXAA 3A7XA 1SQTA 2V3OH 4TY7A 1O2IA 3MWIU 1FY8E 2VWNA 3QK1A 2GZ8A 1EP5A 2SGAA 2GMTB 2R0KA 1HFDA 1CBWC 1DY8A 2YNAA 1LPZB 3QTVH 3A80A 4A1TA 2Q1JA 2BXUH 3E0NB 1BTUA 4NG9H 5FPYA 2G5VA 4OS6A 1D3PB 1DM4B 2ULLA 1BHXF 1O35A 1SHHB 4B2BA 2H5DA 1NU9A 3F2GA 1C9TA 1TPAE 4MPWA 2WZQA 4B2AA 1SLUB 1TMUH 1IQKA 5DP7A 2OLGA 3BV9B 2FOBA 2VINA 1EB1H 4IW4E 1ZHPA 3H7OA 2GT7A 1IQJA 3SO3A 1D4PB 3ZZ4A 3S69A 1EZSC 1A0HB 1JOUB 1C5PA 4BXSA 1HJ9A 4DY7B 2G4TA 2K8IA 2ZHWH 1NFUA 3M36A 2FOHA 3TK6A 1P2OA 1C5UA 2XCNA 5EXLA 1NTPA 1UVSH 3PO1B 2BB4A 4XSKU 4CR9A 2ZDLA 2VIVA 1GMCG 3ZYEA 2DE8A 1NBME 1SGCA 1TRMA 1Y5AT 4K2YA 2BDIA 1NFWA 1MBQA 1CA8B 3UUZA 1AFEH 1J8AA 1PFXC 3LOXA 1DUEA 1CO7E 3RXTA 1VCQA 5CMXH 1O2HA 5EW1H 4WXVA 5PTPA 4YOJA 1OWHA 2UUYA 4X2XA 3A7ZA 1A3BH 3GOVB 1SI5H 4B73A 1SOTA 1O38A 3PWCA 4ZKRU 5F8TA 1O2JA 3DSGA 1P2IA 1MTNB 3OSYA 1PQ7A 1DDJA 2XWAA 1LDTT 2ZGHA 1AFQC 1K1NA 2BX4A 5C1UA 4BANB 1ZRBA 1QB6A 4KKDA 1TMTH 4B74A 1NU7B 1A3EH 1D3QB 5DJ7A 2H2ZA 1NM6A 1MU8B 3PTBA 1IAUA 1UTNA 1LO6A 2HNTF 3HPTB 4HGCA 2A4OA 3AVZA 3FN8A 3OY5U 4FVDA 5I46H 1XUIA 4UDWH 1A4WH 1BRUP 2HNTC 3EDXB 2HPQH 1MTWA 3PMAB 4O97A 1MKXH 2ZTYA 4DVAU 4D7FA 3NPSA 3C1KA 2W6JD 2ZWLH 1YLNA 3K65B 3F9HA 2SGDE 3BN9A 3AW0A 3SUGA 1NRQH 4UEHH 1QRZA 1O2OA 1UCYK 3A88A 3RC4A 1BTXA 1PPGE 2WUBA 3LGYA 3FVFB 1C5OH 5HYOA 8KME2 5T6GA 1KXEA 4FU9A 1E35B 4YT6H 4ACBA 5HXFA 3MYWA 5J4SA 1EJNA 4Y0ZE 5ESTE 2KX4A 1G3BA 4ZHLU 2Y6TA 4FUHA 3VB6A 1WBGB 2ALVA 3I29A 4I8HA 2A7JA 2BD3A 3M5OA 1ETTH 4ABFA 3RU4E 5C94A 3LGIA 2ZU4A 1AN1E 3LJJA 2RA0A 1RRKA 1THPB 4B76A 3RLWH 1O5AB 4YXWD 5L2ZH 5JPMH 3ZVEA 1UVPA 3HKJB 1QL9A 2CJIA 3QGJA 3RMNH 5B6OA 4R8TB 2AS9A 5LH8A 1F0SA 1NN6A 1UTLM 2AGGX 3OYPA 1ESBA 1HNEE 2V6NA 1GMDG 2ZDAH 2BMGB 1RTKA 3VGCC 2G51A 1CGJE 5F53A 2FI4E 3TPIZ 1PYTC 1EP6A 1GBHA 1S6HA 4E7NA 2FPZA 2HGTH 1QGFA 4UFEH 1T7CA 2ZHQH 2H5CA 4Z1MD 2F43B 1G3CA 3KHVA 2KCOA 2ZNKH 4LOYH 1CVWH 1AGJA 1K1LA 2Q6DA 1C4V2 2J95A 2FOGA 1BMAA 2BDYA 1P06A 3A7YA 3UPEA 3VB4A 1UJ1A 2FS9A 2EI8A 2WPHS 5EPYA 3M7TA 2BD9A 2ODPA 2XBYA 3IWMA 1UW7A 1W11U 5T6DA 3SU5A 2BZ6H 2A0QB 1O5FH 3MO6A 2STAE 2GTBA 3GCHB 5HGGA 2YMSB 1HXEH 2HOBA 4DCDA 1ELFA 1V2TT 2NWNA 2B9LA 2BX3A 2QF5A 1F5RA 1FPCH 1F7ZA 2A5AA 2JKHA 2G4UA 1UTPA 4UFFH 1HBTH 3FZZA 4JYUH 1YPGH 3TH4H 1QB1A 3ATIA 1FQ3A 1ORFA 3AW1A 1ESAA 3DCLA 4JK5A 2FIRH 1PJPA 3SU6A 2ZKSA 1GBMA 1XMNB 1O2VA 2G5NA 2WPIS 3BTEE 2ZIQH 2AGEX 3OX7U 4NA7A 3VEQB 4ZHMU 1GBJA 1FIWA 1MU6B 3PTNA 4WF8A 1GBEA 3UQVA 1ARBA 1NT1A 1YCPM 4I8KA 1TPPA 1YPMH 1CBWB 5IYTA 3ZYDA 1O32A 2VWMA 2D1JA 5H4IB 5G4BA 2PUQH 1AHTH 1C5LH 1TIOA 3ZZBA 3LH1A 1QNJA 1Z6EA 4HG6A 5HIYA 3PLKA 4BXWA 2TRMA 1O5GH 3ENSB 1DPOA 2GDDA 2F9VA 2OBQA 2F4LA 2IN2A 2OC1A
chains in the Genus database with same CATH topology
4X8VH 3MOCA 1DXWA 1GBCA 2ODYB 1YKTA 2TGAA 3Q3XA 4ISHH 4X0WU 3P95A 4F4OC 4X2VA 2Y80A 3SZNA 1OS8A 4FUGA 4X2WA 2WPKS 1FONA 1LQEA 1W10U 2FM2A 5LPRA 1IQLA 1LMWB 2B8OH 2VH6A 2FESH 2Y82A 3IG6B 1GI9B 1C2KA 1C5YB 1VCPA 3RXEA 5BPEA 5EU8A 1CT4E 1GJ9B 2UWLA 3RXGA 4ABAA 2Y81A 1ANDA 1C1UH 1XVMA 2PSYA 1TX8A 2W5EA 2GZ7A 2FDAA 4THNH 1TNKA 3CS7A 2HVXA 3PB1E 1C2IA 2JETC 1JRTA 4MTBA 2QXJA 1GHAF 1IQNA 4YZUA 3P70B 1VZQH 3TK9A 3RMOH 1T8MA 2Z3CA 3S7HB 3P6ZB 1AFQB 2BDAA 5A0AE 2BVRH 2ANWA 4YT7H 1VITG 3SU2A 1BTPA 1C5NH 1OWEA 1UTMA 3N7OA 2ZZUH 2GMTC 1GBBA 3FP6E 4IN2A 5GCHG 1PQAA 2J34A 2EA3A 5LPEA 1IQMA 4DG4A 1T8NA 1ACBE 3M35A 1FN8A 3LH3A 1DLKB 1SB1H 3KEEA 1GJAB 2BD5A 2PKAB 1O2SA 1IHTH 1PPZA 2BM2A 3F1SB 2W3IA 3K6YA 4YOGA 1HAYB 4UFGH 4ISOA 6GCHG 1UK3A 4JZFH 4BTUB 2VH0A 1A5IA 4IS5A 3P8OA 3BTME 4Q7ZA 5DP3A 1BBRE 1P2QA 2BHGA 4FUDA 1GHVH 1WTGH 4TYDA 3ZVAA 5JBTA 3GISB 1GJBB 2AMDA 4SGBE 1TNHA 3ZZCA 1UVOA 1YM0A 4Y7BA 1ZR0A 2ZFFH 4CRFA 3DHKH 3PMJA 1N8OB 1UCYH 3Q00A 1ETRH 4E7RG 1QHRB 3TJUA 4JYTA 3PO1C 3SJ8A 1ELVA 3TGKE 1BMNH 1K1PA 1TBRH 4DIIH 1MD7A 2A7CA 3UFAA 5TCCA 3TJVA 3M3SA 5FCRA 3EAJA 1V2JT 2TGDA 5EODA 1O2NA 4JZ1A 1GCTC 5JBAS 3GCTG 3BEIB 2R2MB 1UHBA 2ZCLP 4MVNA 1WOFA 1QJ6B 1EOLA 4U30A 1ZHMA 4NGAH 2TGTA 7LPRA 1HGTH 3TNSA 1XUKA 1O2LA 1SGTA 4X6NA 1UVUH 3RXDA 3BF6H 2ZHDA 1P11E 1H8IH 2FOCA 4ZXXH 5FBIA 1BB0B 1VJAU 1TWXB 4X1PU 1WQVH 4DT7B 4F49A 2A5IA 1ZGIA 2D2DA 1MCTA 2AERH 1Y5UT 1N1LA 1WU1A 4WXIA 2ZTXA 3SJOA 3EE0B 3MU0A 2OC0A 1MTUA 1A7SA 3MU4A 4ABEA 4FVBA 2J2UA 2BZAA 3D23A 1AKSB 2CGAA 2H9EH 1MBMA 1Y3VA 2BQWB 1AMHA 2W7UA 3U8OH 4NIYA 3GY7A 6CHAC 2AYWA 2Q6FA 3V3MA 1P8VC 5C5NA 3ZV9A 2ZU2A 2TBSA 1YF4A 1H9LB 1A5GH 1GJ4H 1A0LA 5DO4H 1YP9A 1C2LA 2Q6GA 4I33A 1GJ5H 1TNLA 2XC5A 2QN5T 1IQIA 3SI4H 1EXFA 1BDAA 2XBVA 5DP6A 1QJ1B 1Y3WA 1SFIA 3B8JA 1QBNA 2P16A 4QT8C 1C1TA 1CHOG 2GVFA 1LPKB 1O0DH 1SSXA 1SGRE 4MPXA 1V2WT 2SNWA 2QF3A 1KXAA 1GJ8B 4AG1A 2QXHA 1FI8A 1GI2A 3Q3KA 4ABJA 3PV4A 4HI3A 1NRRH 2XW9A 3NKKA 3SUDA 1NRSH 4E05H 3QGNB 4AYVB 3P8FA 3HKIB 2P8OC 1SMFE 1XXDA 3MTYA 2NU3E 3SV8A 1GWAA 2FXRA 1FNIA 1TLDA 3SHCH 2V35A 1GI5A 1GMDF 2Y5FA 1ANCA 2A2QH 1SR5C 1UTJA 4GCHF 3SORA 1TRYA 1RIWC 2AIPA 4XFQA 3SGQE 1JBUH 1AZ8A 4DIHH 2GP9B 1F92A 1DY9A 1H8DH 2O8WA 1K21H 3M61U 5E2OA 4MDSA 1VITH 1FDPA 3A86A 1TMBH 2DE9A 4IC6A 4LK4A 3ZZ7A 4OS7A 1OYTH 3A8AA 3B23B 3GDUA 3MO9A 1GI0A 1C2DA 1ELDE 2AFQB 1O3LA 1DOJA 3B9FH 4CRCA 4BAHB 3MU5A 2GCTC 3QDZB 2GKVE 1P01A 2ZGXH 1BMMH 2TGPZ 4X6MA 2ZC9H 2JETB 2WV4A 5IDKA 1LVMA 2O8MA 1GHZA 2PWXA 1B7XB 5EQRA 1C5MD 1ZSJA 4WVPE 1HJ8A 3M7QA 3STJA 3H5CB 1O30A 5A8ZA 4VGCC 2VB0A 1ZGVA 1IQGA 3FP7E 2AH4X 1SGIB 1YPHC 4CRGA 3U1JB 3RDZA 3NXPA 8ESTE 2Z6BD 4U32A 1UK2A 5A0CA 2A32A 5A2MH 1BT7A 4KTCA 1ZMJA 1O2ZA 1GDNA 2BY5X 3RXIA 1Z8IB 1S0RA 3O8RA 3RM2H 1ID5H 3EA7A 2LPRA 3BEFB 3NK8A 2V0BA 2PGQB 2PKSC 1Q31A 1OSSA 4BTTB 2VNTA 1O3BA 1QQUA 2PSXA 2J38A 4AX9H 4I8LA 4X8UH 1MAXA 1YLCA 1B5GH 1OOKB 1SGQE 2XYAA 3NWUA 1T4VH 1LHCH 3A82A 3GICB 1TX6A 2ZGCA 4YO9A 1FZZA 1L4DA 2H9HA 3M5MA 1ELGA 5K0HA 1MCVA 4Y8XA 4AZ2B 1GCTB 1DFPA 1YBWA 1NS3A 1P04A 1DLEA 1TQ7B 1KXFA 1Z8RA 2BD4A 3M37A 2BVXH 1VCWA 4XBBA 2RG3A 4K60A 3SQEE 3M3VA 4Y10E 1PQ8A 5GIBA 1YYY1 2FMJA 4YESB 2P93A 1MD8A 1RFNA 1AUTC 2HWLB 2ZDMA 1L4ZA 4X6PA 2BDCA 1DICA 4BTIB 4CR5A 2C3SA 2SNVA 4TPYA 4B2CA 1EAXA 1O5EH 2Z7FE 2BY7X 4O03A 3GY8A 3D49H 1UHBB 4A92A 3RXFA 3O8CA 1RTLA 2ZHFH 3RXPA 1VITF 1ELEE 3MNCA 2FYRA 1BBRK 4I31A 1C4U2 1K1JA 4MPUA 1NROH 3SI3H 5GCHF 1EJAA 4ZKNU 1GDUA 1HDTH 2EC9H 1TNJA 3UOPA 6CHAB 1C5XB 3KQDA 1OWKA 3BSQA 1C5SA 1GL0E 3EA9A 1W7GH 6GCHF 2C8ZB 1N8OC 1O2KA 3RMMH 3UNSA 2NU1E 5I25A 2NU0E 2F9OA 2Z9LA 3SV9A 1QB9A 3SW2B 3L6PA 3SU1A 2J92A 1ZZZA 3MNSA 2QV1A 3RXOA 4UFDH 2SGPE 4ZUHA 4B1TA 1O2PA 1C1MA 5T3HA 1O2YA 1QA0A 1DUAA 3U8RH 1B0EA 5FX5A 3LT3A 4ZH8A 1EKBB 1DT2A 1LPGB 1UTKA 4AFQA 3ESTA 5GDSH 2A4GA 1HPGA 3RXMA 1V2KT 2ANMH 1AD8H 1TX7A 3VB7A 3RU4T 4DURA 1T8OA 3BTWE 4GCHG 3MNBA 1O3FA 2FTLE 1TBZH 1F0RA 3A7VA 1GPZA 1GHYH 1JXPA 5FCKA 2P8OB 3GCTF 5DG6A 4CBNA 1C5RA 1MTVA 2OP9A 4AFZA 1TPSA 4LZ1H 1G9IE 1FY5A 1E34B 1ARCA 1GHWH 2WPLS 1TRNA 1J16A 4NA8A 2B5TB 1P3EA 1NRPH 1P9SA 3A7WA 3MH7A 1RIWB 2OD3B 1GCDA 1WSSH 3TLOA 4Y0YE 5E8EH 1C5TA 4K5ZA 1J9CH 1ELAA 1KDQA 2ZI2H 3KGPA 4NSYA 2V3HH 2CV3A 3WY8A 1AWHB 4XE4A 1JRSA 1LVYA 2ESTE 4NFFA 1HRTH 1ZRKA 3Q76A 1NPMA 2F9BH 1QBVH 3LKWA 1L0ZA 1AWFH 5GXPA 1A0JA 3W94A 5AFZH 2GCTB 2FP7B 1FY1A 2P95A 2FO9A 3RXQA 5JB9S 1GJDB 1QRWA 2ZDVH 1DXPA 5AVDA 2AMQA 1CU1A 3QZRA 2A2XH 2XCFA 1TGSZ 1Z6JH 2FX4A 3LU9B 1AO5A 2VIQA 1BJVA 5A8YA 1F5KU 1P2NA 3MH6A 2ZP0H 3RXBA 3UY9A 1G32B 1XXFA 4LZ4B 1CGHA 1FLEE 2Z3EA 2F9NA 2ILNA 3E90B 1WUNH 4VGCB 1GG6C 2H9TH 1XM1A 4D9QA 1S6FA 3MU8A 1S83A 1TALA 4JZEH 1LTOA 1CHOF 2FOFA 2STBE 4PROA 3NCLA 1YPKH 1SGYE 4FU7A 3TJNA 3W95A 4UE7H 4IGDA 3VB3A 1BHXB 1C2GA 1MAYA 4XBDA 3T28A 4KELA 5C1YA 3PLBA 2ZHEH 2HPPH 3CP7A 3K9XB 2HALA 2OINA 3KQCA 3UR6A 7GCHF 4KTUA 1O5DH 2VIOA 3OTJE 2ZPRA 2XRCA 4ZMAH 1DANH 3LGVA 1V2MT 2OC7A 2PKSB 4ZKSU 3SJ9A 1B0FA 2Z9JA 1AVWA 3E91A 5EW2H 4FXGH 3D65E 3R3GB 3ITIA 8GCHG 2WINI 2ZCKP 3BG4C 2Z9GA 1DSTA 1KTSB 1EB2A 1GL1A 4Q7YA 1FUJA 1KSNA 1V3XA 1NO9H 4INKA 3L3TA 3QTOH 4AG2A 3KIDU 1P09A 2ZU5A 1W3CA 4AB9A 1P12E 1V2RT 1Z8GA 2IPHA 1SQOA 2BOKA 5LPFA 1C1QA 4AFSA 2BY8X 2A31A 4D9RA 1HJAC 1WQSA 4K1SA 1A61H 2BQ6B 5F8ZA 3U9AH 3RXVA 1W7XH 1QL7A 4R0IA 1TGBA 1SL3A 2QA9E 4ZHAA 3GDSA 1V2PT 3H7TA 3T25A 2GCHG 2O8TA 4X8SH 3SGBE 1LVBA 2XWBI 3LIWA 3RXRA 1MTSA 1WYKA 3MHWU 5EG4A 4NWLA 1AVXA 2BD8A 2Y7XA 3SV7A 2QXIA 3QLPH 2C8YB 5HMAA 2VWOA 3GY2A 3TITA 3A81A 3A84A 4AGJA 1OX1A 1PYTD 1SGPE 1IOEA 1ETSH 3GY5A 5FHTA 1C2EA 3ZVFA 1K28D 1OYQA 2TPIZ 2F83A 4CH2B 3LJOA 4K8YA 4X8TH 3Q77A 5F8XA 2ZFPH 1KIGH 1V2QT 2GD4B 1X7AC 3VPKA 2QF0A 1HV7A 1QFKH 1BBRH 1QURH 1P05A 2XTTB 3U8TH 1QCPA 1SG8B 3HATH 1OP2A 3V12A 4A6LA 2F91A 2FI3E 1DSUA 3BG8A 3DD2H 4JZDH 1THSH 4OS4A 1K2I1 3SOSA 4FUFA 4UONA 4NIXA 1DITH 3V0XA 2CHAC 4Z6AH 1TONA 4YLQH 3TVJB 1BTYA 2YOLA 2QCYA 4K8BA 3A8DA 3ATMA 4GHTA 4CHAB 2VIDA 4OS5A 2FOMB 3LGTA 4OGXA 3HK3B 1LQDB 3ZZ8A 3AASA 3S9CA 5FX6A 3G01A 1NY22 5HM9A 2BQ7B 1ANEA 1ELCA 4WJG2 1CQQA 3HGPA 3PMBB 3SV2H 3A85A 1W2KH 1C9PA 4GPGA 2PTNA 1G2MA 1OP0A 5E0GA 1FAKH 3F6UH 1VJ9U 1ZOMA 2YNBA 2FODA 2P3FH 3BIUH 3RC6A 4WH8A 4U2WA 1TB6H 3U69H 1GVKB 1O3NA 1EAUA 2ZDNA 1BITA 1ELTA 3ODDA 1JMOH 3VB5A 3ZZ9A 1ZHRA 1JWTA 4XOJA 1SLWB 4TY6A 4AYYB 5JBCS 2C93B 5C3NA 2UWPA 4WMDA 4BNRA 3ZVBA 4AN7A 1RGQA 5L2YH 2A4QA 9ESTA 3RXJA 3RXSA 2PR3A 4H42U 1O31A 4GUXA 2ASUB 1XUGA 4AORA 4GLYA 4ESTE 4MNWA 4WMEA 4JMYA 4JK6A 3F9GA 4X2YA 1BRBE 1S81A 1D3TB 3RLYH 1N6YA 1MZAA 3LONA 3JZ1B 1Y3XA 1EPTA 5C5OA 1FMGA 5CHAC 1GBTA 1N6XA 4MLFB 4X6OA 2D8WA 4Y71A 5EXNA 2Z3DA 1KDQB 1OPHB 1V2NT 1CA0C 1SOZA 4KGAA 2QXGA 1L1GA 1GI1A 4CBOA 3TH2H 4DOQA 1HAGE 2P59A 1F0UA 1HIAA 3CENA 5F03A 1THRH 1GG6B 4HZHA 1QL8A 1IHSH 3SJKA 1SQAA 1A2CH 1O3IA 1P9UA 2WPJS 4Y6DA 1EPTC 7GCHG 2PTCE 1V2ST 3S9BA 1A46H 3PM3A 1BTHH 1RJXB 1SC8U 1ZMLA 3QN7A 1ABJH 9LPRA 2ZO3H 1LKAA 2OTVA 4FUEA 1HXFH 1JIMA 5TCAA 1Z7KA 3L33A 3EYDA 4NIVA 5GPIB 1KXBA 1O37A 3O8BA 3FP8E 4Y11E 1O2GH 5E0HA 5CE1A 1C1NA 2GT8A 2UUJB 5SGAE 2HNTE 1V2LT 3NUMA 3BIVH 4Q7XA 4Z0KA 3M3TA 1D9IA 1K22H 3RP2A 5JB8S 3DFJA 4SGAE 3UWIA 4RN6A 5FXLA 1ZMNA 2ZG0H 4AB8A 3BG4B 5E2PA 3V13A 3T2NA 4J2YB 1SGFA 3ZV8A 1O3JA 3IITA 3SU0A 1GHBF 1O3HA 1BTZA 1C5WB 2WYJA 4M7GA 1C1VH 2ZFRH 3PMHB 4GAWA 5J4QA 1QJ7B 1ZSKA 1AUJA 1YPLH 1C4Y2 1MH0A 4K1TA 1P2KA 4X1QU 1LCYA 1HJAB 1XUFA 1O5CB 1OWIA 3FFGA 3MI4A 2GZ9A 2BLOA 4NZQA 2CF9H 3R0FA 4ABBA 1O3DA 3GY4A 1GBAA 2OQ5A 4DJZB 2G55A 2PHBA 2G00A 1SPJA 2CF8H 3UWJH 4KTSA 1GJCB 4O3TA 3E0PB 4NFEA 4IMZA 3BTGE 1AE5A 2ZF0H 3F9EA 3DUXH 1ZSLA 3ZZAA 3RXCA 1Q3XA 1H9HE 3GDVA 4CH8B 1SHYA 3P8NA 5EQQA 1Y3YA 1AB9C 2FTMA 1HB0B 1FN6A 2GV7A 3GCNA 1AZZA 2SFAA 4DGJA 1FAXA 4CREA 4ZROA 1LHEH 3ZVCA 4XBCA 3RXKA 1GI6A 1NC6A 2C8XB 1FIZA 1O3AA 1ZLRA 4B75A 3A83A 1V6DA 3ODFA 3SNDA 1GGDB 1P03A 5FBEA 1M9UA 1GJ7B 4OS1A 5EXMA