1BTYA

Crystal structure of beta-trypsin in complex with benzamidine
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Episelection: novel Ki approximately nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btyA02
3MO6A 3ZVFA 4YOIA 1FI8A 4OS1A 4FUFA 1RJXB 2TBSA 3RXDA 1ID5H 1MQ6A 2FMJA 1BITA 4MNVA 3A7ZA 4K5ZA 1V2WT 3SJOA 4KELA 4FU9A 3EA8A 2VWNA 1YPGH 3SU0A 1RIWC 2A4QA 4Y10E 1UVOA 1A5IA 1XMNB 4IN2A 1QR3E 1E0FD 2ZG0H 1G3DA 2ZEBA 3ATLA 1AVGH 4ZKOU 1PQAA 4DURA 2FLRH 2A5AA 2Z9LA 1NRRH 1UTLM 1V2QT 1XUGA 2EI8A 1F5KU 1T7CA 1LHGH 1XUJA 3VFEA 1TMUH 1LVYA 2VNTA 2ZTXA 2FOHA 2O8UA 1NU9A 1ELEE 1H9LB 3BTQE 3P17H 1O2XA 1QB1A 4UFGH 1GI9B 1ELGA 1V2NT 4FUEA 3D62A 5A8XA 1P2OA 4X6PA 4K8YA 3AASA 1KXEA 1KY9A 2WUCA 3DA9B 1QHRB 1P10A 1O2MA 1O31A 3M7QA 4A6LA 4MLFB 3OY6U 4E06H 2ZO3H 4B73A 1BMNH 1A5GH 1PPEE 1EAIA 4K2YA 5EOKA 4WWYA 4Y7AA 1UVPA 1EOJA 2THFB 1OP2A 1MU6B 3U8OH 2GCHF 1OWHA 1UTOA 1T32A 3LGVA 1KTTB 4JK5A 1ZTJA 4K1SA 3T5FH 1NY22 1UK4A 2Q6GA 1GJAB 8KME2 2BLVA 3UREA 5CHAC 3A82A 1J17T 1SVPA 3SGBE 1D3PB 1MTVA 8LPRA 1VGCB 4CHAC 3ZYEA 2OC0A 2ZGHA 5A2MH 1TQ0B 2JKHA 2XC4A 5K0HA 1E34B 2R0LA 1TAWA 2STBE 1HPGA 2FOFA 3NXPA 1GG6C 3O8RA 2OC8A 1G9IE 3SQEE 1GHBG 1GBEA 2PKSB 2ZCLP 2D2DA 1HAVB 2B5TB 4ISNA 3ZVAA 4ABJA 1FXYA 3S9CA 3UQVA 1DWBH 2BQWB 2JETB 1BRCE 3BTWE 5A8YA 2BB4A 3BG4C 5BPEA 3LU9B 1ARCA 2BTCE 1QBNA 5DP9A 3W95A 2G00A 1G37A 1PJPA 1OYQA 3RC5A 3RXUA 2ZHFH 1YGCH 2PHBA 2VIDA 1PYTC 2FZZA 3R0FA 1Y3UA 1O5DH 1GL0E 2C8WB 3GY3A 2PFEA 1CT2E 3A7VA 1HAIH 3SNEA 1MD8A 3FAOA 4LZ1H 1Y3VA 4NFEA 1QL7A 1ZJKA 1ZZZA 1J14A 2WV5A 3PLBA 2XBVA 4X8SH 3D23A 3MNBA 1QB9A 1A2CH 2I6SA 2PKAA 1ZOMA 3MU1A 9LPRA 2OCVB 4ABFA 3F1SB 3T26A 2O9QA 1CT0E 4OS4A 1ZMJA 1VITF 1OWEA 2F91A 2F9BH 2PR3A 1YKTA 3BIVH 2WUBA 2Y5HA 3DFJA 1IQHA 4ABEA 4ZKRU 2CHAB 3K2UA 5DP8A 1AN1E 1ELAA 1ZTLA 1NS3A 1O2NA 1RGQA 2OBQA 4RN6A 1C5UA 5TCCA 1G30B 4AG1A 2G55A 3RXEA 4E05H 4X6OA 4NA7A 1BTYA 1PPZA 1EP5A 1ZTKA 3I77A 3SU3A 3FFGA 2BD7A 2W26A 1UCYK 3PTBA 3TGKE 1A46H 4ZXXH 3RXAA 3S9AA 1EX3A 1Y3XA 3SU6A 3U69H 1A1RA 1MBQA 4HZHA 1BTUA 1NN6A 2SFAA 4QT8C 1Y59T 3RXCA 4GUXA 1TBRH 1AVXA 3KHVA 1F0SA 1IQMA 3MNCA 4BAKB 1MKWH 1C1NA 3PMAB 2DE8A 4I8JA 1AIXH 1K1PA 3V7TA 3I78A 1EAUA 3S7KB 1AB9C 3SNAA 5K7RA 1EPTA 3CENA 3BTFE 4YT7H 2BD9A 1CBWC 1MCVA 1HIAA 3A7WA 1XM1A 4OS5A 4HFPB 2ZNKH 3O8CA 1ELTA 4IN1A 1UTJA 1YLDA 4ISIH 3ZZ3A 1SFIA 3A7TA 3SUFA 2ZTZA 1TX8A 1DUAA 5E0JA 1BIOA 5EXMA 1D4PB 3E91A 1T4VH 4CRCA 3GDVA 2O8MA 2BM2A 4FUCA 2ZFTA 4MNYA 1ETSH 1O2KA 1O5BB 2KAIA 6ESTA 1C2GA 1O37A 4BTIB 1D6WA 3SJ8A 3A84A 1EB1H 4B1TA 3EA9A 1IAUA 4CBNA 4H4FA 1DICA 1BCUH 1GMHG 1TLDA 4JK6A 1BRUP 1FIZA 2GTBA 3ZZ9A 1GHVH 4GLYA 2ZDVH 3A85A 1ZRBA 2Z3CA 2PKAB 4NWLA 1SHHB 1IHTH 7GCHG 3HGPA 2ODYB 4AOQA 1FAKH 1O3OA 3DUXH 5BRRE 2GD4B 4Y71A 3CP7A 4IMZA 3EAJA 2A7JA 4NIXA 1SMFE 4WXIA 1LVOA 1GGDB 1JRTA 4D9RA 1JIMA 3MTYA 3JZ2B 1J9CH 3NPSA 3PROA 1HV7A 1LCYA 1SGCA 2GKVE 1QA7A 1FIWA 1AWHB 4TWWA 1B0EA 5GDSH 1TNIA 2GP9B 2GVFA 2VIOA 2HRVA 1GMCF 4R0IA 3SHCH 1A0LA 2QC2A 3D49H 3H5CB 2GZ8A 3QLPH 1FZZA 2AIPA 4FVDA 1K1JA 3F9EA 1YPLH 1ELCA 1LKBA 1DX5M 1YYY1 2VH6A 2I6QA 3SV6A 4AFQA 2AFQB 3ATIA 1QTFA 3F9FA 2GDDA 1EPTB 3K65B 1DLKB 2NU2E 3KQDA 3SBKA 4ZXYH 1G2MA 4X8TH 1TMTH 1HIAB 3RXGA 3E0NB 1YBWA 4E7NA 4XBCA 2A32A 5PTPA 3QK1A 2HVXA 4TYDA 1GJ8B 1D3TB 1BT7A 4AZ2B 1GWAA 1V2VT 1HXEH 3ATWA 2TGAA 3TK9A 1N6YA 4CRDA 8GCHF 2STAE 3KN2A 4XE4A 1NTPA 2FI4E 1Z6JH 1L0ZA 5A0BA 1O2HA 2QV1A 4BTUB 3BTTE 2KAIB 5E2PA 3MNXA 4FUBA 2J94A 3RU4T 1TGBA 2XXLA 3SU5A 2W3KA 1GHYH 3S69A 1SGEE 2BD8A 3BTME 1EOLA 4DOQA 2C8ZB 3TH2H 1MKXK 3S0NA 2ZFQH 4A92A 5CE1A 3CS0A 4INLA 3URDA 4D7FA 3PB1E 2UUKB 2XBYA 3ZZ6A 1Y5UT 1P06A 1WYKA 2CMYA 3KIDU 4HGCA 1Z8RA 1C5XB 1QL9A 2SGDE 3VXEH 2XWAA 3SOSA 1ZMNA 1XKBC 5DKMA 1AFQB 1TNLA 3M3VA 3SNCA 2WPJS 4CRFA 1DWDH 1O2VA 1YCPK 1W0YH 3OX7U 1CVWH 2B9LA 2GZ9A 2QF3A 4IMQA 1MTNC 1BRAA 2Z9IA 3BIUH 1IQJA 4YLUA 2GCHG 1FMGA 1IQFA 1Y3WA 2ALVA 1HNEE 1QY6A 4ABHA 1N1LA 1TPAE 3FZZA 1O2LA 2AEIH 3MYWA 2XBXA 6GCHF 1ELDE 1NRNH 5J4QA 3S7HB 3GYMA 3Q76A 1C1PA 1GI5A 4DVAU 2ZDLA 4SGBE 3BF6H 1O3GA 2ANKH 4UD9H 3VGCB 1K1IA 3O8BA 1Z8IB 1K21H 1GBDA 1LHEH 1AWFH 2VGCB 4DG4A 2FXRA 2XRCA 2J4IA 4A1TA 4TY6A 5FBIA 1C1RA 2VIWA 3A8CA 5GPIB 2XW9A 1EB2A 1EZQA 1GCDA 1F2SE 3E1XB 1L1NA 3B9FH 3UTUH 3IITA 2XCNA 4X1RU 2CJIA 2ZP0H 3DHKH 3SN8A 4J1YA 4WY3A 3RU4E 3Q00A 2BHGA 3LGYA 2BMGB 1FNIA 4THNH 3PMJA 4I33A 1C4U2 2BDCA 1U6QA 3RXMA 3TNSA 2GT8A 1O2IA 2SNVA 2ZECA 1IQIA 2RDLA 3KQEA 4AORA 5HXFA 2XCFA 1TGCA 1X7AC 1HAGE 4Y0ZE 4U32A 2Z6BD 5FX5A 1CE5A 5EW2H 2FOCA 1G3EA 3GY2A 2BOKA 2ODQA 3U9AH 4X8UH 1BA8B 4YZUA 2JH0D 4INKA 4GCHF 2RA3A 1C2LA 4Y8ZA 4JZFH 4XBBA 1BHXF 1SFQB 1VITG 4NGAH 3ZZDA 3T62A 1EZXC 1TQ7B 3A7YA 2A0QB 2PLXA 1CA8B 4BXSA 4O97A 2A45B 1TWXB 1GI3A 3UR9A 1CHGA 1C5ZB 1TRMA 1OWIA 3MOCA 3E6PH 5FHTA 3PV4A 3QZQA 1O5EH 1MTSA 1D3DB 2Z9KA 4UFEH 4AFSA 1YPEH 1C4Y2 2P3FH 3UFAA 4O3TA 1EATA 1O2RA 1SGFG 2CF9H 2QN5T 3ZV9A 1Q2WA 4B2AA 4FXGH 1T8MA 5JYIA 3SV9A 2FOGA 5HM2A 2Y5GA 1ZMLA 3V13A 2B8OH 3BTKE 1H9IE 1GVKB 1SGPE 5DJ7A 1GJDB 2C93B 1W10U 2PV9B 3UY9A 2CF8H 3VPKA 1ARBA 5LH8A 4A5TS 1OP0A 4K1EA 1NROH 3OYPA 2LPRA 1C2MA 1O2UA 1N8OC 2RG3A 1HUTH 2ZDKA 2GCTC 2JH5D 3MH7A 2F83A 1NU7B 1RTLA 1MAYA 1O2YA 3AW0A 3ODDA 1G36A 2ILNA 1A0JA 2ZDMA 1O39A 4XFQA 1LQEA 2ZU4A 1V2LT 2AMPA 3M5NA 3LOXA 3PO1C 3RXFA 1GBFA 1XKAC 4YLQH 2ZCKP 3SV7A 1FJSA 1Z1JA 1TBQH 4CRGA 2VIPA 3RUOA 1K9OE 2GMTC 5F6MA 1KIGH 1HAOH 1AMHA 2F9UA 3H7OA 1G3CA 4ZKNU 2R2MB 3QTVH 3ZVEA 2ZCHP 1RD3B 1XUIA 3RP2A 3SNBA 3TK5A 1BBRE 2D1JA 2BD2A 2W3IA 1C1UH 1GHAG 1O5CB 1O2OA 4JCNA 1QBVH 3MH4A 1KDQA 1C2JA 8ESTE 5HYOA 1SGTA 1TFXA 5DO4H 2XYAA 1NFUA 1PPFE 2ZHDA 3LC3A 1VZQH 1H9HE 3JZ1B 4AGKA 2A2XH 1IQNA 1TX6A 2QAAA 2AERH 1YLCA 3M37A 2UUFB 1P9SA 3GDSA 2XTTB 1BTXA 1XUHA 1IHSH 3BEIB 3OTJE 1ZGIA 1EP6A 3SZNA 1C5LH 4DIIH 1EQ9A 3T25A 4NSYA 2J92A 4BAQB 1D3QB 3TJOA 1A61H 3A80A 1NRPH 4AYYB 3A8DA 3RXRA 3LKWA 4LZ4B 1OSSA 1MU8B 5GWZA 2G8TA 1SI5H 1AUTC 1L1JA 4Y76A 1YF4A 3GCHB 4DW2U 1P11E 4LOYH 3ZVBA 4AN7A 2V3OH 5E0HA 3VB5A 5C1UA 2BDBA 1UCYE 1QQUA 1SHYA 1C2HA 1SL3A 3ZVGA 2O8TA 2YNAA 1LHCH 1XXDA 5A8ZA 1K1LA 2FP7B 2Y7ZA 2AGEX 3KQBA 3L3TA 1XUKA 1HYLA 3LDXH 4ESTE 1O35A 5C2ZA 3T28A 5DP6A 4UE7H 1EZSC 2VU8E 3SV8A 3NZIA 2F9PA 1NFYA 5FPYA 1C5NH 2GT7A 1RS0A 3MMGA 3RLWH 8GCHG 4MPXA 3ELAH 4OS7A 5DP7A 1LQDB 1LPZB 5FAHA 3ZVCA 3PWCA 2ZU5A 5JBTA 2QXIA 1VGCC 1WTGH 3RC4A 1O3NA 1BMMH 2BY7X 1TONA 3IWMA 5AFYH 3BG4B 1FONA 1O2ZA 3NWUA 2XC0A 3ZZ5A 3RLYH 4IC5A 3TVJB 3U1JB 1BBRK 1K28D 5EW1H 2PKSC 1KDQB 4WMFA 2R9PA 1TNJA 4MG3A 3T29A 2OQ5A 5C5NA 4CREA 3A87A 2PTNA 2XC5A 2JETC 3EQ0H 3CS7A 1CA0B 1XVOA 4RKOB 3U1IB 4B75A 2ZTYA 2QXHA 5DG6A 1SBWA 2HPPH 1EAWA 1E35B 3LH3A 3LGTA 2PSYA 4AYVB 2V0BA 2BDIA 4XSKU 1AD8H 2HPQH 2ZPSA 1PPGE 1KXAA 2V6NA 1JXPA 6GCHG 2DUCA 1Y3YA 4FVBA 7LPRA 1G32B 1V2MT 1HRTH 3QGJA 4ABIA 5L6NH 4ISLA 1V2KT 5CMXH 1ZSLA 3A89A 4BXWA 1HAHH 1V2RT 3RXTA 1YPMH 1DITH 4U01A 1V2ST 1DT2A 4H42U 2OLGA 3K6ZA 1S6HA 5C67A 1NFWA 4AG2A 4DJZB 1IQEA 2GGVB 3SNDA 5L2ZH 1GJ7B 4IGDA 1CGIE 1TGSZ 2FI3E 2IPHA 2AYWA 1FV9A 3F9GA 2EC9H 2PTCE 2CHAC 1O3IA 1P03A 2Y7XA 1DWCH 1XUFA 1A0HB 4VGCB 2BQ7B 1EAXA 2ZGCA 3P70B 2CV3A 3P8FA 1TA2A 1SGYE 1ZLRA 2ZQ2A 1LPGB 4Z0KA 1A5HA 3MHWU 5T6GA 4JYVH 4RSPA 1UHBA 4O9VA 1EJNA 4WMEA 1HDTH 3RXPA 2K1QA 4AFUA 1DDJA 1TOCB 1LPKB 4OS2A 4GSOA 4O03A 3STIA 1F5LA 4GCHG 4Q7XA 1FAXA 1HXFH 1QFKH 3RMNH 2FESH 4RKJB 1PQ8A 1C2KA 2GDEH 1LO6A 3H7TA 1PYTD 1P09A 1O3EA 3QGNB 2OUAA 2BZAA 1GMDF 2ZFRH 2ZFSA 3ATMA 1DPOA 1UO6A 5E2OA 2BY9X 3M3SA 1L4ZA 2PWXA 2O8LA 3DD2H 1DXWA 2ZDAH 2ZU1A 5LPEA 5JBAS 5EGMA 1Z6EA 3LPRA 1WU1A 3RMOH 3UNSA 3RM2H 3UQOA 2BD3A 2AIQA 3BN9A 1LVMA 2M5TA 2O8WA 2JH6D 2XBWA 1L1GA 3VB7A 3PYHA 1DOJA 1FQ3A 4MNWA 1Z1IA 3TH3H 3BTDE 4A1XA 4MNXA 1BRBE 1FY4A 2UUJB 4ISHH 5A09A 1NRSH 1HJ8A 5JDUB 3MH6A 4WJG2 3ZZ4A 2P94A 2C4FH 2XWBI 1AZZA 2PGBB 1P2QA 1DWEH 5B6OA 2BX4A 2OINA 4DT7B 1TPPA 3RXHA 3LJOA 2SNWA 2QF0A 1S82A 1TE0A 4TPIZ 1W13U 4H6SB 5EU8A 4OGXA 1OP8A 4ZHLU 3P8NA 2BDHA 1HAXB 1INCA 1FY8E 4YTAA 4B76A 1O2GH 1S81A 3TJNA 1BOQA 4ZH8A 1AY6H 3SW2B 1F92A 3KF2A 1GGDC 4UEHH 3HATH 2BYAX 4Y8XA 1S84A 3M7UA 3UNQA 3K9XB 3V0XA 3EYDA 4FUGA 5DPAA 5LPFA 3RU4D 1WBGB 2Y6TA 1C1QA 3A83A 4JZEH 3E0PB 2A2QH 5A0CA 1VR1H 4NFFA 3TJVA 2G51A 3HPTB 4BAOB 1LDTT 4M7GA 1ESBA 3ZZBA 1PQ7A 1UHBB 2ZQ1A 5ABWA 3MH5A 1MCTA 5EPYA 5L30H 2BOHB 5FPSA 1KTSB 1TB6H 4LK4A 4D8NA 4Z6AH 4XOJA 1QJ7B 2FM2A 2GV7A 3MU5A 3A8AA 3FP8E 2SGQE 4BAHB 2ANWA 2ZDNA 1G3BA 1TNKA 1P2NA 1O3PB 1EPTC 1O3MA 3N7OA 2BLWA 5EXLA 3V3MA 1TNHA 1ANDA 1SGRE 4GHTA 4X1SU 1P9UA 3QX5H 1WOFA 2D26C 3QDZB 1O3DA 3A8BA 1JMOH 4FUDA 1BQYA 1N6XA 1CHOF 3SV2H 2C8YB 1V2PT 1BB0B 2FOBA 3B8JA 1P05A 5JBCS 1GJ9B 4MPWA 4NZQA 4KKDA 2ZFFH 1XX9A 2EI7A 4YT6H 1HJAB 1B0FA 4Y6DA 1DVAH 1OX1A 4OGYA 2ZGBH 4WH8A 3GY7A 1MKXH 4ZUHA 1FY1A 1F0TA 1C1MA 4H6TA 2FTMA 3GY8A 3KCGH 3LGUA 1Q3XA 4I8GA 2AS9A 3GCOA 4ASHA 1AZ8A 1IQGA 1E36B 2H2ZA 5GIBA 1K2I1 4I8KA 3KQCA 1YCPH 2WPLS 2UWOA 2WPKS 6CHAB 3MO9A 1J15A 1O3AA 1VCQA 5GXPA 3QWCH 2J95A 4YOJA 1AFQC 1TYNA 1SR5C 3M36A 3SGQE 1GJBB 1JIRA 3GCTF 1C5QA 3P92A 4ZHMU 1SLUB 3T27A 2BLOA 4K3JA 5ETXA 3RMLH 1O2PA 3ZZAA 1A3EH 4YESB 4LXBH 1QQ4A 1VITH 4WH6A 1THPB 1Q31A 1TRNA 1GBAA 5TJXA 2R3YA 1ABIH 2VINA 1RRKA 4AGJA 1P12E 2J34A 3MNSA 3VGCC 1P57B 1GJCB 1C2EA 4J2YB 2FYQA 4GVUA 2VGCC 1S0QA 2AGGX 1CSOE 3RXIA 2D8WA 1GI2A 1KXFA 1SGIB 5C5OA 1C5VA 1HAZB 2P8OB 3VXFH 1P2MA 2WV4A 2AMQA 2WINI 2ZKSA 4I8HA 5T6FA 2FS8A 3LJJA 1OWDA 4B2BA 4FU7A 1SQTA 1C5WB 2TRMA 2H5DA 1BUIA 1DANH 1GHXH 2HLCA 4Y11E 1UK2A 1C1TA 3LC5A 1CT4E 2A7CA 1HAYB 1O30A 5HGGA 3TU7H 1LHDH 1ZSJA 1GBIA 4DCDA 1C5MD 5ESBA 1Z71A 3KNXA 2YOLA 1T8LA 2G4UA 1XXFA 1P3CA 2VH0A 5L2YH 2Z94A 4CR5A 5T6DA 1XVMA 1O33A 5IDKA 4AB9A 5DK1A 1GI0A 2B0FA 4NIYA 1A3BH 1S5SA 4OS6A 2Z9GA 2QYIA 3RXBA 2A5IA 2OBOA 5HMAA 3QZRA 1GBLA 3NK8A 1P3EA 3BEUA 1GCTB 1LTOA 1SLWB 2F9OA 2HNTC 5I46H 1V3XA 3HKJB 4YM9A 4B2CA 2XNIA 2VVUA 3GY5A 3M7TA 1GMHF 2P93A 3RXSA 1S85A 4SGAE 2F9NA 1C5OH 3OSYA 4X1PU 1F5RA 1LKAA 2GZ7A 2PW8H 1YM0A 3FP6E 2OC7A 1QNJA 5EPNA 4B74A 1AGJA 4I32A 1QRWA 5FXLA 1ZYOA 1WCZA 3UUZA 2VVCA 3RDZA 4Q2KA 3ZZ7A 1MAXA 1SGFA 1EJAA 1THRH 2IJOB 1P0SH 5J4SA 5DP4A 1O34A 3TNTA 4R8TB 4IS5A 3OU0A 1DSUA 1B5GH 4FUHA 1QB6A 1GI4A 2P95A 2Z9JA 3MU0A 1GMDG 2Y5FA 4CRBA 1OWKA 4FUIA 1SOTA 3RXKA 3FP7E 4WXVA 3EE0B 3TGIE 1IQLA 4BOHA 1UTMA 3QN7A 1W12U 1SLXB 3ITIA 3RMMH 4X2WA 1OPHB 5JBBS 1O3LA 2H6MA 3LGWA 1ANBA 1HFDA 4UFDH 4K60A 1M9UA 1C5RA 1Z8GA 1LMWB 4Q80A 1RIWB 3EA7A 2BDAA 2FWWA 1P2JA 1V6DA 2VWLA 1SG8B 1T8NA 1O5FH 3A81A 4ABAA 4CBOA 1E38B 1NM6A 3ODFA 4YOGA 2EEKA 2QXJA 1YPKH 1GHWH 1WTHD 2SGFE 5LGOA 3SUGA 4KTSA 3Q3YA 4O3UA 1ZHMA 1BJUA 1JRSA 1TGNA 2A31A 2HNTF 2OTVA 3PWBA 3GOVB 1K22H 2BZ6H 3U98H 1HCGA 2W5EA 2Z7FE 2VWOA 1UJ1A 5HM9A 1KLIH 1BDAA 3KL6A 1WSSH 1NT1A 2R2WU 4TPYA 2BD5A 1FN8A 1GMCG 3PTNA 3SI3H 2W7UA 4D7GA 1NZQH 2HALA 1MZAA 1J8AA 4D9QA 2ODPA 1SSXA 1AFEH 2H9TH 1DS2E 4CH2B 2J2UA 3HK6B 3SORA 1WV7H 1PPHE 3U8TH 1BMLA 3Q77A 2QGRA 4KP0A 2RA0A 2TGTA 3KGPA 4I31A 5AHGH 1RTKA 5F8ZA 6LPRA 2Q6FA 5CHAB 1MQ5A 1C1VH 3GCHC 5AFZH 4CHAB 3SI4H 3AAUA 4ABDA 1W3CA 1KXCA 1H1BA 1DLEA 2R0KA 5JPMH 2VB0A 1MZDA 3BEFB 3UIRA 1GG6B 3VB6A 3F68H 1KXDA 3P6ZB 1Y5BT 2WPIS 4MDSA 1GBJA 1W7GH 3FZDA 2FLBH 3LIWA 5FCKA 1VCWA 1EASA 2FS9A 2OP9A 4CRAA 4Y8YA 1ORFA 3R3GB 1O2SA 2IOTA 1DFPA 1IQKA 1CHOG 1GJ4H 5GJ4B 4BANB 4F4OC 3RC6A 1O5GH 1GBMA 4HTCH 4IBLH 5DGJA 1BTHH 1ELVA 1UMAH 2A1DB 1HGTH 2ZPQA 2G4TA 1C1SA 7ESTE 1FUJA 4YO9A 3TJUA 3E3TA 2BY5X 2ZGXH 4Y79A 2FOAA 3T2NA 2WPHS 1W0ZU 2GV6A 1BTZA 4MPUA 1BBRH 1ANCA 1TRYA 1RTFB 2ALPA 4ABGA 3RXLA 4AB8A 2FX6A 4JMYA 2ZHWH 4ZKSU 3M3TA 3E90B 2FDAA 2FO9A 3QO6A 3TLOA 1P2KA 1HLTH 3STJA 1QRXA 5LPRA 1C5YB 3GDUA 2UUYA 3MU8A 1ANEA 1O3FA 2BY8X 2FI5E 3SUDA 4Y0YE 1ZJDA 3M61U 1CA0C 1BMAA 3P8GA 4K8BA 1TNGA 3GCTG 1GBHA 1KYNA 1MUEB 2C3SA 1OWJA 2PUQH 2ANYA 1C9TA 1DE7H 2ZIQH 3BTHE 2HNTE 2TGDA 2V3HH 4NCYA 3UR6A 1AI8H 1KSNA 3UOUA 4BTTB 1OXGA 1AE5A 2P3TB 4X2XA 3M5MA 3LGIA 4X1NU 3QUMP 3UPEA 1T8OA 1FDPA 1UK3A 1GJ6A 1QIXB 4NA8A 3L33A 1GBCA 1EZUC 5GCHF 5SGAE 3P8OA 3PLPA 3BSQA 1F0RA 1CQQA 3V12A 1ETRH 2ANMH 5C20A 5E8EH 4XDEA 1FN6A 3TH4H 5AF9H 2ZA5A 3IG6B 3NCLA 1PFXC 2Q6DA 2Z3EA 3RXQA 1K1MA 1MH0A 1OS8A 2Y80A 2SGAA 5DP3A 4CR9A 1P04A 1UCYH 4DIHH 3F6UH 4JZ1A 3FVFB 3SJIA 4X2VA 4U30A 4XBDA 1AB9B 1YC0A 3A88A 1UVTH 4CH8B 1ETTH 1UTNA 3ZZCA 1YPHC 1MKWK 1CBWB 4GAWA 3QTOH 1GVLA 1T4UH 2EI6A 2PUXB 4IW4E 5ESTE 2OC1A 3P95A 1C2IA 4VGCC 4HI3A 1L4DA 4ISOA 2BY6X 3WY8A 1NRQH 2A7HA 2BD4A 2FOMB 1ZPZA 3BG8A 1DY9A 1O2QA 2OXSA 3SU2A 1EJMA 1O2JA 3HKIB 2ULLA 1C2FA 3B23B 2TGPZ 1ZR0A 1ZPCA 5EG4A 4NA9H 1GDNA 3Q3KA 1H8DH 4NIWA 3TGJE 4ZAEA 4TY7A 1H4WA 1W2KH 1CO7E 1SGNE 3HK3B 1VCPA 2CGAA 4DGJA 5H4IB 3ZYDA 1VJ9U 2VVVA 1ABJH 1QJ1B 1SLVB 3URCA 1S0RA 1GI8B 2HOBA 4IC6A 2VIVA 2IN2A 1ELFA 5DP5A 2NU1E 1GHZA 2AMDA 1CGHA 1W7XH 1MD7A 3SO3A 5A0AE 5JB8S 1P02A 3SU4A 2ZC9H 1SOZA 3GCNA 1OYTH 1TMBH 1AVWA 1VJAU 2Y81A 4BAMB 1A4WH 1ESAA 1GHAF 1ZHRA 3EDXB 1S83A 3MU4A 1O36A 2VIQA 4A1VA 2BVSH 3ZZ8A 2H5CA 3NUMA 2QA9E 1TX7A 1SQOA 2FEQH 1HB0B 1AUJA 1GBTA 3GICB 5F03A 3NKKA 1P01A 2FIRH 1TPSA 1CGJE 2A5KA 2C90B 3PM3A 2A4RA 3SJKA 1J16A 3VB3A 2FODA 3SJ9A 3LONA 1GI7B 1TALA 3EGKH 2Q1JA 2AGIX 4JZDH 5JB9S 1DM4B 3VEQB 2ZU3A 1V2TT 1Y8TA 1QL8A 2VWMA 1NC6A 3SHAH 2ZU2A 1GL1A 3L6PA 4NG9H 5EQQA 1TA6A 4MVNA 3LT3A 4MQAA 1O3KA 4AFZA 2PGQB 1GDQA 2WYGA 5T3HA 2A4OA 2G5VA 1C9PA 1QRZA 1GBKA 2ZF0H 2QCYA 1HAPH 2UWPA 2Z3DA 1O3HA 2SGEE 1V2UT 1YPJH 1GBBA 1D9IA 2P16A 3DT0H 4JYTA 4WF8A 4WVPE 4X8VH 4B71A 3UOPA 2J9NA 3G01A 2HGTH 4X2YA 3PMHB 1H8IH 4GPGA 1WUNH 3PLKA 1W8BH 3AVZA 1YCPM 3OY5U 1WQVH 1JWTA 1C1WH 2ZFPH 3RM0H 2FYRA 4UDWH 2BXUH 4NIVA 1NPMA 1FPHH 1OOKB 4X0WU 2FOEA 1BZXE 1TOMH 4MTBA 1LVBA 2ESTE 1WQSA 1ZRKA 2BLQA 3FANA 3BTGE 1Z8JB 2BVRH 2BDGA 4GHQA 1O2WA 3A7XA 3ENSB 4ZHAA 1WAYB 3RXJA 2GX4A 3U8RH 2H9EH 1QCPA 1O5AB 1GHBF 1HBTH 3TITA 1AHTH 2HWLB 2QY0B 2G52A 4NZLA 1QBOA 2TIOA 3ZVDA 1UTQA 1C2DA 4FU8A 2BXTH 1BTWA 5C3NA 2VJ1A 1BHXB 3M5OA 4WMDA 1DSTA 1GDUA 1SB1H 2B7DH 2ZI2H 1MTUA 1MTNB 3ESTA 2SGPE 1O2TA 1FY3A 3O8DA 1HJAC 2BX3A 3AAVA 4K1TA 4K69A 1C4V2 1PPCE 4D76A 1C1OA 1LHFH 5FCRA 1L2EA 1PQ5A 1RXPA 4NSVA 1AE8H 2BVXH 3M35A 2R3UA 4Q7YA 4ZROA 5AVDA 5FX6A 2ASUB 2UWLA 4U2WA 2FTLE 1ZHPA 5FPTA 1SGQE 3D65E 6CHAC 3GISB 3MFJA 1A7SA 1Y5AT 2ZHEH 4E7RG 4TWYA 1KLJH 1RFNA 1ESTA 5E0GA 1YPHE 2H9HA 1EKBB 3UNRA 3HGNA 1D6RA 1UTPA 1S6FA 4X6NA 3RXOA 1QURH 1FLEE 2W7SA 2NU0E 1C5SA 5G4BA 1K1OA 3DFLA 1O0DH 3BTEE 1T31A 5EQSA 3SUEA 1AKSA 3TK6A 3C1KA 3SGAE 4Q7ZA 4A7IB 1P8VC 1BJVA 1OKXA 5C1XA 1TABE 4JYUH 1TIOA 2OQUA 3E8LA 4KTUA 3MI4A 1HJ9A 1TPOA 1GJ5H 1SQAA 2AH4X 1MTWA 1AQ7A 5FBEA 4ABBA 4X6MA 5TCAA 1CU1A 5F8TA 3TPIZ 2WYJA 1DUEA 3AW1A 3GY6A 3M5LA 4MPVA 1UTKA 1W11U 2RCEA 3K6YA 2P8OC 1V2OT 5IYTA 2C8XB 4PROA 2TPIZ 3C27B 1THSH 1FPCH 1Z7KA 4UONA 1G2LA 2DE9A 2NU3E 3MWIU 2QXGA 5EODA 1GVZA 2P3UB 4INHA 3UWIA 3UWJH 2PSXA 1GI6A 2ZZUH 2G81E 1ZGVA 1V2JT 1O38A 2ZHQH 3I29A 1F0UA 3PMBB 5I25A 4AX9H 2EA3A 4BNRA 5GCHG 1C5TA 3ATKA 1MBMA 1DY8A 9ESTA 1W14U 3SQHE 1GPZA 3E16B 1MMJN 4KGAA 1ACBE 1E37B 3S9BA 1AU8A 1FY5A 1UVSH 4I8LA 5C1YA 2YNBA 4X1QU 1O3JA 5EXNA 2CN0H 1GCTC 1TGTA 7GCHF 3Q3XA 1IOEA 1AO5A 1NFXA 1ZPBA 2CXVA 1YP9A 1NESE 3BV9B 2F9VA 3W94A 5EQRA 2ZPRA 2A4GA 1JOUB 1SGDE 2J38A 1N8OB 2GCTB 4KTCA 3KEEA 2F3CE 4F49A 1KLTA 1QGFA 1O3BA 2BDYA 4FUJA 1O3CA 1B7XB 2G5NA 2QIQA 4ZMAH 1C5PA 3PO1B 4JZIA 2V35A 1TBZH 1BTPA 1KXBA 2Y82A 4NWKA 1P2IA 1QA0A 2LNCA 2OD3B 2GMTB 1AKSB 3GYLB 1SC8U 3VB4A 1SPJA 1EUFA 1F7ZA 3ZV8A 2BQ6B 7KMEH 1ELBA 1O32A 3SU1A 2P59A 3RXVA 4UFFH 2FPZA 1JBUH 2NWNA 5F8XA 3A86A 3TIUA 3F9HA 2ZWLH 1ZSKA 4DY7B 3LH1A 1EXFA 1UVUH 2NU4E 3MO3A 2WPMS 1NO9H 4Y7BA 2ZGJA 1PPBH 2H1UA 1HAVA 3GY4A 1QJ6B 1DXPA 1GI1A 2FX4A 1K1NA 4I7YH
chains in the Genus database with same CATH superfamily
3MO6A 3ZVFA 4YOIA 1FI8A 4OS1A 4FUFA 1RJXB 2TBSA 3RXDA 1ID5H 3DSOA 1MQ6A 2FMJA 1BITA 4MNVA 3A7ZA 4K5ZA 1V2WT 3SJOA 4KELA 4FU9A 3EA8A 2VWNA 1YPGH 3SU0A 1RIWC 2A4QA 4Y10E 1UVOA 1A5IA 1XMNB 4IN2A 1QR3E 1E0FD 2ZG0H 1G3DA 2ZEBA 3ATLA 1AVGH 4ZKOU 1PQAA 4DURA 2FLRH 2A5AA 2Z9LA 1NRRH 3KQ5A 1UTLM 1V2QT 1XUGA 2EI8A 1F5KU 1T7CA 1LHGH 1XUJA 3VFEA 1TMUH 1LVYA 2VNTA 2ZTXA 2FOHA 2O8UA 1NU9A 1ELEE 1H9LB 3BTQE 3P17H 1O2XA 1QB1A 4UFGH 1GI9B 1ELGA 1V2NT 4FUEA 3D62A 5A8XA 1P2OA 4X6PA 4K8YA 3AASA 1KXEA 1KY9A 2WUCA 3DA9B 1QHRB 1P10A 1O2MA 1O31A 3M7QA 4A6LA 4MLFB 3OY6U 4E06H 2ZO3H 4B73A 1BMNH 1A5GH 1PPEE 1EAIA 4K2YA 5EOKA 4WWYA 4Y7AA 1UVPA 1EOJA 2THFB 1OP2A 1MU6B 3U8OH 2GCHF 1OWHA 1UTOA 1T32A 3LGVA 1KTTB 4JK5A 1ZTJA 4K1SA 3T5FH 1NY22 1UK4A 2Q6GA 1GJAB 8KME2 2BLVA 3UREA 5CHAC 3A82A 1J17T 1SVPA 3SGBE 1D3PB 1MTVA 5HIZA 8LPRA 1VGCB 4CHAC 3WWFA 3ZYEA 2OC0A 2ZGHA 5A2MH 1TQ0B 2JKHA 2XC4A 5K0HA 1E34B 2W6ID 2R0LA 1TAWA 2STBE 1HPGA 2FOFA 3NXPA 1GG6C 3O8RA 2OC8A 1G9IE 3SQEE 1GHBG 1GBEA 2PKSB 2ZCLP 2D2DA 1HAVB 2B5TB 4ISNA 3ZVAA 4ABJA 1FXYA 3S9CA 3UQVA 1DWBH 2BQWB 2JETB 1BRCE 3BTWE 5A8YA 2BB4A 3BG4C 5BPEA 3LU9B 1ARCA 2BTCE 1QBNA 2AHME 5DP9A 3W95A 2G00A 1G37A 1PJPA 1OYQA 3OTPA 3RC5A 3RXUA 2ZHFH 1YGCH 2PHBA 2VIDA 1PYTC 2FZZA 3R0FA 1Y3UA 1O5DH 1GL0E 2C8WB 3GY3A 2PFEA 1CT2E 3A7VA 1HAIH 1YLNA 3SNEA 1MD8A 3FAOA 4LZ1H 1Y3VA 2J98A 4NFEA 1QL7A 1ZJKA 1ZZZA 1J14A 2WV5A 3PLBA 2XBVA 4X8SH 3D23A 3MNBA 1QB9A 1A2CH 2I6SA 2PKAA 1ZOMA 3MU1A 9LPRA 2OCVB 4ABFA 3F1SB 3FO8D 3T26A 2O9QA 1CT0E 4OS4A 1ZMJA 1VITF 1OWEA 2F91A 2F9BH 2PR3A 1YKTA 3BIVH 2WUBA 2Y5HA 3DFJA 1IQHA 4ABEA 5C17A 4ZKRU 2CHAB 3K2UA 5DP8A 1AN1E 1ELAA 1ZTLA 1NS3A 1O2NA 1RGQA 2OBQA 4RN6A 1C5UA 5TCCA 1G30B 4AG1A 2G55A 3RXEA 4E05H 4X6OA 4NA7A 1BTYA 1PPZA 1EP5A 1ZTKA 3I77A 3SU3A 3FFGA 2BD7A 4I86A 2W26A 1UCYK 3PTBA 3TGKE 1A46H 4ZXXH 3RXAA 3S9AA 1EX3A 1Y3XA 3SU6A 3U69H 1A1RA 1MBQA 4HZHA 1BTUA 1NN6A 2SFAA 4B6FA 4QT8C 1Y59T 3RXCA 4GUXA 1TBRH 1AVXA 3KHVA 1F0SA 1IQMA 3MNCA 4BAKB 1MKWH 1C1NA 3PMAB 2DE8A 4I8JA 1AIXH 1K1PA 3V7TA 3I78A 1EAUA 3S7KB 1AB9C 3SNAA 5K7RA 1EPTA 3CENA 3BTFE 4YT7H 2BD9A 1CBWC 1MCVA 1HIAA 3A7WA 1XM1A 4OS5A 4HFPB 2ZNKH 3O8CA 3OEHD 1ELTA 4IN1A 1UTJA 1YLDA 4ISIH 3ZZ3A 1SFIA 3A7TA 3SUFA 2ZTZA 1TX8A 2RFKC 1DUAA 5E0JA 1BIOA 2M2AA 1D4PB 3E91A 5EXMA 1T4VH 4CRCA 3GDVA 2O8MA 2BM2A 4FUCA 2ZFTA 4MNYA 3SZEA 2WSSD 5HIYA 1ETSH 1O2KA 1O5BB 2KAIA 6ESTA 1C2GA 1O37A 4BTIB 1D6WA 3SJ8A 3A84A 1EB1H 4B1TA 2W6JD 3EA9A 1IAUA 4CBNA 4H4FA 5CDFE 1DICA 1BCUH 1GMHG 1TLDA 4JK6A 1BRUP 1FIZA 2GTBA 3ZZ9A 1GHVH 4GLYA 2ZDVH 3A85A 1ZRBA 1VKYA 2Z3CA 2PKAB 4NWLA 1SHHB 1IHTH 7GCHG 3HGPA 2ODYB 4AOQA 1FAKH 1O3OA 3DUXH 2L74A 3GS9A 5BRRE 2GD4B 4Y71A 3CP7A 4IMZA 3EAJA 2A7JA 2KCAA 4NIXA 1SMFE 4WXIA 4XRNA 1LVOA 1GGDB 1JRTA 4D9RA 1JIMA 3MTYA 3JZ2B 1J9CH 3NPSA 3PROA 1HV7A 1LCYA 1SGCA 2GKVE 1QA7A 1FIWA 1AWHB 4TWWA 1B0EA 5GDSH 1TNIA 2GP9B 2GVFA 2VIOA 2HRVA 1GMCF 4R0IA 3SHCH 1A0LA 2QC2A 3D49H 3VG8A 3H5CB 2GZ8A 3QLPH 1FZZA 2AIPA 4FVDA 1K1JA 2JDID 3F9EA 1YPLH 1ELCA 1LKBA 1DX5M 1YYY1 5DSFA 2VH6A 2I6QA 3SV6A 4AFQA 2AFQB 3ATIA 1QTFA 3F9FA 2GDDA 1EPTB 3K65B 3KYFA 1DLKB 2NU2E 3KQDA 3SBKA 4ZXYH 1G2MA 4X8TH 1TMTH 1HIAB 3RXGA 3E0NB 1YBWA 4E7NA 4XBCA 2A32A 5PTPA 3QK1A 2HVXA 4TYDA 3FN8A 1GJ8B 1D3TB 1BT7A 4AZ2B 1GWAA 1V2VT 1HXEH 3ATWA 2TGAA 3TK9A 1N6YA 4CRDA 2KCPA 8GCHF 2STAE 3KN2A 4XE4A 1NTPA 2FI4E 1Z6JH 1L0ZA 5A0BA 1O2HA 2QV1A 4BTUB 3BTTE 2KAIB 5E2PA 3MNXA 4FUBA 2J94A 3RU4T 1TGBA 2XXLA 3SU5A 2W3KA 1GHYH 3S69A 1SGEE 2BD8A 3BTME 1EOLA 4DOQA 1BMFD 2C8ZB 3TH2H 1MKXK 3S0NA 5DN6D 2ZFQH 4A92A 5CE1A 3CS0A 4INLA 3URDA 4D7FA 3PB1E 2UUKB 2XBYA 3ZZ6A 1Y5UT 1P06A 1WYKA 2CMYA 3KIDU 4HGCA 3N7EA 1Z8RA 1C5XB 1QL9A 2SGDE 3VXEH 2XWAA 3SOSA 1ZMNA 4Z1MD 1XKBC 5DKMA 1AFQB 1TNLA 3M3VA 3SNCA 2WPJS 4CRFA 1DWDH 1O2VA 1YCPK 1W0YH 3OX7U 4ASUD 1CVWH 2B9LA 2GZ9A 2QF3A 4IMQA 1MTNC 1BRAA 2Z9IA 3BIUH 5EJLA 1IQJA 4YLUA 2GCHG 1FMGA 1IQFA 1Y3WA 2ALVA 1HNEE 1QY6A 4ABHA 1N1LA 1TPAE 3FZZA 1O2LA 2AEIH 3MYWA 2XBXA 6GCHF 1ELDE 1NRNH 5J4QA 3S7HB 3GYMA 3Q76A 1C1PA 1GI5A 3PRBA 4DVAU 2ZDLA 4SGBE 3BF6H 5FL7D 1O3GA 2ANKH 4UD9H 3VGCB 2WHXA 1K1IA 3O8BA 1Z8IB 1K21H 1GBDA 1LHEH 1AWFH 2VGCB 4DG4A 2FXRA 2XRCA 2J4IA 4A1TA 4TY6A 4TT3D 5FBIA 1C1RA 2VIWA 3A8CA 5GPIB 2XW9A 1EB2A 1EZQA 5B6LA 1GCDA 1F2SE 3E1XB 1L1NA 3B9FH 3UTUH 2LELA 3IITA 2XCNA 4X1RU 2CJIA 2ZP0H 3DHKH 3EE7A 3SN8A 4J1YA 4WY3A 3RU4E 3Q00A 2BHGA 3LGYA 2BMGB 1FNIA 4THNH 3PMJA 4I33A 1C4U2 2BDCA 1U6QA 3RXMA 3TNSA 2GT8A 1O2IA 2SNVA 2ZECA 1IQIA 2RDLA 3KQEA 4AORA 3OAAD 5HXFA 2XCFA 1TGCA 1X7AC 1HAGE 4Y0ZE 4U32A 1S6LA 2Z6BD 5FX5A 1CE5A 5EW2H 2FOCA 1G3EA 3GY2A 2BOKA 2ODQA 3U9AH 4X8UH 2WZQA 1BA8B 4YZUA 2JH0D 4INKA 4GCHF 5EJZA 4HG6A 2RA3A 1C2LA 4Y8ZA 4JZFH 4XBBA 1BHXF 1SFQB 1VITG 4NGAH 3ZZDA 3T62A 1EZXC 1TQ7B 3A7YA 2A0QB 2PLXA 1CA8B 4BXSA 4O97A 5EIYA 2A45B 1TWXB 1GI3A 3UR9A 1CHGA 1C5ZB 1TRMA 1OWIA 3MOCA 3FOAA 3E6PH 5FHTA 3PV4A 3QZQA 1O5EH 1MTSA 1D3DB 2Z9KA 4UFEH 4AFSA 1YPEH 1C4Y2 2P3FH 3UFAA 4O3TA 1EATA 1O2RA 1SGFG 2CF9H 2QN5T 3ZV9A 1Q2WA 4B2AA 4FXGH 1T8MA 5JYIA 3SV9A 2FOGA 5HM2A 2Y5GA 1ZMLA 3V13A 2B8OH 3BTKE 1H9IE 1GVKB 2HLDD 1SGPE 5DJ7A 1GJDB 2C93B 1W10U 2PV9B 3UY9A 2CF8H 3VPKA 1ARBA 5LH8A 4A5TS 1OP0A 4K1EA 1NROH 3OYPA 2LPRA 1C2MA 1O2UA 1N8OC 2RDEA 2RG3A 1HUTH 2ZDKA 2GCTC 2JH5D 3MH7A 2F83A 1NU7B 1RTLA 1MAYA 1O2YA 3AW0A 3ODDA 1G36A 2ILNA 1A0JA 2ZDMA 1O39A 4XFQA 1LQEA 2ZU4A 1KMHB 1V2LT 2AMPA 3M5NA 3LOXA 3PO1C 3RXFA 1GBFA 1XKAC 2QE7D 4YLQH 2ZCKP 3SV7A 1FJSA 1Z1JA 1TBQH 4CRGA 3WW7A 5F53A 4Q4LA 4AC9A 2VIPA 3RUOA 1K9OE 2GMTC 5F6MA 4B6EA 4F48B 1KIGH 1HAOH 1AMHA 2F9UA 3H7OA 1G3CA 4ZKNU 2R2MB 3QTVH 3ZVEA 2ZCHP 1RD3B 1XUIA 3RP2A 3SNBA 3TK5A 3F0OA 1BBRE 2D1JA 1OHHD 2BD2A 2W3IA 1C1UH 1GHAG 1O5CB 1O2OA 4JCNA 1QBVH 3MH4A 1KDQA 1C2JA 8ESTE 5HYOA 1SGTA 1TFXA 5DO4H 2XYAA 1NFUA 1PPFE 2ZHDA 3LC3A 2KCYA 1VZQH 1H9HE 3JZ1B 4AGKA 2A2XH 1IQNA 1TX6A 2IJD1 2AERH 2QAAA 1YLCA 3M37A 2UUFB 1P9SA 3GDSA 2XTTB 1BTXA 1XUHA 1IHSH 3BEIB 3OTJE 1ZGIA 1EP6A 3SZNA 2IPQX 2JJ2D 1C5LH 4DIIH 1EQ9A 3T25A 4NSYA 2J92A 4BAQB 1D3QB 3TJOA 2OK5A 1A61H 3A80A 1NRPH 4AYYB 3A8DA 3RXRA 3LKWA 4LZ4B 1OSSA 1MU8B 5GWZA 1SQRA 2G8TA 1SI5H 1AUTC 1L1JA 4Y76A 1YF4A 3GCHB 4DW2U 1P11E 5C0UA 4LOYH 3ZVBA 4AN7A 2V3OH 5E0HA 3VB5A 5C1UA 2BDBA 1UCYE 2JIZD 1QQUA 1SHYA 1C2HA 1SL3A 3ZVGA 2O8TA 2YNAA 1LHCH 1XXDA 5A8ZA 1K1LA 2FP7B 2Y7ZA 2AGEX 3KQBA 3L3TA 1XUKA 1HYLA 3LDXH 4ESTE 1O35A 5C2ZA 2V7QD 3T28A 5DP6A 4UE7H 1EZSC 2VU8E 3SV8A 3NZIA 2F9PA 1NFYA 5FPYA 1C5NH 2GT7A 1RS0A 3MMGA 3RLWH 8GCHG 4MPXA 3ELAH 4OS7A 5DP7A 1LQDB 1LPZB 5FAHA 3ZVCA 3PWCA 2ZU5A 5JBTA 2QXIA 1VGCC 2F43B 1WTGH 3F3BA 3RC4A 1O3NA 1BMMH 2BY7X 1TONA 3IWMA 5AFYH 3BG4B 1FONA 1O2ZA 3NWUA 2XC0A 3W1EA 3ZZ5A 3RLYH 4IC5A 3TVJB 3U1JB 1BBRK 1K28D 5EW1H 2PKSC 1KDQB 4WMFA 2R9PA 1TNJA 4MG3A 3T29A 2OQ5A 5C5NA 4CREA 3A87A 2PTNA 2XC5A 2JETC 3EQ0H 3CS7A 1CA0B 1XVOA 4RKOB 3U1IB 2KX4A 4B75A 2ZTYA 2QXHA 5DG6A 1SBWA 2HPPH 1EAWA 1E35B 4F55A 5EJ1A 3LH3A 3LGTA 2PSYA 4AYVB 2V0BA 2BDIA 4XSKU 1AD8H 5KGOA 2WV9A 2HPQH 2ZPSA 1PPGE 1KXAA 2V6NA 1JXPA 6GCHG 2DUCA 1Y3YA 4FVBA 7LPRA 1G32B 1V2MT 1HRTH 3QGJA 4ABIA 5L6NH 4ISLA 1V2KT 5CMXH 1ZSLA 3A89A 4BXWA 1HAHH 1V2RT 3RXTA 1YPMH 1DITH 4U01A 1V2ST 1DT2A 4H42U 2OLGA 3K6ZA 1S6HA 5C67A 3DSPA 1NFWA 4AG2A 4DJZB 1IQEA 2GGVB 3SNDA 5L2ZH 1GJ7B 4IGDA 1CGIE 1TGSZ 2FI3E 2IPHA 2HVYB 2AYWA 1FV9A 5T1VA 3F9GA 2EC9H 2PTCE 2CHAC 1O3IA 1E79D 1P03A 2Y7XA 1DWCH 1XUFA 1A0HB 4VGCB 2BQ7B 1EAXA 2ZGCA 3P70B 2CV3A 3P8FA 1TA2A 1SGYE 1ZLRA 2ZQ2A 1LPGB 4Z0KA 1A5HA 3MHWU 5T6GA 4JYVH 4RSPA 1UHBA 4O9VA 1EJNA 4WMEA 1HDTH 3RXPA 1YY3A 2K1QA 4AFUA 1DDJA 3F2HA 1TOCB 3DCLA 1LPKB 4OS2A 4GSOA 4O03A 3STIA 1F5LA 4GCHG 4Q7XA 1FAXA 2F4LA 1HXFH 1QFKH 3RMNH 2FESH 4RKJB 1PQ8A 1C2KA 2GDEH 1LO6A 3H7TA 1PYTD 1P09A 1O3EA 3QGNB 2OUAA 2BZAA 1GMDF 2ZFRH 2ZFSA 3ATMA 1DPOA 1UO6A 5E2OA 2BY9X 3M3SA 1L4ZA 2PWXA 2O8LA 3DD2H 1DXWA 2ZDAH 2ZU1A 5LPEA 5JBAS 5EGMA 1Z6EA 3LPRA 1WU1A 1NBME 3RMOH 3UNSA 2J98B 3SYJA 3RM2H 3UQOA 2BD3A 2AIQA 3BN9A 1LVMA 1E1QD 2M5TA 2O8WA 2JH6D 2XBWA 1L1GA 3VB7A 3PYHA 1DOJA 1FQ3A 4MNWA 2KCOA 1Z1IA 3TH3H 3BTDE 4A1XA 4MNXA 1BRBE 1FY4A 2UUJB 4ISHH 5A09A 1NRSH 1HJ8A 5JDUB 3MH6A 4WJG2 3ZZ4A 2P94A 2C4FH 2XWBI 1AZZA 2EY4C 1P2QA 2PGBB 1DWEH 5B6OA 2BX4A 2OINA 4DT7B 1TPPA 3RXHA 3LJOA 2SNWA 2QF0A 1S82A 1TE0A 3F2GA 1W13U 4TPIZ 2KR7A 4H6SB 1FX0B 5EU8A 4OGXA 1OP8A 4ZHLU 3P8NA 2BDHA 1WDIA 4M9FA 1HAXB 1INCA 1FY8E 3N99A 4YTAA 1O2GH 4B76A 1S81A 3TJNA 1BOQA 4ZH8A 1AY6H 3SW2B 1F92A 3KF2A 1GGDC 4UEHH 3HATH 2BYAX 4Y8XA 1S84A 3M7UA 3UNQA 3K9XB 3V0XA 3EYDA 4FUGA 5DPAA 5LPFA 3RU4D 1WBGB 2Y6TA 1C1QA 3A83A 4JZEH 3E0PB 2A2QH 5A0CA 1VR1H 4NFFA 3TJVA 2G51A 3HPTB 4BAOB 1LDTT 4M7GA 1ESBA 3ZZBA 1PQ7A 1UHBB 2ZQ1A 5ABWA 3MH5A 1MCTA 5CHBA 5EPYA 5L30H 2BOHB 5FPSA 1KTSB 1TB6H 4LK4A 4D8NA 4Z6AH 4XOJA 1QJ7B 2FM2A 2GV7A 3MU5A 3A8AA 3FP8E 2SGQE 4BAHB 2ANWA 2ZDNA 1G3BA 1TNKA 1P2NA 1O3PB 1EPTC 1O3MA 3OFND 3N7OA 2BLWA 5EXLA 3V3MA 1TNHA 1ANDA 1SGRE 4GHTA 4X1SU 1P9UA 3QX5H 1WOFA 2D26C 3QDZB 1O3DA 3A8BA 1JMOH 4FUDA 1BQYA 1N6XA 1CHOF 3SV2H 2XNDD 2C8YB 1V2PT 1BB0B 2FOBA 3B8JA 1WXRA 1P05A 5JBCS 1GJ9B 4MPWA 4NZQA 4KKDA 2ZFFH 1XX9A 2EI7A 4YT6H 1HJAB 1B0FA 4Y6DA 1DVAH 1OX1A 4OGYA 2ZGBH 4WH8A 3GY7A 1MKXH 4ZUHA 1FY1A 1F0TA 1C1MA 4H6TA 2FTMA 3GY8A 3KCGH 3LGUA 1Q3XA 4I8GA 2AS9A 3GCOA 4ASHA 1AZ8A 1IQGA 1E36B 2H2ZA 5GIBA 1K2I1 4I8KA 3KQCA 1H8ED 1YCPH 2WPLS 2UWOA 2WPKS 6CHAB 3MO9A 1J15A 1O3AA 1VCQA 5GXPA 5C94A 3QWCH 2J95A 4YOJA 1AFQC 1TYNA 1SR5C 3M36A 3SGQE 1GJBB 1JIRA 3GCTF 1C5QA 3P92A 4ZHMU 1SLUB 3T27A 2BLOA 4K3JA 5ETXA 3RMLH 1E1RD 1O2PA 3ZZAA 1A3EH 4YESB 4LXBH 1QQ4A 1VITH 5KEDA 4WH6A 1THPB 1Q31A 3KYGA 1TRNA 1GBAA 5TJXA 2R3YA 1ABIH 2VINA 1RRKA 4AGJA 1P12E 2J34A 3MNSA 3VGCC 1P57B 1GJCB 1C2EA 4J2YB 2FYQA 4GVUA 2QF5A 2VGCC 1S0QA 2AGGX 1CSOE 3RXIA 2D8WA 1GI2A 2KFWA 1KXFA 1SGIB 5C5OA 1C5VA 1HAZB 2P8OB 3VXFH 1P2MA 2WV4A 2AMQA 2WINI 2PP6A 2ZKSA 4I8HA 5T6FA 2FS8A 3LJJA 1OWDA 4B2BA 4FU7A 1SQTA 1C5WB 2TRMA 2H5DA 1BUIA 1DANH 1GHXH 2HLCA 4Y11E 1UK2A 4ACBA 1C1TA 3LC5A 1CT4E 2A7CA 1HAYB 1O30A 5HGGA 3TU7H 1LHDH 1ZSJA 1GBIA 4DCDA 1C5MD 5ESBA 1Z71A 3KNXA 2YOLA 1T8LA 2G4UA 1XXFA 1P3CA 2VH0A 3PV5A 5L2YH 2Z94A 4CR5A 5T6DA 1XVMA 1O33A 3UB0A 5IDKA 4AB9A 5DK1A 1GI0A 2B0FA 2V3MA 4NIYA 1A3BH 1S5SA 4OS6A 2Z9GA 2QYIA 3RXBA 3WWBA 2A5IA 1W0KD 2OBOA 5HMAA 3QZRA 1GBLA 3NK8A 1P3EA 3BEUA 1GCTB 1LTOA 1SLWB 1H8HD 2F9OA 2HNTC 2YMSB 3UAIC 5I46H 1V3XA 3HKJB 4YM9A 4B2CA 2XNIA 2VVUA 3GY5A 3M7TA 1GMHF 2P93A 3RXSA 1S85A 4SGAE 2F9NA 1C5OH 3OSYA 4X1PU 1F5RA 1LKAA 2GZ7A 2PW8H 1YM0A 3FP6E 2OC7A 1QNJA 5EPNA 4B74A 1AGJA 4I32A 1QRWA 5FXLA 1ZYOA 1WCZA 3UUZA 2VVCA 3RDZA 4Q2KA 3ZZ7A 1MAXA 1SGFA 1EJAA 1THRH 2IJOB 1P0SH 5J4SA 5DP4A 1O34A 3TNTA 4R8TB 4IS5A 3OU0A 1DSUA 1B5GH 5IK2D 4FUHA 1QB6A 1GI4A 2P95A 2Z9JA 3MU0A 1GMDG 2Y5FA 4CRBA 1OWKA 2EQNA 1SOTA 4FUIA 3RXKA 4TSFD 3FP7E 4WXVA 3EE0B 3TGIE 1IQLA 4BOHA 1UTMA 3QN7A 1W12U 1SLXB 3ITIA 3RMMH 4X2WA 1OPHB 5JBBS 1O3LA 2H6MA 3LGWA 1ANBA 1HFDA 4UFDH 4K60A 1M9UA 1C5RA 1Z8GA 1LMWB 4Q80A 1RIWB 3EA7A 2BDAA 2FWWA 1P2JA 1V6DA 2VWLA 1SG8B 1T8NA 1O5FH 3A81A 4ABAA 4CBOA 1E38B 1NM6A 3ODFA 4YOGA 2EEKA 2QXJA 1YPKH 1GHWH 1WTHD 2SGFE 5LGOA 3SUGA 4KTSA 3Q3YA 4O3UA 1ZHMA 1BJUA 1JRSA 1TGNA 2A31A 2HNTF 2OTVA 3PWBA 3GOVB 1K22H 2BZ6H 3U98H 1HCGA 2W5EA 2Z7FE 2VWOA 1UJ1A 5HM9A 1KLIH 1BDAA 2YMSD 3KL6A 1WSSH 1NT1A 2R2WU 3F2FA 4TPYA 2BD5A 1FN8A 1GMCG 3PTNA 2JJ1D 3SI3H 2W7UA 4D7GA 4XD7D 1NZQH 4RI0A 3U28C 2HALA 1MZAA 1J8AA 1QZ8A 4D9QA 2ODPA 1SSXA 1AFEH 2H9TH 1DS2E 2KM0A 4CH2B 2J2UA 3HK6B 3SORA 1WV7H 1PPHE 3U8TH 1BMLA 3Q77A 2QGRA 4KP0A 2RA0A 2TGTA 3KGPA 4I31A 5AHGH 1RTKA 5F8ZA 6LPRA 2Q6FA 5CHAB 1MQ5A 1C1VH 3GCHC 5AFZH 4CHAB 4RT1A 3SI4H 3AAUA 4ABDA 1W3CA 1KXCA 1H1BA 1DLEA 2R0KA 5JPMH 2VB0A 1MZDA 3BEFB 3UIRA 1GG6B 3VB6A 3F68H 1KXDA 3P6ZB 1Y5BT 2WPIS 2VBCA 4MDSA 4DT4A 1GBJA 1W7GH 3FZDA 2FLBH 3LIWA 5FCKA 1VCWA 1EASA 2FS9A 2OP9A 4CRAA 4FOUC 1ORFA 4Y8YA 3R3GB 1O2SA 2IOTA 1DFPA 1IQKA 1CHOG 1GJ4H 5GJ4B 4BANB 4F4OC 3RC6A 1O5GH 1GBMA 4HTCH 4IBLH 5DGJA 4FETA 1BTHH 1ELVA 1UMAH 2A1DB 1HGTH 2ZPQA 2G4TA 1C1SA 7ESTE 1FUJA 4YO9A 3TJUA 1NBMD 3E3TA 2BY5X 2ZGXH 4Y79A 2FOAA 3T2NA 2WPHS 1W0ZU 2GV6A 1BTZA 4MPUA 1BBRH 1ANCA 1TRYA 1RTFB 2ALPA 4ABGA 3RXLA 4AB8A 2FX6A 4JMYA 2ZHWH 4ZKSU 3M3TA 3E90B 2FDAA 2FO9A 3N7DA 3QO6A 3TLOA 1P2KA 1HLTH 3STJA 4RT0A 1QRXA 5LPRA 1C5YB 3GDUA 2UUYA 3MU8A 1ANEA 1O3FA 2BY8X 2FI5E 3SUDA 4Y0YE 1ZJDA 3M61U 3PV2A 1CA0C 2K8IA 1BMAA 2GJGA 3P8GA 4K8BA 1TNGA 3GCTG 1GBHA 1KYNA 1MUEB 2C3SA 1OWJA 2PUQH 2ANYA 1C9TA 1DE7H 2ZIQH 3BTHE 2HNTE 2TGDA 2V3HH 4NCYA 3UR6A 1AI8H 1KSNA 3UOUA 4BTTB 1OXGA 1AE5A 2P3TB 4X2XA 3M5MA 3LGIA 4X1NU 3QUMP 3UPEA 1T8OA 1FDPA 1UK3A 1GJ6A 1QIXB 4NA8A 3L33A 1GBCA 1EZUC 5GCHF 5SGAE 3P8OA 3PLPA 3BSQA 1F0RA 1CQQA 3V12A 1ETRH 2ANMH 5C20A 5E8EH 4XDEA 1FN6A 3PRDA 3TH4H 3ZIAD 5AF9H 3AK5A 2ZA5A 3IG6B 3NCLA 1PFXC 2Q6DA 2Z3EA 3RXQA 1K1MA 1MH0A 1OS8A 2Y80A 2SGAA 5DP3A 4CR9A 1P04A 1UCYH 4DIHH 3F6UH 4JZ1A 3FVFB 3SJIA 4X2VA 4U30A 4XBDA 1AB9B 1YC0A 3A88A 1UVTH 3CNRA 4CH8B 1ETTH 1UTNA 3ZZCA 1YPHC 1MKWK 1CBWB 4GAWA 2KZ4A 3QTOH 1GVLA 1T4UH 2EI6A 2PUXB 4IW4E 5ESTE 2OC1A 3P95A 1C2IA 4VGCC 4HI3A 1L4DA 4ISOA 2BY6X 3WY8A 1NRQH 2A7HA 2BD4A 2FOMB 1ZPZA 3BG8A 1DY9A 1O2QA 2OXSA 3SU2A 1EJMA 1O2JA 3HKIB 2ULLA 1C2FA 3B23B 2TGPZ 1ZR0A 1ZPCA 5EG4A 4NA9H 1GDNA 3Q3KA 1H8DH 4NIWA 3TGJE 4ZAEA 4TY7A 1H4WA 1W2KH 5C0TA 1CO7E 3F0PA 1SGNE 3HK3B 1VCPA 2CGAA 4DGJA 5H4IB 3ZYDA 1VJ9U 2VVVA 4P00A 1ABJH 1QJ1B 1SLVB 3URCA 1S0RA 1GI8B 2HOBA 4IC6A 2VIVA 2IN2A 1ELFA 5DP5A 2NU1E 1GHZA 2AMDA 1CGHA 1W7XH 1MD7A 3SO3A 5A0AE 5JB8S 1P02A 3SU4A 2ZC9H 1SOZA 3GCNA 1OYTH 1TMBH 1AVWA 1VJAU 2Y81A 4BAMB 1A4WH 1ESAA 1GHAF 1ZHRA 3EDXB 1S83A 2L6OA 3MU4A 1O36A 2VIQA 4A1VA 2BVSH 3ZZ8A 2H5CA 3FKSD 3NUMA 2QA9E 1TX7A 1SQOA 2FEQH 1HB0B 1AUJA 1GBTA 3GICB 5F03A 1YWUA 3NKKA 1P01A 2FIRH 1TPSA 1CGJE 2A5KA 2C90B 3PM3A 2A4RA 3SJKA 1J16A 3VB3A 2FODA 3SJ9A 3LONA 1GI7B 1TALA 3EGKH 2Q1JA 2AGIX 4JZDH 5JB9S 1DM4B 3VEQB 2ZU3A 1V2TT 1Y8TA 1QL8A 2VWMA 1NC6A 3SHAH 2ZU2A 1GL1A 3L6PA 4NG9H 5EQQA 1TA6A 4MVNA 3LT3A 4MQAA 1O3KA 4AFZA 2PGQB 1GDQA 2WYGA 5T3HA 2A4OA 2G5VA 1C9PA 1QRZA 1GBKA 2ZF0H 2QCYA 1HAPH 2UWPA 2Z3DA 1O3HA 2SGEE 1V2UT 1YPJH 1GBBA 1D9IA 2P16A 3DT0H 4JYTA 4WF8A 4WVPE 4X8VH 4B71A 3UOPA 3OE7D 2J9NA 4YXWD 3G01A 2HGTH 4X2YA 3PMHB 1H8IH 2J97A 4GPGA 1WUNH 3PLKA 1W8BH 3AVZA 1YCPM 3OY5U 1WQVH 1JWTA 1C1WH 2ZFPH 3RM0H 2FYRA 4UDWH 2BXUH 4NIVA 1NPMA 1FPHH 1OOKB 4X0WU 2FOEA 1BZXE 1TOMH 4MTBA 1LVBA 1W0JD 2ESTE 1WQSA 1ZRKA 2BLQA 3FANA 3BTGE 1Z8JB 2BVRH 4ZCNA 2BDGA 3NRLA 4GHQA 1O2WA 3A7XA 3ENSB 4ZHAA 1WAYB 3RXJA 2GX4A 3U8RH 2H9EH 1QCPA 1O5AB 1GHBF 1HBTH 3TITA 1AHTH 2HWLB 2QY0B 2G52A 4NZLA 4P02A 1QBOA 2TIOA 3ZVDA 1UTQA 1C2DA 1MABB 4FU8A 2BXTH 1BTWA 5C3NA 2VJ1A 1BHXB 3M5OA 4WMDA 1DSTA 1GDUA 1SB1H 2B7DH 2ZI2H 1MTUA 1MTNB 3ESTA 2SGPE 1O2TA 1FY3A 3O8DA 1HJAC 2BX3A 3AAVA 4K1TA 4K69A 1C4V2 1PPCE 4ACAA 4D76A 1C1OA 1LHFH 5FCRA 1L2EA 1PQ5A 1RXPA 4NSVA 1AE8H 2BVXH 3M35A 2R3UA 4Q7YA 4ZROA 5AVDA 5FX6A 2ASUB 2UWLA 4U2WA 2FTLE 3H09A 1ZHPA 1UW7A 5FPTA 1SGQE 3D65E 6CHAC 3GISB 3MFJA 1A7SA 1Y5AT 2ZHEH 4E7RG 2QF4A 4TWYA 1KLJH 1RFNA 2LP6A 1ESTA 5E0GA 1YPHE 2H9HA 1EKBB 1EFRD 3HGNA 3UNRA 1D6RA 1UTPA 1S6FA 4X6NA 3RXOA 1QURH 1FLEE 2W7SA 2NU0E 1C5SA 5G4BA 1K1OA 3DFLA 1O0DH 3BTEE 1T31A 5EQSA 3SUEA 1AKSA 3TK6A 3C1KA 3SGAE 4Q7ZA 4A7IB 1P8VC 1BJVA 1OKXA 5C1XA 1TABE 4JYUH 1TIOA 2OQUA 3E8LA 4KTUA 3MI4A 1HJ9A 1TPOA 1GJ5H 1SQAA 2AH4X 1MTWA 1AQ7A 5FBEA 4ABBA 4X6MA 5TCAA 1CU1A 5F8TA 3TPIZ 2WYJA 1DUEA 1COWD 3AW1A 3GY6A 2J5UA 3M5LA 4MPVA 1UTKA 1W11U 2RCEA 3K6YA 2P8OC 1V2OT 5IYTA 2C8XB 4PROA 2TPIZ 3C27B 1THSH 1FPCH 1Z7KA 4UONA 1G2LA 2DE9A 2NU3E 3MWIU 2QXGA 5EODA 1GVZA 2P3UB 4INHA 3UWIA 3UWJH 2PSXA 1GI6A 2ZZUH 3DSGA 2CK3D 2G81E 1ZGVA 1V2JT 1O38A 2ZHQH 3I29A 1F0UA 3PMBB 5KECA 4OM9A 5I25A 4AX9H 2EA3A 4BNRA 5GCHG 1C5TA 3ATKA 1MBMA 1SKYE 1DY8A 9ESTA 1W14U 3SQHE 1GPZA 2WPDD 3E16B 1MMJN 4KGAA 1ACBE 1E37B 3S9BA 1AU8A 1FY5A 1UVSH 4I8LA 5C1YA 2YNBA 4X1QU 1O3JA 5EXNA 2CN0H 1GCTC 1TGTA 7GCHF 3Q3XA 1IOEA 1AO5A 1NFXA 1ZPBA 2CXVA 1YP9A 1NESE 3BV9B 2F9VA 2YMSC 3W94A 5EQRA 2ZPRA 2A4GA 1JOUB 1SGDE 2J38A 1N8OB 3OEED 2GCTB 4KTCA 3KEEA 2F3CE 4F49A 1KLTA 1QGFA 1O3BA 2BDYA 1K0HA 4FUJA 5GNDA 1O3CA 1B7XB 2G5NA 2QIQA 4ZMAH 1C5PA 3PO1B 4JZIA 2V35A 1TBZH 1BTPA 1KXBA 2Y82A 4NWKA 1P2IA 1QA0A 2LNCA 2OD3B 2GMTB 1AKSB 3GYLB 1SC8U 3VB4A 1SPJA 1EUFA 1F7ZA 3ZV8A 2BQ6B 7KMEH 1ELBA 1O32A 3SU1A 2P59A 3RXVA 5HKKD 4UFFH 2FPZA 1JBUH 2NWNA 5F8XA 3A86A 3TIUA 3F9HA 2ZWLH 1ZSKA 2XOKD 4DY7B 3LH1A 4Q63A 1EXFA 1UVUH 2NU4E 3MO3A 2WPMS 3MQKC 1NO9H 4Y7BA 2ZGJA 1PPBH 2H1UA 1HAVA 2K0QA 3GY4A 1QJ6B 1DXPA 1GI1A 2FX4A 1K1NA 4I7YH
chains in the Genus database with same CATH topology
3MO6A 3ZVFA 4YOIA 1FI8A 4OS1A 4FUFA 1RJXB 2TBSA 3RXDA 1ID5H 1MQ6A 2FMJA 1BITA 4MNVA 3A7ZA 4K5ZA 1V2WT 3SJOA 4KELA 4FU9A 3EA8A 2VWNA 1YPGH 3SU0A 1RIWC 2A4QA 4Y10E 1UVOA 1A5IA 1XMNB 4IN2A 1QR3E 1E0FD 2ZG0H 1G3DA 2ZEBA 3ATLA 1AVGH 4ZKOU 1PQAA 4DURA 2FLRH 2A5AA 2Z9LA 1NRRH 1UTLM 1V2QT 1XUGA 2EI8A 1F5KU 1T7CA 1LHGH 1XUJA 3VFEA 1TMUH 1LVYA 2VNTA 2ZTXA 2FOHA 2O8UA 1NU9A 1ELEE 1H9LB 3BTQE 3P17H 1O2XA 1QB1A 4UFGH 1GI9B 1ELGA 1V2NT 4FUEA 3D62A 5A8XA 1P2OA 4X6PA 4K8YA 3AASA 1KXEA 1KY9A 2WUCA 3DA9B 1QHRB 1P10A 1O2MA 1O31A 3M7QA 4A6LA 4MLFB 3OY6U 4E06H 2ZO3H 4B73A 1BMNH 1A5GH 1PPEE 1EAIA 4K2YA 5EOKA 4WWYA 4Y7AA 1UVPA 1EOJA 2THFB 1OP2A 1MU6B 3U8OH 2GCHF 1OWHA 1UTOA 1T32A 3LGVA 1KTTB 4JK5A 1ZTJA 4K1SA 3T5FH 1NY22 1UK4A 2Q6GA 1GJAB 8KME2 2BLVA 3UREA 5CHAC 3A82A 1J17T 1SVPA 3SGBE 1D3PB 1MTVA 8LPRA 1VGCB 4CHAC 3ZYEA 2OC0A 2ZGHA 5A2MH 1TQ0B 2JKHA 2XC4A 5K0HA 1E34B 2R0LA 1TAWA 2STBE 1HPGA 2FOFA 3NXPA 1GG6C 3O8RA 2OC8A 1G9IE 3SQEE 1GHBG 1GBEA 2PKSB 2ZCLP 2D2DA 1HAVB 2B5TB 4ISNA 3ZVAA 4ABJA 1FXYA 3S9CA 3UQVA 1DWBH 2BQWB 2JETB 1BRCE 3BTWE 5A8YA 2BB4A 3BG4C 5BPEA 3LU9B 1ARCA 2BTCE 1QBNA 5DP9A 3W95A 2G00A 1G37A 1PJPA 1OYQA 3RC5A 3RXUA 2ZHFH 1YGCH 2PHBA 2VIDA 1PYTC 2FZZA 3R0FA 1Y3UA 1O5DH 1GL0E 2C8WB 3GY3A 2PFEA 1CT2E 3A7VA 1HAIH 3SNEA 1MD8A 3FAOA 4LZ1H 1Y3VA 4NFEA 1QL7A 1ZJKA 1ZZZA 1J14A 2WV5A 3PLBA 2XBVA 4X8SH 3D23A 3MNBA 1QB9A 1A2CH 2I6SA 2PKAA 1ZOMA 3MU1A 9LPRA 2OCVB 4ABFA 3F1SB 3T26A 2O9QA 1CT0E 4OS4A 1ZMJA 1VITF 1OWEA 2F91A 2F9BH 2PR3A 1YKTA 3BIVH 2WUBA 2Y5HA 3DFJA 1IQHA 4ABEA 4ZKRU 2CHAB 3K2UA 5DP8A 1AN1E 1ELAA 1ZTLA 1NS3A 1O2NA 1RGQA 2OBQA 4RN6A 1C5UA 5TCCA 1G30B 4AG1A 2G55A 3RXEA 4E05H 4X6OA 4NA7A 1BTYA 1PPZA 1EP5A 1ZTKA 3I77A 3SU3A 3FFGA 2BD7A 2W26A 1UCYK 3PTBA 3TGKE 1A46H 4ZXXH 3RXAA 3S9AA 1EX3A 1Y3XA 3SU6A 3U69H 1A1RA 1MBQA 4HZHA 1BTUA 1NN6A 2SFAA 4QT8C 1Y59T 3RXCA 4GUXA 1TBRH 1AVXA 3KHVA 1F0SA 1IQMA 3MNCA 4BAKB 1MKWH 1C1NA 3PMAB 2DE8A 4I8JA 1AIXH 1K1PA 3V7TA 3I78A 1EAUA 3S7KB 1AB9C 3SNAA 5K7RA 1EPTA 3CENA 3BTFE 4YT7H 2BD9A 1CBWC 1MCVA 1HIAA 3A7WA 1XM1A 4OS5A 4HFPB 2ZNKH 3O8CA 1ELTA 4IN1A 1UTJA 1YLDA 4ISIH 3ZZ3A 1SFIA 3A7TA 3SUFA 2ZTZA 1TX8A 1DUAA 5E0JA 1BIOA 5EXMA 1D4PB 3E91A 1T4VH 4CRCA 3GDVA 2O8MA 2BM2A 4FUCA 2ZFTA 4MNYA 1ETSH 1O2KA 1O5BB 2KAIA 6ESTA 1C2GA 1O37A 4BTIB 1D6WA 3SJ8A 3A84A 1EB1H 4B1TA 3EA9A 1IAUA 4CBNA 4H4FA 1DICA 1BCUH 1GMHG 1TLDA 4JK6A 1BRUP 1FIZA 2GTBA 3ZZ9A 1GHVH 4GLYA 2ZDVH 3A85A 1ZRBA 2Z3CA 2PKAB 4NWLA 1SHHB 1IHTH 7GCHG 3HGPA 2ODYB 4AOQA 1FAKH 1O3OA 3DUXH 5BRRE 2GD4B 4Y71A 3CP7A 4IMZA 3EAJA 2A7JA 4NIXA 1SMFE 4WXIA 1LVOA 1GGDB 1JRTA 4D9RA 1JIMA 3MTYA 3JZ2B 1J9CH 3NPSA 3PROA 1HV7A 1LCYA 1SGCA 2GKVE 1QA7A 1FIWA 1AWHB 4TWWA 1B0EA 5GDSH 1TNIA 2GP9B 2GVFA 2VIOA 2HRVA 1GMCF 4R0IA 3SHCH 1A0LA 2QC2A 3D49H 3H5CB 2GZ8A 3QLPH 1FZZA 2AIPA 4FVDA 1K1JA 3F9EA 1YPLH 1ELCA 1LKBA 1DX5M 1YYY1 2VH6A 2I6QA 3SV6A 4AFQA 2AFQB 3ATIA 1QTFA 3F9FA 2GDDA 1EPTB 3K65B 1DLKB 2NU2E 3KQDA 3SBKA 4ZXYH 1G2MA 4X8TH 1TMTH 1HIAB 3RXGA 3E0NB 1YBWA 4E7NA 4XBCA 2A32A 5PTPA 3QK1A 2HVXA 4TYDA 1GJ8B 1D3TB 1BT7A 4AZ2B 1GWAA 1V2VT 1HXEH 3ATWA 2TGAA 3TK9A 1N6YA 4CRDA 8GCHF 2STAE 3KN2A 4XE4A 1NTPA 2FI4E 1Z6JH 1L0ZA 5A0BA 1O2HA 2QV1A 4BTUB 3BTTE 2KAIB 5E2PA 3MNXA 4FUBA 2J94A 3RU4T 1TGBA 2XXLA 3SU5A 2W3KA 1GHYH 3S69A 1SGEE 2BD8A 3BTME 1EOLA 4DOQA 2C8ZB 3TH2H 1MKXK 3S0NA 2ZFQH 4A92A 5CE1A 3CS0A 4INLA 3URDA 4D7FA 3PB1E 2UUKB 2XBYA 3ZZ6A 1Y5UT 1P06A 1WYKA 2CMYA 3KIDU 4HGCA 1Z8RA 1C5XB 1QL9A 2SGDE 3VXEH 2XWAA 3SOSA 1ZMNA 1XKBC 5DKMA 1AFQB 1TNLA 3M3VA 3SNCA 2WPJS 4CRFA 1DWDH 1O2VA 1YCPK 1W0YH 3OX7U 1CVWH 2B9LA 2GZ9A 2QF3A 4IMQA 1MTNC 1BRAA 2Z9IA 3BIUH 1IQJA 4YLUA 2GCHG 1FMGA 1IQFA 1Y3WA 2ALVA 1HNEE 1QY6A 4ABHA 1N1LA 1TPAE 3FZZA 1O2LA 2AEIH 3MYWA 2XBXA 6GCHF 1ELDE 1NRNH 5J4QA 3S7HB 3GYMA 3Q76A 1C1PA 1GI5A 4DVAU 2ZDLA 4SGBE 3BF6H 1O3GA 2ANKH 4UD9H 3VGCB 1K1IA 3O8BA 1Z8IB 1K21H 1GBDA 1LHEH 1AWFH 2VGCB 4DG4A 2FXRA 2XRCA 2J4IA 4A1TA 4TY6A 5FBIA 1C1RA 2VIWA 3A8CA 5GPIB 2XW9A 1EB2A 1EZQA 1GCDA 1F2SE 3E1XB 1L1NA 3B9FH 3UTUH 3IITA 2XCNA 4X1RU 2CJIA 2ZP0H 3DHKH 3SN8A 4J1YA 4WY3A 3RU4E 3Q00A 2BHGA 3LGYA 2BMGB 1FNIA 4THNH 3PMJA 4I33A 1C4U2 2BDCA 1U6QA 3RXMA 3TNSA 2GT8A 1O2IA 2SNVA 2ZECA 1IQIA 2RDLA 3KQEA 4AORA 5HXFA 2XCFA 1TGCA 1X7AC 1HAGE 4Y0ZE 4U32A 2Z6BD 5FX5A 1CE5A 5EW2H 2FOCA 1G3EA 3GY2A 2BOKA 2ODQA 3U9AH 4X8UH 1BA8B 4YZUA 2JH0D 4INKA 4GCHF 2RA3A 1C2LA 4Y8ZA 4JZFH 4XBBA 1BHXF 1SFQB 1VITG 4NGAH 3ZZDA 3T62A 1EZXC 1TQ7B 3A7YA 2A0QB 2PLXA 1CA8B 4BXSA 4O97A 2A45B 1TWXB 1GI3A 3UR9A 1CHGA 1C5ZB 1TRMA 1OWIA 3MOCA 3E6PH 5FHTA 3PV4A 3QZQA 1O5EH 1MTSA 1D3DB 2Z9KA 4UFEH 4AFSA 1YPEH 1C4Y2 2P3FH 3UFAA 4O3TA 1EATA 1O2RA 1SGFG 2CF9H 2QN5T 3ZV9A 1Q2WA 4B2AA 4FXGH 1T8MA 5JYIA 3SV9A 2FOGA 5HM2A 2Y5GA 1ZMLA 3V13A 2B8OH 3BTKE 1H9IE 1GVKB 1SGPE 5DJ7A 1GJDB 2C93B 1W10U 2PV9B 3UY9A 2CF8H 3VPKA 1ARBA 5LH8A 4A5TS 1OP0A 4K1EA 1NROH 3OYPA 2LPRA 1C2MA 1O2UA 1N8OC 2RG3A 1HUTH 2ZDKA 2GCTC 2JH5D 3MH7A 2F83A 1NU7B 1RTLA 1MAYA 1O2YA 3AW0A 3ODDA 1G36A 2ILNA 1A0JA 2ZDMA 1O39A 4XFQA 1LQEA 2ZU4A 1V2LT 2AMPA 3M5NA 3LOXA 3PO1C 3RXFA 1GBFA 1XKAC 4YLQH 2ZCKP 3SV7A 1FJSA 1Z1JA 1TBQH 4CRGA 2VIPA 3RUOA 1K9OE 2GMTC 5F6MA 1KIGH 1HAOH 1AMHA 2F9UA 3H7OA 1G3CA 4ZKNU 2R2MB 3QTVH 3ZVEA 2ZCHP 1RD3B 1XUIA 3RP2A 3SNBA 3TK5A 1BBRE 2D1JA 2BD2A 2W3IA 1C1UH 1GHAG 1O5CB 1O2OA 4JCNA 1QBVH 3MH4A 1KDQA 1C2JA 8ESTE 5HYOA 1SGTA 1TFXA 5DO4H 2XYAA 1NFUA 1PPFE 2ZHDA 3LC3A 1VZQH 1H9HE 3JZ1B 4AGKA 2A2XH 1IQNA 1TX6A 2QAAA 2AERH 1YLCA 3M37A 2UUFB 1P9SA 3GDSA 2XTTB 1BTXA 1XUHA 1IHSH 3BEIB 3OTJE 1ZGIA 1EP6A 3SZNA 1C5LH 4DIIH 1EQ9A 3T25A 4NSYA 2J92A 4BAQB 1D3QB 3TJOA 1A61H 3A80A 1NRPH 4AYYB 3A8DA 3RXRA 3LKWA 4LZ4B 1OSSA 1MU8B 5GWZA 2G8TA 1SI5H 1AUTC 1L1JA 4Y76A 1YF4A 3GCHB 4DW2U 1P11E 4LOYH 3ZVBA 4AN7A 2V3OH 5E0HA 3VB5A 5C1UA 2BDBA 1UCYE 1QQUA 1SHYA 1C2HA 1SL3A 3ZVGA 2O8TA 2YNAA 1LHCH 1XXDA 5A8ZA 1K1LA 2FP7B 2Y7ZA 2AGEX 3KQBA 3L3TA 1XUKA 1HYLA 3LDXH 4ESTE 1O35A 5C2ZA 3T28A 5DP6A 4UE7H 1EZSC 2VU8E 3SV8A 3NZIA 2F9PA 1NFYA 5FPYA 1C5NH 2GT7A 1RS0A 3MMGA 3RLWH 8GCHG 4MPXA 3ELAH 4OS7A 5DP7A 1LQDB 1LPZB 5FAHA 3ZVCA 3PWCA 2ZU5A 5JBTA 2QXIA 1VGCC 1WTGH 3RC4A 1O3NA 1BMMH 2BY7X 1TONA 3IWMA 5AFYH 3BG4B 1FONA 1O2ZA 3NWUA 2XC0A 3ZZ5A 3RLYH 4IC5A 3TVJB 3U1JB 1BBRK 1K28D 5EW1H 2PKSC 1KDQB 4WMFA 2R9PA 1TNJA 4MG3A 3T29A 2OQ5A 5C5NA 4CREA 3A87A 2PTNA 2XC5A 2JETC 3EQ0H 3CS7A 1CA0B 1XVOA 4RKOB 3U1IB 4B75A 2ZTYA 2QXHA 5DG6A 1SBWA 2HPPH 1EAWA 1E35B 3LH3A 3LGTA 2PSYA 4AYVB 2V0BA 2BDIA 4XSKU 1AD8H 2HPQH 2ZPSA 1PPGE 1KXAA 2V6NA 1JXPA 6GCHG 2DUCA 1Y3YA 4FVBA 7LPRA 1G32B 1V2MT 1HRTH 3QGJA 4ABIA 5L6NH 4ISLA 1V2KT 5CMXH 1ZSLA 3A89A 4BXWA 1HAHH 1V2RT 3RXTA 1YPMH 1DITH 4U01A 1V2ST 1DT2A 4H42U 2OLGA 3K6ZA 1S6HA 5C67A 1NFWA 4AG2A 4DJZB 1IQEA 2GGVB 3SNDA 5L2ZH 1GJ7B 4IGDA 1CGIE 1TGSZ 2FI3E 2IPHA 2AYWA 1FV9A 3F9GA 2EC9H 2PTCE 2CHAC 1O3IA 1P03A 2Y7XA 1DWCH 1XUFA 1A0HB 4VGCB 2BQ7B 1EAXA 2ZGCA 3P70B 2CV3A 3P8FA 1TA2A 1SGYE 1ZLRA 2ZQ2A 1LPGB 4Z0KA 1A5HA 3MHWU 5T6GA 4JYVH 4RSPA 1UHBA 4O9VA 1EJNA 4WMEA 1HDTH 3RXPA 2K1QA 4AFUA 1DDJA 1TOCB 1LPKB 4OS2A 4GSOA 4O03A 3STIA 1F5LA 4GCHG 4Q7XA 1FAXA 1HXFH 1QFKH 3RMNH 2FESH 4RKJB 1PQ8A 1C2KA 2GDEH 1LO6A 3H7TA 1PYTD 1P09A 1O3EA 3QGNB 2OUAA 2BZAA 1GMDF 2ZFRH 2ZFSA 3ATMA 1DPOA 1UO6A 5E2OA 2BY9X 3M3SA 1L4ZA 2PWXA 2O8LA 3DD2H 1DXWA 2ZDAH 2ZU1A 5LPEA 5JBAS 5EGMA 1Z6EA 3LPRA 1WU1A 3RMOH 3UNSA 3RM2H 3UQOA 2BD3A 2AIQA 3BN9A 1LVMA 2M5TA 2O8WA 2JH6D 2XBWA 1L1GA 3VB7A 3PYHA 1DOJA 1FQ3A 4MNWA 1Z1IA 3TH3H 3BTDE 4A1XA 4MNXA 1BRBE 1FY4A 2UUJB 4ISHH 5A09A 1NRSH 1HJ8A 5JDUB 3MH6A 4WJG2 3ZZ4A 2P94A 2C4FH 2XWBI 1AZZA 2PGBB 1P2QA 1DWEH 5B6OA 2BX4A 2OINA 4DT7B 1TPPA 3RXHA 3LJOA 2SNWA 2QF0A 1S82A 1TE0A 4TPIZ 1W13U 4H6SB 5EU8A 4OGXA 1OP8A 4ZHLU 3P8NA 2BDHA 1HAXB 1INCA 1FY8E 4YTAA 4B76A 1O2GH 1S81A 3TJNA 1BOQA 4ZH8A 1AY6H 3SW2B 1F92A 3KF2A 1GGDC 4UEHH 3HATH 2BYAX 4Y8XA 1S84A 3M7UA 3UNQA 3K9XB 3V0XA 3EYDA 4FUGA 5DPAA