1BUJA

Structure of binase in solution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
AVINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAEVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of binase in solution.
pubmed doi rcsb
source organism Bacillus intermedius
molecule tags Hydrolase
molecule keywords PROTEIN (BINASE)
total genus 23
structure length 109
sequence length 109
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bujA00
1LRAA 7RNTA 1CH0A 1DE3A 1B2ZA 3RNTA 1BGSA 1B20A 1RGFA 1BSBA 2BU4A 1RCKA 2KF4A 1LOVA 3URPA 4BU4A 1TRPA 9RNTA 1C54A 4GSPA 1GOVA 3KCHA 1TTOA 6GSPA 4HOHA 1T2IA 1FZUA 1HZ1A 5BU4A 1RN4A 1RNTA 2AADA 1BANA 3D4AA 4BIRA 1GOUA 2KF3A 3Q3FA 1PYLA 1BUJA 1PY3A 3D5IA 1HYFA 1RGCA 1FW7A 1IYYA 1I0VA 1T2HA 1I8VA 1UCKA 1JBRA 1RGAA 5RNTA 3BIRA 1LOYA 1RGGA 5BIRA 1RCLA 1X1UA 1AY7A 2F5MA 1MGRA 1B21A 1BNSA 1YVSA 1GMQA 3SYUA 3GSPA 1I2GA 1RMSA 5HOHA 1JBTA 2RBIA 5GSPA 1BRHA 1B2XA 1UCIA 4J5GA 1AQZA 1GOYA 1RNBA 7GSPA 1RSNA 1RLSA 2ZA4A 6RNTA 1BIRA 1B3SA 3DGYA 1SARA 1GSPA 2HOHA 1I2FA 4RNTA 2SARA 3A5EA 1BSCA 1BRJA 1BSAA 4J5KA 3D5GA 1DETA 1LNIA 3WHOA 1A2PA 1FYSA 1BSEA 1RHLA 1BNIA 1LOWA 1JBSA 1BRIA 3HOHA 1TRQA 1MGWA 1BOXA 2AAEA 1YGWA 1B2SA 3AGNA 3BU4A 1R4YA 1X1XA 2RNTA 1ZGXA 1I0XA 1YNVX 1B27A 1I2EA 1I3IA 1BRGA 1BNJA 2F56A 2KAAA 2F4YA 3DH2A 1Q9EA 2F5WA 4GHOA 1BSDA 1BVIA 1G02A 1GMPA 1RDSA 8RNTA 1RGLA 1BU4A 1RGHA 2BIRA 1BNRA 2KF5A 3AHWA 3AGOA 1BRKA 2KF6A 1I3FA 1FUTA 1UCLA 1X1WA 1B2MA 1GMRA 1BNFA 1B2UA 3WR2A 1FUSA 2GSPA 1RN1A 1RGKA 1X1YA 1RGEA 4HAAA 1UCJA 1BNGA 2C4BA 1BRNL 1I70A 3AHSA 1BRSA 1BNEA 1RTUA 1BAOA
chains in the Genus database with same CATH superfamily
1M1XB 7RNTA 5HGRA 1A2VA 1R4CA 2ZHXB 3LOYA 2RSXA 3CCM3 1M9GA 1VQ93 5EQLA 3URPA 1UI7A 2BU4A 2GBXB 3U97A 4BU4A 2PZVA 1GOVA 6GSPA 5TGNA 3DGLA 1FZUA 3MYTA 2ZL8A 1ROVA 2AADA 1K28A 3D4AA 3LT8A 1YJN3 1J2BA 1OCVA 2Q07A 3KFQC 4BIRA 4EXRA 3IPTA 4R80A 2UGIA 1PYLA 1RN7A 1ROAA 3KIIA 5IW9A 3FH1A 1E97A 3D5IA 4MMXB 4RBNA 1RGCA 4WYKA 1JKGB 3WOFB 4K90B 1T2HA 5AYRB 4X2HA 1FGOA 1M904 1RGAA 1HKXA 2XF3A 3DMCA 1JNQA 5AIHA 3V98A 3VF1A 5IENA 1JN5B 5BIRA 4BTWA 1W6GA 1X1UA 3H3HA 4I4KA 2CK3H 1LQMB 3NBBA 3ALAA 1AVKA 2YX9A 4XDWA 5IG5A 3CCS3 3NM2A 2UX0A 3NM7A 3AMOA 3SOAA 4RNYA 1LOXA 2CWTA 1YVSA 1TU5A 2OQEC 3WA3A 1JB5A 1I2GA 2CFLA 2H0HA 2MF7A 3PXMA 2RFRA 1VQ63 4MEIA 4N6LA 3DXOA 5GSPA 1IQYA 4HM7B 3EX9A 1W6YA 5ELUA 3EB8A 1RNBA 2GEXA 3LXUX 3CC23 1OHPA 3OX9A 4HYZA 1K41A 1RSNA 1RRHA 5CXOA 2BT3A 3OWSA 1B3SA 5CK6A 2HOHA 1I2FA 2SARA 3B4PA 5G2GA 1G0TA 5FW5A 3M8CA 1LXEA 4AKZA 4J5KA 4LYLB 1Y4KA 1UUGB 3DGOA 2W03A 2OTJ3 1FYSA 3T0UA 1RHLA 3JUPA 1W01A 4IIAA 1JBSA 2O9UX 3FG1A 1YJ93 1U5OA 1MWSA 3GZBA 3HOHA 2XEPA 1OF5A 1ZS7A 3Q90A 3X40A 2FGTA 1DVDA 5I97A 1O7NB 3N9HA 3JUMA 3K63A 1UW1A 1MWTA 3JVCA 1ZGXA 3HX8A 1YNVX 1B27A 3OXAA 1ISKA 1I2EA 2F56A 1BRGA 1TP6A 2WOFA 3DH2A 4AKYA 3G4S3 1W00A 3CXC2 3V92A 1YHQ3 2E2TA 3CC73 1G02A 1RDSA 3RGAA 2WGQA 3OW22 2BNGA 1NO3A 4XBYA 5JPUA 1M1K4 1RGHA 2BIRA 1N9JA 2L1SA 2P09A 2KF5A 2XH9A 3PCRA 1K734 3AGOA 1JV2B 2KF6A 1VQM3 2F98A 3N54B 4KT3B 3BNDA 5D81A 2JQ5A 4HM8B 1IVUA 4JRFA 2JDIH 1B2MA 1GMRA 1NWWA 3FKAA 3WDGB 1N8QA 3KSED 4IPBA 2W6JH 2WGOA 1JRQA 1TIJA 3AHSA 3LT9A 5EVHA 4OVMA 3FF0A 4J8TA 2IUKA 1A2KA 3GRDA 3K7CA 1BAOA 2STDA 3CU3A 1LRAA 2IY2A 1JZDA 1NB3I 4XBTA 1IDPA 1JN5A 2CC3A 3NQZA 3EHCA 1YIJ3 2E2VA 1UGIA 1B20A 2KF4A 1BSBA 4R9LA 3BNCA 4N6OB 4HM6B 4GSPA 3BLZA 3KCHA 1IVWA 1TUHA 3CCQ3 2HMLB 3KSPA 3QRDA 3ROBA 3D79A 1HZ1A 1Q7Y4 1DMMA 4HBRA 1EKMA 4N6NB 3CCJ3 1AVLA 1BANA 1MOLA 3FZWA 2GBWB 4FR9A 3WMDA 1GOUA 1YI23 3Q3FA 4HKVB 5M1AA 4BTYA 1TFOA 4AEQA 1EG9B 3O8YA 3CME3 1Q40A 3N8BA 3MHEA 2XRXB 2P05A 3QK9A 1IYYA 3DGNA 3DGMA 5AIGA 3FSDA 4L7KA 2F86B 1FGRA 1QJGA 1LOYA 1RGGA 3K9MC 3SXXA 1GYBA 5IG3A 5BXQA 2RCDA 2Z76A 1KD14 3F7XA 4KZ1A 1US1A 2O3OA 2F5MA 1JBRA 3S28A 3T8UA 2J8XB 1U8CB 1UI8A 2BMQB 4NPBA 1GY7A 1LQGC 1RMSA 3E99A 5HOHA 3K5TA 3NBRA 3MKIA 4H61A 4Q53A 1JBTA 4MMYB 2CWUA 3K0ZA 4N6V0 3ZG5A 1AQZA 2XSOB 3STDA 3CCV3 2CFKA 1CYVA 4GB5A 4EV5A 2ZA4A 1DMNA 5AEUB 5G1KA 1OPYA 2CFGA 2GEYA 4XM4A 1BSCA 2W9QA 1VQO3 1BSAA 3EBYA 4EC6A 2IA7A 1Q864 1DETA 4LGQA 1QAKA 4HM5B 1E3VA 1BSEA 1E3RA 2CG0A 3CCE3 1LOWA 4HVNA 1IK3A 3FG3A 1WMNA 3F7SA 3HZPA 1IVXA 1MGWA 3JUQA 3EN8A 4KFFA 3EC9A 1L5GB 4KVHA 1N5HA 3DM8A 3WODG 5KP1A 3IMAB 2ML5A 1I3IA 2I9WA 3JUOA 1JB2A 1WQLB 2OTL3 4BL3A 1OGZA 4HM3B 3GZYB 4GHOA 1W2ZA 5CLKA 5DRVA 2OCTA 1GMPA 8RNTA 3MWZA 1MNLA 3EN1B 1SQWA 3DUKA 1FA3A 3CCR3 1JKGA 2LYXA 1GD4A 3VSYA 5JBSA 3MG2A 2CFWA 7STDA 1X1WA 1O7GB 1SIIA 4N6UA 1HU9A 2HMMB 2IMJA 3CNMA 3FCSB 2CWVA 2HMNB 1KWIA 1FUSA 2V1LA 2W04A 1X1YA 1VQ83 2BMRB 2WO0A 4HAAA 4RZMA 2YFJB 1Q7HA 1QALA 1FUWA 1IT7A 3CNXA 3CCL3 1JB4A 1RTUA 1BNEA 1UGHI 2C10A 2CX0A 2R4IA 3LTCA 4L8OA 2H0GA 1DVCA 3EF8A 1PU4A 1CH0A 2CG1A 5IG4A 1TFKA 3FG4A 3PGBA 1DE3A 1O7WB 1B2ZA 5AIFA 1BGSA 3RNTA 1LOVA 1T3BA 2Z6BA 1TRPA 3NV0A 4HM0B 4O2HA 4CCVA 1VQK3 1C54A 1TTOA 4HOHA 1OGXA 1T2IA 4HJLB 3KKGA 3KE7A 8CHOA 2KF3A 3G0KA 2D42A 1BUJA 2CIUA 2IUJA 1ZX2A 2A15A 3HK4A 3NBJA 1HYFA 3SX1A 1YJW3 1FW7A 2CFDA 1I0VA 4OUQA 4J9AA 1AV4A 1OHSA 5CF1A 2XR8B 3MPHA 5RNTA 2C11A 4CJNA 3GZRA 1IQXA 1W02A 3SOYA 5EEOA 1Q42A 4EBGA 1CYUA 1AY7A 5JPPA 1S723 2CKFB 1WMOA 5STDA 1MGRA 3GAXA 1STDA 1B21A 1UUWB 1BNSA 2OQEA 3CCU3 3SYUA 4EV2A 1IV9A 4G1MB 1WMPA 1OF5B 4HM2B 3SLUA 3G8ZA 1F8NA 1VZZA 3VGNA 4BTXA 4N6MA 3CMA3 2YFLB 1TJDA 2RBIA 3V99A 1BRHA 1LVNA 1PFPA 1KSIA 3DZLA 3OWYA 4WFOA 1Q814 1C7HA 3HIIA 1GOYA 3CPOA 2XGLA 1Q40B 1RLSA 3X3ZA 4WYKB 4FMBA 6RNTA 2QA43 5AYSC 1BIRA 4KFEA 4R1KA 3DGYA 4FCZA 1GSPA 3PYJA 1MWRA 3KN4A 3A5EA 2SBLA 2FNQA 1GY6A 2D1WA 3BNEA 4O3VA 3G6E3 5AI1A 1D6UA 3D5GA 3WHOA 2HMKB 1A2PA 3EBTA 5AIIA 2YFIB 2QGUA 3OWUA 4X2OA 2MC8A 3BB9A 2W0QA 1QVG2 2OWPA 3D9RA 3UNLA 3S5CA 1BRIA 6STDA 3S29A 3DY5A 1DMQA 1DYUA 3FGYA 4N3VA 1VQ43 3H51A 3EQQB 1B2SA 4XDVA 3T8NA 2XSHB 3UJMA 4MJDA 4K1VA 1VQ53 3CD63 1R4YA 1WTHA 5G1LA 4DKIA 4EW5A 3S27A 1I0XA 5AEWB 1O7HB 4PEJA 2ML6A 3B8LA 1UUVB 3NQYA 1Q9EA 2F5WA 3ECFA 4FMDA 1G96A 3F14A 1BSDA 1NU3A 3U1WA 5M19A 1IT8A 1RGLA 1RKYA 3Q1CA 2B1XB 1FGTA 5KP3A 2P0XA 2HMOB 2HMJB 4HM1B 3AHWA 1A67A 1BRKA 2KCDA 2XFTA 1GY5A 1I3FA 1FUTA 1CQSA 2WOHA 2Y73A 3B4OA 1T5YA 3G16A 3Q2PA 1IVVA 4IT7A 1YGEA 1NJI4 1NNVA 1SJWA 1K8A4 1VQN3 3NHXA 2B24B 3WR2A 2GSPA 3BNBA 1RGKA 1D6YA 1UCJA 1EUIC 2C4BA 4XB5A 3TDGA 2W9PA 5LC7A 2RGQA 2UUGC 3F40A 1SPUA 3GZXB 3HIGA 4WP5A 2KRTA 3UB1A 4ILFA 2GU1A 2GXFA 2H0IA 1JZOA 3X3YA 1FGQA 2K3DA 3I0YA 1KC84 3LTBA 1QAFA 3F8HA 3L0RA 3X41A 1N5PA 3HI7A 2K54A 2QEX3 5IEPA 2F99A 1O7PB 3D3LA 1RGFA 5BVBA 1RCKA 1W2B2 1ULJB 2ZDJA 1QVF2 9RNTA 1EA2A 3AMOB 3CC43 1SIHA 1K9M4 3RGRA 4BL2A 2L4VA 4O02B 1BUQA 5BU4A 3ER7A 1RN4A 1RNTA 5IEOA 5IERA 1IQ8A 5ELJA 5IF6A 3S67A 3ZG0A 4FCJA 4HZ9B 1GS3A 4K61A 4ORLA 3CPW2 2PNCA 2BO9B 4RNZA 1PY3A 3G713 1STFI 3LYGA 2CH9A 1I8VA 3X3XA 1UCKA 4XBXA 4CPKA 1MWUA 4FMAA 1VQ73 2QIYA 2XFSA 1KQS2 1O7MB 3NUVA 3BIRA 4MMZB 1W5ZA 5CF2A 5LC6A 3I553 4R4KA 4GL6A 3KZTA 1RCLA 2CHCA 2Y74A 2W2CA 1QMAA 1IV7A 4FMCA 1N8R4 4HM4B 2XGNA 4O8SA 1UDII 2CW9A 1GMQA 3LTAA 2IYJA 3FLJA 3LTDA 3GSPA 1Z1SA 3A76A 4LEHA 3UL6A 4NHFA 5M18A 1GD3A 1D6ZA 1RJOA 1V74A 2GU3A 4KFDA 1B2XA 1UCIA 4J5GA 4WWUC 1OACA 5IG0A 3MG3A 4STDA 2FXTA 3NX0A 3JUNA 4QWTA 7GSPA 5KP4A 3UL5A 1VQP3 3IJEB 4N6TA 3EJVA 2Z7AA 1SARA 1N9EA 4RNTA 3PCSA 1EEJA 2OOVA 1BRJA 2OOVC 4K1UA 1OH0A 1JJ22 2M7OA 1A90A 1LNIA 1Q824 2W56A 1VQL3 2E2UA 1BNIA 1RRLA 3LZAA 1WNHA 2BMOB 4LZIA 5DREA 4EYCA 1NDOB 4H3UA 1S5AA 4LMIA 1ZO2A 1W7CA 1TRQA 2R41A 1OUNA 3MSOA 3GWRA 3WA2X 1BOXA 2AAEA 3F8XA 4FCMA 3OV4A 1YGWA 4I5QA 5D82A 1ASKA 3AGNA 3J7Yd 3PZWA 4TX4A 3BU4A 5FGOA 4LSOA 2BHMA 1X1XA 2RNTA 1V57A 1LNHA 2P38A 3B7CA 1BNJA 2KAAA 3EE1A 1V58A 2F4YA 4OK0A 4R9KA 1FGMA 1BVIA 1ULIB 1YIT3 2LQVA 1BU4A 3PS8A 3WOEB 4ZM8A 1BNRA 4U13A 4NREA 2KXGA 5A0OB 3NV0B 4CDLA 1CEWI 4HZBB 2W56B 3X42A 3LMLA 1UCLA 3I563 4WHAA 1W4NA 3SVAA 2Z77A 3RDEA 1W6CA 1YVBI 1BNFA 4JF8A 5D83A 1B2UA 3SEDA 3LH4A 1RN1A 3MG1A 3ZFZA 1RGEA 2P0MA 3F9SA 1BNGA 1NB5I 2CX1A 1BRNL 1I70A 1OHOA 1AR0A 3FF2A 2K0MA 1BRSA 1IU7A 1VQQA 2INXA 4L8PA 3NXJA 1EQKA
chains in the Genus database with same CATH topology
1LRAA 7RNTA 1CH0A 1DE3A 1B2ZA 3RNTA 1BGSA 1B20A 1RGFA 1BSBA 2BU4A 1RCKA 2KF4A 1LOVA 3URPA 4BU4A 1TRPA 9RNTA 1C54A 4GSPA 1GOVA 3KCHA 1TTOA 6GSPA 4HOHA 1T2IA 1FZUA 1HZ1A 5BU4A 1RN4A 1RNTA 2AADA 1BANA 3D4AA 4BIRA 1GOUA 2KF3A 3Q3FA 1PYLA 1BUJA 1PY3A 3D5IA 1HYFA 1RGCA 1FW7A 1IYYA 1I0VA 1T2HA 1I8VA 1UCKA 1JBRA 1RGAA 5RNTA 3BIRA 1LOYA 1RGGA 5BIRA 1RCLA 1X1UA 1AY7A 2F5MA 1MGRA 1B21A 1BNSA 1YVSA 1GMQA 3SYUA 3GSPA 1I2GA 1RMSA 5HOHA 1JBTA 2RBIA 5GSPA 1BRHA 1B2XA 1UCIA 4J5GA 1AQZA 1GOYA 1RNBA 7GSPA 1RSNA 1RLSA 2ZA4A 6RNTA 1BIRA 1B3SA 3DGYA 1SARA 1GSPA 2HOHA 1I2FA 4RNTA 2SARA 3A5EA 1BSCA 1BRJA 1BSAA 4J5KA 3D5GA 1DETA 1LNIA 3WHOA 1A2PA 1FYSA 1BSEA 1RHLA 1BNIA 1LOWA 1JBSA 1BRIA 3HOHA 1TRQA 1MGWA 1BOXA 2AAEA 1YGWA 1B2SA 3AGNA 3BU4A 1R4YA 1X1XA 2RNTA 1ZGXA 1I0XA 1YNVX 1B27A 1I2EA 1I3IA 1BRGA 1BNJA 2F56A 2KAAA 2F4YA 3DH2A 1Q9EA 2F5WA 4GHOA 1BSDA 1BVIA 1G02A 1GMPA 1RDSA 8RNTA 1RGLA 1BU4A 1RGHA 2BIRA 1BNRA 2KF5A 3AHWA 3AGOA 1BRKA 2KF6A 1I3FA 1FUTA 1UCLA 1X1WA 1B2MA 1GMRA 1BNFA 1B2UA 3WR2A 1FUSA 2GSPA 1RN1A 1RGKA 1X1YA 1RGEA 4HAAA 1UCJA 1BNGA 2C4BA 1BRNL 1I70A 3AHSA 1BRSA 1BNEA 1RTUA 1BAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LRA A;  7RNT A;  1CH0 A;  1DE3 A;  1B2Z A;  3RNT A;  1BGS A;  1B20 A;  1RGF A;  1BSB A;  2BU4 A;  1RCK A;  2KF4 A;  1LOV A;  3URP A;  4BU4 A;  1TRP A;  9RNT A;  1C54 A;  4GSP A;  1GOV A;  3KCH A;  1TTO A;  6GSP A;  4HOH A;  1T2I A;  1FZU A;  1HZ1 A;  5BU4 A;  1RN4 A;  1RNT A;  2AAD A;  1BAN A;  3D4A A;  4BIR A;  1GOU A;  2KF3 A;  3Q3F A;  1PYL A;  1BUJ A;  1PY3 A;  3D5I A;  1HYF A;  1RGC A;  1FW7 A;  1IYY A;  1I0V A;  1T2H A;  1I8V A;  1UCK A;  1JBR A;  1RGA A;  5RNT A;  3BIR A;  1LOY A;  1RGG A;  5BIR A;  1RCL A;  1X1U A;  1AY7 A;  2F5M A;  1MGR A;  1B21 A;  1BNS A;  1YVS A;  1GMQ A;  3SYU A;  3GSP A;  1I2G A;  1RMS A;  5HOH A;  1JBT A;  2RBI A;  5GSP A;  1BRH A;  1B2X A;  1UCI A;  4J5G A;  1AQZ A;  1GOY A;  1RNB A;  7GSP A;  1RSN A;  1RLS A;  2ZA4 A;  6RNT A;  1BIR A;  1B3S A;  3DGY A;  1SAR A;  1GSP A;  2HOH A;  1I2F A;  4RNT A;  2SAR A;  3A5E A;  1BSC A;  1BRJ A;  1BSA A;  4J5K A;  3D5G A;  1DET A;  1LNI A;  3WHO A;  1A2P A;  1FYS A;  1BSE A;  1RHL A;  1BNI A;  1LOW A;  1JBS A;  1BRI A;  3HOH A;  1TRQ A;  1MGW A;  1BOX A;  2AAE A;  1YGW A;  1B2S A;  3AGN A;  3BU4 A;  1R4Y A;  1X1X A;  2RNT A;  1ZGX A;  1I0X A;  1YNV X;  1B27 A;  1I2E A;  1I3I A;  1BRG A;  1BNJ A;  2F56 A;  2KAA A;  2F4Y A;  3DH2 A;  1Q9E A;  2F5W A;  4GHO A;  1BSD A;  1BVI A;  1G02 A;  1GMP A;  1RDS A;  8RNT A;  1RGL A;  1BU4 A;  1RGH A;  2BIR A;  1BNR A;  2KF5 A;  3AHW A;  3AGO A;  1BRK A;  2KF6 A;  1I3F A;  1FUT A;  1UCL A;  1X1W A;  1B2M A;  1GMR A;  1BNF A;  1B2U A;  3WR2 A;  1FUS A;  2GSP A;  1RN1 A;  1RGK A;  1X1Y A;  1RGE A;  4HAA A;  1UCJ A;  1BNG A;  2C4B A;  1BRN L;  1I70 A;  3AHS A;  1BRS A;  1BNE A;  1RTU A;  1BAO A; 
#chains in the Genus database with same CATH topology
 1M1X B;  7RNT A;  5HGR A;  1A2V A;  1R4C A;  2ZHX B;  3LOY A;  2RSX A;  3CCM 3;  1M9G A;  1VQ9 3;  5EQL A;  3URP A;  1UI7 A;  2BU4 A;  2GBX B;  3U97 A;  4BU4 A;  2PZV A;  1GOV A;  6GSP A;  5TGN A;  3DGL A;  1FZU A;  3MYT A;  2ZL8 A;  1ROV A;  2AAD A;  1K28 A;  3D4A A;  3LT8 A;  1YJN 3;  1J2B A;  1OCV A;  2Q07 A;  3KFQ C;  4BIR A;  4EXR A;  3IPT A;  4R80 A;  2UGI A;  1PYL A;  1RN7 A;  1ROA A;  3KII A;  5IW9 A;  3FH1 A;  1E97 A;  3D5I A;  4MMX B;  4RBN A;  1RGC A;  4WYK A;  1JKG B;  3WOF B;  4K90 B;  1T2H A;  5AYR B;  4X2H A;  1FGO A;  1M90 4;  1RGA A;  1HKX A;  2XF3 A;  3DMC A;  1JNQ A;  5AIH A;  3V98 A;  3VF1 A;  5IEN A;  1JN5 B;  5BIR A;  4BTW A;  1W6G A;  1X1U A;  3H3H A;  4I4K A;  2CK3 H;  1LQM B;  3NBB A;  3ALA A;  1AVK A;  2YX9 A;  4XDW A;  5IG5 A;  3CCS 3;  3NM2 A;  2UX0 A;  3NM7 A;  3AMO A;  3SOA A;  4RNY A;  1LOX A;  2CWT A;  1YVS A;  1TU5 A;  2OQE C;  3WA3 A;  1JB5 A;  1I2G A;  2CFL A;  2H0H A;  2MF7 A;  3PXM A;  2RFR A;  1VQ6 3;  4MEI A;  4N6L A;  3DXO A;  5GSP A;  1IQY A;  4HM7 B;  3EX9 A;  1W6Y A;  5ELU A;  3EB8 A;  1RNB A;  2GEX A;  3LXU X;  3CC2 3;  1OHP A;  3OX9 A;  4HYZ A;  1K41 A;  1RSN A;  1RRH A;  5CXO A;  2BT3 A;  3OWS A;  1B3S A;  5CK6 A;  2HOH A;  1I2F A;  2SAR A;  3B4P A;  5G2G A;  1G0T A;  5FW5 A;  3M8C A;  1LXE A;  4AKZ A;  4J5K A;  4LYL B;  1Y4K A;  1UUG B;  3DGO A;  2W03 A;  2OTJ 3;  1FYS A;  3T0U A;  1RHL A;  3JUP A;  1W01 A;  4IIA A;  1JBS A;  2O9U X;  3FG1 A;  1YJ9 3;  1U5O A;  1MWS A;  3GZB A;  3HOH A;  2XEP A;  1OF5 A;  1ZS7 A;  3Q90 A;  3X40 A;  2FGT A;  1DVD A;  5I97 A;  1O7N B;  3N9H A;  3JUM A;  3K63 A;  1UW1 A;  1MWT A;  3JVC A;  1ZGX A;  3HX8 A;  1YNV X;  1B27 A;  3OXA A;  1ISK A;  1I2E A;  2F56 A;  1BRG A;  1TP6 A;  2WOF A;  3DH2 A;  4AKY A;  3G4S 3;  1W00 A;  3CXC 2;  3V92 A;  1YHQ 3;  2E2T A;  3CC7 3;  1G02 A;  1RDS A;  3RGA A;  2WGQ A;  3OW2 2;  2BNG A;  1NO3 A;  4XBY A;  5JPU A;  1M1K 4;  1RGH A;  2BIR A;  1N9J A;  2L1S A;  2P09 A;  2KF5 A;  2XH9 A;  3PCR A;  1K73 4;  3AGO A;  1JV2 B;  2KF6 A;  1VQM 3;  2F98 A;  3N54 B;  4KT3 B;  3BND A;  5D81 A;  2JQ5 A;  4HM8 B;  1IVU A;  4JRF A;  2JDI H;  1B2M A;  1GMR A;  1NWW A;  3FKA A;  3WDG B;  1N8Q A;  3KSE D;  4IPB A;  2W6J H;  2WGO A;  1JRQ A;  1TIJ A;  3AHS A;  3LT9 A;  5EVH A;  4OVM A;  3FF0 A;  4J8T A;  2IUK A;  1A2K A;  3GRD A;  3K7C A;  1BAO A;  2STD A;  3CU3 A;  1LRA A;  2IY2 A;  1JZD A;  1NB3 I;  4XBT A;  1IDP A;  1JN5 A;  2CC3 A;  3NQZ A;  3EHC A;  1YIJ 3;  2E2V A;  1UGI A;  1B20 A;  2KF4 A;  1BSB A;  4R9L A;  3BNC A;  4N6O B;  4HM6 B;  4GSP A;  3BLZ A;  3KCH A;  1IVW A;  1TUH A;  3CCQ 3;  2HML B;  3KSP A;  3QRD A;  3ROB A;  3D79 A;  1HZ1 A;  1Q7Y 4;  1DMM A;  4HBR A;  1EKM A;  4N6N B;  3CCJ 3;  1AVL A;  1BAN A;  1MOL A;  3FZW A;  2GBW B;  4FR9 A;  3WMD A;  1GOU A;  1YI2 3;  3Q3F A;  4HKV B;  5M1A A;  4BTY A;  1TFO A;  4AEQ A;  1EG9 B;  3O8Y A;  3CME 3;  1Q40 A;  3N8B A;  3MHE A;  2XRX B;  2P05 A;  3QK9 A;  1IYY A;  3DGN A;  3DGM A;  5AIG A;  3FSD A;  4L7K A;  2F86 B;  1FGR A;  1QJG A;  1LOY A;  1RGG A;  3K9M C;  3SXX A;  1GYB A;  5IG3 A;  5BXQ A;  2RCD A;  2Z76 A;  1KD1 4;  3F7X A;  4KZ1 A;  1US1 A;  2O3O A;  2F5M A;  1JBR A;  3S28 A;  3T8U A;  2J8X B;  1U8C B;  1UI8 A;  2BMQ B;  4NPB A;  1GY7 A;  1LQG C;  1RMS A;  3E99 A;  5HOH A;  3K5T A;  3NBR A;  3MKI A;  4H61 A;  4Q53 A;  1JBT A;  4MMY B;  2CWU A;  3K0Z A;  4N6V 0;  3ZG5 A;  1AQZ A;  2XSO B;  3STD A;  3CCV 3;  2CFK A;  1CYV A;  4GB5 A;  4EV5 A;  2ZA4 A;  1DMN A;  5AEU B;  5G1K A;  1OPY A;  2CFG A;  2GEY A;  4XM4 A;  1BSC A;  2W9Q A;  1VQO 3;  1BSA A;  3EBY A;  4EC6 A;  2IA7 A;  1Q86 4;  1DET A;  4LGQ A;  1QAK A;  4HM5 B;  1E3V A;  1BSE A;  1E3R A;  2CG0 A;  3CCE 3;  1LOW A;  4HVN A;  1IK3 A;  3FG3 A;  1WMN A;  3F7S A;  3HZP A;  1IVX A;  1MGW A;  3JUQ A;  3EN8 A;  4KFF A;  3EC9 A;  1L5G B;  4KVH A;  1N5H A;  3DM8 A;  3WOD G;  5KP1 A;  3IMA B;  2ML5 A;  1I3I A;  2I9W A;  3JUO A;  1JB2 A;  1WQL B;  2OTL 3;  4BL3 A;  1OGZ A;  4HM3 B;  3GZY B;  4GHO A;  1W2Z A;  5CLK A;  5DRV A;  2OCT A;  1GMP A;  8RNT A;  3MWZ A;  1MNL A;  3EN1 B;  1SQW A;  3DUK A;  1FA3 A;  3CCR 3;  1JKG A;  2LYX A;  1GD4 A;  3VSY A;  5JBS A;  3MG2 A;  2CFW A;  7STD A;  1X1W A;  1O7G B;  1SII A;  4N6U A;  1HU9 A;  2HMM B;  2IMJ A;  3CNM A;  3FCS B;  2CWV A;  2HMN B;  1KWI A;  1FUS A;  2V1L A;  2W04 A;  1X1Y A;  1VQ8 3;  2BMR B;  2WO0 A;  4HAA A;  4RZM A;  2YFJ B;  1Q7H A;  1QAL A;  1FUW A;  1IT7 A;  3CNX A;  3CCL 3;  1JB4 A;  1RTU A;  1BNE A;  1UGH I;  2C10 A;  2CX0 A;  2R4I A;  3LTC A;  4L8O A;  2H0G A;  1DVC A;  3EF8 A;  1PU4 A;  1CH0 A;  2CG1 A;  5IG4 A;  1TFK A;  3FG4 A;  3PGB A;  1DE3 A;  1O7W B;  1B2Z A;  5AIF A;  1BGS A;  3RNT A;  1LOV A;  1T3B A;  2Z6B A;  1TRP A;  3NV0 A;  4HM0 B;  4O2H A;  4CCV A;  1VQK 3;  1C54 A;  1TTO A;  4HOH A;  1OGX A;  1T2I A;  4HJL B;  3KKG A;  3KE7 A;  8CHO A;  2KF3 A;  3G0K A;  2D42 A;  1BUJ A;  2CIU A;  2IUJ A;  1ZX2 A;  2A15 A;  3HK4 A;  3NBJ A;  1HYF A;  3SX1 A;  1YJW 3;  1FW7 A;  2CFD A;  1I0V A;  4OUQ A;  4J9A A;  1AV4 A;  1OHS A;  5CF1 A;  2XR8 B;  3MPH A;  5RNT A;  2C11 A;  4CJN A;  3GZR A;  1IQX A;  1W02 A;  3SOY A;  5EEO A;  1Q42 A;  4EBG A;  1CYU A;  1AY7 A;  5JPP A;  1S72 3;  2CKF B;  1WMO A;  5STD A;  1MGR A;  3GAX A;  1STD A;  1B21 A;  1UUW B;  1BNS A;  2OQE A;  3CCU 3;  3SYU A;  4EV2 A;  1IV9 A;  4G1M B;  1WMP A;  1OF5 B;  4HM2 B;  3SLU A;  3G8Z A;  1F8N A;  1VZZ A;  3VGN A;  4BTX A;  4N6M A;  3CMA 3;  2YFL B;  1TJD A;  2RBI A;  3V99 A;  1BRH A;  1LVN A;  1PFP A;  1KSI A;  3DZL A;  3OWY A;  4WFO A;  1Q81 4;  1C7H A;  3HII A;  1GOY A;  3CPO A;  2XGL A;  1Q40 B;  1RLS A;  3X3Z A;  4WYK B;  4FMB A;  6RNT A;  2QA4 3;  5AYS C;  1BIR A;  4KFE A;  4R1K A;  3DGY A;  4FCZ A;  1GSP A;  3PYJ A;  1MWR A;  3KN4 A;  3A5E A;  2SBL A;  2FNQ A;  1GY6 A;  2D1W A;  3BNE A;  4O3V A;  3G6E 3;  5AI1 A;  1D6U A;  3D5G A;  3WHO A;  2HMK B;  1A2P A;  3EBT A;  5AII A;  2YFI B;  2QGU A;  3OWU A;  4X2O A;  2MC8 A;  3BB9 A;  2W0Q A;  1QVG 2;  2OWP A;  3D9R A;  3UNL A;  3S5C A;  1BRI A;  6STD A;  3S29 A;  3DY5 A;  1DMQ A;  1DYU A;  3FGY A;  4N3V A;  1VQ4 3;  3H51 A;  3EQQ B;  1B2S A;  4XDV A;  3T8N A;  2XSH B;  3UJM A;  4MJD A;  4K1V A;  1VQ5 3;  3CD6 3;  1R4Y A;  1WTH A;  5G1L A;  4DKI A;  4EW5 A;  3S27 A;  1I0X A;  5AEW B;  1O7H B;  4PEJ A;  2ML6 A;  3B8L A;  1UUV B;  3NQY A;  1Q9E A;  2F5W A;  3ECF A;  4FMD A;  1G96 A;  3F14 A;  1BSD A;  1NU3 A;  3U1W A;  5M19 A;  1IT8 A;  1RGL A;  1RKY A;  3Q1C A;  2B1X B;  1FGT A;  5KP3 A;  2P0X A;  2HMO B;  2HMJ B;  4HM1 B;  3AHW A;  1A67 A;  1BRK A;  2KCD A;  2XFT A;  1GY5 A;  1I3F A;  1FUT A;  1CQS A;  2WOH A;  2Y73 A;  3B4O A;  1T5Y A;  3G16 A;  3Q2P A;  1IVV A;  4IT7 A;  1YGE A;  1NJI 4;  1NNV A;  1SJW A;  1K8A 4;  1VQN 3;  3NHX A;  2B24 B;  3WR2 A;  2GSP A;  3BNB A;  1RGK A;  1D6Y A;  1UCJ A;  1EUI C;  2C4B A;  4XB5 A;  3TDG A;  2W9P A;  5LC7 A;  2RGQ A;  2UUG C;  3F40 A;  1SPU A;  3GZX B;  3HIG A;  4WP5 A;  2KRT A;  3UB1 A;  4ILF A;  2GU1 A;  2GXF A;  2H0I A;  1JZO A;  3X3Y A;  1FGQ A;  2K3D A;  3I0Y A;  1KC8 4;  3LTB A;  1QAF A;  3F8H A;  3L0R A;  3X41 A;  1N5P A;  3HI7 A;  2K54 A;  2QEX 3;  5IEP A;  2F99 A;  1O7P B;  3D3L A;  1RGF A;  5BVB A;  1RCK A;  1W2B 2;  1ULJ B;  2ZDJ A;  1QVF 2;  9RNT A;  1EA2 A;  3AMO B;  3CC4 3;  1SIH A;  1K9M 4;  3RGR A;  4BL2 A;  2L4V A;  4O02 B;  1BUQ A;  5BU4 A;  3ER7 A;  1RN4 A;  1RNT A;  5IEO A;  5IER A;  1IQ8 A;  5ELJ A;  5IF6 A;  3S67 A;  3ZG0 A;  4FCJ A;  4HZ9 B;  1GS3 A;  4K61 A;  4ORL A;  3CPW 2;  2PNC A;  2BO9 B;  4RNZ A;  1PY3 A;  3G71 3;  1STF I;  3LYG A;  2CH9 A;  1I8V A;  3X3X A;  1UCK A;  4XBX A;  4CPK A;  1MWU A;  4FMA A;  1VQ7 3;  2QIY A;  2XFS A;  1KQS 2;  1O7M B;  3NUV A;  3BIR A;  4MMZ B;  1W5Z A;  5CF2 A;  5LC6 A;  3I55 3;  4R4K A;  4GL6 A;  3KZT A;  1RCL A;  2CHC A;  2Y74 A;  2W2C A;  1QMA A;  1IV7 A;  4FMC A;  1N8R 4;  4HM4 B;  2XGN A;  4O8S A;  1UDI I;  2CW9 A;  1GMQ A;  3LTA A;  2IYJ A;  3FLJ A;  3LTD A;  3GSP A;  1Z1S A;  3A76 A;  4LEH A;  3UL6 A;  4NHF A;  5M18 A;  1GD3 A;  1D6Z A;  1RJO A;  1V74 A;  2GU3 A;  4KFD A;  1B2X A;  1UCI A;  4J5G A;  4WWU C;  1OAC A;  5IG0 A;  3MG3 A;  4STD A;  2FXT A;  3NX0 A;  3JUN A;  4QWT A;  7GSP A;  5KP4 A;  3UL5 A;  1VQP 3;  3IJE B;  4N6T A;  3EJV A;  2Z7A A;  1SAR A;  1N9E A;  4RNT A;  3PCS A;  1EEJ A;  2OOV A;  1BRJ A;  2OOV C;  4K1U A;  1OH0 A;  1JJ2 2;  2M7O A;  1A90 A;  1LNI A;  1Q82 4;  2W56 A;  1VQL 3;  2E2U A;  1BNI A;  1RRL A;  3LZA A;  1WNH A;  2BMO B;  4LZI A;  5DRE A;  4EYC A;  1NDO B;  4H3U A;  1S5A A;  4LMI A;  1ZO2 A;  1W7C A;  1TRQ A;  2R41 A;  1OUN A;  3MSO A;  3GWR A;  3WA2 X;  1BOX A;  2AAE A;  3F8X A;  4FCM A;  3OV4 A;  1YGW A;  4I5Q A;  5D82 A;  1ASK A;  3AGN A;  3J7Y d;  3PZW A;  4TX4 A;  3BU4 A;  5FGO A;  4LSO A;  2BHM A;  1X1X A;  2RNT A;  1V57 A;  1LNH A;  2P38 A;  3B7C A;  1BNJ A;  2KAA A;  3EE1 A;  1V58 A;  2F4Y A;  4OK0 A;  4R9K A;  1FGM A;  1BVI A;  1ULI B;  1YIT 3;  2LQV A;  1BU4 A;  3PS8 A;  3WOE B;  4ZM8 A;  1BNR A;  4U13 A;  4NRE A;  2KXG A;  5A0O B;  3NV0 B;  4CDL A;  1CEW I;  4HZB B;  2W56 B;  3X42 A;  3LML A;  1UCL A;  3I56 3;  4WHA A;  1W4N A;  3SVA A;  2Z77 A;  3RDE A;  1W6C A;  1YVB I;  1BNF A;  4JF8 A;  5D83 A;  1B2U A;  3SED A;  3LH4 A;  1RN1 A;  3MG1 A;  3ZFZ A;  1RGE A;  2P0M A;  3F9S A;  1BNG A;  1NB5 I;  2CX1 A;  1BRN L;  1I70 A;  1OHO A;  1AR0 A;  3FF2 A;  2K0M A;  1BRS A;  1IU7 A;  1VQQ A;  2INX A;  4L8P A;  3NXJ A;  1EQK A; 
#chains in the Genus database with same CATH homology
 1LRA A;  7RNT A;  1CH0 A;  1DE3 A;  1B2Z A;  3RNT A;  1BGS A;  1B20 A;  1RGF A;  1BSB A;  2BU4 A;  1RCK A;  2KF4 A;  1LOV A;  3URP A;  4BU4 A;  1TRP A;  9RNT A;  1C54 A;  4GSP A;  1GOV A;  3KCH A;  1TTO A;  6GSP A;  4HOH A;  1T2I A;  1FZU A;  1HZ1 A;  5BU4 A;  1RN4 A;  1RNT A;  2AAD A;  1BAN A;  3D4A A;  4BIR A;  1GOU A;  2KF3 A;  3Q3F A;  1PYL A;  1BUJ A;  1PY3 A;  3D5I A;  1HYF A;  1RGC A;  1FW7 A;  1IYY A;  1I0V A;  1T2H A;  1I8V A;  1UCK A;  1JBR A;  1RGA A;  5RNT A;  3BIR A;  1LOY A;  1RGG A;  5BIR A;  1RCL A;  1X1U A;  1AY7 A;  2F5M A;  1MGR A;  1B21 A;  1BNS A;  1YVS A;  1GMQ A;  3SYU A;  3GSP A;  1I2G A;  1RMS A;  5HOH A;  1JBT A;  2RBI A;  5GSP A;  1BRH A;  1B2X A;  1UCI A;  4J5G A;  1AQZ A;  1GOY A;  1RNB A;  7GSP A;  1RSN A;  1RLS A;  2ZA4 A;  6RNT A;  1BIR A;  1B3S A;  3DGY A;  1SAR A;  1GSP A;  2HOH A;  1I2F A;  4RNT A;  2SAR A;  3A5E A;  1BSC A;  1BRJ A;  1BSA A;  4J5K A;  3D5G A;  1DET A;  1LNI A;  3WHO A;  1A2P A;  1FYS A;  1BSE A;  1RHL A;  1BNI A;  1LOW A;  1JBS A;  1BRI A;  3HOH A;  1TRQ A;  1MGW A;  1BOX A;  2AAE A;  1YGW A;  1B2S A;  3AGN A;  3BU4 A;  1R4Y A;  1X1X A;  2RNT A;  1ZGX A;  1I0X A;  1YNV X;  1B27 A;  1I2E A;  1I3I A;  1BRG A;  1BNJ A;  2F56 A;  2KAA A;  2F4Y A;  3DH2 A;  1Q9E A;  2F5W A;  4GHO A;  1BSD A;  1BVI A;  1G02 A;  1GMP A;  1RDS A;  8RNT A;  1RGL A;  1BU4 A;  1RGH A;  2BIR A;  1BNR A;  2KF5 A;  3AHW A;  3AGO A;  1BRK A;  2KF6 A;  1I3F A;  1FUT A;  1UCL A;  1X1W A;  1B2M A;  1GMR A;  1BNF A;  1B2U A;  3WR2 A;  1FUS A;  2GSP A;  1RN1 A;  1RGK A;  1X1Y A;  1RGE A;  4HAA A;  1UCJ A;  1BNG A;  2C4B A;  1BRN L;  1I70 A;  3AHS A;  1BRS A;  1BNE A;  1RTU A;  1BAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...