1BUJA

Structure of binase in solution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
AVINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAEVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of binase in solution.
pubmed doi rcsb
source organism Bacillus intermedius
molecule tags Hydrolase
molecule keywords PROTEIN (BINASE)
total genus 23
structure length 109
sequence length 109
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bujA00
1B27A 1BOXA 4HAAA 1FZUA 1I0VA 3AHWA 1BRHA 3AGNA 3BIRA 3DH2A 3KCHA 1YNVX 4GHOA 1RGAA 1BAOA 3Q3FA 1JBSA 1G02A 1BGSA 1GOYA 2F5MA 1AQZA 1BVIA 1FYSA 1I8VA 2ZA4A 4HOHA 1FUSA 1I0XA 1BRJA 1RGCA 1BRSA 1I2FA 9RNTA 5HOHA 7GSPA 1PY3A 1B2SA 1I3FA 4J5GA 2KF4A 2KF3A 1BRNL 1HYFA 2RBIA 1BSCA 1UCJA 2F5WA 1LOVA 3D4AA 1RLSA 1LOYA 1RNBA 1I2GA 1B3SA 1GMQA 1TRPA 1BNRA 1T2HA 3D5GA 1T2IA 2HOHA 1MGRA 2AAEA 1LOWA 2BU4A 1B2MA 8RNTA 1LRAA 1X1WA 1YGWA 1B20A 1DETA 1RHLA 1AY7A 1B21A 1DE3A 1GOUA 3D5IA 1RCLA 1RN4A 1X1YA 1BNGA 3AHSA 1R4YA 1RMSA 5RNTA 2RNTA 1A2PA 1GMPA 1HZ1A 1BRKA 1BSDA 1BNIA 2F4YA 2SARA 3WHOA 1RCKA 1YVSA 2C4BA 1BRIA 1BNJA 3A5EA 1BUJA 3HOHA 1UCKA 1BNEA 1LNIA 1TRQA 1UCIA 4J5KA 4RNTA 1B2UA 1UCLA 1B2ZA 1X1XA 1FW7A 3BU4A 2F56A 2AADA 2KF6A 2KAAA 3GSPA 7RNTA 1PYLA 1RNTA 3WR2A 2BIRA 1Q9EA 1I2EA 1RTUA 1RSNA 6GSPA 3DGYA 1RGGA 1JBRA 1SARA 5BIRA 1RGFA 1BSBA 1X1UA 1BNSA 1BANA 1TTOA 4GSPA 4BIRA 3RNTA 1BU4A 1GSPA 1BSAA 1C54A 1GMRA 2GSPA 1BIRA 5GSPA 1RGEA 2KF5A 1RGHA 1IYYA 1BNFA 1FUTA 3AGOA 1MGWA 1I70A 5BU4A 1RGKA 1BSEA 1RDSA 4BU4A 1ZGXA 3URPA 1GOVA 1B2XA 1JBTA 1BRGA 1I3IA 1CH0A 3SYUA 6RNTA 1RN1A 1RGLA
chains in the Genus database with same CATH superfamily
3H3HA 1IT7A 3U97A 1VQP3 4LYLB 4WWUC 3G6E3 1I0VA 2WO0A 3ER7A 3AGNA 4IPBA 3V98A 3DH2A 5ELJA 4ILFA 3OW22 3HX8A 1YI23 4GHOA 4HM5B 2Z76A 1BAOA 5CXOA 3Q3FA 3X40A 2IUJA 1QVG2 3CCJ3 1C7HA 1ISKA 4O2HA 2H0GA 1LVNA 2K0MA 1SQWA 3BLZA 3FKAA 1CQSA 4RNZA 3FF0A 1I0XA 1BRJA 8CHOA 4EYCA 3GZXB 2MC8A 2YFIB 2E2UA 2RGQA 4HM6B 5DREA 2WOHA 1QJGA 3CCL3 3JUMA 4J5GA 1VQ73 1BRNL 1HYFA 2CH9A 1D6YA 2I9WA 1MWTA 3D4AA 1US1A 3F8HA 1RRLA 3CCE3 4U13A 4MEIA 3V99A 2KCDA 4BL2A 5M1AA 3J7Yd 2P0MA 1B3SA 1TRPA 3CNMA 1BNRA 2GBWB 2W6JH 1KWIA 2CG0A 3D5GA 4PEJA 2CIUA 2IYJA 2GBXB 4XDVA 2F86B 1IT8A 4J9AA 1YGWA 2LQVA 1VZZA 1DETA 1JZOA 4HZBB 5JPUA 1DE3A 1RKYA 1JJ22 3D5IA 1RCLA 1X1YA 3T8NA 1BNGA 1GY6A 1A2VA 1R4YA 1RMSA 3S28A 5RNTA 1A2PA 3F8XA 2F4YA 1CEWI 1W6GA 1LQGC 1W5ZA 1M904 1NU3A 5IEOA 1JKGA 3X3YA 3X42A 4MMYB 1V74A 4HYZA 1IVUA 3EX9A 2WGOA 4EV5A 4CPKA 4HBRA 1BRIA 5IG4A 1NO3A 4GB5A 3UJMA 1V58A 2IUKA 3I0YA 2OWPA 1FGOA 1B2ZA 3N9HA 3TDGA 1ZS7A 1K734 2GU3A 3OWUA 2KF6A 4HM7B 1VQ63 2KAAA 4X2HA 1E3RA 2D42A 1V57A 3WODG 3F40A 2W9QA 1VQ43 3WR2A 5I97A 1QALA 3LZAA 3N8BA 3EQQB 1TP6A 4ZM8A 5IENA 3DXOA 1SARA 3F14A 3BNBA 1W4NA 3ROBA 1BNSA 1BANA 1TTOA 1OH0A 1IQXA 2HMLB 3EBTA 3EHCA 3HIIA 3Q1CA 3RNTA 4HKVB 3Q90A 4KT3B 5STDA 2QIYA 4OVMA 2OOVA 5EVHA 1Q40A 2Y73A 3NV0A 3I553 3JUNA 5IEPA 1OPYA 1BIRA 3FF2A 1RGEA 5AEUB 1IQYA 4STDA 2GXFA 1W2B2 3JUQA 1BNFA 1QMAA 4R1KA 2L1SA 1Q814 1E97A 4X2OA 1DMQA 3WMDA 1DYUA 1RGKA 4KFFA 1EA2A 1FGTA 3MG1A 1IU7A 3IMAB 3PGBA 1NDOB 3EN1B 3URPA 1B2XA 1TUHA 3NHXA 1IDPA 1NB3I 3LTCA 2SBLA 2CFDA 3NUVA 1UGIA 1ROVA 3F7XA 5AIGA 3K7CA 2IMJA 2OTL3 4EW5A 1I3IA 1CH0A 1DMNA 1RN1A 2OOVC 4O3VA 3S27A 1STDA 2HMMB 3U1WA 5M18A 1B27A 4FMAA 1WNHA 1FZUA 2CX0A 4CJNA 2H0IA 3IPTA 3AHWA 2HMKB 1VQQA 4FMCA 1PU4A 3NBJA 1FGMA 1G02A 1BGSA 2F5MA 3FG4A 1IK3A 2OQEA 3SVAA 3D3LA 3LMLA 4GL6A 5IG3A 4LEHA 3CCV3 1QAFA 2R41A 3EF8A 1FUSA 2FNQA 1KSIA 1I2FA 1O7GB 3LT8A 3RGRA 2UGIA 2P09A 3G713 2P05A 3G0KA 1W00A 3CD63 1JB2A 1LXEA 4EC6A 3CCS3 1YIJ3 2KF3A 2CKFB 3WA2X 1EKMA 5HGRA 1N9JA 1BSCA 1UCJA 4FCMA 1WMOA 1W6YA 2LYXA 2V1LA 1YIT3 3OX9A 2CG1A 3KFQC 2XSHB 1W6CA 1FGRA 1Q7HA 2M7OA 3DGMA 3S67A 2W0QA 1BUQA 1YVBI 5FW5A 1MGRA 1W7CA 3FCSB 3PS8A 3F9SA 4N6TA 1WQLB 2RCDA 1AY7A 3KIIA 3WOFB 5KP4A 1GOUA 3JUOA 1RN4A 4K61A 3AHSA 4XB5A 4R9LA 1GD4A 3KSED 5ELUA 5KP3A 2SARA 1GMPA 4BTWA 1BRKA 2CHCA 4AKZA 3DGNA 2F99A 3VSYA 3NBBA 2C10A 5CK6A 4BTYA 1GS3A 1N5PA 3S5CA 1OF5B 1TFOA 4J8TA 3A5EA 5AEWB 1BUJA 4XBYA 3HOHA 1UCKA 2OQEC 1LNIA 1UCIA 1UUVB 4HJLB 1FW7A 3MPHA 4RNYA 1STFI 2F56A 3GZBA 1YGEA 3M8CA 3DY5A 2PNCA 4LGQA 2ZHXB 3BNDA 3GSPA 3KKGA 3K0ZA 3X3XA 2UX0A 3FZWA 1VQO3 4JF8A 4MMZB 4R9KA 2BIRA 1Q9EA 2E2VA 3B4PA 1JB5A 1TFKA 2CK3H 3ZFZA 2XF3A 6GSPA 1UW1A 3B4OA 1IVVA 2ML5A 3DGYA 1N8R4 5CF1A 1OACA 4RZMA 1G0TA 3OXAA 3FG3A 1BSBA 4K1UA 3I563 2XFSA 4GSPA 3PCSA 1O7WB 3EN8A 3LT9A 4IT7A 1BU4A 4KVHA 1BSAA 2HMNB 2JQ5A 1C54A 4N6V0 1OHOA 1EEJA 1GMRA 1F8NA 2KXGA 3NXJA 2YFJB 1IV7A 2RFRA 3OWSA 4WFOA 2XR8B 1NB5I 1RGHA 4HM8B 3X3ZA 1IV9A 1OF5A 1OCVA 2XRXB 1JN5B 4XM4A 1JRQA 1I70A 3CME3 5KP1A 3GAXA 7STDA 2CC3A 5CLKA 1NNVA 1PFPA 2CW9A 4CDLA 3LTDA 1ZGXA 3MG3A 2BO9B 3K9MC 1M9GA 4HM4B 3S29A 1GY7A 2BMQB 3PCRA 3GZRA 1W02A 1VQL3 1M1K4 3EJVA 3GRDA 3JVCA 4KZ1A 2L4VA 1JKGB 3CXC2 1YJN3 2CWUA 2HMJB 2YX9A 2QEX3 1BOXA 1OGZA 5G1KA 4HAAA 2XSOB 4WYKA 5JBSA 2CFWA 3BIRA 3LTAA 2W56B 3HIGA 1VQK3 4I4KA 1A67A 1RGAA 1J2BA 3SOAA 3LOYA 3Q2PA 1GOYA 4RBNA 3STDA 1KD14 1L5GB 1AQZA 4G1MB 1OGXA 4BL3A 1CYVA 2Z7AA 2O9UX 3FGYA 3ALAA 1RGCA 4FMBA 5HOHA 1Q824 1LOXA 4ORLA 1N8QA 1Z1SA 1B2SA 2BHMA 7GSPA 3CC43 1O7NB 1QAKA 4IIAA 4N6MA 3FG1A 3WA3A 1AR0A 1I3FA 1LNHA 2KF4A 4K90B 3F7SA 4N6OB 2B1XB 3UL5A 5CF2A 4N6LA 1LOVA 3EE1A 3EC9A 1HKXA 4KFEA 3KN4A 1EG9B 1LOYA 3CPOA 4O02B 1GMQA 1K28A 3G16A 1RNBA 4AEQA 4KFDA 1VQ53 1T2IA 2BMRB 2HOHA 4CCVA 2BU4A 8RNTA 4OUQA 1LRAA 3AMOB 4R4KA 1B20A 1RHLA 2BT3A 1Q864 4JRFA 3KZTA 3CCR3 3IJEB 3CU3A 1JN5A 1M1XB 4FCJA 3WDGB 3E99A 4WHAA 3WHOA 3MWZA 4L7KA 1EUIC 3NQYA 2CWTA 3NQZA 2HMOB 4HM3B 3PXMA 1UI7A 1N9EA 3FLJA 1VQN3 4J5KA 2IA7A 4MJDA 1B2UA 1UCLA 1X1XA 5TGNA 3SX1A 4I5QA 1QVF2 2FGTA 5LC7A 3BU4A 4NREA 3UB1A 1OHSA 3B7CA 2GEXA 2AADA 1AVKA 2KRTA 5AI1A 3MG2A 1U8CB 4LSOA 1VQ83 3OV4A 4WP5A 3MYTA 1UI8A 2B24B 7RNTA 1MNLA 1PYLA 1RRHA 4AKYA 3A76A 3RDEA 1I2EA 2XFTA 1TJDA 1RSNA 1Y4KA 3CC23 3CCQ3 2Z6BA 5IG5A 1Q7Y4 2CFKA 1YHQ3 1JBRA 1SIIA 2A15A 3LH4A 5BIRA 1X1UA 5AIHA 1VQM3 1FA3A 3EB8A 5BXQA 3WOEB 1MWRA 3H51A 1K41A 1UDII 2YFLB 2GSPA 2J8XB 5D81A 3B8LA 4HM1B 5G2GA 4QWTA 2K54A 2Z77A 1IYYA 1ZO2A 2W03A 1FUTA 3AGOA 3BB9A 4N6UA 1MGWA 5BU4A 3CPW2 1K8A4 5AYSC 1FGQA 3QK9A 1BSEA 1RDSA 4N6NB 4H3UA 2JDIH 4LZIA 4MMXB 1GOVA 3PZWA 1JBTA 4R80A 2ML6A 3L0RA 2IY2A 1AV4A 1IVXA 3SXXA 2WGQA 3PYJA 4XBXA 6RNTA 2XGLA 4HZ9B 1RGLA 2P0XA 4Q53A 2XGNA 3DUKA 4NPBA 5DRVA 4HM2B 3CMA3 3OWYA 1BRHA 5AYRB 3KCHA 1CYUA 2FXTA 2CFGA 3NM2A 1YNVX 3NX0A 1ULIB 1DVCA 3CNXA 2C11A 1JBSA 2Q07A 1N5HA 2BMOB 3DM8A 2STDA 1BVIA 1FYSA 2CFLA 1YJW3 1K9M4 1A90A 1I8VA 2ZA4A 1O7HB 4HOHA 1RJOA 5JPPA 1T3BA 1BRSA 4L8OA 9RNTA 1PY3A 3HZPA 1GD3A 3RGAA 2P38A 1AVLA 1ZX2A 3CCU3 5AIIA 1VQ93 3KSPA 2RBIA 2W9PA 1MWUA 1O7MB 2F5WA 2R4IA 1ULJB 2E2TA 1RLSA 3SLUA 2WOFA 1T5YA 5A0OB 2MF7A 4BTXA 1KQS2 3LTBA 3QRDA 1I2GA 4EV2A 3HK4A 5EEOA 4BIRA 1T2HA 3T8UA 2W2CA 2PZVA 2AAEA 3EBYA 3T0UA 3VGNA 1ROAA 1LOWA 1B2MA 1X1WA 2CWVA 5IW9A 3LYGA 1JV2B 3GWRA 1S723 2OTJ3 1B21A 2XH9A 4L8PA 2UUGC 4DKIA 4TX4A 3AMOA 3UL6A 5IERA 2RNTA 2H0HA 1HZ1A 1BSDA 1GYBA 1BNIA 4O8SA 3SEDA 1G96A 2Y74A 1JNQA 1KC84 1E3VA 1RCKA 3DZLA 2W04A 4K1VA 4XDWA 1UUGB 1WMNA 1MWSA 1YVSA 1SJWA 2BNGA 3JUPA 2W56A 4EXRA 1R4CA 2C4BA 2CX1A 2GU1A 1BNJA 2O3OA 1YJ93 5IG0A 1BNEA 1TRQA 4RNTA 4EBGA 3SOYA 4FR9A 2F98A 1FUWA 1TIJA 5EQLA 1RN7A 3K63A 3MHEA 3DGOA 5D83A 2QGUA 2ZL8A 3KE7A 1UGHI 2ZDJA 3O8YA 5AIFA 1RNTA 3UNLA 3VF1A 4HVNA 1HU9A 1RTUA 1OHPA 3MSOA 1RGGA 4FCZA 1SIHA 1EQKA 3NM7A 1Q42A 3GZYB 3K5TA 2XEPA 1RGFA 1IQ8A 3D9RA 2INXA 3ZG0A 4WYKB 3BNCA 3BNEA 3FSDA 3NBRA 3CC73 1DVDA 1W2ZA 3G8ZA 1DMMA 1NWWA 1GY5A 5LC6A 1JZDA 5D82A 4XBTA 5FGOA 3ZG5A 1IVWA 1GSPA 1U5OA 3FH1A 5IF6A 3ECFA 5GSPA 2KF5A 2K3DA 4LMIA 1A2KA 4NHFA 3X41A 3HI7A 1LQMB 1Q40B 3NV0B 1D6ZA 1S5AA 2D1WA 3D79A 3LXUX 1O7PB 3G4S3 4BU4A 1JB4A 1WTHA 3DMCA 5BVBA 4OK0A 5M19A 2OCTA 1WMPA 3MKIA 1D6UA 1UUWB 5G1LA 4N3VA 4FMDA 2GEYA 6STDA 4HM0B 1SPUA 1OUNA 1BRGA 1TU5A 4H61A 1ASKA 1W01A 2RSXA 3CCM3 3SYUA 1NJI4 3V92A 2QA43 3N54B 1MOLA 3DGLA
chains in the Genus database with same CATH topology
1B27A 1BOXA 4HAAA 1FZUA 1I0VA 3AHWA 1BRHA 3AGNA 3BIRA 3DH2A 3KCHA 1YNVX 4GHOA 1RGAA 1BAOA 3Q3FA 1JBSA 1G02A 1BGSA 1GOYA 2F5MA 1AQZA 1BVIA 1FYSA 1I8VA 2ZA4A 4HOHA 1FUSA 1I0XA 1BRJA 1RGCA 1BRSA 1I2FA 9RNTA 5HOHA 7GSPA 1PY3A 1B2SA 1I3FA 4J5GA 2KF4A 2KF3A 1BRNL 1HYFA 2RBIA 1BSCA 1UCJA 2F5WA 1LOVA 3D4AA 1RLSA 1LOYA 1RNBA 1I2GA 1B3SA 1GMQA 1TRPA 1BNRA 1T2HA 3D5GA 1T2IA 2HOHA 1MGRA 2AAEA 1LOWA 2BU4A 1B2MA 8RNTA 1LRAA 1X1WA 1YGWA 1B20A 1DETA 1RHLA 1AY7A 1B21A 1DE3A 1GOUA 3D5IA 1RCLA 1RN4A 1X1YA 1BNGA 3AHSA 1R4YA 1RMSA 5RNTA 2RNTA 1A2PA 1GMPA 1HZ1A 1BRKA 1BSDA 1BNIA 2F4YA 2SARA 3WHOA 1RCKA 1YVSA 2C4BA 1BRIA 1BNJA 3A5EA 1BUJA 3HOHA 1UCKA 1BNEA 1LNIA 1TRQA 1UCIA 4J5KA 4RNTA 1B2UA 1UCLA 1B2ZA 1X1XA 1FW7A 3BU4A 2F56A 2AADA 2KF6A 2KAAA 3GSPA 7RNTA 1PYLA 1RNTA 3WR2A 2BIRA 1Q9EA 1I2EA 1RTUA 1RSNA 6GSPA 3DGYA 1RGGA 1JBRA 1SARA 5BIRA 1RGFA 1BSBA 1X1UA 1BNSA 1BANA 1TTOA 4GSPA 4BIRA 3RNTA 1BU4A 1GSPA 1BSAA 1C54A 1GMRA 2GSPA 1BIRA 5GSPA 1RGEA 2KF5A 1RGHA 1IYYA 1BNFA 1FUTA 3AGOA 1MGWA 1I70A 5BU4A 1RGKA 1BSEA 1RDSA 4BU4A 1ZGXA 3URPA 1GOVA 1B2XA 1JBTA 1BRGA 1I3IA 1CH0A 3SYUA 6RNTA 1RN1A 1RGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B27 A;  1BOX A;  4HAA A;  1FZU A;  1I0V A;  3AHW A;  1BRH A;  3AGN A;  3BIR A;  3DH2 A;  3KCH A;  1YNV X;  4GHO A;  1RGA A;  1BAO A;  3Q3F A;  1JBS A;  1G02 A;  1BGS A;  1GOY A;  2F5M A;  1AQZ A;  1BVI A;  1FYS A;  1I8V A;  2ZA4 A;  4HOH A;  1FUS A;  1I0X A;  1BRJ A;  1RGC A;  1BRS A;  1I2F A;  9RNT A;  5HOH A;  7GSP A;  1PY3 A;  1B2S A;  1I3F A;  4J5G A;  2KF4 A;  2KF3 A;  1BRN L;  1HYF A;  2RBI A;  1BSC A;  1UCJ A;  2F5W A;  1LOV A;  3D4A A;  1RLS A;  1LOY A;  1RNB A;  1I2G A;  1B3S A;  1GMQ A;  1TRP A;  1BNR A;  1T2H A;  3D5G A;  1T2I A;  2HOH A;  1MGR A;  2AAE A;  1LOW A;  2BU4 A;  1B2M A;  8RNT A;  1LRA A;  1X1W A;  1YGW A;  1B20 A;  1DET A;  1RHL A;  1AY7 A;  1B21 A;  1DE3 A;  1GOU A;  3D5I A;  1RCL A;  1RN4 A;  1X1Y A;  1BNG A;  3AHS A;  1R4Y A;  1RMS A;  5RNT A;  2RNT A;  1A2P A;  1GMP A;  1HZ1 A;  1BRK A;  1BSD A;  1BNI A;  2F4Y A;  2SAR A;  3WHO A;  1RCK A;  1YVS A;  2C4B A;  1BRI A;  1BNJ A;  3A5E A;  1BUJ A;  3HOH A;  1UCK A;  1BNE A;  1LNI A;  1TRQ A;  1UCI A;  4J5K A;  4RNT A;  1B2U A;  1UCL A;  1B2Z A;  1X1X A;  1FW7 A;  3BU4 A;  2F56 A;  2AAD A;  2KF6 A;  2KAA A;  3GSP A;  7RNT A;  1PYL A;  1RNT A;  3WR2 A;  2BIR A;  1Q9E A;  1I2E A;  1RTU A;  1RSN A;  6GSP A;  3DGY A;  1RGG A;  1JBR A;  1SAR A;  5BIR A;  1RGF A;  1BSB A;  1X1U A;  1BNS A;  1BAN A;  1TTO A;  4GSP A;  4BIR A;  3RNT A;  1BU4 A;  1GSP A;  1BSA A;  1C54 A;  1GMR A;  2GSP A;  1BIR A;  5GSP A;  1RGE A;  2KF5 A;  1RGH A;  1IYY A;  1BNF A;  1FUT A;  3AGO A;  1MGW A;  1I70 A;  5BU4 A;  1RGK A;  1BSE A;  1RDS A;  4BU4 A;  1ZGX A;  3URP A;  1GOV A;  1B2X A;  1JBT A;  1BRG A;  1I3I A;  1CH0 A;  3SYU A;  6RNT A;  1RN1 A;  1RGL A; 
#chains in the Genus database with same CATH topology
 3H3H A;  1IT7 A;  3U97 A;  1VQP 3;  4LYL B;  4WWU C;  3G6E 3;  1I0V A;  2WO0 A;  3ER7 A;  3AGN A;  4IPB A;  3V98 A;  3DH2 A;  5ELJ A;  4ILF A;  3OW2 2;  3HX8 A;  1YI2 3;  4GHO A;  4HM5 B;  2Z76 A;  1BAO A;  5CXO A;  3Q3F A;  3X40 A;  2IUJ A;  1QVG 2;  3CCJ 3;  1C7H A;  1ISK A;  4O2H A;  2H0G A;  1LVN A;  2K0M A;  1SQW A;  3BLZ A;  3FKA A;  1CQS A;  4RNZ A;  3FF0 A;  1I0X A;  1BRJ A;  8CHO A;  4EYC A;  3GZX B;  2MC8 A;  2YFI B;  2E2U A;  2RGQ A;  4HM6 B;  5DRE A;  2WOH A;  1QJG A;  3CCL 3;  3JUM A;  4J5G A;  1VQ7 3;  1BRN L;  1HYF A;  2CH9 A;  1D6Y A;  2I9W A;  1MWT A;  3D4A A;  1US1 A;  3F8H A;  1RRL A;  3CCE 3;  4U13 A;  4MEI A;  3V99 A;  2KCD A;  4BL2 A;  5M1A A;  3J7Y d;  2P0M A;  1B3S A;  1TRP A;  3CNM A;  1BNR A;  2GBW B;  2W6J H;  1KWI A;  2CG0 A;  3D5G A;  4PEJ A;  2CIU A;  2IYJ A;  2GBX B;  4XDV A;  2F86 B;  1IT8 A;  4J9A A;  1YGW A;  2LQV A;  1VZZ A;  1DET A;  1JZO A;  4HZB B;  5JPU A;  1DE3 A;  1RKY A;  1JJ2 2;  3D5I A;  1RCL A;  1X1Y A;  3T8N A;  1BNG A;  1GY6 A;  1A2V A;  1R4Y A;  1RMS A;  3S28 A;  5RNT A;  1A2P A;  3F8X A;  2F4Y A;  1CEW I;  1W6G A;  1LQG C;  1W5Z A;  1M90 4;  1NU3 A;  5IEO A;  1JKG A;  3X3Y A;  3X42 A;  4MMY B;  1V74 A;  4HYZ A;  1IVU A;  3EX9 A;  2WGO A;  4EV5 A;  4CPK A;  4HBR A;  1BRI A;  5IG4 A;  1NO3 A;  4GB5 A;  3UJM A;  1V58 A;  2IUK A;  3I0Y A;  2OWP A;  1FGO A;  1B2Z A;  3N9H A;  3TDG A;  1ZS7 A;  1K73 4;  2GU3 A;  3OWU A;  2KF6 A;  4HM7 B;  1VQ6 3;  2KAA A;  4X2H A;  1E3R A;  2D42 A;  1V57 A;  3WOD G;  3F40 A;  2W9Q A;  1VQ4 3;  3WR2 A;  5I97 A;  1QAL A;  3LZA A;  3N8B A;  3EQQ B;  1TP6 A;  4ZM8 A;  5IEN A;  3DXO A;  1SAR A;  3F14 A;  3BNB A;  1W4N A;  3ROB A;  1BNS A;  1BAN A;  1TTO A;  1OH0 A;  1IQX A;  2HML B;  3EBT A;  3EHC A;  3HII A;  3Q1C A;  3RNT A;  4HKV B;  3Q90 A;  4KT3 B;  5STD A;  2QIY A;  4OVM A;  2OOV A;  5EVH A;  1Q40 A;  2Y73 A;  3NV0 A;  3I55 3;  3JUN A;  5IEP A;  1OPY A;  1BIR A;  3FF2 A;  1RGE A;  5AEU B;  1IQY A;  4STD A;  2GXF A;  1W2B 2;  3JUQ A;  1BNF A;  1QMA A;  4R1K A;  2L1S A;  1Q81 4;  1E97 A;  4X2O A;  1DMQ A;  3WMD A;  1DYU A;  1RGK A;  4KFF A;  1EA2 A;  1FGT A;  3MG1 A;  1IU7 A;  3IMA B;  3PGB A;  1NDO B;  3EN1 B;  3URP A;  1B2X A;  1TUH A;  3NHX A;  1IDP A;  1NB3 I;  3LTC A;  2SBL A;  2CFD A;  3NUV A;  1UGI A;  1ROV A;  3F7X A;  5AIG A;  3K7C A;  2IMJ A;  2OTL 3;  4EW5 A;  1I3I A;  1CH0 A;  1DMN A;  1RN1 A;  2OOV C;  4O3V A;  3S27 A;  1STD A;  2HMM B;  3U1W A;  5M18 A;  1B27 A;  4FMA A;  1WNH A;  1FZU A;  2CX0 A;  4CJN A;  2H0I A;  3IPT A;  3AHW A;  2HMK B;  1VQQ A;  4FMC A;  1PU4 A;  3NBJ A;  1FGM A;  1G02 A;  1BGS A;  2F5M A;  3FG4 A;  1IK3 A;  2OQE A;  3SVA A;  3D3L A;  3LML A;  4GL6 A;  5IG3 A;  4LEH A;  3CCV 3;  1QAF A;  2R41 A;  3EF8 A;  1FUS A;  2FNQ A;  1KSI A;  1I2F A;  1O7G B;  3LT8 A;  3RGR A;  2UGI A;  2P09 A;  3G71 3;  2P05 A;  3G0K A;  1W00 A;  3CD6 3;  1JB2 A;  1LXE A;  4EC6 A;  3CCS 3;  1YIJ 3;  2KF3 A;  2CKF B;  3WA2 X;  1EKM A;  5HGR A;  1N9J A;  1BSC A;  1UCJ A;  4FCM A;  1WMO A;  1W6Y A;  2LYX A;  2V1L A;  1YIT 3;  3OX9 A;  2CG1 A;  3KFQ C;  2XSH B;  1W6C A;  1FGR A;  1Q7H A;  2M7O A;  3DGM A;  3S67 A;  2W0Q A;  1BUQ A;  1YVB I;  5FW5 A;  1MGR A;  1W7C A;  3FCS B;  3PS8 A;  3F9S A;  4N6T A;  1WQL B;  2RCD A;  1AY7 A;  3KII A;  3WOF B;  5KP4 A;  1GOU A;  3JUO A;  1RN4 A;  4K61 A;  3AHS A;  4XB5 A;  4R9L A;  1GD4 A;  3KSE D;  5ELU A;  5KP3 A;  2SAR A;  1GMP A;  4BTW A;  1BRK A;  2CHC A;  4AKZ A;  3DGN A;  2F99 A;  3VSY A;  3NBB A;  2C10 A;  5CK6 A;  4BTY A;  1GS3 A;  1N5P A;  3S5C A;  1OF5 B;  1TFO A;  4J8T A;  3A5E A;  5AEW B;  1BUJ A;  4XBY A;  3HOH A;  1UCK A;  2OQE C;  1LNI A;  1UCI A;  1UUV B;  4HJL B;  1FW7 A;  3MPH A;  4RNY A;  1STF I;  2F56 A;  3GZB A;  1YGE A;  3M8C A;  3DY5 A;  2PNC A;  4LGQ A;  2ZHX B;  3BND A;  3GSP A;  3KKG A;  3K0Z A;  3X3X A;  2UX0 A;  3FZW A;  1VQO 3;  4JF8 A;  4MMZ B;  4R9K A;  2BIR A;  1Q9E A;  2E2V A;  3B4P A;  1JB5 A;  1TFK A;  2CK3 H;  3ZFZ A;  2XF3 A;  6GSP A;  1UW1 A;  3B4O A;  1IVV A;  2ML5 A;  3DGY A;  1N8R 4;  5CF1 A;  1OAC A;  4RZM A;  1G0T A;  3OXA A;  3FG3 A;  1BSB A;  4K1U A;  3I56 3;  2XFS A;  4GSP A;  3PCS A;  1O7W B;  3EN8 A;  3LT9 A;  4IT7 A;  1BU4 A;  4KVH A;  1BSA A;  2HMN B;  2JQ5 A;  1C54 A;  4N6V 0;  1OHO A;  1EEJ A;  1GMR A;  1F8N A;  2KXG A;  3NXJ A;  2YFJ B;  1IV7 A;  2RFR A;  3OWS A;  4WFO A;  2XR8 B;  1NB5 I;  1RGH A;  4HM8 B;  3X3Z A;  1IV9 A;  1OF5 A;  1OCV A;  2XRX B;  1JN5 B;  4XM4 A;  1JRQ A;  1I70 A;  3CME 3;  5KP1 A;  3GAX A;  7STD A;  2CC3 A;  5CLK A;  1NNV A;  1PFP A;  2CW9 A;  4CDL A;  3LTD A;  1ZGX A;  3MG3 A;  2BO9 B;  3K9M C;  1M9G A;  4HM4 B;  3S29 A;  1GY7 A;  2BMQ B;  3PCR A;  3GZR A;  1W02 A;  1VQL 3;  1M1K 4;  3EJV A;  3GRD A;  3JVC A;  4KZ1 A;  2L4V A;  1JKG B;  3CXC 2;  1YJN 3;  2CWU A;  2HMJ B;  2YX9 A;  2QEX 3;  1BOX A;  1OGZ A;  5G1K A;  4HAA A;  2XSO B;  4WYK A;  5JBS A;  2CFW A;  3BIR A;  3LTA A;  2W56 B;  3HIG A;  1VQK 3;  4I4K A;  1A67 A;  1RGA A;  1J2B A;  3SOA A;  3LOY A;  3Q2P A;  1GOY A;  4RBN A;  3STD A;  1KD1 4;  1L5G B;  1AQZ A;  4G1M B;  1OGX A;  4BL3 A;  1CYV A;  2Z7A A;  2O9U X;  3FGY A;  3ALA A;  1RGC A;  4FMB A;  5HOH A;  1Q82 4;  1LOX A;  4ORL A;  1N8Q A;  1Z1S A;  1B2S A;  2BHM A;  7GSP A;  3CC4 3;  1O7N B;  1QAK A;  4IIA A;  4N6M A;  3FG1 A;  3WA3 A;  1AR0 A;  1I3F A;  1LNH A;  2KF4 A;  4K90 B;  3F7S A;  4N6O B;  2B1X B;  3UL5 A;  5CF2 A;  4N6L A;  1LOV A;  3EE1 A;  3EC9 A;  1HKX A;  4KFE A;  3KN4 A;  1EG9 B;  1LOY A;  3CPO A;  4O02 B;  1GMQ A;  1K28 A;  3G16 A;  1RNB A;  4AEQ A;  4KFD A;  1VQ5 3;  1T2I A;  2BMR B;  2HOH A;  4CCV A;  2BU4 A;  8RNT A;  4OUQ A;  1LRA A;  3AMO B;  4R4K A;  1B20 A;  1RHL A;  2BT3 A;  1Q86 4;  4JRF A;  3KZT A;  3CCR 3;  3IJE B;  3CU3 A;  1JN5 A;  1M1X B;  4FCJ A;  3WDG B;  3E99 A;  4WHA A;  3WHO A;  3MWZ A;  4L7K A;  1EUI C;  3NQY A;  2CWT A;  3NQZ A;  2HMO B;  4HM3 B;  3PXM A;  1UI7 A;  1N9E A;  3FLJ A;  1VQN 3;  4J5K A;  2IA7 A;  4MJD A;  1B2U A;  1UCL A;  1X1X A;  5TGN A;  3SX1 A;  4I5Q A;  1QVF 2;  2FGT A;  5LC7 A;  3BU4 A;  4NRE A;  3UB1 A;  1OHS A;  3B7C A;  2GEX A;  2AAD A;  1AVK A;  2KRT A;  5AI1 A;  3MG2 A;  1U8C B;  4LSO A;  1VQ8 3;  3OV4 A;  4WP5 A;  3MYT A;  1UI8 A;  2B24 B;  7RNT A;  1MNL A;  1PYL A;  1RRH A;  4AKY A;  3A76 A;  3RDE A;  1I2E A;  2XFT A;  1TJD A;  1RSN A;  1Y4K A;  3CC2 3;  3CCQ 3;  2Z6B A;  5IG5 A;  1Q7Y 4;  2CFK A;  1YHQ 3;  1JBR A;  1SII A;  2A15 A;  3LH4 A;  5BIR A;  1X1U A;  5AIH A;  1VQM 3;  1FA3 A;  3EB8 A;  5BXQ A;  3WOE B;  1MWR A;  3H51 A;  1K41 A;  1UDI I;  2YFL B;  2GSP A;  2J8X B;  5D81 A;  3B8L A;  4HM1 B;  5G2G A;  4QWT A;  2K54 A;  2Z77 A;  1IYY A;  1ZO2 A;  2W03 A;  1FUT A;  3AGO A;  3BB9 A;  4N6U A;  1MGW A;  5BU4 A;  3CPW 2;  1K8A 4;  5AYS C;  1FGQ A;  3QK9 A;  1BSE A;  1RDS A;  4N6N B;  4H3U A;  2JDI H;  4LZI A;  4MMX B;  1GOV A;  3PZW A;  1JBT A;  4R80 A;  2ML6 A;  3L0R A;  2IY2 A;  1AV4 A;  1IVX A;  3SXX A;  2WGQ A;  3PYJ A;  4XBX A;  6RNT A;  2XGL A;  4HZ9 B;  1RGL A;  2P0X A;  4Q53 A;  2XGN A;  3DUK A;  4NPB A;  5DRV A;  4HM2 B;  3CMA 3;  3OWY A;  1BRH A;  5AYR B;  3KCH A;  1CYU A;  2FXT A;  2CFG A;  3NM2 A;  1YNV X;  3NX0 A;  1ULI B;  1DVC A;  3CNX A;  2C11 A;  1JBS A;  2Q07 A;  1N5H A;  2BMO B;  3DM8 A;  2STD A;  1BVI A;  1FYS A;  2CFL A;  1YJW 3;  1K9M 4;  1A90 A;  1I8V A;  2ZA4 A;  1O7H B;  4HOH A;  1RJO A;  5JPP A;  1T3B A;  1BRS A;  4L8O A;  9RNT A;  1PY3 A;  3HZP A;  1GD3 A;  3RGA A;  2P38 A;  1AVL A;  1ZX2 A;  3CCU 3;  5AII A;  1VQ9 3;  3KSP A;  2RBI A;  2W9P A;  1MWU A;  1O7M B;  2F5W A;  2R4I A;  1ULJ B;  2E2T A;  1RLS A;  3SLU A;  2WOF A;  1T5Y A;  5A0O B;  2MF7 A;  4BTX A;  1KQS 2;  3LTB A;  3QRD A;  1I2G A;  4EV2 A;  3HK4 A;  5EEO A;  4BIR A;  1T2H A;  3T8U A;  2W2C A;  2PZV A;  2AAE A;  3EBY A;  3T0U A;  3VGN A;  1ROA A;  1LOW A;  1B2M A;  1X1W A;  2CWV A;  5IW9 A;  3LYG A;  1JV2 B;  3GWR A;  1S72 3;  2OTJ 3;  1B21 A;  2XH9 A;  4L8P A;  2UUG C;  4DKI A;  4TX4 A;  3AMO A;  3UL6 A;  5IER A;  2RNT A;  2H0H A;  1HZ1 A;  1BSD A;  1GYB A;  1BNI A;  4O8S A;  3SED A;  1G96 A;  2Y74 A;  1JNQ A;  1KC8 4;  1E3V A;  1RCK A;  3DZL A;  2W04 A;  4K1V A;  4XDW A;  1UUG B;  1WMN A;  1MWS A;  1YVS A;  1SJW A;  2BNG A;  3JUP A;  2W56 A;  4EXR A;  1R4C A;  2C4B A;  2CX1 A;  2GU1 A;  1BNJ A;  2O3O A;  1YJ9 3;  5IG0 A;  1BNE A;  1TRQ A;  4RNT A;  4EBG A;  3SOY A;  4FR9 A;  2F98 A;  1FUW A;  1TIJ A;  5EQL A;  1RN7 A;  3K63 A;  3MHE A;  3DGO A;  5D83 A;  2QGU A;  2ZL8 A;  3KE7 A;  1UGH I;  2ZDJ A;  3O8Y A;  5AIF A;  1RNT A;  3UNL A;  3VF1 A;  4HVN A;  1HU9 A;  1RTU A;  1OHP A;  3MSO A;  1RGG A;  4FCZ A;  1SIH A;  1EQK A;  3NM7 A;  1Q42 A;  3GZY B;  3K5T A;  2XEP A;  1RGF A;  1IQ8 A;  3D9R A;  2INX A;  3ZG0 A;  4WYK B;  3BNC A;  3BNE A;  3FSD A;  3NBR A;  3CC7 3;  1DVD A;  1W2Z A;  3G8Z A;  1DMM A;  1NWW A;  1GY5 A;  5LC6 A;  1JZD A;  5D82 A;  4XBT A;  5FGO A;  3ZG5 A;  1IVW A;  1GSP A;  1U5O A;  3FH1 A;  5IF6 A;  3ECF A;  5GSP A;  2KF5 A;  2K3D A;  4LMI A;  1A2K A;  4NHF A;  3X41 A;  3HI7 A;  1LQM B;  1Q40 B;  3NV0 B;  1D6Z A;  1S5A A;  2D1W A;  3D79 A;  3LXU X;  1O7P B;  3G4S 3;  4BU4 A;  1JB4 A;  1WTH A;  3DMC A;  5BVB A;  4OK0 A;  5M19 A;  2OCT A;  1WMP A;  3MKI A;  1D6U A;  1UUW B;  5G1L A;  4N3V A;  4FMD A;  2GEY A;  6STD A;  4HM0 B;  1SPU A;  1OUN A;  1BRG A;  1TU5 A;  4H61 A;  1ASK A;  1W01 A;  2RSX A;  3CCM 3;  3SYU A;  1NJI 4;  3V92 A;  2QA4 3;  3N54 B;  1MOL A;  3DGL A; 
#chains in the Genus database with same CATH homology
 1B27 A;  1BOX A;  4HAA A;  1FZU A;  1I0V A;  3AHW A;  1BRH A;  3AGN A;  3BIR A;  3DH2 A;  3KCH A;  1YNV X;  4GHO A;  1RGA A;  1BAO A;  3Q3F A;  1JBS A;  1G02 A;  1BGS A;  1GOY A;  2F5M A;  1AQZ A;  1BVI A;  1FYS A;  1I8V A;  2ZA4 A;  4HOH A;  1FUS A;  1I0X A;  1BRJ A;  1RGC A;  1BRS A;  1I2F A;  9RNT A;  5HOH A;  7GSP A;  1PY3 A;  1B2S A;  1I3F A;  4J5G A;  2KF4 A;  2KF3 A;  1BRN L;  1HYF A;  2RBI A;  1BSC A;  1UCJ A;  2F5W A;  1LOV A;  3D4A A;  1RLS A;  1LOY A;  1RNB A;  1I2G A;  1B3S A;  1GMQ A;  1TRP A;  1BNR A;  1T2H A;  3D5G A;  1T2I A;  2HOH A;  1MGR A;  2AAE A;  1LOW A;  2BU4 A;  1B2M A;  8RNT A;  1LRA A;  1X1W A;  1YGW A;  1B20 A;  1DET A;  1RHL A;  1AY7 A;  1B21 A;  1DE3 A;  1GOU A;  3D5I A;  1RCL A;  1RN4 A;  1X1Y A;  1BNG A;  3AHS A;  1R4Y A;  1RMS A;  5RNT A;  2RNT A;  1A2P A;  1GMP A;  1HZ1 A;  1BRK A;  1BSD A;  1BNI A;  2F4Y A;  2SAR A;  3WHO A;  1RCK A;  1YVS A;  2C4B A;  1BRI A;  1BNJ A;  3A5E A;  1BUJ A;  3HOH A;  1UCK A;  1BNE A;  1LNI A;  1TRQ A;  1UCI A;  4J5K A;  4RNT A;  1B2U A;  1UCL A;  1B2Z A;  1X1X A;  1FW7 A;  3BU4 A;  2F56 A;  2AAD A;  2KF6 A;  2KAA A;  3GSP A;  7RNT A;  1PYL A;  1RNT A;  3WR2 A;  2BIR A;  1Q9E A;  1I2E A;  1RTU A;  1RSN A;  6GSP A;  3DGY A;  1RGG A;  1JBR A;  1SAR A;  5BIR A;  1RGF A;  1BSB A;  1X1U A;  1BNS A;  1BAN A;  1TTO A;  4GSP A;  4BIR A;  3RNT A;  1BU4 A;  1GSP A;  1BSA A;  1C54 A;  1GMR A;  2GSP A;  1BIR A;  5GSP A;  1RGE A;  2KF5 A;  1RGH A;  1IYY A;  1BNF A;  1FUT A;  3AGO A;  1MGW A;  1I70 A;  5BU4 A;  1RGK A;  1BSE A;  1RDS A;  4BU4 A;  1ZGX A;  3URP A;  1GOV A;  1B2X A;  1JBT A;  1BRG A;  1I3I A;  1CH0 A;  3SYU A;  6RNT A;  1RN1 A;  1RGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...