1BUJA

Structure of binase in solution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
AVINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAEVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BINASE)
publication title Three-dimensional structure of binase in solution.
pubmed doi rcsb
source organism Bacillus intermedius
molecule tags Hydrolase
total genus 23
structure length 109
sequence length 109
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bujA00
2KF3A 4GSPA 1PY3A 1GOYA 4J5GA 2GSPA 1GOVA 1I3FA 1UCJA 1BSBA 3Q3FA 1RGHA 1FUSA 1UCLA 5BIRA 1FUTA 1BNIA 1RHLA 6RNTA 1RN4A 1BRHA 1BSEA 1BANA 1BVIA 1DE3A 1BAOA 2BIRA 1GOUA 1RGKA 1BRGA 2BU4A 1I8VA 1MGRA 1UCIA 1I0VA 1FZUA 1AQZA 1BSDA 1SARA 2F56A 1BOXA 4J5KA 1LOWA 1R4YA 8RNTA 1RNBA 1B2ZA 3BU4A 1JBRA 1DETA 3AGOA 1B2SA 2AADA 1B2MA 1B27A 1G02A 1RGGA 4RNTA 3D5IA 1RSNA 1TTOA 2AAEA 1BUJA 1RTUA 2KAAA 1BRJA 1LNIA 1PYLA 1RGLA 1I3IA 1CH0A 4HAAA 1TRPA 3URPA 5BU4A 1BRSA 1BNJA 1A2PA 1GMQA 1GMPA 2RBIA 3AHSA 2F5MA 2ZA4A 7RNTA 1RGCA 9RNTA 1BRNL 1T2IA 1I2FA 1LOVA 1RGFA 1I2GA 1BIRA 3DGYA 1BRIA 7GSPA 1MGWA 1C54A 1LRAA 2KF4A 1RN1A 1YNVX 4BIRA 1IYYA 1TRQA 1RMSA 1I70A 3A5EA 1JBTA 1ZGXA 1BSAA 2KF6A 3AGNA 1AY7A 1YGWA 1I0XA 1B2UA 4GHOA 3KCHA 1GSPA 3D5GA 3WR2A 1I2EA 1BNSA 3GSPA 1RCKA 1BGSA 2RNTA 1RNTA 1B20A 3RNTA 1BNGA 1HYFA 1BU4A 3SYUA 1FW7A 3HOHA 6GSPA 1BSCA 1BRKA 1YVSA 2KF5A 1BNRA 1LOYA 1UCKA 5RNTA 1BNEA 3DH2A 1BNFA 2HOHA 3WHOA 1X1XA 2F5WA 1B2XA 3BIRA 2F4YA 1JBSA 5GSPA 1T2HA 5HOHA 1RDSA 1Q9EA 1FYSA 1GMRA 4BU4A 1HZ1A 1RGAA 1B3SA 1RCLA 4HOHA 1RGEA 1RLSA 1X1YA 3AHWA 2SARA 1X1WA 2C4BA 1X1UA 1B21A 3D4AA
chains in the Genus database with same CATH superfamily
4GSPA 1Y4KA 1PY3A 5EQLA 3DGLA 3DGNA 1IVXA 1TFKA 2GSPA 3GZBA 4J5GA 3H51A 1RGHA 2GEXA 1N9JA 2K54A 1QAFA 4XB5A 1VQP3 1BNIA 2H0HA 3CCV3 1KWIA 2CWTA 1SPUA 3B7CA 5KP3A 1IVVA 1BSEA 1UUVB 3CU3A 1W5ZA 3K7CA 1TFOA 2BIRA 1NNVA 2ZDJA 4HM7B 1ULIB 1YIJ3 3BNBA 1MGRA 3X3ZA 4XM4A 1IQYA 1I0VA 1OGZA 1LVNA 4EV2A 3TDGA 1AQZA 1BSDA 2IYJA 2M7OA 4KFFA 3NUVA 4N3VA 1VQ43 4TX4A 3DZLA 5AIHA 3I553 1VQM3 2XFTA 1RNBA 1JN5A 1V74A 4ILFA 2RFRA 2CFGA 3SXXA 1JBRA 3X3XA 1E3RA 2D42A 1JRQA 3G4S3 1C7HA 3WDGB 1CQSA 2UUGC 5CF1A 2AADA 1B2MA 4HZBB 4EW5A 2I9WA 3FH1A 1YVBI 1RGGA 4O02B 2Y73A 2HMLB 1BUJA 5FW5A 2KAAA 3OWSA 3UL5A 1FA3A 1UGIA 1PYLA 3I563 1W4NA 3OX9A 1I3IA 1CH0A 4XBXA 4CJNA 3EB8A 2FNQA 3F8HA 2GBXB 3OWYA 1VQL3 1BRSA 5EEOA 1BNJA 1ULJB 1WQLB 1A2PA 1FGOA 5IG0A 2OTL3 1GMPA 2J8XB 4WYKB 5CF2A 3IJEB 7STDA 1ISKA 1KSIA 2QGUA 5M19A 1JB5A 3QRDA 3T0UA 2LQVA 1OCVA 3EF8A 1RJOA 4FMBA 3LH4A 4FR9A 7GSPA 1MGWA 4OVMA 4HM4B 1W2ZA 3CCQ3 2ZL8A 4HM3B 1KQS2 1FGQA 4EC6A 4I5QA 2CW9A 4OUQA 4K90B 3FCSB 3LZAA 1CYVA 1RRHA 2P0MA 1QMAA 1FUWA 2W6JH 1DMMA 1YGWA 1W6GA 3HZPA 3KN4A 1ZX2A 5M18A 4BTYA 1KD14 3AMOB 2GBWB 4HKVB 1B2UA 3EE1A 2CH9A 1QALA 1S723 5KP4A 3NXJA 3GSPA 3EN8A 1RCKA 2RNTA 1RNTA 2W56B 4LEHA 1EEJA 3PXMA 2KCDA 3K9MC 1IV7A 1W02A 3PCSA 4HM2B 4K1UA 1MWTA 5DREA 2BMQB 4N6LA 3VSYA 1BU4A 1A67A 3SYUA 3ECFA 1M1XB 2CX0A 3HOHA 2K0MA 1OHOA 3B8LA 2GXFA 1ZO2A 3FG3A 2C10A 1OF5A 1NB5I 3CPOA 4HM6B 2XH9A 1UCKA 3CXC2 2CG1A 1Q7HA 4N6UA 1BNFA 3VGNA 2JQ5A 1X1XA 2F5WA 2D1WA 1B2XA 1MWRA 2F4YA 2IY2A 1JBSA 1MOLA 5TGNA 2F98A 1UGHI 1K28A 1Q814 1FYSA 3T8UA 1OUNA 3CCU3 4IPBA 3G16A 1JB2A 1VQQA 1F8NA 3I0YA 4LGQA 2CFWA 2Z76A 1D6YA 1RGAA 1E3VA 3GWRA 4HOHA 4K1VA 1RLSA 3FG4A 3ROBA 3X40A 1X1YA 4J9AA 1Q40B 2C4BA 4O8SA 1X1UA 2A15A 1JZDA 2CX1A 4N6OB 1GOYA 1PFPA 4FCMA 2OTJ3 1EG9B 1N9EA 1GOVA 4EXRA 1BSBA 3RGRA 3KFQC 3F7XA 3LTCA 3LT9A 2V1LA 1EUIC 8CHOA 3JUMA 4BL2A 1BRHA 1YGEA 2WGOA 4Q53A 1FGMA 1BANA 1NU3A 3BNDA 3X42A 4CDLA 2IA7A 1DVDA 1GOUA 3CC73 1RN7A 1BRGA 2BU4A 3BNCA 4ZM8A 2QA43 1V58A 1DMNA 3V98A 1YI23 3JVCA 1FZUA 3SOAA 2E2VA 4J8TA 3Q2PA 1LOWA 5D83A 2MF7A 1Q824 1R4YA 5STDA 1GD4A 1LOXA 3GAXA 1J2BA 4LYLB 4N6TA 1W01A 1DETA 5A0OB 4WYKA 4EV5A 1K8A4 2F99A 3MHEA 5AI1A 3FF0A 2HMJB 2HMNB 3KIIA 4LZIA 3RGAA 3EX9A 2BO9B 1R4CA 2B24B 1LNHA 4RNTA 1N5PA 3B4OA 3KZTA 3NQZA 4RBNA 1IT7A 2STDA 3U97A 1GY5A 3MG2A 4CCVA 4BTWA 4RZMA 2Y74A 1VQ63 4HAAA 5AIFA 3EBTA 3URPA 2YX9A 4R4KA 4R1KA 3V92A 1GMQA 3AHSA 2RBIA 5AIGA 2F5MA 2WO0A 1US1A 7RNTA 3SVAA 2ML6A 4EYCA 3LYGA 3DM8A 4G1MB 3SOYA 3AMOA 3CCR3 1JKGB 1GYBA 1I2FA 1I2GA 1LOVA 1ROAA 2GU1A 1BRIA 4AKZA 1YJ93 1O7MB 5LC6A 1WNHA 4QWTA 1C54A 3E99A 3FGYA 4EBGA 1Z1SA 1VQ83 2W56A 1RMSA 1JBTA 1SQWA 1UI8A 1WMPA 4GB5A 2KF6A 1OGXA 3AGNA 3EJVA 2OQEA 4JRFA 1Q42A 1W6YA 3G6E3 2OQEC 1WTHA 3G713 3A76A 1LQMB 3VF1A 4FMCA 2UX0A 1GSPA 2KXGA 3JUQA 4FCJA 5G1LA 2O3OA 3CME3 1BGSA 2FGTA 1O7HB 3LTAA 3SX1A 3EC9A 1NWWA 2CFKA 4NREA 2P05A 3FSDA 3DGMA 1YHQ3 5IG3A 3LMLA 5D82A 3FG1A 1K41A 1BRKA 1Q40A 3KKGA 3S27A 1TU5A 1S5AA 1UUWB 2HMKB 2KRTA 3CD63 1ZS7A 2HOHA 3G8ZA 3PS8A 2XRXB 2GU3A 3PZWA 3K5TA 1IU7A 3FF2A 3O8YA 1FGRA 1IDPA 3CNMA 5M1AA 1T2HA 5HOHA 1RDSA 1Q9EA 1GMRA 4MMZB 5IG4A 2YFLB 3SLUA 3HK4A 4RNZA 5IENA 2INXA 2XR8B 2Z6BA 1OHPA 1JJ22 4U13A 2W2CA 5HGRA 4FCZA 1TUHA 3UNLA 3ZFZA 1OACA 2E2TA 3Q3FA 1FUSA 1UCLA 2CWVA 3RDEA 3HIGA 3WA3A 1FUTA 2HMOB 3CNXA 1RHLA 3JUOA 6RNTA 1RN4A 1ROVA 2FXTA 3N9HA 3UL6A 1E97A 1STFI 2RCDA 3B4PA 4WFOA 1W00A 1GY7A 2HMMB 1DE3A 1A2VA 3S29A 1RRLA 4LSOA 3ZG0A 5CXOA 1I8VA 3ALAA 4XBTA 1IQXA 3CCS3 3HIIA 1UCIA 2F56A 1JV2B 3NV0B 3OV4A 4R9LA 1BOXA 4J5KA 5ELUA 1QAKA 2L1SA 3BNEA 1EKMA 1GS3A 1NJI4 1YJN3 1B2ZA 5LC7A 5JPPA 1IK3A 1AV4A 3V99A 1VQO3 3H3HA 1B2SA 3CC43 3OWUA 1B27A 1SIHA 1O7GB 1JKGA 3D5IA 1TJDA 2AAEA 5AIIA 4H3UA 1RTUA 3NBJA 1BRJA 2CWUA 1LNIA 5BVBA 3G0KA 2Z77A 4MMXB 1RGLA 3D79A 2YFJB 1EA2A 1VQK3 3GZRA 1TRPA 2XEPA 1QVF2 1M9GA 2OWPA 2ZA4A 1NB3I 1VQ53 3MG1A 1RGCA 1CYUA 3EQQB 3CPW2 2LYXA 1AR0A 2H0GA 4CPKA 2W03A 9RNTA 1W6CA 1T2IA 2RGQA 4HZ9B 4BL3A 1RGFA 3DGYA 1BIRA 4L7KA 1WMOA 2SBLA 3NBRA 2KF4A 1RN1A 4BIRA 5IF6A 3PGBA 4IT7A 1AVLA 2K3DA 3F8XA 1K734 2IUJA 4X2HA 5IERA 4KVHA 3EHCA 5JBSA 3LXUX 3DY5A 1OH0A 1OHSA 2XGNA 3L0RA 4O2HA 1TP6A 4PEJA 2CKFB 3K63A 1U8CB 2XSHB 1N8R4 3GZXB 3KCHA 1MNLA 4N6V0 4WHAA 1MWUA 1I2EA 1BNSA 3WR2A 1Q7Y4 1QVG2 1U5OA 5AYRB 3GRDA 2F86B 1W2B2 4JF8A 4OK0A 3MSOA 3RNTA 3S5CA 1VQ93 4KFDA 4X2OA 2W9PA 2WOHA 1A90A 2C11A 1HYFA 3ER7A 3DUKA 4L8OA 1T3BA 3NQYA 3PCRA 2R4IA 4H61A 6GSPA 4I4KA 3Q1CA 2W04A 2Q07A 2MC8A 1YVSA 1BNRA 1M904 5RNTA 3UJMA 3DH2A 1ASKA 3EN1B 1MWSA 2CG0A 1FGTA 1YJW3 5JPUA 3BIRA 3D9RA 1DYUA 5GSPA 2P09A 3LTBA 2CFDA 1HKXA 5KP1A 4L8PA 4BU4A 1RKYA 3X3YA 2Z7AA 1YIT3 1HZ1A 1RCLA 1B3SA 1IV9A 4XBYA 1RGEA 2XFSA 3AHWA 3SEDA 1AVKA 5ELJA 4DKIA 4XDWA 1B21A 1BAOA 2W0QA 3STDA 2KF3A 2ZHXB 4HM5B 2PZVA 1K9M4 1UCJA 1I3FA 3NV0A 1G0TA 2BMOB 1KC84 5AEUB 5AYSC 1VQN3 5BIRA 2E2UA 2XGLA 4FMDA 1O7NB 3WMDA 3CCJ3 3N8BA 1IQ8A 3OXAA 1LQGC 1OPYA 1IT8A 1UW1A 2CHCA 2JDIH 2WGQA 3NX0A 5IEPA 4BTXA 1IVWA 2CFLA 1BVIA 1N8QA 2W9QA 4R80A 3WOEB 2QEX3 1O7WB 1RGKA 3JUPA 2R41A 4O3VA 2QIYA 3FKAA 4HM1B 1SJWA 5DRVA 1JB4A 1N5HA 2XSOB 3CCM3 3LT8A 3DMCA 4WP5A 5FGOA 4STDA 3X41A 5IG5A 1SARA 3J7Yd 2WOFA 5CK6A 1UDII 1O7PB 3MKIA 1D6UA 8RNTA 1VZZA 3BU4A 2OCTA 2UGIA 2IUKA 1L5GB 3AGOA 4KT3B 4MEIA 4XDVA 3U1WA 4KFEA 1G02A 2OOVA 3MPHA 2P0XA 1RSNA 3Q90A 3NM2A 1TTOA 3CCL3 3OW22 2OOVC 3EBYA 1CEWI 4RNYA 2IMJA 3S67A 2BNGA 1T5YA 2BHMA 2ML5A 3JUNA 5BU4A 1JN5B 1M1K4 3D3LA 3UB1A 3IMAB 1DVCA 3FLJA 5I97A 1STDA 3DXOA 4K61A 2CC3A 1BRNL 1D6ZA 3F7SA 5IEOA 1Q864 2CK3H 3FZWA 4MMYB 5G1KA 1DMQA 1JZOA 1W7CA 5BXQA 4HJLB 2YFIB 1LRAA 3F40A 1YNVX 3DGOA 1IYYA 1TRQA 2L4VA 5CLKA 1I70A 3A5EA 4N6NB 3LOYA 1IVUA 5EVHA 1ZGXA 3F14A 1BSAA 2XF3A 4LMIA 5AEWB 3MYTA 1AY7A 2O9UX 4KZ1A 4WWUC 5IW9A 1WMNA 1UI7A 1I0XA 1TIJA 2RSXA 3GZYB 3LTDA 3MG3A 4IIAA 4GHOA 3D5GA 1UUGB 1GY6A 4NHFA 3QK9A 4GL6A 1PU4A 3K0ZA 1NDOB 3BB9A 3KE7A 1SIIA 3HX8A 1B20A 1A2KA 3WA2X 3WODG 1BNGA 5D81A 4HM8B 4FMAA 4HVNA 1FW7A 6STDA 4AEQA 3BLZA 2CIUA 1BSCA 3KSED 3NBBA 2KF5A 1QJGA 3PYJA 1LOYA 3NHXA 1LXEA 1BNEA 1G96A 1HU9A 1VQ73 2BMRB 3WHOA 1JNQA 2GEYA 3N54B 2H0IA 3F9SA 1NO3A 3NM7A 4R9KA 4AKYA 4HBRA 2B1XB 2PNCA 5G2GA 3CMA3 2P38A 3WOFB 3CCE3 4MJDA 3CC23 1V57A 4HYZA 3T8NA 1BUQA 2BT3A 3M8CA 3IPTA 4ORLA 1EQKA 3ZG5A 2SARA 1OF5B 4HM0B 1X1WA 3KSPA 3MWZA 4N6MA 4NPBA 3S28A 1GD3A 3HI7A 3D4AA
chains in the Genus database with same CATH topology
2KF3A 4GSPA 1PY3A 1GOYA 4J5GA 2GSPA 1GOVA 1I3FA 1UCJA 1BSBA 3Q3FA 1RGHA 1FUSA 1UCLA 5BIRA 1FUTA 1BNIA 1RHLA 6RNTA 1RN4A 1BRHA 1BSEA 1BANA 1BVIA 1DE3A 1BAOA 2BIRA 1GOUA 1RGKA 1BRGA 2BU4A 1I8VA 1MGRA 1UCIA 1I0VA 1FZUA 1AQZA 1BSDA 1SARA 2F56A 1BOXA 4J5KA 1LOWA 1R4YA 8RNTA 1RNBA 1B2ZA 3BU4A 1JBRA 1DETA 3AGOA 1B2SA 2AADA 1B2MA 1B27A 1G02A 1RGGA 4RNTA 3D5IA 1RSNA 1TTOA 2AAEA 1BUJA 1RTUA 2KAAA 1BRJA 1LNIA 1PYLA 1RGLA 1I3IA 1CH0A 4HAAA 1TRPA 3URPA 5BU4A 1BRSA 1BNJA 1A2PA 1GMQA 1GMPA 2RBIA 3AHSA 2F5MA 2ZA4A 7RNTA 1RGCA 9RNTA 1BRNL 1T2IA 1I2FA 1LOVA 1RGFA 1I2GA 1BIRA 3DGYA 1BRIA 7GSPA 1MGWA 1C54A 1LRAA 2KF4A 1RN1A 1YNVX 4BIRA 1IYYA 1TRQA 1RMSA 1I70A 3A5EA 1JBTA 1ZGXA 1BSAA 2KF6A 3AGNA 1AY7A 1YGWA 1I0XA 1B2UA 4GHOA 3KCHA 1GSPA 3D5GA 3WR2A 1I2EA 1BNSA 3GSPA 1RCKA 1BGSA 2RNTA 1RNTA 1B20A 3RNTA 1BNGA 1HYFA 1BU4A 3SYUA 1FW7A 3HOHA 6GSPA 1BSCA 1BRKA 1YVSA 2KF5A 1BNRA 1LOYA 1UCKA 5RNTA 1BNEA 3DH2A 1BNFA 2HOHA 3WHOA 1X1XA 2F5WA 1B2XA 3BIRA 2F4YA 1JBSA 5GSPA 1T2HA 5HOHA 1RDSA 1Q9EA 1FYSA 1GMRA 4BU4A 1HZ1A 1RGAA 1B3SA 1RCLA 4HOHA 1RGEA 1RLSA 1X1YA 3AHWA 2SARA 1X1WA 2C4BA 1X1UA 1B21A 3D4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KF3 A;  4GSP A;  1PY3 A;  1GOY A;  4J5G A;  2GSP A;  1GOV A;  1I3F A;  1UCJ A;  1BSB A;  3Q3F A;  1RGH A;  1FUS A;  1UCL A;  5BIR A;  1FUT A;  1BNI A;  1RHL A;  6RNT A;  1RN4 A;  1BRH A;  1BSE A;  1BAN A;  1BVI A;  1DE3 A;  1BAO A;  2BIR A;  1GOU A;  1RGK A;  1BRG A;  2BU4 A;  1I8V A;  1MGR A;  1UCI A;  1I0V A;  1FZU A;  1AQZ A;  1BSD A;  1SAR A;  2F56 A;  1BOX A;  4J5K A;  1LOW A;  1R4Y A;  8RNT A;  1RNB A;  1B2Z A;  3BU4 A;  1JBR A;  1DET A;  3AGO A;  1B2S A;  2AAD A;  1B2M A;  1B27 A;  1G02 A;  1RGG A;  4RNT A;  3D5I A;  1RSN A;  1TTO A;  2AAE A;  1BUJ A;  1RTU A;  2KAA A;  1BRJ A;  1LNI A;  1PYL A;  1RGL A;  1I3I A;  1CH0 A;  4HAA A;  1TRP A;  3URP A;  5BU4 A;  1BRS A;  1BNJ A;  1A2P A;  1GMQ A;  1GMP A;  2RBI A;  3AHS A;  2F5M A;  2ZA4 A;  7RNT A;  1RGC A;  9RNT A;  1BRN L;  1T2I A;  1I2F A;  1LOV A;  1RGF A;  1I2G A;  1BIR A;  3DGY A;  1BRI A;  7GSP A;  1MGW A;  1C54 A;  1LRA A;  2KF4 A;  1RN1 A;  1YNV X;  4BIR A;  1IYY A;  1TRQ A;  1RMS A;  1I70 A;  3A5E A;  1JBT A;  1ZGX A;  1BSA A;  2KF6 A;  3AGN A;  1AY7 A;  1YGW A;  1I0X A;  1B2U A;  4GHO A;  3KCH A;  1GSP A;  3D5G A;  3WR2 A;  1I2E A;  1BNS A;  3GSP A;  1RCK A;  1BGS A;  2RNT A;  1RNT A;  1B20 A;  3RNT A;  1BNG A;  1HYF A;  1BU4 A;  3SYU A;  1FW7 A;  3HOH A;  6GSP A;  1BSC A;  1BRK A;  1YVS A;  2KF5 A;  1BNR A;  1LOY A;  1UCK A;  5RNT A;  1BNE A;  3DH2 A;  1BNF A;  2HOH A;  3WHO A;  1X1X A;  2F5W A;  1B2X A;  3BIR A;  2F4Y A;  1JBS A;  5GSP A;  1T2H A;  5HOH A;  1RDS A;  1Q9E A;  1FYS A;  1GMR A;  4BU4 A;  1HZ1 A;  1RGA A;  1B3S A;  1RCL A;  4HOH A;  1RGE A;  1RLS A;  1X1Y A;  3AHW A;  2SAR A;  1X1W A;  2C4B A;  1X1U A;  1B21 A;  3D4A A; 
#chains in the Genus database with same CATH topology
 4GSP A;  1Y4K A;  1PY3 A;  5EQL A;  3DGL A;  3DGN A;  1IVX A;  1TFK A;  2GSP A;  3GZB A;  4J5G A;  3H51 A;  1RGH A;  2GEX A;  1N9J A;  2K54 A;  1QAF A;  4XB5 A;  1VQP 3;  1BNI A;  2H0H A;  3CCV 3;  1KWI A;  2CWT A;  1SPU A;  3B7C A;  5KP3 A;  1IVV A;  1BSE A;  1UUV B;  3CU3 A;  1W5Z A;  3K7C A;  1TFO A;  2BIR A;  1NNV A;  2ZDJ A;  4HM7 B;  1ULI B;  1YIJ 3;  3BNB A;  1MGR A;  3X3Z A;  4XM4 A;  1IQY A;  1I0V A;  1OGZ A;  1LVN A;  4EV2 A;  3TDG A;  1AQZ A;  1BSD A;  2IYJ A;  2M7O A;  4KFF A;  3NUV A;  4N3V A;  1VQ4 3;  4TX4 A;  3DZL A;  5AIH A;  3I55 3;  1VQM 3;  2XFT A;  1RNB A;  1JN5 A;  1V74 A;  4ILF A;  2RFR A;  2CFG A;  3SXX A;  1JBR A;  3X3X A;  1E3R A;  2D42 A;  1JRQ A;  3G4S 3;  1C7H A;  3WDG B;  1CQS A;  2UUG C;  5CF1 A;  2AAD A;  1B2M A;  4HZB B;  4EW5 A;  2I9W A;  3FH1 A;  1YVB I;  1RGG A;  4O02 B;  2Y73 A;  2HML B;  1BUJ A;  5FW5 A;  2KAA A;  3OWS A;  3UL5 A;  1FA3 A;  1UGI A;  1PYL A;  3I56 3;  1W4N A;  3OX9 A;  1I3I A;  1CH0 A;  4XBX A;  4CJN A;  3EB8 A;  2FNQ A;  3F8H A;  2GBX B;  3OWY A;  1VQL 3;  1BRS A;  5EEO A;  1BNJ A;  1ULJ B;  1WQL B;  1A2P A;  1FGO A;  5IG0 A;  2OTL 3;  1GMP A;  2J8X B;  4WYK B;  5CF2 A;  3IJE B;  7STD A;  1ISK A;  1KSI A;  2QGU A;  5M19 A;  1JB5 A;  3QRD A;  3T0U A;  2LQV A;  1OCV A;  3EF8 A;  1RJO A;  4FMB A;  3LH4 A;  4FR9 A;  7GSP A;  1MGW A;  4OVM A;  4HM4 B;  1W2Z A;  3CCQ 3;  2ZL8 A;  4HM3 B;  1KQS 2;  1FGQ A;  4EC6 A;  4I5Q A;  2CW9 A;  4OUQ A;  4K90 B;  3FCS B;  3LZA A;  1CYV A;  1RRH A;  2P0M A;  1QMA A;  1FUW A;  2W6J H;  1DMM A;  1YGW A;  1W6G A;  3HZP A;  3KN4 A;  1ZX2 A;  5M18 A;  4BTY A;  1KD1 4;  3AMO B;  2GBW B;  4HKV B;  1B2U A;  3EE1 A;  2CH9 A;  1QAL A;  1S72 3;  5KP4 A;  3NXJ A;  3GSP A;  3EN8 A;  1RCK A;  2RNT A;  1RNT A;  2W56 B;  4LEH A;  1EEJ A;  3PXM A;  2KCD A;  3K9M C;  1IV7 A;  1W02 A;  3PCS A;  4HM2 B;  4K1U A;  1MWT A;  5DRE A;  2BMQ B;  4N6L A;  3VSY A;  1BU4 A;  1A67 A;  3SYU A;  3ECF A;  1M1X B;  2CX0 A;  3HOH A;  2K0M A;  1OHO A;  3B8L A;  2GXF A;  1ZO2 A;  3FG3 A;  2C10 A;  1OF5 A;  1NB5 I;  3CPO A;  4HM6 B;  2XH9 A;  1UCK A;  3CXC 2;  2CG1 A;  1Q7H A;  4N6U A;  1BNF A;  3VGN A;  2JQ5 A;  1X1X A;  2F5W A;  2D1W A;  1B2X A;  1MWR A;  2F4Y A;  2IY2 A;  1JBS A;  1MOL A;  5TGN A;  2F98 A;  1UGH I;  1K28 A;  1Q81 4;  1FYS A;  3T8U A;  1OUN A;  3CCU 3;  4IPB A;  3G16 A;  1JB2 A;  1VQQ A;  1F8N A;  3I0Y A;  4LGQ A;  2CFW A;  2Z76 A;  1D6Y A;  1RGA A;  1E3V A;  3GWR A;  4HOH A;  4K1V A;  1RLS A;  3FG4 A;  3ROB A;  3X40 A;  1X1Y A;  4J9A A;  1Q40 B;  2C4B A;  4O8S A;  1X1U A;  2A15 A;  1JZD A;  2CX1 A;  4N6O B;  1GOY A;  1PFP A;  4FCM A;  2OTJ 3;  1EG9 B;  1N9E A;  1GOV A;  4EXR A;  1BSB A;  3RGR A;  3KFQ C;  3F7X A;  3LTC A;  3LT9 A;  2V1L A;  1EUI C;  8CHO A;  3JUM A;  4BL2 A;  1BRH A;  1YGE A;  2WGO A;  4Q53 A;  1FGM A;  1BAN A;  1NU3 A;  3BND A;  3X42 A;  4CDL A;  2IA7 A;  1DVD A;  1GOU A;  3CC7 3;  1RN7 A;  1BRG A;  2BU4 A;  3BNC A;  4ZM8 A;  2QA4 3;  1V58 A;  1DMN A;  3V98 A;  1YI2 3;  3JVC A;  1FZU A;  3SOA A;  2E2V A;  4J8T A;  3Q2P A;  1LOW A;  5D83 A;  2MF7 A;  1Q82 4;  1R4Y A;  5STD A;  1GD4 A;  1LOX A;  3GAX A;  1J2B A;  4LYL B;  4N6T A;  1W01 A;  1DET A;  5A0O B;  4WYK A;  4EV5 A;  1K8A 4;  2F99 A;  3MHE A;  5AI1 A;  3FF0 A;  2HMJ B;  2HMN B;  3KII A;  4LZI A;  3RGA A;  3EX9 A;  2BO9 B;  1R4C A;  2B24 B;  1LNH A;  4RNT A;  1N5P A;  3B4O A;  3KZT A;  3NQZ A;  4RBN A;  1IT7 A;  2STD A;  3U97 A;  1GY5 A;  3MG2 A;  4CCV A;  4BTW A;  4RZM A;  2Y74 A;  1VQ6 3;  4HAA A;  5AIF A;  3EBT A;  3URP A;  2YX9 A;  4R4K A;  4R1K A;  3V92 A;  1GMQ A;  3AHS A;  2RBI A;  5AIG A;  2F5M A;  2WO0 A;  1US1 A;  7RNT A;  3SVA A;  2ML6 A;  4EYC A;  3LYG A;  3DM8 A;  4G1M B;  3SOY A;  3AMO A;  3CCR 3;  1JKG B;  1GYB A;  1I2F A;  1I2G A;  1LOV A;  1ROA A;  2GU1 A;  1BRI A;  4AKZ A;  1YJ9 3;  1O7M B;  5LC6 A;  1WNH A;  4QWT A;  1C54 A;  3E99 A;  3FGY A;  4EBG A;  1Z1S A;  1VQ8 3;  2W56 A;  1RMS A;  1JBT A;  1SQW A;  1UI8 A;  1WMP A;  4GB5 A;  2KF6 A;  1OGX A;  3AGN A;  3EJV A;  2OQE A;  4JRF A;  1Q42 A;  1W6Y A;  3G6E 3;  2OQE C;  1WTH A;  3G71 3;  3A76 A;  1LQM B;  3VF1 A;  4FMC A;  2UX0 A;  1GSP A;  2KXG A;  3JUQ A;  4FCJ A;  5G1L A;  2O3O A;  3CME 3;  1BGS A;  2FGT A;  1O7H B;  3LTA A;  3SX1 A;  3EC9 A;  1NWW A;  2CFK A;  4NRE A;  2P05 A;  3FSD A;  3DGM A;  1YHQ 3;  5IG3 A;  3LML A;  5D82 A;  3FG1 A;  1K41 A;  1BRK A;  1Q40 A;  3KKG A;  3S27 A;  1TU5 A;  1S5A A;  1UUW B;  2HMK B;  2KRT A;  3CD6 3;  1ZS7 A;  2HOH A;  3G8Z A;  3PS8 A;  2XRX B;  2GU3 A;  3PZW A;  3K5T A;  1IU7 A;  3FF2 A;  3O8Y A;  1FGR A;  1IDP A;  3CNM A;  5M1A A;  1T2H A;  5HOH A;  1RDS A;  1Q9E A;  1GMR A;  4MMZ B;  5IG4 A;  2YFL B;  3SLU A;  3HK4 A;  4RNZ A;  5IEN A;  2INX A;  2XR8 B;  2Z6B A;  1OHP A;  1JJ2 2;  4U13 A;  2W2C A;  5HGR A;  4FCZ A;  1TUH A;  3UNL A;  3ZFZ A;  1OAC A;  2E2T A;  3Q3F A;  1FUS A;  1UCL A;  2CWV A;  3RDE A;  3HIG A;  3WA3 A;  1FUT A;  2HMO B;  3CNX A;  1RHL A;  3JUO A;  6RNT A;  1RN4 A;  1ROV A;  2FXT A;  3N9H A;  3UL6 A;  1E97 A;  1STF I;  2RCD A;  3B4P A;  4WFO A;  1W00 A;  1GY7 A;  2HMM B;  1DE3 A;  1A2V A;  3S29 A;  1RRL A;  4LSO A;  3ZG0 A;  5CXO A;  1I8V A;  3ALA A;  4XBT A;  1IQX A;  3CCS 3;  3HII A;  1UCI A;  2F56 A;  1JV2 B;  3NV0 B;  3OV4 A;  4R9L A;  1BOX A;  4J5K A;  5ELU A;  1QAK A;  2L1S A;  3BNE A;  1EKM A;  1GS3 A;  1NJI 4;  1YJN 3;  1B2Z A;  5LC7 A;  5JPP A;  1IK3 A;  1AV4 A;  3V99 A;  1VQO 3;  3H3H A;  1B2S A;  3CC4 3;  3OWU A;  1B27 A;  1SIH A;  1O7G B;  1JKG A;  3D5I A;  1TJD A;  2AAE A;  5AII A;  4H3U A;  1RTU A;  3NBJ A;  1BRJ A;  2CWU A;  1LNI A;  5BVB A;  3G0K A;  2Z77 A;  4MMX B;  1RGL A;  3D79 A;  2YFJ B;  1EA2 A;  1VQK 3;  3GZR A;  1TRP A;  2XEP A;  1QVF 2;  1M9G A;  2OWP A;  2ZA4 A;  1NB3 I;  1VQ5 3;  3MG1 A;  1RGC A;  1CYU A;  3EQQ B;  3CPW 2;  2LYX A;  1AR0 A;  2H0G A;  4CPK A;  2W03 A;  9RNT A;  1W6C A;  1T2I A;  2RGQ A;  4HZ9 B;  4BL3 A;  1RGF A;  3DGY A;  1BIR A;  4L7K A;  1WMO A;  2SBL A;  3NBR A;  2KF4 A;  1RN1 A;  4BIR A;  5IF6 A;  3PGB A;  4IT7 A;  1AVL A;  2K3D A;  3F8X A;  1K73 4;  2IUJ A;  4X2H A;  5IER A;  4KVH A;  3EHC A;  5JBS A;  3LXU X;  3DY5 A;  1OH0 A;  1OHS A;  2XGN A;  3L0R A;  4O2H A;  1TP6 A;  4PEJ A;  2CKF B;  3K63 A;  1U8C B;  2XSH B;  1N8R 4;  3GZX B;  3KCH A;  1MNL A;  4N6V 0;  4WHA A;  1MWU A;  1I2E A;  1BNS A;  3WR2 A;  1Q7Y 4;  1QVG 2;  1U5O A;  5AYR B;  3GRD A;  2F86 B;  1W2B 2;  4JF8 A;  4OK0 A;  3MSO A;  3RNT A;  3S5C A;  1VQ9 3;  4KFD A;  4X2O A;  2W9P A;  2WOH A;  1A90 A;  2C11 A;  1HYF A;  3ER7 A;  3DUK A;  4L8O A;  1T3B A;  3NQY A;  3PCR A;  2R4I A;  4H61 A;  6GSP A;  4I4K A;  3Q1C A;  2W04 A;  2Q07 A;  2MC8 A;  1YVS A;  1BNR A;  1M90 4;  5RNT A;  3UJM A;  3DH2 A;  1ASK A;  3EN1 B;  1MWS A;  2CG0 A;  1FGT A;  1YJW 3;  5JPU A;  3BIR A;  3D9R A;  1DYU A;  5GSP A;  2P09 A;  3LTB A;  2CFD A;  1HKX A;  5KP1 A;  4L8P A;  4BU4 A;  1RKY A;  3X3Y A;  2Z7A A;  1YIT 3;  1HZ1 A;  1RCL A;  1B3S A;  1IV9 A;  4XBY A;  1RGE A;  2XFS A;  3AHW A;  3SED A;  1AVK A;  5ELJ A;  4DKI A;  4XDW A;  1B21 A;  1BAO A;  2W0Q A;  3STD A;  2KF3 A;  2ZHX B;  4HM5 B;  2PZV A;  1K9M 4;  1UCJ A;  1I3F A;  3NV0 A;  1G0T A;  2BMO B;  1KC8 4;  5AEU B;  5AYS C;  1VQN 3;  5BIR A;  2E2U A;  2XGL A;  4FMD A;  1O7N B;  3WMD A;  3CCJ 3;  3N8B A;  1IQ8 A;  3OXA A;  1LQG C;  1OPY A;  1IT8 A;  1UW1 A;  2CHC A;  2JDI H;  2WGQ A;  3NX0 A;  5IEP A;  4BTX A;  1IVW A;  2CFL A;  1BVI A;  1N8Q A;  2W9Q A;  4R80 A;  3WOE B;  2QEX 3;  1O7W B;  1RGK A;  3JUP A;  2R41 A;  4O3V A;  2QIY A;  3FKA A;  4HM1 B;  1SJW A;  5DRV A;  1JB4 A;  1N5H A;  2XSO B;  3CCM 3;  3LT8 A;  3DMC A;  4WP5 A;  5FGO A;  4STD A;  3X41 A;  5IG5 A;  1SAR A;  3J7Y d;  2WOF A;  5CK6 A;  1UDI I;  1O7P B;  3MKI A;  1D6U A;  8RNT A;  1VZZ A;  3BU4 A;  2OCT A;  2UGI A;  2IUK A;  1L5G B;  3AGO A;  4KT3 B;  4MEI A;  4XDV A;  3U1W A;  4KFE A;  1G02 A;  2OOV A;  3MPH A;  2P0X A;  1RSN A;  3Q90 A;  3NM2 A;  1TTO A;  3CCL 3;  3OW2 2;  2OOV C;  3EBY A;  1CEW I;  4RNY A;  2IMJ A;  3S67 A;  2BNG A;  1T5Y A;  2BHM A;  2ML5 A;  3JUN A;  5BU4 A;  1JN5 B;  1M1K 4;  3D3L A;  3UB1 A;  3IMA B;  1DVC A;  3FLJ A;  5I97 A;  1STD A;  3DXO A;  4K61 A;  2CC3 A;  1BRN L;  1D6Z A;  3F7S A;  5IEO A;  1Q86 4;  2CK3 H;  3FZW A;  4MMY B;  5G1K A;  1DMQ A;  1JZO A;  1W7C A;  5BXQ A;  4HJL B;  2YFI B;  1LRA A;  3F40 A;  1YNV X;  3DGO A;  1IYY A;  1TRQ A;  2L4V A;  5CLK A;  1I70 A;  3A5E A;  4N6N B;  3LOY A;  1IVU A;  5EVH A;  1ZGX A;  3F14 A;  1BSA A;  2XF3 A;  4LMI A;  5AEW B;  3MYT A;  1AY7 A;  2O9U X;  4KZ1 A;  4WWU C;  5IW9 A;  1WMN A;  1UI7 A;  1I0X A;  1TIJ A;  2RSX A;  3GZY B;  3LTD A;  3MG3 A;  4IIA A;  4GHO A;  3D5G A;  1UUG B;  1GY6 A;  4NHF A;  3QK9 A;  4GL6 A;  1PU4 A;  3K0Z A;  1NDO B;  3BB9 A;  3KE7 A;  1SII A;  3HX8 A;  1B20 A;  1A2K A;  3WA2 X;  3WOD G;  1BNG A;  5D81 A;  4HM8 B;  4FMA A;  4HVN A;  1FW7 A;  6STD A;  4AEQ A;  3BLZ A;  2CIU A;  1BSC A;  3KSE D;  3NBB A;  2KF5 A;  1QJG A;  3PYJ A;  1LOY A;  3NHX A;  1LXE A;  1BNE A;  1G96 A;  1HU9 A;  1VQ7 3;  2BMR B;  3WHO A;  1JNQ A;  2GEY A;  3N54 B;  2H0I A;  3F9S A;  1NO3 A;  3NM7 A;  4R9K A;  4AKY A;  4HBR A;  2B1X B;  2PNC A;  5G2G A;  3CMA 3;  2P38 A;  3WOF B;  3CCE 3;  4MJD A;  3CC2 3;  1V57 A;  4HYZ A;  3T8N A;  1BUQ A;  2BT3 A;  3M8C A;  3IPT A;  4ORL A;  1EQK A;  3ZG5 A;  2SAR A;  1OF5 B;  4HM0 B;  1X1W A;  3KSP A;  3MWZ A;  4N6M A;  4NPB A;  3S28 A;  1GD3 A;  3HI7 A;  3D4A A; 
#chains in the Genus database with same CATH homology
 2KF3 A;  4GSP A;  1PY3 A;  1GOY A;  4J5G A;  2GSP A;  1GOV A;  1I3F A;  1UCJ A;  1BSB A;  3Q3F A;  1RGH A;  1FUS A;  1UCL A;  5BIR A;  1FUT A;  1BNI A;  1RHL A;  6RNT A;  1RN4 A;  1BRH A;  1BSE A;  1BAN A;  1BVI A;  1DE3 A;  1BAO A;  2BIR A;  1GOU A;  1RGK A;  1BRG A;  2BU4 A;  1I8V A;  1MGR A;  1UCI A;  1I0V A;  1FZU A;  1AQZ A;  1BSD A;  1SAR A;  2F56 A;  1BOX A;  4J5K A;  1LOW A;  1R4Y A;  8RNT A;  1RNB A;  1B2Z A;  3BU4 A;  1JBR A;  1DET A;  3AGO A;  1B2S A;  2AAD A;  1B2M A;  1B27 A;  1G02 A;  1RGG A;  4RNT A;  3D5I A;  1RSN A;  1TTO A;  2AAE A;  1BUJ A;  1RTU A;  2KAA A;  1BRJ A;  1LNI A;  1PYL A;  1RGL A;  1I3I A;  1CH0 A;  4HAA A;  1TRP A;  3URP A;  5BU4 A;  1BRS A;  1BNJ A;  1A2P A;  1GMQ A;  1GMP A;  2RBI A;  3AHS A;  2F5M A;  2ZA4 A;  7RNT A;  1RGC A;  9RNT A;  1BRN L;  1T2I A;  1I2F A;  1LOV A;  1RGF A;  1I2G A;  1BIR A;  3DGY A;  1BRI A;  7GSP A;  1MGW A;  1C54 A;  1LRA A;  2KF4 A;  1RN1 A;  1YNV X;  4BIR A;  1IYY A;  1TRQ A;  1RMS A;  1I70 A;  3A5E A;  1JBT A;  1ZGX A;  1BSA A;  2KF6 A;  3AGN A;  1AY7 A;  1YGW A;  1I0X A;  1B2U A;  4GHO A;  3KCH A;  1GSP A;  3D5G A;  3WR2 A;  1I2E A;  1BNS A;  3GSP A;  1RCK A;  1BGS A;  2RNT A;  1RNT A;  1B20 A;  3RNT A;  1BNG A;  1HYF A;  1BU4 A;  3SYU A;  1FW7 A;  3HOH A;  6GSP A;  1BSC A;  1BRK A;  1YVS A;  2KF5 A;  1BNR A;  1LOY A;  1UCK A;  5RNT A;  1BNE A;  3DH2 A;  1BNF A;  2HOH A;  3WHO A;  1X1X A;  2F5W A;  1B2X A;  3BIR A;  2F4Y A;  1JBS A;  5GSP A;  1T2H A;  5HOH A;  1RDS A;  1Q9E A;  1FYS A;  1GMR A;  4BU4 A;  1HZ1 A;  1RGA A;  1B3S A;  1RCL A;  4HOH A;  1RGE A;  1RLS A;  1X1Y A;  3AHW A;  2SAR A;  1X1W A;  2C4B A;  1X1U A;  1B21 A;  3D4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...