1BULA

6alpha-(hydroxypropyl)penicillanate acylated on nmc-a beta-lactamase from enterobacter cloacae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
265
structure length
265
Chain Sequence
NTKGIDEIKNLETDFNGRIGVYALDTGSGKSFSYRANERFPLCSSFKGFLAAAVLKGSQDNRLNLNQIVNYNTRSLEFHSPITTKYKDNGMSLGDMAAAALQYSDNGATNIILERYIGGPEGMTKFMRSIGDEDFRLDRWELDLNTAIPGDERDTSTPAAVAKSLKTLALGNILSEHEKETYQTWLKGNTTGAARIRASVPSDWVVGDKTGSCGAYGTANDYAVVWPKNRAPLIISVYTTKNEKEAKHEDKVIAEASRIAIDNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Nmc-A B-Lactamase by a Penicillanic Acid Derivative, and the Structural Bases for the Increase in Substrate Profile of This Antibiotic Resistance Enzyme
pubmed rcsb
molecule tags Hydrolase
molecule keywords NMC-A BETA-LACTAMASE
total genus 92
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1bulA00
3IXHA 4M3KA 4QB8A 4DE0A 5AQAA 3UPNA 4OOMA 1GA9A 2XQZA 1BT5A 2XD1A 4Y0TA 3C7VA 4BL3A 4XXRA 1MBLA 2V20A 1LHYA 3N8SA 4KZ7A 2XK1A 3Q82A 3N6IA 4FH2A 3WWXA 1XX2A 3BLSA 3WS2A 4E6XA 2HP6A 2A49A 1K57A 1IYQA 4KQRA 5A93A 5L2FA 2H10A 4LENA 3UE0A 4WEJA 2OSUA 4WZ5A 4KZ6A 5CECA 3HLBA 1TVFA 4YFMA 3ZVWA 3W4QA 1L0EA 5CHUA 4GNUA 4OH0A 3AGFA 3IF6C 3IXGA 2X01A 2WAFA 4HEFA 3TG9A 4P85A 4LCMA 1PW8A 1PYYA 2PBYA 4WBGA 2P74A 5DTSA 3SOIA 3VMAA 5FA7A 3ZDJA 1SHVA 1XA1A 1KVMA 2WKEA 3ZCZA 3GVBA 3NDGA 4OQGA 4GKUA 4F94A 1FR1A 2JE5A 2ZQ9A 5TFQA 1PIOA 4ZBEA 2Y2GA 4ZAMA 3IXBA 3BM6A 5CTNA 3IWOA 1IYPA 3M6HA 2PU4A 3Q07A 2ZM8A 3VP1A 1WYBA 4WEKA 3LO7A 2A3UA 3BFDA 1NXYA 4S2PA 3UE3A 2ZD8A 3IT9A 2Z2LB 3G2ZA 2G2UA 3C4PA 2WUQA 4LV2A 3PAEA 5HAPA 3VFHA 3E2LA 4KG2A 1LI0A 1BLSA 4GD8A 5FSRA 4B4XA 1LL9A 4KG5A 4QJGA 1MWSA 1SDNA 2EFXA 2EX8A 3DW0A 3E2KA 4MLLA 5E2GA 3ZG7B 2WZZA 1BLCA 4EBNA 2EXAA 1K6SA 1K38A 2DNSA 5DF7A 3MKFA 3VOZA 1KDSA 1JWVA 1K4EA 3C4OA 2J9PA 1MXOA 5GHZA 4P87A 1ESIA 5FAQA 4UAAA 4EV4A 4DF6A 5GL9A 3LY3A 4Y7PA 2ZM2A 2Y2KA 1QMEA 5FAPA 1H5XA 2X02A 1K25A 4UA7A 3SS4A 1IYOA 4KZ9A 4WMCA 4OPRA 1MKIA 4JXSA 5FDHA 2UWXA 1BULA 1K54A 3BEBA 1DJBA 2XEPA 1KE0A 3Q7VB 4XUXA 3UY6A 4B88A 3C5AA 3IHBA 2Y4AA 4OVDA 2WGWB 5FAOA 3UO9A 3S4XA 4OOYA 5FI7A 5FQIA 3ZG5A 4X53A 5GLDA 2J8YA 2ZMAA 3NI9A 4OOLA 3OC2A 3OPHA 4MEZA 5IHVA 1M6KA 3GTCA 5HAIA 4WM9A 3V5MA 3UPOA 2XLNA 3MXRA 1XP4A 1C3BA 2XR0A 1ZKJA 1GHIA 1ES3A 4Z9QA 3PBQA 4OPQA 1WYCA 3WRTA 3ZVTA 3M2KA 1YLTA 2EX2A 4EBPA 3UDIA 3A3FA 3SS5A 1KGFA 3MBZA 2C5WB 4C3QA 3VP0A 2B5RA 2XFSA 4KZ4A 3P09A 1BSGA 1K6RA 3G2YA 1CEFA 2QPNA 5TGFA 3IF5A 4DXBA 3AGDA 3LEZA 1RCJA 3OPLA 3OCLA 1IKGA 2H0TA 1KE4A 2QMIA 4IVIA 3ZHHA 4LV0A 4LCLA 4JLFA 1GCEA 4PM8A 4R0QA 3HUNA 3PTEA 1EWZA 1XA7A 3FZCA 3W4OA 4WYYA 3JYIA 4BLMA 1G68A 1BZAA 2WAEA 5E2EA 5FQQA 4ZDXA 5HL1A 4U3TA 1QMFA 3UDFA 4E3NA 3UN7A 2ZC6B 2JCHA 4KZ5A 1ES2A 2EX9A 3IH8A 1Z6FA 1BLPA 4OPZA 5EVLA 4WELA 2XGNA 3HREA 1YQSA 3IH9A 4R3BA 3B3XA 1OMEA 4ID4A 1W8QA 4BD0A 4FSFA 4QD4A 2ZC3B 4UA6A 3SH7A 3QNCA 4MBFA 2Y2OA 5CERA 1J9MA 1PZPA 4HBUA 4N1XA 5F83A 2E8IA 3V3RA 3FV7A 5A92A 2DRWA 2Y59A 4S2NA 4IBXA 3DWKA 4GOGA 3HLCA 4CJNA 1CEGA 1KE3A 3NDEA 4HESA 4KZ8A 4YINA 4S2LA 3N4IA 1ONHA 2QZ6A 3BLMA 1FCNA 4LV1A 5E2FA 5EECA 1XGIA 5EVIC 5FQMA 1YMSA 4DRTA 1I2SA 1IELA 1WE4A 2ZQ7A 3G31A 4Y0OA 3FKWA 4JXWA 2OV5A 3WS1A 5FASA 1MPLA 1XXMA 5GLCA 3VSKA 5KSHA 3IWQA 4Q8IA 4JBFA 1TEMA 4C6YA 5DF9A 5EOOA 5HW3A 1KVLA 4GB7A 3ZFZA 3IXDA 5FI2A 4BJPA 2HDRA 4B4ZA 1GHMA 1KGGA 3ZNYA 4GD6A 5BOHA 4L0LA 1I5QA 2IWCA 5CRFA 4DE1A 2ZC7A 1LI9A 3ZNTA 4ZJ1A 4DKIA 1FR6A 3C7UA 1HVBA 3W4PA 2XH9A 1YLYA 2HP5A 1NYMA 1U60A 3BFEA 1SCWA 4X6TA 2VGKA 2HDUA 3WRZA 3LCEA 3GQZA 3OPPA 5M1AA 4WMCD 5FQ9A 5EVIB 4OPYA 1BLHA 1ZG4A 3HLFA 4FD8A 2CC1A 5E43A 3ZG0A 4PM9A 1NY0A 3Q81A 4R23A 2HPBA 1FSYA 3OPRA 5FATA 3EQVA 1PWDA 3VP3A 1M40A 5GLAA 1CI9A 1BTLA 2HDSA 2ZM0A 4R4RA 3ZG9B 1HD8A 5JYOA 1K56A 4NETA 4PM5A 5JYPA 1YM1A 2Y2IA 1DY6A 5EOEA 2WGIA 3TSGA 5KMWA 1ERQA 1NZOA 2WADA 2GDNA 4MBKA 5GHYA 1MWTA 4KQQA 1AXBA 1FCOA 1PI5A 4PM7A 1RGYA 3UPPA 1JTDA 4EWFA 3ITAA 2HP9A 4H8RA 4JF5A 3O87A 1N9BA 1ES4A 3NCKA 4PPRA 3IQAA 3DWZA 1H8YA 4C75A 4E3MA 1ES5A 1L2SA 2I72A 3PBSA 5D3OA 3EQUA 4D2OA 4DE3A 1E25A 1JVJA 2VGJA 4OLGA 5A91A 3VP2A 3PBNA 4E6WA 3I7JA 3AGEA 1JTGA 3TOIA 4RX3A 4KZBA 2Q9NA 3DTMA 5KSCA 4ZJ2A 1PWGA 3VOYA 4E3OA 5TR7A 4N9KA 5A90A 2WGWA 4JKTA 1NJ4A 4RA7A 5E2HA 3HLDA 1O7EA 1YLPA 4QY6A 5CHJA 1G6AA 5AQ9A 1MWUA 4S2JA 4U0TA 3UNWA 2WK0A 3V3SA 1IKIA 5CEDA 3HBRA 3BECA 2C6WB 4X56A 1Y54A 1TDLA 1K4FA 1PI4A 2ZQDA 4LV3A 3A3DA 2V1ZA 1FCMA 3UE1A 3A3EA 2ZJ9A 1CK3A 1K56D 1YMXA 3FWLA 2Y2HA 4IEDA 4S2OA 1NZUA 2JBFA 2XD5A 1XGJA 3PBOA 2ZQAA 1KGEA 4GZBA 4XUZA 5AQBA 1XKZA 1Q2QA 5J8XA 3A3JA 2RCXA 1NYYA 4P6BA 3Q1FA 4OONA 3MZDA 4E3IA 4R1GA 4E3JA 4KENB 2Y2MA 2HDQA 4R4SA 4EQIA 4IVKA 4R3JA 3O88A 1ONGA 1KDWA 1LL5A 3CG5A 1W79A 1TDGA 3S1YA 2XFTA 3V50A 4ZTKA 1YLZA 5CGXA 5CXWA 2J7VA 4K91A 3BFCA 3HUMA 4DXCA 5CHMA 5HX9A 2EXBA 5HARA 5F1GA 5FQKA 2ZQ8A 2H0YA 3QNBA 5GLBA 3HL9A 5M18A 4QU3A 2RL3A 3MXSA 4GDNA 5HAQA 2Y55A 1RP5A 3VSLA 3ISGA 2P9VA 1L0DA 3G32A 1W8YA 3NC8A 1IEMA 3QHYA 3HLGA 5CEBA 1FSWA 3G4PA 4GDBA 4MNRA 2BLSA 2WGVA 3RXXA 3VP4A 4OP5A 1W5DA 4X68A 5DF8A 3VFFA 3O86A 3NBLA 1N4OA 2P9VB 5G18A 2Y2NA 3PAGA 4K0WA 3MFDA 2BG1A 4O7DA 1S6RA 3D4FA 4JPMA 1HTZA 3FYZA 2WYXA 3M6BA 3MKEA 3GR2A 5F82A 4RVAA 4S2IA 1RGZA 5U47A 2R9XA 1JWPA 3IF6A 3OCNA 1PW1A 2XF3A 3GMWA 3W8KA 5FQJA 3S22A 3ITBA 1BUEA 4FCFA 3MZEA 2ZC4B 3O3VA 1GA0A 1ESUA 2WKIA 4OP8A 4A5RA 2XDMA 3NIAA 4HBTA 2X71A 4BD1A 3GRJA 4N1HA 3NY4A 4WZ4A 5M19A 3SS3A 1YT4A 2J9OA 2Z2MB 4IBRA 2DCFA 5AQ7A 1W7FA 5I94A 1IYSA 1NRFA 4Y0UA 4JXGA 4GN2A 4DDSA 3G30A 3V39A 2Y2QA 4QY5A 4BQMA 5EPHA 3SH8A 4RX2A 1FQGA 4U0XA 4X69A 3ZGAB 1E4DA 3HVFA 2WKHA 1FOFA 1LLBA 5GHXA 2FFYA 4OQIA 1E3UD 1DJCA 3RXWA 1K55C 3IHAA 2ZLYA 4P0MA 4RYEA 3GV9A 1VM1A 1XPBA 3N7WA 5KZHA 4N9LA 4KQOA 4OQ0A 4NK3A 4UHUA 4N92A 4KZAA 5DVAA 3N8LA 1E3UA 3GSGA 4KZ3A 3WS0A 4ZJ3A 3BYDA 2Y2LA 3P98A 2V2FF 4S2KA 4DE2A 4JXVA 3WS4A 1DJAA 1EI5A 3Q7ZA 2WZXA 4QHCA 1L0FA 5EE8A 3HLEA 1ZG6A 3PBTA 4E3LA 3SH9A 5EVID 1MY8A 4FH4A 2H5SA 3LY4A 1I2WA 3PBRA 1YLJA 1JWZA 4JF4A 4S2NC 3CZDA 1ERMA 3WS5A 2PU2A 5HFOA 4JF6A 5DTTA 3RJUA 1PWCA 4EBLA 1SKFA 1K54C 5F1FA 2JC7A 4OLDA 4DDYA 2R9WA 2EFUA 1HZOA 3CJMA 4PMAA 4E3KA 3G34A 3BFFA 3A3IA 2OLVA 2EX6A 4K0XA 4CPKA 1K55A 1GHPA 2Q9MA 1MWRA 2IWBA 3ZG8B 3HUOA 4S2MA 1S0WA 3CMZA 5CTMA 2ZC5B 3IWIA 1H8ZA 5CGWA 4PM6A 2Y2JA 4KG6A 2Y91A 5FI6A 2G2WA 1CI8A 1K57C 1O07A 1SDEA 2FFFB 5EUAA 3UDXA 3BRMA 1VQQA 2IWDA 5CGSA 5EVIA 3OZHA 2OLUA 3HLWA 3N8RA 4WZ5C 3BFGA 4OQHA 4EUZA 1Q2PA 3FKVA 3G35A 1EROA 1ALQA 3M2JA 3MZFA 4MBHA 4OKPA 1L0GA 2Y2PA 2ZQCA 1PZOA 1YLWA 4X55A 3Q7VA 4BENA 4BL2A 4UA9A 5DTKA 1ZC2A 3IF6B
chains in the Genus database with same CATH superfamily
1XFQA 3IXHA 5AQAA 3T4LA 2W3DA 2VEAA 4X1LA 4X1MA 3N8SA 3Q82A 2HZ5A 1XX2A 3BLSA 4HP9A 2W3FA 3NJAA 2A49A 5L2FA 4LENA 3UE0A 4G3VA 4KZ6A 1S1YA 3HLBA 1TVFA 1VHMA 3HJIA 2VA0A 3IXGA 4DN0A 2X01A 3TG9A 4LCMA 4I38A 5DTSA 1XA1A 1KVMA 4P6ZM 1D7EA 4LPZA 3T4KA 1LSWA 5TFQA 1PIOA 4ZBEA 1VEUB 2Y2GA 4ZAMA 3IXBA 5CTNA 3IWOA 3Q07A 2ZM8A 3VP1A 1Y4OA 2VX8A 3UE3A 2ZD8A 2Z2LB 4LV2A 3PAEA 3VFHA 5FSRA 3UB7A 4B4XA 4KG5A 4QJGA 3H9WA 5E2GA 2OWHA 3G6OA 3ZG7B 1BLCA 2EXAA 3QP8A 4I5SA 3VOZA 5EM1A 1KDSA 2J9PA 1MXOA 5FAQA 4EV4A 1ZHHB 3LUQA 1QMEA 5FAPA 2UV0E 2M7VA 4UA7A 2PD7A 3LICA 4WMCA 3F1PB 4MN6A 1HLUP 1K54A 4ESPA 4XUXA 3UY6A 4OVDA 2Y4AA 3S4XA 2V0UA 5FQIA 2J8YA 2ZMAA 4LFUA 5IHVA 5HAIA 3GTCA 3UPOA 2XLNA 3GDIA 4PKYA 1GHIA 4EU0A 3PBQA 4OPQA 3V67A 3M2KA 4EBPA 4HH2A 3A3FA 1KGFA 2Q0OA 2OOLA 5MC7A 4Q0HA 3IF5A 2VGLS 5AJGA 2H0TA 4IVIA 4FUWA 2P08A 3PTEA 1XA7A 4WYYA 3LYXA 3S7QA 4Y15A 2JCHA 1ES2A 2EX9A 3ZYTA 2XROA 3IX3A 3UB8A 4WELA 1OT6A 4R3BA 1OMEA 1W8QA 1XJ6A 2G7UA 2VV7A 4UA6A 2V9AA 2D02A 2Y2OA 4N1XA 3GECA 2OWJA 3CITA 3DWKA 4GLQA 1KE3A 3NDEA 4HESA 3ULFA 4IHQA 4EEPA 4HP4A 3BLMA 1PNEA 5FQMA 3BY8A 1IELA 2ZQ7A 3WS1A 3EEAA 1XXMA 1GSVA 2W1RA 4HJ3A 5GLCA 4JBFA 1TEMA 4C6YA 5DF9A 5I5LA 3RH8B 1KVLA 4GB7A 4DMZA 4BJPA 1LI9A 3ZNTA 1D1JA 1HVBA 2HP5A 1NYMA 1U60A 2H28A 4WMCD 5EVIB 3CHWP 4FD8A 2CC1A 1NY0A 4R23A 2HPBA 3OPRA 2JN7A 1CI9A 1BTLA 4R4RA 3EEHA 4NETA 4PM5A 3MFXA 1DY6A 4CLCD 1W63Q 4O01A 1YPRA 2WADA 2GDNA 2PBDP 4ME4A 5GHYA 1MWTA 1FCOA 4PM7A 5HL6A 4UQIS 1JTDA 1ZTUA 4EWFA 2FH5A 3ITAA 3O87A 4KUOA 3NCKA 4PPRA 3OOVA 1SZVA 3K3DA 5D3OA 1LL8A 4XT2B 4DE3A 4E6WA 3PBNA 4BBTA 1P9WA 1N9LA 2M1CA 3DTMA 1PWGA 2W3HA 3U4LP 4E3OA 4HNBA 5TR7A 5K5BA 4JKTA 5E2HA 1O7EA 5CHJA 5HPIA 4DJ2A 3C30A 2JKTM 3UNWA 2WK0A 1IKIA 1YAXA 3HBRA 1TDLA 2V1ZA 3A3EA 3MJQA 5DKLA 1CK3A 4IEDA 4L9GA 2JBFA 4GZBA 1XGJA 4XUZA 2ZQAA 3EGDC 3A3JA 4EERA 2RCXA 1NYYA 4P6BA 2PD8A 4L9EA 3D3OA 4E3JA 2P7JA 4EQIA 3CG5A 1W79A 1GSWA 3S1YA 4ZTKA 5CGXA 3S7OA 3BFCA 1WA9A 3EWKA 1NWZA 2RL3A 4GDNA 3F1OB 1RP5A 3A0SA 3G32A 1FSWA 3G4PA 3LFVA 3RXXA 3KSHA 3VP4A 1OTAA 2PT7A 5G18A 1OT9A 2B02A 1S4RA 1S6RA 2HV1A 3D4FA 3FYZA 3LIAA 3MKEA 3GR2A 3LR0A 5U47A 2V1BA 2R9XA 1JWPA 2XF3A 5FQJA 3S22A 1BUEA 3O3VA 3NIAA 4HBTA 1NLZA 4WZ4A 3SS3A 1S1ZA 4GJ4A 3A0RA 1NRFA 4Y0UA 4JXGA 4QY5A 3VV4A 2VZWA 4ETZA 3HVFA 1FOFA 3ZQ5A 4P0MA 3N7WA 5KZHA 4N92A 4KZAA 4KZ3A 3LIBA 4S2KA 3IX4A 1EI5A 1XJ4A 2YKHA 3Q7ZA 3HLEA 1ZG6A 4FH4A 5AVEA 4JF4A 2PU2A 1PWCA 2PRFA 1STZA 3C2WA 4DDYA 3G34A 3BFFA 2QWSA 3LIEA 1H3QA 3BQ8A 2WKPA 4S2MA 3IWIA 5CGWA 5HD5A 2FFFB 1O07A 5J4EA 1VQQA 2XA7M 4II7A 4OQHA 3G35A 4GS9B 4OKPA 1PZOA 5DTKA 3G2ZA 4M3KA 4QB8A 1GA9A 4IUKA 4XXRA 3WWXA 1LHYA 3N6IA 3WS2A 4E6XA 5EFWA 1YKDA 2H10A 4WEJA 2J80A 2PDRA 4WZ5A 5CECA 5HWVA 3ZVWA 1L0EA 5CHUA 4GNUA 5L09A 2WAFA 1KOUA 1PW8A 4HOIA 2PBYA 3VMAA 2P74A 3SOIA 3ZDJA 5FA7A 1SHVA 2WKEA 5FEFA 3NDGA 4GKUA 2ZQ9A 5HWWA 4G3KA 4R70A 3E4OA 5DJUA 1IYPA 1WYBA 4S2PA 3IT9A 2G2UA 2WUQA 4FTXA 2PYRA 4MN5A 1LL9A 1SDNA 2EFXA 2WZZA 1K6SA 1K4EA 4NXBA 4ZRRA 5GHZA 4P87A 1ESIA 1FILA 4DF6A 3LY3A 1H5XA 4XT2A 3SS4A 3KSIA 4KZ9A 4OPRA 2UWXA 1BULA 1K0KA 1TS8A 2XEPA 4B88A 3C5AA 3IHBA 2WGWB 2YKFA 5FI7A 2OAQ1 4X53A 5LBRA 2V1AA 3UE6A 3OC2A 3OPHA 4MEZA 4G3WA 3V5MA 4WM9A 2QJ7A 3IBRA 1XP4A 1OTDA 1ES3A 2K31A 1T18A 2BASA 3SS5A 3MBZA 5EVEA 2C5WB 4C3QA 3VP0A 1SKOA 4KZ4A 3P09A 2Y8HA 5TGFA 2ZL1A 3OPLA 3E0YA 3OCLA 4NG2A 1KE4A 3NECA 2PHYA 4JLFA 4PM8A 4R0QA 3FZCA 3W4OA 4BLMA 3T1SA 2WAEA 1BZAA 4Z1WA 5E2EA 5FQQA 1X0OA 1Z6FA 1BLPA 1LSXA 3HREA 3BWLA 2HGVA 1YQSA 3IH9A 3K3CA 4ID4A 4QD4A 2ZC3B 4H6JA 1IOUA 4MBFA 3FPVA 4R3AA 1J9MA 2QYBA 3V3RA 3FV7A 5A92A 2Y59A 4CJNA 2O99A 4KZ8A 3NHQA 4EEUA 4YINA 3N4IA 1ONHA 3NOUC 4PKYG 4UEYA 4WUJA 5E2FA 1XGIA 4DRTA 3DBAA 1WE4A 2OV5A 1YSPA 4Y0OA 3FKWA 3IWQA 5FI2A 1EW0A 1KGGA 3ZNYA 4L0LA 5CRFA 1CQAA 3B33A 3LR3A 2A24A 3C7UA 4JGPA 1YLYA 5DFXA 3BFEA 4ARZA 1SCWA 2VGKA 3LCEA 3OPPA 2ZBBA 2B18A 5E43A 4B93A 4CLCC 1HD8A 5JYOA 4KQDA 3DTEA 3TSGA 5HDCA 1ERQA 5G4ZA 4KQQA 4H8RA 4JF5A 1N9BA 1ES4A 4C75A 4E3MA 1ES5A 1L2SA 3EQUA 2VGJA 4OLGA 3TE8A 3TOIA 5KSCA 3VOYA 4O8GA 2JKFA 4N9KA 5A90A 2WGWA 1PRQA 4NXGA 4D60A 4RA7A 1CJFA 5F6AA 1ZC2A 1G6AA 3CUEC 3W2ZA 1XJ3A 3QP4A 1PI4A 3QP5A 2L0WA 3UE1A 1VETB 4NXFA 3D72A 5HDSA 1XKZA 1Q2QA 1S66L 3Q1FA 1H0MA 4OONA 3TJZC 3PXPA 2HDQA 4R4SA 3O88A 1ONGA 1LL5A 2XFTA 5HX9A 5F1GA 3JVUA 5GLBA 3HL9A 5M18A 3F1NA 3ISGA 4IUHA 2P9VA 5FL3A 3FPWA 5AVFA 2ZMVA 1IEMA 4GHIB 5CEBA 1F98A 4MNRA 1OJGA 1W5DA 3LI9A 3VFFA 2P9VB 5G4YA 2CMNA 3PAGA 2BG1A 3IS2A 3MSHA 4I3IA 1RGZA 1VEUA 3OCNA 3B42A 3GMWA 3ITBA 2XA7S 4FCFA 3MZEA 3IBJA 3LIDA 4WF0A 3NY4A 5M19A 1YT4A 2J9OA 2Z2MB 2DCFA 5AQ7A 1VETA 4GN2A 4DDSA 3V39A 3SH8A 3P01A 2BTFP 1FQGA 4NKPA 4U0XA 2W1TB 3T1QB 2FFYA 4OQIA 1E3UD 5EV0A 2EWWA 4RYEA 3RTYA 1XPBA 3T4TA 1A0KA 4B9OA 4OQ0A 4UHUA 2V0WA 5DVAA 3TRCA 2Y2LA 3CPTB 2L1MA 4Y17A 5EVID 1MY8A 2H5SA 3LY4A 3PBRA 1JWZA 3H82B 3CZDA 3WS5A 4JF6A 4EBLA 5HPFA 2JC7A 2R9WA 2EFUA 5IT5A 4E3KA 2OLVA 3QP1A 1GHPA 3R7WA 2Q9MA 1MWRA 3MQQA 2IWBA 3ZG8B 2ZMFA 5CTMA 2ZC5B 5L8MA 1H8ZA 1V9ZA 4PM6A 1TS7A 4KG6A 1T1AA 5DFYA 1K57C 1SDEA 5EUAA 1FIKA 3HLWA 3N8RA 3M2JA 1MZUA 2Y2PA 3Q7VA 2VLGA 4BENA 4BL2A 4UA9A 3IF6B 3PYPA 4DE0A 3UPNA 3C7VA 2V20A 4KZ7A 2XK1A 3T50A 3ICYA 4KQRA 4P6ZS 3HCYA 4YFMA 3B47A 2J3TD 3AGFA 3IF6C 1P97A 4P85A 4GCZA 4IJGA 4F3LB 1DP8A 1PYYA 2K7SA 3BY9A 4WBGA 3UB6A 2O9CA 4F94A 2JE5A 1T1CA 4I3AA 2AVXA 4BBVA 3MF0A 2A3UA 3BFDA 2Y79A 1NXYA 3UMEA 1XFNA 3VE4A 3E2LA 4KG2A 1LI0A 4GD8A 4EUVA 1JNUA 1MWSA 4MLLA 3E2KA 4LLOB 1S67L 4NXEA 3MKFA 4EQ1A 3FC7A 4UAAA 5GL9A 4Y7PA 5IS1A 1IYOA 4H6JB 3LEQA 4LRZE 3BEBA 1DJBA 1KE0A 2HF6A 3Q7VB 3NOPC 1F9IA 3KX0X 3T1XA 2WKQA 5GLDA 3NI9A 4HI4A 2XR0A 1ZKJA 1Y28A 4Z9QA 2Z6CA 1WYCA 3ZVTA 3MMHA 4Y13A 2EX2A 2B5RA 4JGRA 3P7NA 3DTIA 3LGOA 2XFSA 1BSGA 1K6RA 3G2YA 1CEFA 1SKOB 2QPNA 4BBUA 4DXBA 3LEZA 3SZTA 1RCJA 2MJ6A 3H82A 1F5MA 1IKGA 4GW9A 2QMIA 2FZ0A 1OPXA 4LV0A 1GCEA 4E3IA 2PYPA 3JYIA 1G68A 2NUTC 4U3TA 1QMFA 4E3NA 2J3WA 3UN7A 5C5KA 4KZ5A 5EVLA 4HY8A 1UWPX 3R4KA 3B3XA 1XJ2A 4FSFA 4BD0A 1LSVA 3SH7A 3QNCA 2O9BA 2E8JA 4LRXC 4HBUA 2L4RA 1NRJA 1CEGA 1H8MA 2QZ6A 1FCNA 3T1RA 5EVIC 5J3WA 2GZAA 4JXWA 3VSKA 5KSHA 4HJ6A 5EOOA 5HW3A 3T12B 5BOHA 4BMWA 4GD6A 2IWCA 4DJ3A 4ZJ1A 3KSGA 2XH9A 4X6TA 3WRZA 3GQZA 5M1AA 3BQAA 3HLFA 3ZG0A 4PM9A 1OTEA 1N9OA 2XRNA 5FATA 3EQVA 5GLAA 4KUKA 2IA2A 3ZG9B 2OAP1 2VKSA 1S4SA 3KO6A 5JYPA 1P0ZA 5EOEA 2WGIA 5KMWA 4MBKA 1AXBA 4WL9A 1RGYA 2HP9A 4Y3IA 3DWZA 4MN7A 3PBSA 2I72A 1E25A 5A91A 3VP2A 3I7JA 3IX8A 1DP9A 1OTIA 4ZJ2A 4GS9A 1NJ4A 1G5UA 2HJ9C 1GSXA 2A24B 2V8CA 3C8CA 4GHIA 4QY6A 4Y2FA 1MWUA 3F1NB 4M4XA 3V3SA 2I9VA 1Y54A 3K2NA 3KYZA 5DKKA 3QP2A 3A3DA 1K56D 3FWLA 4S2OA 1NZUA 3PBOA 3BJNA 5J8XA 3MZDA 4IVKA 4R3JA 2JKRI 3V50A 1YLZA 5CXWA 4DXCA 5CHMA 5HARA 5FQKA 3FG8A 2KLIA 1VB6A 5L10A 3QNBA 2Y55A 5A8BA 3D9YA 1L0DA 3NC8A 1W8YA 2JKGA 4GDBA 2BLSA 2WGVA 4X68A 1D06A 4ARZB 1N4OA 2Y2NA 2KDKA 3KYQA 3S7PA 4K0WA 3MFDA 3LR5A 4O7DA 1YSQA 4JPMA 1HTZA 2WYXA 3UMDA 1PW1A 3CAXA 3NULA 5KIZA 3CLOA 2B95A 3L7HA 2ZC4B 2WKIA 4A5RA 2X71A 3GRJA 2PR6A 1TF1A 2QJ5A 1UWNX 3E4QA 3H7WA 1LT0A 3DAVA 4IBRA 1W7FA 1DP6A 1IYSA 2Y2QA 5EPHA 4YNRA 3EOIA 3A0VA 4X69A 2WKHA 1LLBA 5GHXA 5J7EA 2ACGA 3GV9A 3MS6A 4HJ4A 4KQOA 1G6OA 4NK3A 3UB9A 3N8LA 4Q0JA 3GSGA 4EXOA 1ACFA 5HSQA 3BYDA 3C38A 2P04A 2V2FF 4DE2A 4FOFA 1DJAA 2WZXA 4QHCA 4E3LA 3SH9A 2LB5A 1I2WA 4S2NC 2ZL1B 2V8FA 3LR4A 5DTTA 5F1FA 4OLDA 4PMAA 5TJJA 1S0WA 3H7WB 5F69A 2Y91A 5FI6A 5EM0A 4UQIM 3BRMA 2IWDA 5EVIA 3OZHA 2JHEA 3BFGA 3FKVA 1EROA 4R38A 3MZFA 1L0GA 2ZQCA 1YLWA 1F2KA 3E98A 4YWZA 2VK3A 4OOMA 2XQZA 1BT5A 2XD1A 4Y0TA 4HQAA 4LRYC 3JPUA 4BL3A 1MBLA 1T19A 4K08A 4FH2A 2INWA 2HP6A 5A93A 1K57A 1IYQA 3U2AA 4ETXA 2OSUA 2QHKA 3W4QA 4OH0A 3R7WB 4HEFA 3RFBA 1J3WA 2R78A 2M7UA 3ZCZA 3GVBA 4OQGA 1FR1A 2WKRA 3BM6A 2GX5A 2KX6A 4I39A 3M6HA 2PU4A 1W63M 4WEKA 3LO7A 2EA9A 2W27A 3C4PA 5HAPA 3MXQA 1BLSA 2EX8A 3DW0A 4EBNA 1K38A 2DNSA 5DF7A 2W1TA 1PFLA 3C4OA 1JWVA 4PHTA 2D01A 5HD3A 2PR5A 4RQ9A 2ZM2A 2Y2KA 3QP6A 2X02A 1K25A 1MKIA 4JXSA 5FDHA 1G28A 4HIAA 3CI6A 5FAOA 3UO9A 4OOYA 4OOLA 1M6KA 3MXRA 1C3BA 2K2NA 2VV8A 3WRTA 5HDDA 1CF0A 1YLTA 4MDZA 3UDIA 3S7NA 1DRMA 3HJKA 4LGWA 3PHYA 3AGDA 2GNXA 2O0YA 2VV6A 3ZHHA 4LCLA 3HUNA 1EWZA 5TBMA 4ZDXA 5HL1A 3UDFA 2ZC6B 3IH8A 5CX7A 2W3EA 4OPZA 2XGNA 2VGLM 2J3TC 1L3LA 3T4JA 3KSFA 3F1PA 5CERA 1PZPA 3IS2B 3CPTA 5F83A 2E8IA 5L07A 2DRWA 4S2NA 3O5YA 4IBXA 4GOGA 3HLCA 3VOLA 3LIFA 2GJ3A 4S2LA 3L9KA 2Z6DA 2ZOHA 4LV1A 5EECA 1YMSA 1I2SA 3G31A 5FASA 3UB5P 1MPLA 4Q8IA 4NEED 4X25A 3ZFZA 5DJTA 3IXDA 2HDRA 4B4ZA 1GHMA 1I5QA 4DE1A 2ZC7A 4Y5FA 4DKIA 1FR6A 1BYWA 3W4PA 4QPRA 2HDUA 5FQ9A 4QWOA 4OPYA 1BLHA 1ZG4A 3OLOA 2XSSA 3Q81A 2LB9A 4WLAA 5TBMB 1FSYA 1PWDA 3VP3A 1M40A 3NOTC 2HDSA 2ZM0A 1K56A 1YM1A 2Y2IA 2HJEA 1NZOA 3BW6A 1PI5A 3UPPA 5FEGA 3LI8A 3IQAA 1H8YA 5IU1A 1TD5A 4JGOA 4BWIA 4D2OA 1JVJA 2KOIA 3CWFA 4O0PA 5F5YA 4WN5A 3T4OA 3AGEA 1JTGA 4EESA 4RX3A 4KZBA 2Q9NA 1V9YA 4R6LA 3HLDA 1YLPA 5AQ9A 4S2JA 3F1OA 4U0TA 5CEDA 3BECA 2C6WB 4X56A 1ODVA 1K4FA 2ZQDA 4LV3A 1FCMA 2ZJ9A 4AFIA 1YMXA 2Y2HA 2ZOIA 1N9NA 4HH3A 2XD5A 1KGEA 5AQBA 1P9RA 4R1GA 4KENB 1TS6A 2Y2MA 4L9FA 4YOFA 2DMWA 1KDWA 3PR6A 1TDGA 1TS0A 2J7VA 3CUEA 1AWIA 4K91A 3HUMA 2EXBA 2ZQ8A 2H0YA 4HHDA 3MQ0A 4QU3A 3MXSA 5F68A 5HAQA 3VSLA 3E4PA 4Q0IA 3QHYA 5HZHA 3HLGA 2W3GA 4OP5A 5DF8A 3KYEA 3O86A 2NUPC 3NBLA 3M6BA 5F82A 4JGQA 4RVAA 4S2IA 1UGUA 3IF6A 4CLCB 3W8KA 1GA0A 1ESUA 4OP8A 2QKPA 4CLCA 2XDMA 1MKMA 4BD1A 4N1HA 1OTBA 4MCWA 4PAUA 5I94A 2VJWA 3G30A 4BQMA 4RX2A 3ZGAB 1E4DA 1IFQA 2W0NA 3VE3A 1DJCA 1K55C 3IHAA 2ZLYA 1VM1A 4N9LA 4CQHA 4EETB 3EGXC 1Z09A 1E3UA 3WS0A 4ZJ3A 3P98A 2O9AA 4JXVA 3WS4A 2JKTI 2JKRM 1L0FA 5EE8A 3PBTA 1YLJA 4I3JA 1ERMA 5HFOA 3RJUA 1SKFA 1K54C 3T4QA 3MQOA 1HZOA 3CJMA 3A3IA 4K0XA 2EX6A 4CLCE 4CPKA 4MMNA 3DTKA 1K55A 2PAVP 4F3LA 3HUOA 4EW7A 3CMZA 1OJ5A 2Y2JA 3MR0A 4E04A 2G2WA 3T4SA 1CI8A 2EWVA 3JVVA 3OBFA 3UDXA 1T1BA 5CGSA 3TW8A 2OLUA 4WZ5C 5FDSA 4EUZA 1Q2PA 1ALQA 1MC0A 4MBHA 1NLYA 5HWTA 4X55A 3RXWA 3ZG5A 3SW1A 2A2LA
chains in the Genus database with same CATH topology
3IXHA 4M3KA 4QB8A 4DE0A 5AQAA 3UPNA 4OOMA 1GA9A 2XQZA 1BT5A 2XD1A 4Y0TA 3C7VA 4BL3A 4XXRA 1MBLA 2V20A 1LHYA 3N8SA 4KZ7A 2XK1A 3Q82A 3N6IA 4FH2A 3WWXA 1XX2A 3BLSA 3WS2A 4E6XA 2HP6A 2A49A 1K57A 1IYQA 4KQRA 5A93A 5L2FA 2H10A 4LENA 3UE0A 4WEJA 2OSUA 4WZ5A 4KZ6A 5CECA 3HLBA 1TVFA 4YFMA 3ZVWA 3W4QA 1L0EA 5CHUA 4GNUA 4OH0A 3AGFA 3IF6C 3IXGA 2X01A 2WAFA 4HEFA 3TG9A 4P85A 4LCMA 1PW8A 1PYYA 2PBYA 4WBGA 2P74A 5DTSA 3SOIA 3VMAA 5FA7A 3ZDJA 1SHVA 1XA1A 1KVMA 2WKEA 3ZCZA 3GVBA 3NDGA 4OQGA 4GKUA 4F94A 1FR1A 2JE5A 2ZQ9A 5TFQA 1PIOA 4ZBEA 2Y2GA 4ZAMA 3IXBA 3BM6A 5CTNA 3IWOA 1IYPA 3M6HA 2PU4A 3Q07A 2ZM8A 3VP1A 1WYBA 4WEKA 3LO7A 2A3UA 3BFDA 1NXYA 4S2PA 3UE3A 2ZD8A 3IT9A 2Z2LB 3G2ZA 2G2UA 3C4PA 2WUQA 4LV2A 3PAEA 5HAPA 3VFHA 3E2LA 4KG2A 1LI0A 1BLSA 4GD8A 5FSRA 4B4XA 1LL9A 4KG5A 4QJGA 1MWSA 1SDNA 2EFXA 2EX8A 3DW0A 3E2KA 4MLLA 5E2GA 3ZG7B 2WZZA 1BLCA 4EBNA 2EXAA 1K6SA 1K38A 2DNSA 5DF7A 3MKFA 3VOZA 1KDSA 1JWVA 1K4EA 3C4OA 2J9PA 1MXOA 5GHZA 4P87A 1ESIA 5FAQA 4UAAA 4EV4A 4DF6A 5GL9A 3LY3A 4Y7PA 2ZM2A 2Y2KA 1QMEA 5FAPA 1H5XA 2X02A 1K25A 4UA7A 3SS4A 1IYOA 4KZ9A 4WMCA 4OPRA 1MKIA 4JXSA 5FDHA 2UWXA 1BULA 1K54A 3BEBA 1DJBA 2XEPA 1KE0A 3Q7VB 4XUXA 3UY6A 4B88A 3C5AA 3IHBA 2Y4AA 4OVDA 2WGWB 5FAOA 3UO9A 3S4XA 4OOYA 5FI7A 5FQIA 3ZG5A 4X53A 5GLDA 2J8YA 2ZMAA 3NI9A 4OOLA 3OC2A 3OPHA 4MEZA 5IHVA 1M6KA 3GTCA 5HAIA 4WM9A 3V5MA 3UPOA 2XLNA 3MXRA 1XP4A 1C3BA 2XR0A 1ZKJA 1GHIA 1ES3A 4Z9QA 3PBQA 4OPQA 1WYCA 3WRTA 3ZVTA 3M2KA 1YLTA 2EX2A 4EBPA 3UDIA 3A3FA 3SS5A 1KGFA 3MBZA 2C5WB 4C3QA 3VP0A 2B5RA 2XFSA 4KZ4A 3P09A 1BSGA 1K6RA 3G2YA 1CEFA 2QPNA 5TGFA 3IF5A 4DXBA 3AGDA 3LEZA 1RCJA 3OPLA 3OCLA 1IKGA 2H0TA 1KE4A 2QMIA 4IVIA 3ZHHA 4LV0A 4LCLA 4JLFA 1GCEA 4PM8A 4R0QA 3HUNA 3PTEA 1EWZA 1XA7A 3FZCA 3W4OA 4WYYA 3JYIA 4BLMA 1G68A 1BZAA 2WAEA 5E2EA 5FQQA 4ZDXA 5HL1A 4U3TA 1QMFA 3UDFA 4E3NA 3UN7A 2ZC6B 2JCHA 4KZ5A 1ES2A 2EX9A 3IH8A 1Z6FA 1BLPA 4OPZA 5EVLA 4WELA 2XGNA 3HREA 1YQSA 3IH9A 4R3BA 3B3XA 1OMEA 4ID4A 1W8QA 4BD0A 4FSFA 4QD4A 2ZC3B 4UA6A 3SH7A 3QNCA 4MBFA 2Y2OA 5CERA 1J9MA 1PZPA 4HBUA 4N1XA 5F83A 2E8IA 3V3RA 3FV7A 5A92A 2DRWA 2Y59A 4S2NA 4IBXA 3DWKA 4GOGA 3HLCA 4CJNA 1CEGA 1KE3A 3NDEA 4HESA 4KZ8A 4YINA 4S2LA 3N4IA 1ONHA 2QZ6A 3BLMA 1FCNA 4LV1A 5E2FA 5EECA 1XGIA 5EVIC 5FQMA 1YMSA 4DRTA 1I2SA 1IELA 1WE4A 2ZQ7A 3G31A 4Y0OA 3FKWA 4JXWA 2OV5A 3WS1A 5FASA 1MPLA 1XXMA 5GLCA 3VSKA 5KSHA 3IWQA 4Q8IA 4JBFA 1TEMA 4C6YA 5DF9A 5EOOA 5HW3A 1KVLA 4GB7A 3ZFZA 3IXDA 5FI2A 4BJPA 2HDRA 4B4ZA 1GHMA 1KGGA 3ZNYA 4GD6A 5BOHA 4L0LA 1I5QA 2IWCA 5CRFA 4DE1A 2ZC7A 1LI9A 3ZNTA 4ZJ1A 4DKIA 1FR6A 3C7UA 1HVBA 3W4PA 2XH9A 1YLYA 2HP5A 1NYMA 1U60A 3BFEA 1SCWA 4X6TA 2VGKA 2HDUA 3WRZA 3LCEA 3GQZA 3OPPA 5M1AA 4WMCD 5FQ9A 5EVIB 4OPYA 1BLHA 1ZG4A 3HLFA 4FD8A 2CC1A 5E43A 3ZG0A 4PM9A 1NY0A 3Q81A 4R23A 2HPBA 1FSYA 3OPRA 5FATA 3EQVA 1PWDA 3VP3A 1M40A 5GLAA 1CI9A 1BTLA 2HDSA 2ZM0A 4R4RA 3ZG9B 1HD8A 5JYOA 1K56A 4NETA 4PM5A 5JYPA 1YM1A 2Y2IA 1DY6A 5EOEA 2WGIA 3TSGA 5KMWA 1ERQA 1NZOA 2WADA 2GDNA 4MBKA 5GHYA 1MWTA 4KQQA 1AXBA 1FCOA 1PI5A 4PM7A 1RGYA 3UPPA 1JTDA 4EWFA 3ITAA 2HP9A 4H8RA 4JF5A 3O87A 1N9BA 1ES4A 3NCKA 4PPRA 3IQAA 3DWZA 1H8YA 4C75A 4E3MA 1ES5A 1L2SA 2I72A 3PBSA 5D3OA 3EQUA 4D2OA 4DE3A 1E25A 1JVJA 2VGJA 4OLGA 5A91A 3VP2A 3PBNA 4E6WA 3I7JA 3AGEA 1JTGA 3TOIA 4RX3A 4KZBA 2Q9NA 3DTMA 5KSCA 4ZJ2A 1PWGA 3VOYA 4E3OA 5TR7A 4N9KA 5A90A 2WGWA 4JKTA 1NJ4A 4RA7A 5E2HA 3HLDA 1O7EA 1YLPA 4QY6A 5CHJA 1G6AA 5AQ9A 1MWUA 4S2JA 4U0TA 3UNWA 2WK0A 3V3SA 1IKIA 5CEDA 3HBRA 3BECA 2C6WB 4X56A 1Y54A 1TDLA 1K4FA 1PI4A 2ZQDA 4LV3A 3A3DA 2V1ZA 1FCMA 3UE1A 3A3EA 2ZJ9A 1CK3A 1K56D 1YMXA 3FWLA 2Y2HA 4IEDA 4S2OA 1NZUA 2JBFA 2XD5A 1XGJA 3PBOA 2ZQAA 1KGEA 4GZBA 4XUZA 5AQBA 1XKZA 1Q2QA 5J8XA 3A3JA 2RCXA 1NYYA 4P6BA 3Q1FA 4OONA 3MZDA 4E3IA 4R1GA 4E3JA 4KENB 2Y2MA 2HDQA 4R4SA 4EQIA 4IVKA 4R3JA 3O88A 1ONGA 1KDWA 1LL5A 3CG5A 1W79A 1TDGA 3S1YA 2XFTA 3V50A 4ZTKA 1YLZA 5CGXA 5CXWA 2J7VA 4K91A 3BFCA 3HUMA 4DXCA 5CHMA 5HX9A 2EXBA 5HARA 5F1GA 5FQKA 2ZQ8A 2H0YA 3QNBA 5GLBA 3HL9A 5M18A 4QU3A 2RL3A 3MXSA 4GDNA 5HAQA 2Y55A 1RP5A 3VSLA 3ISGA 2P9VA 1L0DA 3G32A 1W8YA 3NC8A 1IEMA 3QHYA 3HLGA 5CEBA 1FSWA 3G4PA 4GDBA 4MNRA 2BLSA 2WGVA 3RXXA 3VP4A 4OP5A 1W5DA 4X68A 5DF8A 3VFFA 3O86A 3NBLA 1N4OA 2P9VB 5G18A 2Y2NA 3PAGA 4K0WA 3MFDA 2BG1A 4O7DA 1S6RA 3D4FA 4JPMA 1HTZA 3FYZA 2WYXA 3M6BA 3MKEA 3GR2A 5F82A 4RVAA 4S2IA 1RGZA 5U47A 2R9XA 1JWPA 3IF6A 3OCNA 1PW1A 2XF3A 3GMWA 3W8KA 5FQJA 3S22A 3ITBA 1BUEA 4FCFA 3MZEA 2ZC4B 3O3VA 1GA0A 1ESUA 2WKIA 4OP8A 4A5RA 2XDMA 3NIAA 4HBTA 2X71A 4BD1A 3GRJA 4N1HA 3NY4A 4WZ4A 5M19A 3SS3A 1YT4A 2J9OA 2Z2MB 4IBRA 2DCFA 5AQ7A 1W7FA 5I94A 1IYSA 1NRFA 4Y0UA 4JXGA 4GN2A 4DDSA 3G30A 3V39A 2Y2QA 4QY5A 4BQMA 5EPHA 3SH8A 4RX2A 1FQGA 4U0XA 4X69A 3ZGAB 1E4DA 3HVFA 2WKHA 1FOFA 1LLBA 5GHXA 2FFYA 4OQIA 1E3UD 1DJCA 3RXWA 1K55C 3IHAA 2ZLYA 4P0MA 4RYEA 3GV9A 1VM1A 1XPBA 3N7WA 5KZHA 4N9LA 4KQOA 4OQ0A 4NK3A 4UHUA 4N92A 4KZAA 5DVAA 3N8LA 1E3UA 3GSGA 4KZ3A 3WS0A 4ZJ3A 3BYDA 2Y2LA 3P98A 2V2FF 4S2KA 4DE2A 4JXVA 3WS4A 1DJAA 1EI5A 3Q7ZA 2WZXA 4QHCA 1L0FA 5EE8A 3HLEA 1ZG6A 3PBTA 4E3LA 3SH9A 5EVID 1MY8A 4FH4A 2H5SA 3LY4A 1I2WA 3PBRA 1YLJA 1JWZA 4JF4A 4S2NC 3CZDA 1ERMA 3WS5A 2PU2A 5HFOA 4JF6A 5DTTA 3RJUA 1PWCA 4EBLA 1SKFA 1K54C 5F1FA 2JC7A 4OLDA 4DDYA 2R9WA 2EFUA 1HZOA 3CJMA 4PMAA 4E3KA 3G34A 3BFFA 3A3IA 2OLVA 2EX6A 4K0XA 4CPKA 1K55A 1GHPA 2Q9MA 1MWRA 2IWBA 3ZG8B 3HUOA 4S2MA 1S0WA 3CMZA 5CTMA 2ZC5B 3IWIA 1H8ZA 5CGWA 4PM6A 2Y2JA 4KG6A 2Y91A 5FI6A 2G2WA 1CI8A 1K57C 1O07A 1SDEA 2FFFB 5EUAA 3UDXA 3BRMA 1VQQA 2IWDA 5CGSA 5EVIA 3OZHA 2OLUA 3HLWA 3N8RA 4WZ5C 3BFGA 4OQHA 4EUZA 1Q2PA 3FKVA 3G35A 1EROA 1ALQA 3M2JA 3MZFA 4MBHA 4OKPA 1L0GA 2Y2PA 2ZQCA 1PZOA 1YLWA 4X55A 3Q7VA 4BENA 4BL2A 4UA9A 5DTKA 1ZC2A 3IF6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IXH A;  4M3K A;  4QB8 A;  4DE0 A;  5AQA A;  3UPN A;  4OOM A;  1GA9 A;  2XQZ A;  1BT5 A;  2XD1 A;  4Y0T A;  3C7V A;  4BL3 A;  4XXR A;  1MBL A;  2V20 A;  1LHY A;  3N8S A;  4KZ7 A;  2XK1 A;  3Q82 A;  3N6I A;  4FH2 A;  3WWX A;  1XX2 A;  3BLS A;  3WS2 A;  4E6X A;  2HP6 A;  2A49 A;  1K57 A;  1IYQ A;  4KQR A;  5A93 A;  5L2F A;  2H10 A;  4LEN A;  3UE0 A;  4WEJ A;  2OSU A;  4WZ5 A;  4KZ6 A;  5CEC A;  3HLB A;  1TVF A;  4YFM A;  3ZVW A;  3W4Q A;  1L0E A;  5CHU A;  4GNU A;  4OH0 A;  3AGF A;  3IF6 C;  3IXG A;  2X01 A;  2WAF A;  4HEF A;  3TG9 A;  4P85 A;  4LCM A;  1PW8 A;  1PYY A;  2PBY A;  4WBG A;  2P74 A;  5DTS A;  3SOI A;  3VMA A;  5FA7 A;  3ZDJ A;  1SHV A;  1XA1 A;  1KVM A;  2WKE A;  3ZCZ A;  3GVB A;  3NDG A;  4OQG A;  4GKU A;  4F94 A;  1FR1 A;  2JE5 A;  2ZQ9 A;  5TFQ A;  1PIO A;  4ZBE A;  2Y2G A;  4ZAM A;  3IXB A;  3BM6 A;  5CTN A;  3IWO A;  1IYP A;  3M6H A;  2PU4 A;  3Q07 A;  2ZM8 A;  3VP1 A;  1WYB A;  4WEK A;  3LO7 A;  2A3U A;  3BFD A;  1NXY A;  4S2P A;  3UE3 A;  2ZD8 A;  3IT9 A;  2Z2L B;  3G2Z A;  2G2U A;  3C4P A;  2WUQ A;  4LV2 A;  3PAE A;  5HAP A;  3VFH A;  3E2L A;  4KG2 A;  1LI0 A;  1BLS A;  4GD8 A;  5FSR A;  4B4X A;  1LL9 A;  4KG5 A;  4QJG A;  1MWS A;  1SDN A;  2EFX A;  2EX8 A;  3DW0 A;  3E2K A;  4MLL A;  5E2G A;  3ZG7 B;  2WZZ A;  1BLC A;  4EBN A;  2EXA A;  1K6S A;  1K38 A;  2DNS A;  5DF7 A;  3MKF A;  3VOZ A;  1KDS A;  1JWV A;  1K4E A;  3C4O A;  2J9P A;  1MXO A;  5GHZ A;  4P87 A;  1ESI A;  5FAQ A;  4UAA A;  4EV4 A;  4DF6 A;  5GL9 A;  3LY3 A;  4Y7P A;  2ZM2 A;  2Y2K A;  1QME A;  5FAP A;  1H5X A;  2X02 A;  1K25 A;  4UA7 A;  3SS4 A;  1IYO A;  4KZ9 A;  4WMC A;  4OPR A;  1MKI A;  4JXS A;  5FDH A;  2UWX A;  1BUL A;  1K54 A;  3BEB A;  1DJB A;  2XEP A;  1KE0 A;  3Q7V B;  4XUX A;  3UY6 A;  4B88 A;  3C5A A;  3IHB A;  2Y4A A;  4OVD A;  2WGW B;  5FAO A;  3UO9 A;  3S4X A;  4OOY A;  5FI7 A;  5FQI A;  3ZG5 A;  4X53 A;  5GLD A;  2J8Y A;  2ZMA A;  3NI9 A;  4OOL A;  3OC2 A;  3OPH A;  4MEZ A;  5IHV A;  1M6K A;  3GTC A;  5HAI A;  4WM9 A;  3V5M A;  3UPO A;  2XLN A;  3MXR A;  1XP4 A;  1C3B A;  2XR0 A;  1ZKJ A;  1GHI A;  1ES3 A;  4Z9Q A;  3PBQ A;  4OPQ A;  1WYC A;  3WRT A;  3ZVT A;  3M2K A;  1YLT A;  2EX2 A;  4EBP A;  3UDI A;  3A3F A;  3SS5 A;  1KGF A;  3MBZ A;  2C5W B;  4C3Q A;  3VP0 A;  2B5R A;  2XFS A;  4KZ4 A;  3P09 A;  1BSG A;  1K6R A;  3G2Y A;  1CEF A;  2QPN A;  5TGF A;  3IF5 A;  4DXB A;  3AGD A;  3LEZ A;  1RCJ A;  3OPL A;  3OCL A;  1IKG A;  2H0T A;  1KE4 A;  2QMI A;  4IVI A;  3ZHH A;  4LV0 A;  4LCL A;  4JLF A;  1GCE A;  4PM8 A;  4R0Q A;  3HUN A;  3PTE A;  1EWZ A;  1XA7 A;  3FZC A;  3W4O A;  4WYY A;  3JYI A;  4BLM A;  1G68 A;  1BZA A;  2WAE A;  5E2E A;  5FQQ A;  4ZDX A;  5HL1 A;  4U3T A;  1QMF A;  3UDF A;  4E3N A;  3UN7 A;  2ZC6 B;  2JCH A;  4KZ5 A;  1ES2 A;  2EX9 A;  3IH8 A;  1Z6F A;  1BLP A;  4OPZ A;  5EVL A;  4WEL A;  2XGN A;  3HRE A;  1YQS A;  3IH9 A;  4R3B A;  3B3X A;  1OME A;  4ID4 A;  1W8Q A;  4BD0 A;  4FSF A;  4QD4 A;  2ZC3 B;  4UA6 A;  3SH7 A;  3QNC A;  4MBF A;  2Y2O A;  5CER A;  1J9M A;  1PZP A;  4HBU A;  4N1X A;  5F83 A;  2E8I A;  3V3R A;  3FV7 A;  5A92 A;  2DRW A;  2Y59 A;  4S2N A;  4IBX A;  3DWK A;  4GOG A;  3HLC A;  4CJN A;  1CEG A;  1KE3 A;  3NDE A;  4HES A;  4KZ8 A;  4YIN A;  4S2L A;  3N4I A;  1ONH A;  2QZ6 A;  3BLM A;  1FCN A;  4LV1 A;  5E2F A;  5EEC A;  1XGI A;  5EVI C;  5FQM A;  1YMS A;  4DRT A;  1I2S A;  1IEL A;  1WE4 A;  2ZQ7 A;  3G31 A;  4Y0O A;  3FKW A;  4JXW A;  2OV5 A;  3WS1 A;  5FAS A;  1MPL A;  1XXM A;  5GLC A;  3VSK A;  5KSH A;  3IWQ A;  4Q8I A;  4JBF A;  1TEM A;  4C6Y A;  5DF9 A;  5EOO A;  5HW3 A;  1KVL A;  4GB7 A;  3ZFZ A;  3IXD A;  5FI2 A;  4BJP A;  2HDR A;  4B4Z A;  1GHM A;  1KGG A;  3ZNY A;  4GD6 A;  5BOH A;  4L0L A;  1I5Q A;  2IWC A;  5CRF A;  4DE1 A;  2ZC7 A;  1LI9 A;  3ZNT A;  4ZJ1 A;  4DKI A;  1FR6 A;  3C7U A;  1HVB A;  3W4P A;  2XH9 A;  1YLY A;  2HP5 A;  1NYM A;  1U60 A;  3BFE A;  1SCW A;  4X6T A;  2VGK A;  2HDU A;  3WRZ A;  3LCE A;  3GQZ A;  3OPP A;  5M1A A;  4WMC D;  5FQ9 A;  5EVI B;  4OPY A;  1BLH A;  1ZG4 A;  3HLF A;  4FD8 A;  2CC1 A;  5E43 A;  3ZG0 A;  4PM9 A;  1NY0 A;  3Q81 A;  4R23 A;  2HPB A;  1FSY A;  3OPR A;  5FAT A;  3EQV A;  1PWD A;  3VP3 A;  1M40 A;  5GLA A;  1CI9 A;  1BTL A;  2HDS A;  2ZM0 A;  4R4R A;  3ZG9 B;  1HD8 A;  5JYO A;  1K56 A;  4NET A;  4PM5 A;  5JYP A;  1YM1 A;  2Y2I A;  1DY6 A;  5EOE A;  2WGI A;  3TSG A;  5KMW A;  1ERQ A;  1NZO A;  2WAD A;  2GDN A;  4MBK A;  5GHY A;  1MWT A;  4KQQ A;  1AXB A;  1FCO A;  1PI5 A;  4PM7 A;  1RGY A;  3UPP A;  1JTD A;  4EWF A;  3ITA A;  2HP9 A;  4H8R A;  4JF5 A;  3O87 A;  1N9B A;  1ES4 A;  3NCK A;  4PPR A;  3IQA A;  3DWZ A;  1H8Y A;  4C75 A;  4E3M A;  1ES5 A;  1L2S A;  2I72 A;  3PBS A;  5D3O A;  3EQU A;  4D2O A;  4DE3 A;  1E25 A;  1JVJ A;  2VGJ A;  4OLG A;  5A91 A;  3VP2 A;  3PBN A;  4E6W A;  3I7J A;  3AGE A;  1JTG A;  3TOI A;  4RX3 A;  4KZB A;  2Q9N A;  3DTM A;  5KSC A;  4ZJ2 A;  1PWG A;  3VOY A;  4E3O A;  5TR7 A;  4N9K A;  5A90 A;  2WGW A;  4JKT A;  1NJ4 A;  4RA7 A;  5E2H A;  3HLD A;  1O7E A;  1YLP A;  4QY6 A;  5CHJ A;  1G6A A;  5AQ9 A;  1MWU A;  4S2J A;  4U0T A;  3UNW A;  2WK0 A;  3V3S A;  1IKI A;  5CED A;  3HBR A;  3BEC A;  2C6W B;  4X56 A;  1Y54 A;  1TDL A;  1K4F A;  1PI4 A;  2ZQD A;  4LV3 A;  3A3D A;  2V1Z A;  1FCM A;  3UE1 A;  3A3E A;  2ZJ9 A;  1CK3 A;  1K56 D;  1YMX A;  3FWL A;  2Y2H A;  4IED A;  4S2O A;  1NZU A;  2JBF A;  2XD5 A;  1XGJ A;  3PBO A;  2ZQA A;  1KGE A;  4GZB A;  4XUZ A;  5AQB A;  1XKZ A;  1Q2Q A;  5J8X A;  3A3J A;  2RCX A;  1NYY A;  4P6B A;  3Q1F A;  4OON A;  3MZD A;  4E3I A;  4R1G A;  4E3J A;  4KEN B;  2Y2M A;  2HDQ A;  4R4S A;  4EQI A;  4IVK A;  4R3J A;  3O88 A;  1ONG A;  1KDW A;  1LL5 A;  3CG5 A;  1W79 A;  1TDG A;  3S1Y A;  2XFT A;  3V50 A;  4ZTK A;  1YLZ A;  5CGX A;  5CXW A;  2J7V A;  4K91 A;  3BFC A;  3HUM A;  4DXC A;  5CHM A;  5HX9 A;  2EXB A;  5HAR A;  5F1G A;  5FQK A;  2ZQ8 A;  2H0Y A;  3QNB A;  5GLB A;  3HL9 A;  5M18 A;  4QU3 A;  2RL3 A;  3MXS A;  4GDN A;  5HAQ A;  2Y55 A;  1RP5 A;  3VSL A;  3ISG A;  2P9V A;  1L0D A;  3G32 A;  1W8Y A;  3NC8 A;  1IEM A;  3QHY A;  3HLG A;  5CEB A;  1FSW A;  3G4P A;  4GDB A;  4MNR A;  2BLS A;  2WGV A;  3RXX A;  3VP4 A;  4OP5 A;  1W5D A;  4X68 A;  5DF8 A;  3VFF A;  3O86 A;  3NBL A;  1N4O A;  2P9V B;  5G18 A;  2Y2N A;  3PAG A;  4K0W A;  3MFD A;  2BG1 A;  4O7D A;  1S6R A;  3D4F A;  4JPM A;  1HTZ A;  3FYZ A;  2WYX A;  3M6B A;  3MKE A;  3GR2 A;  5F82 A;  4RVA A;  4S2I A;  1RGZ A;  5U47 A;  2R9X A;  1JWP A;  3IF6 A;  3OCN A;  1PW1 A;  2XF3 A;  3GMW A;  3W8K A;  5FQJ A;  3S22 A;  3ITB A;  1BUE A;  4FCF A;  3MZE A;  2ZC4 B;  3O3V A;  1GA0 A;  1ESU A;  2WKI A;  4OP8 A;  4A5R A;  2XDM A;  3NIA A;  4HBT A;  2X71 A;  4BD1 A;  3GRJ A;  4N1H A;  3NY4 A;  4WZ4 A;  5M19 A;  3SS3 A;  1YT4 A;  2J9O A;  2Z2M B;  4IBR A;  2DCF A;  5AQ7 A;  1W7F A;  5I94 A;  1IYS A;  1NRF A;  4Y0U A;  4JXG A;  4GN2 A;  4DDS A;  3G30 A;  3V39 A;  2Y2Q A;  4QY5 A;  4BQM A;  5EPH A;  3SH8 A;  4RX2 A;  1FQG A;  4U0X A;  4X69 A;  3ZGA B;  1E4D A;  3HVF A;  2WKH A;  1FOF A;  1LLB A;  5GHX A;  2FFY A;  4OQI A;  1E3U D;  1DJC A;  3RXW A;  1K55 C;  3IHA A;  2ZLY A;  4P0M A;  4RYE A;  3GV9 A;  1VM1 A;  1XPB A;  3N7W A;  5KZH A;  4N9L A;  4KQO A;  4OQ0 A;  4NK3 A;  4UHU A;  4N92 A;  4KZA A;  5DVA A;  3N8L A;  1E3U A;  3GSG A;  4KZ3 A;  3WS0 A;  4ZJ3 A;  3BYD A;  2Y2L A;  3P98 A;  2V2F F;  4S2K A;  4DE2 A;  4JXV A;  3WS4 A;  1DJA A;  1EI5 A;  3Q7Z A;  2WZX A;  4QHC A;  1L0F A;  5EE8 A;  3HLE A;  1ZG6 A;  3PBT A;  4E3L A;  3SH9 A;  5EVI D;  1MY8 A;  4FH4 A;  2H5S A;  3LY4 A;  1I2W A;  3PBR A;  1YLJ A;  1JWZ A;  4JF4 A;  4S2N C;  3CZD A;  1ERM A;  3WS5 A;  2PU2 A;  5HFO A;  4JF6 A;  5DTT A;  3RJU A;  1PWC A;  4EBL A;  1SKF A;  1K54 C;  5F1F A;  2JC7 A;  4OLD A;  4DDY A;  2R9W A;  2EFU A;  1HZO A;  3CJM A;  4PMA A;  4E3K A;  3G34 A;  3BFF A;  3A3I A;  2OLV A;  2EX6 A;  4K0X A;  4CPK A;  1K55 A;  1GHP A;  2Q9M A;  1MWR A;  2IWB A;  3ZG8 B;  3HUO A;  4S2M A;  1S0W A;  3CMZ A;  5CTM A;  2ZC5 B;  3IWI A;  1H8Z A;  5CGW A;  4PM6 A;  2Y2J A;  4KG6 A;  2Y91 A;  5FI6 A;  2G2W A;  1CI8 A;  1K57 C;  1O07 A;  1SDE A;  2FFF B;  5EUA A;  3UDX A;  3BRM A;  1VQQ A;  2IWD A;  5CGS A;  5EVI A;  3OZH A;  2OLU A;  3HLW A;  3N8R A;  4WZ5 C;  3BFG A;  4OQH A;  4EUZ A;  1Q2P A;  3FKV A;  3G35 A;  1ERO A;  1ALQ A;  3M2J A;  3MZF A;  4MBH A;  4OKP A;  1L0G A;  2Y2P A;  2ZQC A;  1PZO A;  1YLW A;  4X55 A;  3Q7V A;  4BEN A;  4BL2 A;  4UA9 A;  5DTK A;  1ZC2 A;  3IF6 B; 
#chains in the Genus database with same CATH topology
 1XFQ A;  3IXH A;  5AQA A;  3T4L A;  2W3D A;  2VEA A;  4X1L A;  4X1M A;  3N8S A;  3Q82 A;  2HZ5 A;  1XX2 A;  3BLS A;  4HP9 A;  2W3F A;  3NJA A;  2A49 A;  5L2F A;  4LEN A;  3UE0 A;  4G3V A;  4KZ6 A;  1S1Y A;  3HLB A;  1TVF A;  1VHM A;  3HJI A;  2VA0 A;  3IXG A;  4DN0 A;  2X01 A;  3TG9 A;  4LCM A;  4I38 A;  5DTS A;  1XA1 A;  1KVM A;  4P6Z M;  1D7E A;  4LPZ A;  3T4K A;  1LSW A;  5TFQ A;  1PIO A;  4ZBE A;  1VEU B;  2Y2G A;  4ZAM A;  3IXB A;  5CTN A;  3IWO A;  3Q07 A;  2ZM8 A;  3VP1 A;  1Y4O A;  2VX8 A;  3UE3 A;  2ZD8 A;  2Z2L B;  4LV2 A;  3PAE A;  3VFH A;  5FSR A;  3UB7 A;  4B4X A;  4KG5 A;  4QJG A;  3H9W A;  5E2G A;  2OWH A;  3G6O A;  3ZG7 B;  1BLC A;  2EXA A;  3QP8 A;  4I5S A;  3VOZ A;  5EM1 A;  1KDS A;  2J9P A;  1MXO A;  5FAQ A;  4EV4 A;  1ZHH B;  3LUQ A;  1QME A;  5FAP A;  2UV0 E;  2M7V A;  4UA7 A;  2PD7 A;  3LIC A;  4WMC A;  3F1P B;  4MN6 A;  1HLU P;  1K54 A;  4ESP A;  4XUX A;  3UY6 A;  4OVD A;  2Y4A A;  3S4X A;  2V0U A;  5FQI A;  2J8Y A;  2ZMA A;  4LFU A;  5IHV A;  5HAI A;  3GTC A;  3UPO A;  2XLN A;  3GDI A;  4PKY A;  1GHI A;  4EU0 A;  3PBQ A;  4OPQ A;  3V67 A;  3M2K A;  4EBP A;  4HH2 A;  3A3F A;  1KGF A;  2Q0O A;  2OOL A;  5MC7 A;  4Q0H A;  3IF5 A;  2VGL S;  5AJG A;  2H0T A;  4IVI A;  4FUW A;  2P08 A;  3PTE A;  1XA7 A;  4WYY A;  3LYX A;  3S7Q A;  4Y15 A;  2JCH A;  1ES2 A;  2EX9 A;  3ZYT A;  2XRO A;  3IX3 A;  3UB8 A;  4WEL A;  1OT6 A;  4R3B A;  1OME A;  1W8Q A;  1XJ6 A;  2G7U A;  2VV7 A;  4UA6 A;  2V9A A;  2D02 A;  2Y2O A;  4N1X A;  3GEC A;  2OWJ A;  3CIT A;  3DWK A;  4GLQ A;  1KE3 A;  3NDE A;  4HES A;  3ULF A;  4IHQ A;  4EEP A;  4HP4 A;  3BLM A;  1PNE A;  5FQM A;  3BY8 A;  1IEL A;  2ZQ7 A;  3WS1 A;  3EEA A;  1XXM A;  1GSV A;  2W1R A;  4HJ3 A;  5GLC A;  4JBF A;  1TEM A;  4C6Y A;  5DF9 A;  5I5L A;  3RH8 B;  1KVL A;  4GB7 A;  4DMZ A;  4BJP A;  1LI9 A;  3ZNT A;  1D1J A;  1HVB A;  2HP5 A;  1NYM A;  1U60 A;  2H28 A;  4WMC D;  5EVI B;  3CHW P;  4FD8 A;  2CC1 A;  1NY0 A;  4R23 A;  2HPB A;  3OPR A;  2JN7 A;  1CI9 A;  1BTL A;  4R4R A;  3EEH A;  4NET A;  4PM5 A;  3MFX A;  1DY6 A;  4CLC D;  1W63 Q;  4O01 A;  1YPR A;  2WAD A;  2GDN A;  2PBD P;  4ME4 A;  5GHY A;  1MWT A;  1FCO A;  4PM7 A;  5HL6 A;  4UQI S;  1JTD A;  1ZTU A;  4EWF A;  2FH5 A;  3ITA A;  3O87 A;  4KUO A;  3NCK A;  4PPR A;  3OOV A;  1SZV A;  3K3D A;  5D3O A;  1LL8 A;  4XT2 B;  4DE3 A;  4E6W A;  3PBN A;  4BBT A;  1P9W A;  1N9L A;  2M1C A;  3DTM A;  1PWG A;  2W3H A;  3U4L P;  4E3O A;  4HNB A;  5TR7 A;  5K5B A;  4JKT A;  5E2H A;  1O7E A;  5CHJ A;  5HPI A;  4DJ2 A;  3C30 A;  2JKT M;  3UNW A;  2WK0 A;  1IKI A;  1YAX A;  3HBR A;  1TDL A;  2V1Z A;  3A3E A;  3MJQ A;  5DKL A;  1CK3 A;  4IED A;  4L9G A;  2JBF A;  4GZB A;  1XGJ A;  4XUZ A;  2ZQA A;  3EGD C;  3A3J A;  4EER A;  2RCX A;  1NYY A;  4P6B A;  2PD8 A;  4L9E A;  3D3O A;  4E3J A;  2P7J A;  4EQI A;  3CG5 A;  1W79 A;  1GSW A;  3S1Y A;  4ZTK A;  5CGX A;  3S7O A;  3BFC A;  1WA9 A;  3EWK A;  1NWZ A;  2RL3 A;  4GDN A;  3F1O B;  1RP5 A;  3A0S A;  3G32 A;  1FSW A;  3G4P A;  3LFV A;  3RXX A;  3KSH A;  3VP4 A;  1OTA A;  2PT7 A;  5G18 A;  1OT9 A;  2B02 A;  1S4R A;  1S6R A;  2HV1 A;  3D4F A;  3FYZ A;  3LIA A;  3MKE A;  3GR2 A;  3LR0 A;  5U47 A;  2V1B A;  2R9X A;  1JWP A;  2XF3 A;  5FQJ A;  3S22 A;  1BUE A;  3O3V A;  3NIA A;  4HBT A;  1NLZ A;  4WZ4 A;  3SS3 A;  1S1Z A;  4GJ4 A;  3A0R A;  1NRF A;  4Y0U A;  4JXG A;  4QY5 A;  3VV4 A;  2VZW A;  4ETZ A;  3HVF A;  1FOF A;  3ZQ5 A;  4P0M A;  3N7W A;  5KZH A;  4N92 A;  4KZA A;  4KZ3 A;  3LIB A;  4S2K A;  3IX4 A;  1EI5 A;  1XJ4 A;  2YKH A;  3Q7Z A;  3HLE A;  1ZG6 A;  4FH4 A;  5AVE A;  4JF4 A;  2PU2 A;  1PWC A;  2PRF A;  1STZ A;  3C2W A;  4DDY A;  3G34 A;  3BFF A;  2QWS A;  3LIE A;  1H3Q A;  3BQ8 A;  2WKP A;  4S2M A;  3IWI A;  5CGW A;  5HD5 A;  2FFF B;  1O07 A;  5J4E A;  1VQQ A;  2XA7 M;  4II7 A;  4OQH A;  3G35 A;  4GS9 B;  4OKP A;  1PZO A;  5DTK A;  3G2Z A;  4M3K A;  4QB8 A;  1GA9 A;  4IUK A;  4XXR A;  3WWX A;  1LHY A;  3N6I A;  3WS2 A;  4E6X A;  5EFW A;  1YKD A;  2H10 A;  4WEJ A;  2J80 A;  2PDR A;  4WZ5 A;  5CEC A;  5HWV A;  3ZVW A;  1L0E A;  5CHU A;  4GNU A;  5L09 A;  2WAF A;  1KOU A;  1PW8 A;  4HOI A;  2PBY A;  3VMA A;  2P74 A;  3SOI A;  3ZDJ A;  5FA7 A;  1SHV A;  2WKE A;  5FEF A;  3NDG A;  4GKU A;  2ZQ9 A;  5HWW A;  4G3K A;  4R70 A;  3E4O A;  5DJU A;  1IYP A;  1WYB A;  4S2P A;  3IT9 A;  2G2U A;  2WUQ A;  4FTX A;  2PYR A;  4MN5 A;  1LL9 A;  1SDN A;  2EFX A;  2WZZ A;  1K6S A;  1K4E A;  4NXB A;  4ZRR A;  5GHZ A;  4P87 A;  1ESI A;  1FIL A;  4DF6 A;  3LY3 A;  1H5X A;  4XT2 A;  3SS4 A;  3KSI A;  4KZ9 A;  4OPR A;  2UWX A;  1BUL A;  1K0K A;  1TS8 A;  2XEP A;  4B88 A;  3C5A A;  3IHB A;  2WGW B;  2YKF A;  5FI7 A;  2OAQ 1;  4X53 A;  5LBR A;  2V1A A;  3UE6 A;  3OC2 A;  3OPH A;  4MEZ A;  4G3W A;  3V5M A;  4WM9 A;  2QJ7 A;  3IBR A;  1XP4 A;  1OTD A;  1ES3 A;  2K31 A;  1T18 A;  2BAS A;  3SS5 A;  3MBZ A;  5EVE A;  2C5W B;  4C3Q A;  3VP0 A;  1SKO A;  4KZ4 A;  3P09 A;  2Y8H A;  5TGF A;  2ZL1 A;  3OPL A;  3E0Y A;  3OCL A;  4NG2 A;  1KE4 A;  3NEC A;  2PHY A;  4JLF A;  4PM8 A;  4R0Q A;  3FZC A;  3W4O A;  4BLM A;  3T1S A;  2WAE A;  1BZA A;  4Z1W A;  5E2E A;  5FQQ A;  1X0O A;  1Z6F A;  1BLP A;  1LSX A;  3HRE A;  3BWL A;  2HGV A;  1YQS A;  3IH9 A;  3K3C A;  4ID4 A;  4QD4 A;  2ZC3 B;  4H6J A;  1IOU A;  4MBF A;  3FPV A;  4R3A A;  1J9M A;  2QYB A;  3V3R A;  3FV7 A;  5A92 A;  2Y59 A;  4CJN A;  2O99 A;  4KZ8 A;  3NHQ A;  4EEU A;  4YIN A;  3N4I A;  1ONH A;  3NOU C;  4PKY G;  4UEY A;  4WUJ A;  5E2F A;  1XGI A;  4DRT A;  3DBA A;  1WE4 A;  2OV5 A;  1YSP A;  4Y0O A;  3FKW A;  3IWQ A;  5FI2 A;  1EW0 A;  1KGG A;  3ZNY A;  4L0L A;  5CRF A;  1CQA A;  3B33 A;  3LR3 A;  2A24 A;  3C7U A;  4JGP A;  1YLY A;  5DFX A;  3BFE A;  4ARZ A;  1SCW A;  2VGK A;  3LCE A;  3OPP A;  2ZBB A;  2B18 A;  5E43 A;  4B93 A;  4CLC C;  1HD8 A;  5JYO A;  4KQD A;  3DTE A;  3TSG A;  5HDC A;  1ERQ A;  5G4Z A;  4KQQ A;  4H8R A;  4JF5 A;  1N9B A;  1ES4 A;  4C75 A;  4E3M A;  1ES5 A;  1L2S A;  3EQU A;  2VGJ A;  4OLG A;  3TE8 A;  3TOI A;  5KSC A;  3VOY A;  4O8G A;  2JKF A;  4N9K A;  5A90 A;  2WGW A;  1PRQ A;  4NXG A;  4D60 A;  4RA7 A;  1CJF A;  5F6A A;  1ZC2 A;  1G6A A;  3CUE C;  3W2Z A;  1XJ3 A;  3QP4 A;  1PI4 A;  3QP5 A;  2L0W A;  3UE1 A;  1VET B;  4NXF A;  3D72 A;  5HDS A;  1XKZ A;  1Q2Q A;  1S66 L;  3Q1F A;  1H0M A;  4OON A;  3TJZ C;  3PXP A;  2HDQ A;  4R4S A;  3O88 A;  1ONG A;  1LL5 A;  2XFT A;  5HX9 A;  5F1G A;  3JVU A;  5GLB A;  3HL9 A;  5M18 A;  3F1N A;  3ISG A;  4IUH A;  2P9V A;  5FL3 A;  3FPW A;  5AVF A;  2ZMV A;  1IEM A;  4GHI B;  5CEB A;  1F98 A;  4MNR A;  1OJG A;  1W5D A;  3LI9 A;  3VFF A;  2P9V B;  5G4Y A;  2CMN A;  3PAG A;  2BG1 A;  3IS2 A;  3MSH A;  4I3I A;  1RGZ A;  1VEU A;  3OCN A;  3B42 A;  3GMW A;  3ITB A;  2XA7 S;  4FCF A;  3MZE A;  3IBJ A;  3LID A;  4WF0 A;  3NY4 A;  5M19 A;  1YT4 A;  2J9O A;  2Z2M B;  2DCF A;  5AQ7 A;  1VET A;  4GN2 A;  4DDS A;  3V39 A;  3SH8 A;  3P01 A;  2BTF P;  1FQG A;  4NKP A;  4U0X A;  2W1T B;  3T1Q B;  2FFY A;  4OQI A;  1E3U D;  5EV0 A;  2EWW A;  4RYE A;  3RTY A;  1XPB A;  3T4T A;  1A0K A;  4B9O A;  4OQ0 A;  4UHU A;  2V0W A;  5DVA A;  3TRC A;  2Y2L A;  3CPT B;  2L1M A;  4Y17 A;  5EVI D;  1MY8 A;  2H5S A;  3LY4 A;  3PBR A;  1JWZ A;  3H82 B;  3CZD A;  3WS5 A;  4JF6 A;  4EBL A;  5HPF A;  2JC7 A;  2R9W A;  2EFU A;  5IT5 A;  4E3K A;  2OLV A;  3QP1 A;  1GHP A;  3R7W A;  2Q9M A;  1MWR A;  3MQQ A;  2IWB A;  3ZG8 B;  2ZMF A;  5CTM A;  2ZC5 B;  5L8M A;  1H8Z A;  1V9Z A;  4PM6 A;  1TS7 A;  4KG6 A;  1T1A A;  5DFY A;  1K57 C;  1SDE A;  5EUA A;  1FIK A;  3HLW A;  3N8R A;  3M2J A;  1MZU A;  2Y2P A;  3Q7V A;  2VLG A;  4BEN A;  4BL2 A;  4UA9 A;  3IF6 B;  3PYP A;  4DE0 A;  3UPN A;  3C7V A;  2V20 A;  4KZ7 A;  2XK1 A;  3T50 A;  3ICY A;  4KQR A;  4P6Z S;  3HCY A;  4YFM A;  3B47 A;  2J3T D;  3AGF A;  3IF6 C;  1P97 A;  4P85 A;  4GCZ A;  4IJG A;  4F3L B;  1DP8 A;  1PYY A;  2K7S A;  3BY9 A;  4WBG A;  3UB6 A;  2O9C A;  4F94 A;  2JE5 A;  1T1C A;  4I3A A;  2AVX A;  4BBV A;  3MF0 A;  2A3U A;  3BFD A;  2Y79 A;  1NXY A;  3UME A;  1XFN A;  3VE4 A;  3E2L A;  4KG2 A;  1LI0 A;  4GD8 A;  4EUV A;  1JNU A;  1MWS A;  4MLL A;  3E2K A;  4LLO B;  1S67 L;  4NXE A;  3MKF A;  4EQ1 A;  3FC7 A;  4UAA A;  5GL9 A;  4Y7P A;  5IS1 A;  1IYO A;  4H6J B;  3LEQ A;  4LRZ E;  3BEB A;  1DJB A;  1KE0 A;  2HF6 A;  3Q7V B;  3NOP C;  1F9I A;  3KX0 X;  3T1X A;  2WKQ A;  5GLD A;  3NI9 A;  4HI4 A;  2XR0 A;  1ZKJ A;  1Y28 A;  4Z9Q A;  2Z6C A;  1WYC A;  3ZVT A;  3MMH A;  4Y13 A;  2EX2 A;  2B5R A;  4JGR A;  3P7N A;  3DTI A;  3LGO A;  2XFS A;  1BSG A;  1K6R A;  3G2Y A;  1CEF A;  1SKO B;  2QPN A;  4BBU A;  4DXB A;  3LEZ A;  3SZT A;  1RCJ A;  2MJ6 A;  3H82 A;  1F5M A;  1IKG A;  4GW9 A;  2QMI A;  2FZ0 A;  1OPX A;  4LV0 A;  1GCE A;  4E3I A;  2PYP A;  3JYI A;  1G68 A;  2NUT C;  4U3T A;  1QMF A;  4E3N A;  2J3W A;  3UN7 A;  5C5K A;  4KZ5 A;  5EVL A;  4HY8 A;  1UWP X;  3R4K A;  3B3X A;  1XJ2 A;  4FSF A;  4BD0 A;  1LSV A;  3SH7 A;  3QNC A;  2O9B A;  2E8J A;  4LRX C;  4HBU A;  2L4R A;  1NRJ A;  1CEG A;  1H8M A;  2QZ6 A;  1FCN A;  3T1R A;  5EVI C;  5J3W A;  2GZA A;  4JXW A;  3VSK A;  5KSH A;  4HJ6 A;  5EOO A;  5HW3 A;  3T12 B;  5BOH A;  4BMW A;  4GD6 A;  2IWC A;  4DJ3 A;  4ZJ1 A;  3KSG A;  2XH9 A;  4X6T A;  3WRZ A;  3GQZ A;  5M1A A;  3BQA A;  3HLF A;  3ZG0 A;  4PM9 A;  1OTE A;  1N9O A;  2XRN A;  5FAT A;  3EQV A;  5GLA A;  4KUK A;  2IA2 A;  3ZG9 B;  2OAP 1;  2VKS A;  1S4S A;  3KO6 A;  5JYP A;  1P0Z A;  5EOE A;  2WGI A;  5KMW A;  4MBK A;  1AXB A;  4WL9 A;  1RGY A;  2HP9 A;  4Y3I A;  3DWZ A;  4MN7 A;  3PBS A;  2I72 A;  1E25 A;  5A91 A;  3VP2 A;  3I7J A;  3IX8 A;  1DP9 A;  1OTI A;  4ZJ2 A;  4GS9 A;  1NJ4 A;  1G5U A;  2HJ9 C;  1GSX A;  2A24 B;  2V8C A;  3C8C A;  4GHI A;  4QY6 A;  4Y2F A;  1MWU A;  3F1N B;  4M4X A;  3V3S A;  2I9V A;  1Y54 A;  3K2N A;  3KYZ A;  5DKK A;  3QP2 A;  3A3D A;  1K56 D;  3FWL A;  4S2O A;  1NZU A;  3PBO A;  3BJN A;  5J8X A;  3MZD A;  4IVK A;  4R3J A;  2JKR I;  3V50 A;  1YLZ A;  5CXW A;  4DXC A;  5CHM A;  5HAR A;  5FQK A;  3FG8 A;  2KLI A;  1VB6 A;  5L10 A;  3QNB A;  2Y55 A;  5A8B A;  3D9Y A;  1L0D A;  3NC8 A;  1W8Y A;  2JKG A;  4GDB A;  2BLS A;  2WGV A;  4X68 A;  1D06 A;  4ARZ B;  1N4O A;  2Y2N A;  2KDK A;  3KYQ A;  3S7P A;  4K0W A;  3MFD A;  3LR5 A;  4O7D A;  1YSQ A;  4JPM A;  1HTZ A;  2WYX A;  3UMD A;  1PW1 A;  3CAX A;  3NUL A;  5KIZ A;  3CLO A;  2B95 A;  3L7H A;  2ZC4 B;  2WKI A;  4A5R A;  2X71 A;  3GRJ A;  2PR6 A;  1TF1 A;  2QJ5 A;  1UWN X;  3E4Q A;  3H7W A;  1LT0 A;  3DAV A;  4IBR A;  1W7F A;  1DP6 A;  1IYS A;  2Y2Q A;  5EPH A;  4YNR A;  3EOI A;  3A0V A;  4X69 A;  2WKH A;  1LLB A;  5GHX A;  5J7E A;  2ACG A;  3GV9 A;  3MS6 A;  4HJ4 A;  4KQO A;  1G6O A;  4NK3 A;  3UB9 A;  3N8L A;  4Q0J A;  3GSG A;  4EXO A;  1ACF A;  5HSQ A;  3BYD A;  3C38 A;  2P04 A;  2V2F F;  4DE2 A;  4FOF A;  1DJA A;  2WZX A;  4QHC A;  4E3L A;  3SH9 A;  2LB5 A;  1I2W A;  4S2N C;  2ZL1 B;  2V8F A;  3LR4 A;  5DTT A;  5F1F A;  4OLD A;  4PMA A;  5TJJ A;  1S0W A;  3H7W B;  5F69 A;  2Y91 A;  5FI6 A;  5EM0 A;  4UQI M;  3BRM A;  2IWD A;  5EVI A;  3OZH A;  2JHE A;  3BFG A;  3FKV A;  1ERO A;  4R38 A;  3MZF A;  1L0G A;  2ZQC A;  1YLW A;  1F2K A;  3E98 A;  4YWZ A;  2VK3 A;  4OOM A;  2XQZ A;  1BT5 A;  2XD1 A;  4Y0T A;  4HQA A;  4LRY C;  3JPU A;  4BL3 A;  1MBL A;  1T19 A;  4K08 A;  4FH2 A;  2INW A;  2HP6 A;  5A93 A;  1K57 A;  1IYQ A;  3U2A A;  4ETX A;  2OSU A;  2QHK A;  3W4Q A;  4OH0 A;  3R7W B;  4HEF A;  3RFB A;  1J3W A;  2R78 A;  2M7U A;  3ZCZ A;  3GVB A;  4OQG A;  1FR1 A;  2WKR A;  3BM6 A;  2GX5 A;  2KX6 A;  4I39 A;  3M6H A;  2PU4 A;  1W63 M;  4WEK A;  3LO7 A;  2EA9 A;  2W27 A;  3C4P A;  5HAP A;  3MXQ A;  1BLS A;  2EX8 A;  3DW0 A;  4EBN A;  1K38 A;  2DNS A;  5DF7 A;  2W1T A;  1PFL A;  3C4O A;  1JWV A;  4PHT A;  2D01 A;  5HD3 A;  2PR5 A;  4RQ9 A;  2ZM2 A;  2Y2K A;  3QP6 A;  2X02 A;  1K25 A;  1MKI A;  4JXS A;  5FDH A;  1G28 A;  4HIA A;  3CI6 A;  5FAO A;  3UO9 A;  4OOY A;  4OOL A;  1M6K A;  3MXR A;  1C3B A;  2K2N A;  2VV8 A;  3WRT A;  5HDD A;  1CF0 A;  1YLT A;  4MDZ A;  3UDI A;  3S7N A;  1DRM A;  3HJK A;  4LGW A;  3PHY A;  3AGD A;  2GNX A;  2O0Y A;  2VV6 A;  3ZHH A;  4LCL A;  3HUN A;  1EWZ A;  5TBM A;  4ZDX A;  5HL1 A;  3UDF A;  2ZC6 B;  3IH8 A;  5CX7 A;  2W3E A;  4OPZ A;  2XGN A;  2VGL M;  2J3T C;  1L3L A;  3T4J A;  3KSF A;  3F1P A;  5CER A;  1PZP A;  3IS2 B;  3CPT A;  5F83 A;  2E8I A;  5L07 A;  2DRW A;  4S2N A;  3O5Y A;  4IBX A;  4GOG A;  3HLC A;  3VOL A;  3LIF A;  2GJ3 A;  4S2L A;  3L9K A;  2Z6D A;  2ZOH A;  4LV1 A;  5EEC A;  1YMS A;  1I2S A;  3G31 A;  5FAS A;  3UB5 P;  1MPL A;  4Q8I A;  4NEE D;  4X25 A;  3ZFZ A;  5DJT A;  3IXD A;  2HDR A;  4B4Z A;  1GHM A;  1I5Q A;  4DE1 A;  2ZC7 A;  4Y5F A;  4DKI A;  1FR6 A;  1BYW A;  3W4P A;  4QPR A;  2HDU A;  5FQ9 A;  4QWO A;  4OPY A;  1BLH A;  1ZG4 A;  3OLO A;  2XSS A;  3Q81 A;  2LB9 A;  4WLA A;  5TBM B;  1FSY A;  1PWD A;  3VP3 A;  1M40 A;  3NOT C;  2HDS A;  2ZM0 A;  1K56 A;  1YM1 A;  2Y2I A;  2HJE A;  1NZO A;  3BW6 A;  1PI5 A;  3UPP A;  5FEG A;  3LI8 A;  3IQA A;  1H8Y A;  5IU1 A;  1TD5 A;  4JGO A;  4BWI A;  4D2O A;  1JVJ A;  2KOI A;  3CWF A;  4O0P A;  5F5Y A;  4WN5 A;  3T4O A;  3AGE A;  1JTG A;  4EES A;  4RX3 A;  4KZB A;  2Q9N A;  1V9Y A;  4R6L A;  3HLD A;  1YLP A;  5AQ9 A;  4S2J A;  3F1O A;  4U0T A;  5CED A;  3BEC A;  2C6W B;  4X56 A;  1ODV A;  1K4F A;  2ZQD A;  4LV3 A;  1FCM A;  2ZJ9 A;  4AFI A;  1YMX A;  2Y2H A;  2ZOI A;  1N9N A;  4HH3 A;  2XD5 A;  1KGE A;  5AQB A;  1P9R A;  4R1G A;  4KEN B;  1TS6 A;  2Y2M A;  4L9F A;  4YOF A;  2DMW A;  1KDW A;  3PR6 A;  1TDG A;  1TS0 A;  2J7V A;  3CUE A;  1AWI A;  4K91 A;  3HUM A;  2EXB A;  2ZQ8 A;  2H0Y A;  4HHD A;  3MQ0 A;  4QU3 A;  3MXS A;  5F68 A;  5HAQ A;  3VSL A;  3E4P A;  4Q0I A;  3QHY A;  5HZH A;  3HLG A;  2W3G A;  4OP5 A;  5DF8 A;  3KYE A;  3O86 A;  2NUP C;  3NBL A;  3M6B A;  5F82 A;  4JGQ A;  4RVA A;  4S2I A;  1UGU A;  3IF6 A;  4CLC B;  3W8K A;  1GA0 A;  1ESU A;  4OP8 A;  2QKP A;  4CLC A;  2XDM A;  1MKM A;  4BD1 A;  4N1H A;  1OTB A;  4MCW A;  4PAU A;  5I94 A;  2VJW A;  3G30 A;  4BQM A;  4RX2 A;  3ZGA B;  1E4D A;  1IFQ A;  2W0N A;  3VE3 A;  1DJC A;  1K55 C;  3IHA A;  2ZLY A;  1VM1 A;  4N9L A;  4CQH A;  4EET B;  3EGX C;  1Z09 A;  1E3U A;  3WS0 A;  4ZJ3 A;  3P98 A;  2O9A A;  4JXV A;  3WS4 A;  2JKT I;  2JKR M;  1L0F A;  5EE8 A;  3PBT A;  1YLJ A;  4I3J A;  1ERM A;  5HFO A;  3RJU A;  1SKF A;  1K54 C;  3T4Q A;  3MQO A;  1HZO A;  3CJM A;  3A3I A;  4K0X A;  2EX6 A;  4CLC E;  4CPK A;  4MMN A;  3DTK A;  1K55 A;  2PAV P;  4F3L A;  3HUO A;  4EW7 A;  3CMZ A;  1OJ5 A;  2Y2J A;  3MR0 A;  4E04 A;  2G2W A;  3T4S A;  1CI8 A;  2EWV A;  3JVV A;  3OBF A;  3UDX A;  1T1B A;  5CGS A;  3TW8 A;  2OLU A;  4WZ5 C;  5FDS A;  4EUZ A;  1Q2P A;  1ALQ A;  1MC0 A;  4MBH A;  1NLY A;  5HWT A;  4X55 A;  3RXW A;  3ZG5 A;  3SW1 A;  2A2L A; 
#chains in the Genus database with same CATH homology
 3IXH A;  4M3K A;  4QB8 A;  4DE0 A;  5AQA A;  3UPN A;  4OOM A;  1GA9 A;  2XQZ A;  1BT5 A;  2XD1 A;  4Y0T A;  3C7V A;  4BL3 A;  4XXR A;  1MBL A;  2V20 A;  1LHY A;  3N8S A;  4KZ7 A;  2XK1 A;  3Q82 A;  3N6I A;  4FH2 A;  3WWX A;  1XX2 A;  3BLS A;  3WS2 A;  4E6X A;  2HP6 A;  2A49 A;  1K57 A;  1IYQ A;  4KQR A;  5A93 A;  5L2F A;  2H10 A;  4LEN A;  3UE0 A;  4WEJ A;  2OSU A;  4WZ5 A;  4KZ6 A;  5CEC A;  3HLB A;  1TVF A;  4YFM A;  3ZVW A;  3W4Q A;  1L0E A;  5CHU A;  4GNU A;  4OH0 A;  3AGF A;  3IF6 C;  3IXG A;  2X01 A;  2WAF A;  4HEF A;  3TG9 A;  4P85 A;  4LCM A;  1PW8 A;  1PYY A;  2PBY A;  4WBG A;  2P74 A;  5DTS A;  3SOI A;  3VMA A;  5FA7 A;  3ZDJ A;  1SHV A;  1XA1 A;  1KVM A;  2WKE A;  3ZCZ A;  3GVB A;  3NDG A;  4OQG A;  4GKU A;  4F94 A;  1FR1 A;  2JE5 A;  2ZQ9 A;  5TFQ A;  1PIO A;  4ZBE A;  2Y2G A;  4ZAM A;  3IXB A;  3BM6 A;  5CTN A;  3IWO A;  1IYP A;  3M6H A;  2PU4 A;  3Q07 A;  2ZM8 A;  3VP1 A;  1WYB A;  4WEK A;  3LO7 A;  2A3U A;  3BFD A;  1NXY A;  4S2P A;  3UE3 A;  2ZD8 A;  3IT9 A;  2Z2L B;  3G2Z A;  2G2U A;  3C4P A;  2WUQ A;  4LV2 A;  3PAE A;  5HAP A;  3VFH A;  3E2L A;  4KG2 A;  1LI0 A;  1BLS A;  4GD8 A;  5FSR A;  4B4X A;  1LL9 A;  4KG5 A;  4QJG A;  1MWS A;  1SDN A;  2EFX A;  2EX8 A;  3DW0 A;  3E2K A;  4MLL A;  5E2G A;  3ZG7 B;  2WZZ A;  1BLC A;  4EBN A;  2EXA A;  1K6S A;  1K38 A;  2DNS A;  5DF7 A;  3MKF A;  3VOZ A;  1KDS A;  1JWV A;  1K4E A;  3C4O A;  2J9P A;  1MXO A;  5GHZ A;  4P87 A;  1ESI A;  5FAQ A;  4UAA A;  4EV4 A;  4DF6 A;  5GL9 A;  3LY3 A;  4Y7P A;  2ZM2 A;  2Y2K A;  1QME A;  5FAP A;  1H5X A;  2X02 A;  1K25 A;  4UA7 A;  3SS4 A;  1IYO A;  4KZ9 A;  4WMC A;  4OPR A;  1MKI A;  4JXS A;  5FDH A;  2UWX A;  1BUL A;  1K54 A;  3BEB A;  1DJB A;  2XEP A;  1KE0 A;  3Q7V B;  4XUX A;  3UY6 A;  4B88 A;  3C5A A;  3IHB A;  2Y4A A;  4OVD A;  2WGW B;  5FAO A;  3UO9 A;  3S4X A;  4OOY A;  5FI7 A;  5FQI A;  3ZG5 A;  4X53 A;  5GLD A;  2J8Y A;  2ZMA A;  3NI9 A;  4OOL A;  3OC2 A;  3OPH A;  4MEZ A;  5IHV A;  1M6K A;  3GTC A;  5HAI A;  4WM9 A;  3V5M A;  3UPO A;  2XLN A;  3MXR A;  1XP4 A;  1C3B A;  2XR0 A;  1ZKJ A;  1GHI A;  1ES3 A;  4Z9Q A;  3PBQ A;  4OPQ A;  1WYC A;  3WRT A;  3ZVT A;  3M2K A;  1YLT A;  2EX2 A;  4EBP A;  3UDI A;  3A3F A;  3SS5 A;  1KGF A;  3MBZ A;  2C5W B;  4C3Q A;  3VP0 A;  2B5R A;  2XFS A;  4KZ4 A;  3P09 A;  1BSG A;  1K6R A;  3G2Y A;  1CEF A;  2QPN A;  5TGF A;  3IF5 A;  4DXB A;  3AGD A;  3LEZ A;  1RCJ A;  3OPL A;  3OCL A;  1IKG A;  2H0T A;  1KE4 A;  2QMI A;  4IVI A;  3ZHH A;  4LV0 A;  4LCL A;  4JLF A;  1GCE A;  4PM8 A;  4R0Q A;  3HUN A;  3PTE A;  1EWZ A;  1XA7 A;  3FZC A;  3W4O A;  4WYY A;  3JYI A;  4BLM A;  1G68 A;  1BZA A;  2WAE A;  5E2E A;  5FQQ A;  4ZDX A;  5HL1 A;  4U3T A;  1QMF A;  3UDF A;  4E3N A;  3UN7 A;  2ZC6 B;  2JCH A;  4KZ5 A;  1ES2 A;  2EX9 A;  3IH8 A;  1Z6F A;  1BLP A;  4OPZ A;  5EVL A;  4WEL A;  2XGN A;  3HRE A;  1YQS A;  3IH9 A;  4R3B A;  3B3X A;  1OME A;  4ID4 A;  1W8Q A;  4BD0 A;  4FSF A;  4QD4 A;  2ZC3 B;  4UA6 A;  3SH7 A;  3QNC A;  4MBF A;  2Y2O A;  5CER A;  1J9M A;  1PZP A;  4HBU A;  4N1X A;  5F83 A;  2E8I A;  3V3R A;  3FV7 A;  5A92 A;  2DRW A;  2Y59 A;  4S2N A;  4IBX A;  3DWK A;  4GOG A;  3HLC A;  4CJN A;  1CEG A;  1KE3 A;  3NDE A;  4HES A;  4KZ8 A;  4YIN A;  4S2L A;  3N4I A;  1ONH A;  2QZ6 A;  3BLM A;  1FCN A;  4LV1 A;  5E2F A;  5EEC A;  1XGI A;  5EVI C;  5FQM A;  1YMS A;  4DRT A;  1I2S A;  1IEL A;  1WE4 A;  2ZQ7 A;  3G31 A;  4Y0O A;  3FKW A;  4JXW A;  2OV5 A;  3WS1 A;  5FAS A;  1MPL A;  1XXM A;  5GLC A;  3VSK A;  5KSH A;  3IWQ A;  4Q8I A;  4JBF A;  1TEM A;  4C6Y A;  5DF9 A;  5EOO A;  5HW3 A;  1KVL A;  4GB7 A;  3ZFZ A;  3IXD A;  5FI2 A;  4BJP A;  2HDR A;  4B4Z A;  1GHM A;  1KGG A;  3ZNY A;  4GD6 A;  5BOH A;  4L0L A;  1I5Q A;  2IWC A;  5CRF A;  4DE1 A;  2ZC7 A;  1LI9 A;  3ZNT A;  4ZJ1 A;  4DKI A;  1FR6 A;  3C7U A;  1HVB A;  3W4P A;  2XH9 A;  1YLY A;  2HP5 A;  1NYM A;  1U60 A;  3BFE A;  1SCW A;  4X6T A;  2VGK A;  2HDU A;  3WRZ A;  3LCE A;  3GQZ A;  3OPP A;  5M1A A;  4WMC D;  5FQ9 A;  5EVI B;  4OPY A;  1BLH A;  1ZG4 A;  3HLF A;  4FD8 A;  2CC1 A;  5E43 A;  3ZG0 A;  4PM9 A;  1NY0 A;  3Q81 A;  4R23 A;  2HPB A;  1FSY A;  3OPR A;  5FAT A;  3EQV A;  1PWD A;  3VP3 A;  1M40 A;  5GLA A;  1CI9 A;  1BTL A;  2HDS A;  2ZM0 A;  4R4R A;  3ZG9 B;  1HD8 A;  5JYO A;  1K56 A;  4NET A;  4PM5 A;  5JYP A;  1YM1 A;  2Y2I A;  1DY6 A;  5EOE A;  2WGI A;  3TSG A;  5KMW A;  1ERQ A;  1NZO A;  2WAD A;  2GDN A;  4MBK A;  5GHY A;  1MWT A;  4KQQ A;  1AXB A;  1FCO A;  1PI5 A;  4PM7 A;  1RGY A;  3UPP A;  1JTD A;  4EWF A;  3ITA A;  2HP9 A;  4H8R A;  4JF5 A;  3O87 A;  1N9B A;  1ES4 A;  3NCK A;  4PPR A;  3IQA A;  3DWZ A;  1H8Y A;  4C75 A;  4E3M A;  1ES5 A;  1L2S A;  2I72 A;  3PBS A;  5D3O A;  3EQU A;  4D2O A;  4DE3 A;  1E25 A;  1JVJ A;  2VGJ A;  4OLG A;  5A91 A;  3VP2 A;  3PBN A;  4E6W A;  3I7J A;  3AGE A;  1JTG A;  3TOI A;  4RX3 A;  4KZB A;  2Q9N A;  3DTM A;  5KSC A;  4ZJ2 A;  1PWG A;  3VOY A;  4E3O A;  5TR7 A;  4N9K A;  5A90 A;  2WGW A;  4JKT A;  1NJ4 A;  4RA7 A;  5E2H A;  3HLD A;  1O7E A;  1YLP A;  4QY6 A;  5CHJ A;  1G6A A;  5AQ9 A;  1MWU A;  4S2J A;  4U0T A;  3UNW A;  2WK0 A;  3V3S A;  1IKI A;  5CED A;  3HBR A;  3BEC A;  2C6W B;  4X56 A;  1Y54 A;  1TDL A;  1K4F A;  1PI4 A;  2ZQD A;  4LV3 A;  3A3D A;  2V1Z A;  1FCM A;  3UE1 A;  3A3E A;  2ZJ9 A;  1CK3 A;  1K56 D;  1YMX A;  3FWL A;  2Y2H A;  4IED A;  4S2O A;  1NZU A;  2JBF A;  2XD5 A;  1XGJ A;  3PBO A;  2ZQA A;  1KGE A;  4GZB A;  4XUZ A;  5AQB A;  1XKZ A;  1Q2Q A;  5J8X A;  3A3J A;  2RCX A;  1NYY A;  4P6B A;  3Q1F A;  4OON A;  3MZD A;  4E3I A;  4R1G A;  4E3J A;  4KEN B;  2Y2M A;  2HDQ A;  4R4S A;  4EQI A;  4IVK A;  4R3J A;  3O88 A;  1ONG A;  1KDW A;  1LL5 A;  3CG5 A;  1W79 A;  1TDG A;  3S1Y A;  2XFT A;  3V50 A;  4ZTK A;  1YLZ A;  5CGX A;  5CXW A;  2J7V A;  4K91 A;  3BFC A;  3HUM A;  4DXC A;  5CHM A;  5HX9 A;  2EXB A;  5HAR A;  5F1G A;  5FQK A;  2ZQ8 A;  2H0Y A;  3QNB A;  5GLB A;  3HL9 A;  5M18 A;  4QU3 A;  2RL3 A;  3MXS A;  4GDN A;  5HAQ A;  2Y55 A;  1RP5 A;  3VSL A;  3ISG A;  2P9V A;  1L0D A;  3G32 A;  1W8Y A;  3NC8 A;  1IEM A;  3QHY A;  3HLG A;  5CEB A;  1FSW A;  3G4P A;  4GDB A;  4MNR A;  2BLS A;  2WGV A;  3RXX A;  3VP4 A;  4OP5 A;  1W5D A;  4X68 A;  5DF8 A;  3VFF A;  3O86 A;  3NBL A;  1N4O A;  2P9V B;  5G18 A;  2Y2N A;  3PAG A;  4K0W A;  3MFD A;  2BG1 A;  4O7D A;  1S6R A;  3D4F A;  4JPM A;  1HTZ A;  3FYZ A;  2WYX A;  3M6B A;  3MKE A;  3GR2 A;  5F82 A;  4RVA A;  4S2I A;  1RGZ A;  5U47 A;  2R9X A;  1JWP A;  3IF6 A;  3OCN A;  1PW1 A;  2XF3 A;  3GMW A;  3W8K A;  5FQJ A;  3S22 A;  3ITB A;  1BUE A;  4FCF A;  3MZE A;  2ZC4 B;  3O3V A;  1GA0 A;  1ESU A;  2WKI A;  4OP8 A;  4A5R A;  2XDM A;  3NIA A;  4HBT A;  2X71 A;  4BD1 A;  3GRJ A;  4N1H A;  3NY4 A;  4WZ4 A;  5M19 A;  3SS3 A;  1YT4 A;  2J9O A;  2Z2M B;  4IBR A;  2DCF A;  5AQ7 A;  1W7F A;  5I94 A;  1IYS A;  1NRF A;  4Y0U A;  4JXG A;  4GN2 A;  4DDS A;  3G30 A;  3V39 A;  2Y2Q A;  4QY5 A;  4BQM A;  5EPH A;  3SH8 A;  4RX2 A;  1FQG A;  4U0X A;  4X69 A;  3ZGA B;  1E4D A;  3HVF A;  2WKH A;  1FOF A;  1LLB A;  5GHX A;  2FFY A;  4OQI A;  1E3U D;  1DJC A;  3RXW A;  1K55 C;  3IHA A;  2ZLY A;  4P0M A;  4RYE A;  3GV9 A;  1VM1 A;  1XPB A;  3N7W A;  5KZH A;  4N9L A;  4KQO A;  4OQ0 A;  4NK3 A;  4UHU A;  4N92 A;  4KZA A;  5DVA A;  3N8L A;  1E3U A;  3GSG A;  4KZ3 A;  3WS0 A;  4ZJ3 A;  3BYD A;  2Y2L A;  3P98 A;  2V2F F;  4S2K A;  4DE2 A;  4JXV A;  3WS4 A;  1DJA A;  1EI5 A;  3Q7Z A;  2WZX A;  4QHC A;  1L0F A;  5EE8 A;  3HLE A;  1ZG6 A;  3PBT A;  4E3L A;  3SH9 A;  5EVI D;  1MY8 A;  4FH4 A;  2H5S A;  3LY4 A;  1I2W A;  3PBR A;  1YLJ A;  1JWZ A;  4JF4 A;  4S2N C;  3CZD A;  1ERM A;  3WS5 A;  2PU2 A;  5HFO A;  4JF6 A;  5DTT A;  3RJU A;  1PWC A;  4EBL A;  1SKF A;  1K54 C;  5F1F A;  2JC7 A;  4OLD A;  4DDY A;  2R9W A;  2EFU A;  1HZO A;  3CJM A;  4PMA A;  4E3K A;  3G34 A;  3BFF A;  3A3I A;  2OLV A;  2EX6 A;  4K0X A;  4CPK A;  1K55 A;  1GHP A;  2Q9M A;  1MWR A;  2IWB A;  3ZG8 B;  3HUO A;  4S2M A;  1S0W A;  3CMZ A;  5CTM A;  2ZC5 B;  3IWI A;  1H8Z A;  5CGW A;  4PM6 A;  2Y2J A;  4KG6 A;  2Y91 A;  5FI6 A;  2G2W A;  1CI8 A;  1K57 C;  1O07 A;  1SDE A;  2FFF B;  5EUA A;  3UDX A;  3BRM A;  1VQQ A;  2IWD A;  5CGS A;  5EVI A;  3OZH A;  2OLU A;  3HLW A;  3N8R A;  4WZ5 C;  3BFG A;  4OQH A;  4EUZ A;  1Q2P A;  3FKV A;  3G35 A;  1ERO A;  1ALQ A;  3M2J A;  3MZF A;  4MBH A;  4OKP A;  1L0G A;  2Y2P A;  2ZQC A;  1PZO A;  1YLW A;  4X55 A;  3Q7V A;  4BEN A;  4BL2 A;  4UA9 A;  5DTK A;  1ZC2 A;  3IF6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...