1BULA

6alpha-(hydroxypropyl)penicillanate acylated on nmc-a beta-lactamase from enterobacter cloacae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
265
structure length
265
Chain Sequence
NTKGIDEIKNLETDFNGRIGVYALDTGSGKSFSYRANERFPLCSSFKGFLAAAVLKGSQDNRLNLNQIVNYNTRSLEFHSPITTKYKDNGMSLGDMAAAALQYSDNGATNIILERYIGGPEGMTKFMRSIGDEDFRLDRWELDLNTAIPGDERDTSTPAAVAKSLKTLALGNILSEHEKETYQTWLKGNTTGAARIRASVPSDWVVGDKTGSCGAYGTANDYAVVWPKNRAPLIISVYTTKNEKEAKHEDKVIAEASRIAIDNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NMC-A BETA-LACTAMASE
publication title Inhibition of the Nmc-A B-Lactamase by a Penicillanic Acid Derivative, and the Structural Bases for the Increase in Substrate Profile of This Antibiotic Resistance Enzyme
pubmed rcsb
molecule tags Hydrolase
total genus 92
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1bulA00
1I5QA 4U0XA 5FQQA 1CEFA 3Q81A 4FH2A 2WKIA 1W8YA 4KZ8A 5JYOA 3A3IA 2VGJA 1BLCA 2C6WB 3M6BA 1PZPA 2XEPA 4NETA 3IXBA 3RXXA 5CTNA 4U3TA 2ZQ9A 4R1GA 3DW0A 5HAIA 2Y91A 5FI7A 4B88A 2J7VA 1K4FA 4UA7A 3VOYA 3IF6A 4KZ4A 4ZJ1A 4KQQA 1XGJA 4GOGA 3S22A 2QMIA 5EECA 4D2OA 2X01A 1SKFA 2H0YA 3S4XA 2Z2MB 3OPPA 1KGFA 1DJCA 4N1HA 2DCFA 5TR7A 1RGZA 1NRFA 5FAQA 1NYYA 3PBQA 4E3OA 2Y4AA 4JF4A 3G32A 3ITAA 3C4PA 3UO9A 2J9PA 4JXSA 4E3LA 1SDEA 5E2FA 1YQSA 3W8KA 2JCHA 1H8YA 4XUZA 4GB7A 1IYQA 3UDIA 4DDSA 2WKEA 3HLGA 1K55A 2Y55A 3GVBA 5CRFA 4OQIA 4XXRA 4FSFA 3IH9A 3HLCA 3ZG9B 2OLVA 1TDGA 4S2OA 3V39A 2ZQDA 4GKUA 5M18A 2ZC5B 3NDGA 1ZG4A 5EUAA 4DE3A 3HLEA 3M6HA 4OLDA 1EWZA 1GA9A 3O88A 5GLCA 3IHAA 2DRWA 1E3UA 3FKWA 5EPHA 1BLHA 4QD4A 1S6RA 5FI6A 2HP6A 3FYZA 2WZZA 5CEBA 3HUOA 1BULA 1KDWA 1PIOA 3IHBA 1K6RA 3Q7VB 3DTMA 3NBLA 1K54C 4JXGA 5GHYA 2IWBA 1NJ4A 4WZ5A 2R9WA 5TGFA 1CI8A 1PWCA 3G4PA 2ZC3B 4MLLA 4QHCA 4EWFA 3ZNYA 3LY3A 3UY6A 5L2FA 3GMWA 5EE8A 3Q07A 4OONA 1FR6A 2Y2HA 4C75A 4Q8IA 4XUXA 5GLAA 3SH8A 2C5WB 2PU2A 4RYEA 4DE1A 3IWQA 4JXVA 1I2WA 4KZ6A 3UDXA 4EBLA 4KENB 1YLZA 3IWIA 1KVLA 4WZ5C 3NI9A 3V3RA 5KSHA 3CJMA 1E3UD 1RGYA 3CZDA 5DTKA 1HTZA 2G2WA 4OPZA 3EQVA 3C7UA 2Y2LA 1L0EA 5GL9A 3RXWA 3BM6A 3UNWA 3BECA 1G68A 1N4OA 1S0WA 4FH4A 3MBZA 4DRTA 4WM9A 5FAPA 5HW3A 1VQQA 4KG2A 4UAAA 1GHIA 1IEMA 4ZTKA 2XD1A 3SS3A 2HDRA 3WS5A 2ZLYA 3MKFA 2Y2MA 4MBHA 4X56A 5M1AA 1HD8A 3HVFA 2JC7A 4N1XA 3LY4A 4N9LA 2XDMA 5GHXA 2Y2JA 1Z6FA 1RCJA 4QY5A 5E43A 3UE0A 2P9VA 2WKHA 3N8LA 1ES3A 4L0LA 1YT4A 4RA7A 1NY0A 4CJNA 4S2NA 4S2LA 5D3OA 5FA7A 4UHUA 4DKIA 4WBGA 4EV4A 3PAEA 4FCFA 4N9KA 4ZDXA 5AQ7A 3O86A 3GR2A 1WE4A 3OCLA 4N92A 4Y0TA 3IH8A 1XA7A 4Y0OA 3WS1A 3MZEA 4OLGA 4GDNA 4BL3A 3P09A 4S2JA 1IELA 2HDUA 1YLJA 1YLWA 4KG6A 5EVLA 1ONGA 4E6WA 4S2NC 3AGDA 3MKEA 5KMWA 4OPRA 1DY6A 3VOZA 4LV1A 1L0GA 1FR1A 1OMEA 1K57A 3EQUA 5CTMA 1GHMA 1J9MA 3VP3A 3O3VA 3QNBA 1XP4A 2EX8A 1I2SA 4PMAA 3SOIA 1JTDA 3B3XA 2ZM2A 2H10A 2FFYA 1JWZA 4IBRA 5TFQA 4BQMA 4E3NA 3LEZA 5EVIA 3ZG8B 5JYPA 3W4PA 2A3UA 1Q2QA 3N8SA 1FSYA 5A91A 1K57C 2PBYA 3IQAA 4WZ4A 1IYOA 5EVIB 4KG5A 4OQGA 1CEGA 3O87A 3IF6B 3SH9A 5CEDA 4JBFA 1L0DA 3OPLA 5CGSA 5CECA 2ZQAA 3AGEA 2XLNA 4E3JA 2I72A 5A92A 4R4SA 3DWKA 4A5RA 4DE2A 3ZDJA 3GSGA 3FV7A 2V20A 5EVIC 1PW1A 4WELA 1ALQA 4FD8A 3IF6C 4DXBA 1FCOA 4JXWA 2WYXA 4EBPA 3A3EA 4KQOA 1LI9A 5AQAA 5U47A 4HBUA 3GV9A 4HBTA 1MBLA 2JE5A 4LV2A 5F1GA 3PBTA 4S2KA 4R0QA 2ZQ7A 5DF8A 1PZOA 2GDNA 1IYPA 3IXHA 1CI9A 3OC2A 3ZVTA 1KDSA 1O7EA 5CERA 4NK3A 5DTTA 4JLFA 5EVID 2EX2A 4O7DA 1ES4A 2EX6A 3HUNA 4GNUA 1ZG6A 4P6BA 3UN7A 3VSKA 1QMFA 4PM6A 3VP0A 2J8YA 1NYMA 1K55C 3BEBA 4KZAA 2XFSA 4BENA 3Q7ZA 1FCNA 5CHJA 3ITBA 1LL9A 2OLUA 5GHZA 3UPOA 2ZM0A 3NDEA 2OV5A 4KZ9A 5CGXA 1XXMA 3TG9A 2Y2QA 3V5MA 1JWPA 4X68A 3WS0A 5HAQA 2QZ6A 2XD5A 4R23A 4ZJ2A 1K4EA 3LO7A 1M40A 2P74A 1BZAA 4PM8A 3FWLA 3MFDA 3MXRA 3Q82A 1PYYA 5FATA 2B5RA 5CXWA 5DF9A 1G6AA 3VFHA 3W4QA 4DE0A 3ISGA 2WUQA 3OPRA 1IKIA 3CMZA 5E2EA 4WMCA 5HAPA 4GN2A 3NIAA 3VP2A 2J9OA 2EFXA 2IWCA 3PTEA 5KSCA 4X6TA 4R3BA 2BLSA 3SH7A 2Y2KA 3NCKA 3FZCA 4UA6A 3UPPA 1YLTA 4BL2A 2WGVA 2HPBA 2HDQA 1ONHA 1IKGA 1ERQA 2DNSA 3G31A 3I7JA 1K6SA 4K0WA 1BLPA 1GA0A 4K0XA 4X55A 3RJUA 1AXBA 3AGFA 3A3FA 3GQZA 3QNCA 4H8RA 3ZG0A 1XA1A 4LCLA 4P0MA 3FKVA 4ZJ3A 5FQKA 3N6IA 3PBOA 1W8QA 4WEJA 3VFFA 3OZHA 3E2LA 1YLPA 4MNRA 4OOLA 3C4OA 5M19A 1O07A 4HESA 4EUZA 1N9BA 2Y59A 1LL5A 2R9XA 3A3JA 3JYIA 2P9VB 2V1ZA 3V50A 3VMAA 4WMCD 1NXYA 2X02A 5FSRA 3BLSA 2Q9MA 3HUMA 2QPNA 3BRMA 2E8IA 3UE3A 3WS4A 3WS2A 1YLYA 2Y2OA 1KGEA 4E3IA 3C5AA 4P87A 1L2SA 3D4FA 1YMXA 5IHVA 3N7WA 4RVAA 1BTLA 5F82A 2EFUA 3GRJA 4KZ5A 4ZAMA 2ZMAA 4B4XA 2PU4A 3M2JA 4OOMA 1PI4A 1ZC2A 4S2MA 5FQ9A 1XX2A 4PPRA 3OPHA 1LI0A 1SDNA 1XGIA 1JVJA 1TVFA 2WK0A 3PBSA 4IVIA 3W4OA 2ZJ9A 4RX2A 3WWXA 5FQMA 1MWRA 4X53A 3CG5A 4GD8A 2BG1A 3ZFZA 3LCEA 2A49A 3N8RA 2ZQ8A 2WZXA 2XR0A 3BFCA 3G2YA 4OVDA 2RCXA 5EOEA 4Y0UA 1KVMA 4OH0A 1W79A 3HLWA 3E2KA 2RL3A 5E2HA 1ZKJA 2ZC6B 1BUEA 1FCMA 3BFGA 5EOOA 1XPBA 5KZHA 5FQIA 1ERMA 5DVAA 1K25A 5HARA 1Q2PA 4GD6A 2IWDA 3BFFA 2X71A 1E4DA 4IEDA 1JTGA 2V2FF 1MXOA 3G30A 2ZD8A 1TEMA 3OCNA 3P98A 4E3KA 5F1FA 2Q9NA 4DF6A 1MWTA 2WAEA 4MEZA 4HEFA 3ZNTA 2Y2IA 4LENA 1LHYA 4S2IA 1QMEA 4C6YA 4OKPA 4OOYA 1NZOA 3MZFA 4YFMA 4LCMA 3G2ZA 4IVKA 1K56A 2ZC4B 2Y2NA 3QHYA 1KGGA 4Y7PA 2Y2PA 1CK3A 4JF5A 5A90A 4P85A 4LV0A 5HL1A 4C3QA 3WRZA 1GHPA 3G34A 1LLBA 5FQJA 4MBFA 3NY4A 4DDYA 4WYYA 4EQIA 1GCEA 1TDLA 1WYBA 3C7VA 3IWOA 3HLFA 4QY6A 2Z2LB 4PM7A 2HP5A 3PBRA 3ZVWA 4DXCA 4YINA 3BYDA 1MPLA 4JPMA 4M3KA 1M6KA 1WYCA 4OQHA 1PWGA 4BLMA 4KZBA 3BLMA 2XGNA 1K54A 1HZOA 4MBKA 2EXAA 2H5SA 1BSGA 4OPYA 3V3SA 1YMSA 5A93A 4LV3A 1SHVA 2XH9A 1ES5A 3PBNA 4JF6A 4Z9QA 3N4IA 3Q7VA 2HP9A 1DJBA 1K56D 4BJPA 5BOHA 4GDBA 4CPKA 5CGWA 3HLDA 1L0FA 4UA9A 4U0TA 5CHUA 1E25A 3ZGAB 3S1YA 5J8XA 2WAFA 1MKIA 1YM1A 4OP8A 4RX3A 2ZQCA 3BFEA 1VM1A 4GZBA 4OQ0A 5E2GA 5HX9A 3G35A 4X69A 4KQRA 1MWSA 3HBRA 1ES2A 3MZDA 5GLBA 5GLDA 4E3MA 4R3JA 5G18A 1ESUA 2JBFA 4QU3A 3BFDA 1RP5A 1PWDA 4S2PA 5F83A 1K38A 2XQZA 3SS4A 4PM9A 5I94A 2XK1A 1DJAA 2OSUA 1KE4A 1ESIA 3SS5A 4IBXA 3ZG5A 3UDFA 3ZG7B 5FASA 4JKTA 1XKZA 3TOIA 1MY8A 4BD1A 2H0TA 4KZ3A 1Y54A 1C3BA 1KE0A 3IF5A 4R4RA 3VP1A 5FI2A 1KE3A 3WRTA 5CHMA 3A3DA 2ZC7A 4KZ7A 3IXGA 3Q1FA 3DWZA 3VSLA 4F94A 1IYSA 2CC1A 1FQGA 1H8ZA 3VP4A 1H5XA 3MXSA 4EBNA 5DTSA 5HFOA 2ZM8A 1EROA 1FOFA 2XFTA 2WGWA 4OPQA 5AQBA 1U60A 2XF3A 2WGIA 2VGKA 4QB8A 4WEKA 5FDHA 4QJGA 2EX9A 1PI5A 1HVBA 1PW8A 2HDSA 2WGWB 3HL9A 4OP5A 3PAGA 3UPNA 3ZCZA 5DF7A 2WADA 3GTCA 3NC8A 3IXDA 1SCWA 5FAOA 4ZBEA 1W5DA 4ID4A 3TSGA 1W7FA 3ZHHA 1MWUA 1FSWA 2UWXA 1NZUA 2Y2GA 4B4ZA 2G2UA 1EI5A 3HLBA 3IT9A 1BLSA 3M2KA 4E6XA 3UE1A 2FFFB 4PM5A 3HREA 1BT5A 4K91A 5AQ9A 1JWVA 4BD0A 2EXBA
chains in the Genus database with same CATH superfamily
1PFLA 4KQDA 3TW8A 3EGDC 3LIFA 4KZ8A 5JYOA 3M6BA 1BLCA 2C6WB 4MN7A 2XEPA 4NETA 3IXBA 3T1SA 2GZAA 2J3WA 4D60A 5HAIA 4B88A 2M7VA 4UA7A 4ZJ1A 1XGJA 1ZHHB 3S4XA 1P9RA 1NRFA 1NYYA 1S4SA 1NWZA 3ITAA 3UO9A 1SDEA 2VGLS 5E2FA 4MN5A 3UDIA 4PAUA 4II7A 5CRFA 3DTEA 4OQIA 2OLVA 1TDGA 4S2OA 4GKUA 3LYXA 1LSXA 5M18A 3M6HA 2DRWA 4L9FA 4QD4A 3FYZA 2WZZA 1TF1A 3HUOA 3NOTC 2DMWA 4Q0IA 3ZNYA 3UY6A 1S67L 2HJ9C 1H8MA 1FR6A 4C75A 3D9YA 3OLOA 4RYEA 3IWQA 3UDXA 1DP8A 1P9WA 1G28A 4F3LB 1RGYA 1W63M 3CZDA 1HTZA 3CLOA 1YSPA 1L0EA 3RXWA 4DRTA 4WM9A 3LIAA 1VQQA 2AVXA 3SS3A 2ZLYA 2Y2MA 4E04A 4N9LA 2XDMA 1IFQA 1Z6FA 1RCJA 5E43A 3VOLA 3N8LA 3A0SA 1YT4A 1NY0A 2BASA 4S2NA 3UB8A 5D3OA 4EV4A 3F1PA 4ZDXA 5AQ7A 3O86A 3GR2A 1WE4A 2FZ0A 3HCYA 4Y0OA 3WS1A 4GDNA 5FL3A 4EETB 1IELA 1YLWA 4HQAA 2D02A 3T4KA 4S2NC 3LGOA 3AGDA 5KMWA 1S1ZA 4LV1A 1L0GA 1GHMA 3LI9A 5L07A 3CUEA 3VP3A 2XA7S 3DBAA 1VEUB 2ZM2A 4IBRA 1F9IA 4WF0A 5TFQA 3ZG8B 5JYPA 3W4PA 4IJGA 3KSGA 5A91A 3B42A 2PBYA 3ULFA 5DJTA 1ZTUA 4OQGA 4JBFA 3DTIA 1TS7A 4O8GA 4HIAA 2I72A 5A92A 4R4SA 4FOFA 3ZDJA 3GSGA 2V20A 1PW1A 4X1LA 1FCOA 4EBPA 5AQAA 3GV9A 3QP5A 2JE5A 5K5BA 1UWPX 4S2KA 4R0QA 5DF8A 3TRCA 4ARZA 1IYPA 3A0VA 3ZVTA 5DTTA 5EVID 3O5YA 1ES4A 5FEFA 1QMFA 3F1NA 1LSWA 1LT0A 3VP0A 2G7UA 1LL9A 2OLUA 3UPOA 3LR4A 2OV5A 4KZ9A 3TG9A 5HDCA 2XD5A 4XT2A 3W4QA 5CXWA 1G6AA 1P0ZA 3UE6A 3JVUA 2JKGA 3CMZA 2HZ5A 3NIAA 3VP2A 3PTEA 5HD3A 3NCKA 3UPPA 2WGVA 2HPBA 3I7JA 1GA0A 4GLQA 4X55A 1MC0A 3UMDA 4LCLA 1TD5A 4EXOA 4WEJA 4MNRA 4LPZA 3PHYA 4HESA 2Y59A 2R9XA 3A3JA 3JYIA 3V50A 2QJ7A 2Y2OA 4P87A 3F1PB 1T1BA 4HJ3A 3D4FA 3N7WA 4RVAA 1BTLA 5J4EA 3GRJA 1NLYA 4OOMA 1YKDA 1PI4A 5FQ9A 1OTBA 2QJ5A 3T1XA 3KYZA 1XGIA 3W4OA 3NULA 1MWRA 3T12B 4GD8A 3ZFZA 2ZQ8A 5EOEA 3D3OA 2VZWA 3PYPA 2VK3A 1ZKJA 1FCMA 5KZHA 1K25A 2QYBA 1Q2PA 4GD6A 4I3AA 1YAXA 1MXOA 2ZD8A 1TEMA 2L4RA 3ZNTA 4HOIA 4OOYA 1NZOA 3G2ZA 4IVKA 3MSHA 2V0UA 3SZTA 1KGGA 2OWHA 4Y7PA 2Y2PA 4LV0A 5IT5A 4C3QA 2PT7A 3G34A 5FQJA 4MBFA 4WUJA 3ZYTA 4Q0HA 1GCEA 3IWOA 1DRMA 4PM7A 4DXCA 5DJUA 1VHMA 3F1NB 3BYDA 1MPLA 4M3KA 3F1OA 1M6KA 4MN6A 2EXAA 2H5SA 2YKHA 3NHQA 3RFBA 2J80A 4QPRA 4Z9QA 1SHVA 2XH9A 3PBNA 2UV0E 3N4IA 3Q7VA 5BOHA 4GDBA 5HD5A 3HLDA 1L0FA 3S7PA 2PD8A 3T1RA 5HWTA 3ZGAB 1YM1A 3B47A 4KQRA 3R7WB 3PXPA 5GLBA 2J3TD 4Q0JA 1ESUA 4QU3A 3BFDA 1PWDA 1K38A 4PM9A 2XK1A 2Y79A 3RTYA 3ZG5A 2JKRM 5F69A 3TOIA 1XKZA 2H0TA 1Y54A 2CMNA 1GSVA 1UWNX 3A3DA 3VSLA 4MDZA 4WL9A 3MXSA 4EW7A 4EBNA 1FOFA 3IS2A 4OPQA 2O9BA 2PAVP 4EESA 4QJGA 3UPNA 3MQQA 2QWSA 3ZCZA 5L8MA 5HWWA 3NC8A 4ZBEA 3H82A 1MWUA 2UWXA 3HJIA 3IT9A 3M2KA 3BY8A 4PM5A 4FTXA 4CQHA 4K91A 4HJ4A 1JWVA 5FQQA 3Q81A 3T4LA 2ZOIA 3FPVA 1PZPA 3RXXA 4WN5A 4I39A 4EU0A 5FI7A 2HJEA 3U2AA 4YOFA 5EECA 2Z2MB 3OPPA 4N1HA 2O99A 4NXFA 3T4OA 1RGZA 1CF0A 1Y4OA 2J9PA 4JXSA 1L3LA 4GB7A 2NUPC 4DDSA 3CHWP 3T4JA 2WKEA 1K55A 2Y55A 3IH9A 3ZG9B 1CQAA 2PYPA 2ZQDA 2ZC5B 4LFUA 1G5UA 3O88A 3F1OB 5GLCA 2B95A 3IHAA 1E3UA 4PKYA 4GJ4A 5EPHA 2J3TC 1S6RA 1T18A 2Q0OA 3IHBA 3Q7VB 3NBLA 1K54C 4JXGA 2IWBA 4WZ5A 5TGFA 4DJ2A 4KUOA 4MLLA 2W3HA 2IA2A 4HY8A 5EE8A 1ACFA 2NUTC 2V8FA 4OONA 2Y2HA 4Q8IA 5GLAA 3KO6A 5A8BA 1I2WA 4CLCE 4EBLA 2A24A 4FUWA 3MJQA 4WZ5C 5EVEA 5KSHA 5DTKA 5AVEA 3C7UA 1WA9A 2Y2LA 5GL9A 2JHEA 1G68A 1N4OA 3BECA 4FH4A 3MBZA 3MQOA 4UAAA 4KG2A 4E3OA 3WS5A 3MKFA 4MBHA 5M1AA 1HD8A 2JC7A 4UQIM 4L0LA 4UHUA 4WBGA 4GHIA 3IS2B 3PAEA 4FCFA 2K31A 3V67A 4Y0TA 3IH8A 2V0WA 4OLGA 1T1AA 4S2JA 1YLJA 2L0WA 4E6WA 1OT6A 3MKEA 1DY6A 1YSQA 1KOUA 3QNBA 4PMAA 3C38A 2W1RA 1JWZA 4IUHA 3KYQA 2ZL1A 3LR5A 3N8SA 2PRFA 5J3WA 4LLOB 3IQAA 4WZ4A 1IYOA 3GECA 1CEGA 3O87A 1OPXA 3OPLA 5CECA 3AGEA 4E3JA 3DWKA 4A5RA 3FV7A 4WELA 4LRZE 4DXBA 2ZMVA 4KQOA 1LI9A 4HBTA 1MBLA 2ZQ7A 1PZOA 4I38A 3IXHA 3OC2A 3HJKA 1O7EA 5CERA 4GS9A 2EX6A 4LRXC 3UN7A 4P6BA 2J8YA 4RQ9A 1NYMA 5CHJA 3ITBA 3PR6A 5CGXA 3V5MA 4X68A 4R23A 3UMEA 1K4EA 3LO7A 1PYYA 4DE0A 5DF9A 1V9YA 1FILA 2W0NA 3OPRA 1IKIA 4WMCA 4K08A 4GN2A 2IWCA 4R3BA 2Y2KA 4UA6A 4HH3A 4BL2A 1H0MA 1H3QA 2HDQA 5IS1A 1OJGA 2A24B 2DNSA 3G31A 2PYRA 3AGFA 3GQZA 3A3FA 1OTDA 4BMWA 2PR6A 3QP2A 3N6IA 2WKRA 3NECA 4OOLA 2KLIA 5M19A 2VV8A 1JNUA 2P7JA 3JPUA 2V1ZA 3MXQA 2X02A 3WS2A 3WS4A 1YLYA 4GHIB 1L2SA 4ETXA 5IHVA 4ZAMA 2ZMAA 4B4XA 2PU4A 1PRQA 1ZC2A 4S2MA 2HV1A 1XX2A 3OPHA 1LI0A 2Z6DA 2BTFP 1TVFA 3PBSA 4EEUA 4IUKA 3WWXA 5FQMA 4O0PA 3CG5A 3EEHA 3G2YA 4OVDA 4Y0UA 1EW0A 3HLWA 3E2KA 3BFGA 3UB7A 3FG8A 3CUEC 3CITA 2ZL1B 3NOUC 1OJ5A 2JKFA 4IEDA 3CAXA 3G30A 5F1FA 4E3KA 2VKSA 2Y8HA 4DF6A 2PR5A 1MWTA 2WAEA 1XFQA 3IX4A 4HEFA 1F98A 4LENA 4S2IA 1LHYA 3MZFA 5DFYA 1CK3A 4JF5A 5A90A 4G3KA 4Z1WA 1T19A 1GHPA 4O01A 4GS9B 4DDYA 5HSQA 4EQIA 1TDLA 4QY6A 2Z2LB 2VX8A 3G6OA 3PBRA 4YINA 1D7EA 2YKFA 4BLMA 4KZBA 4B9OA 2A2LA 2INWA 2XGNA 4MBKA 4EERA 1MZUA 4G3VA 4JF6A 4NEED 2VGLM 4HP4A 4BJPA 3QP6A 4U0TA 2GX5A 5CHUA 2V1AA 4QWOA 3R7WA 3S1YA 5J8XA 2WAFA 4OP8A 1VM1A 5E2GA 4OQ0A 3G35A 4X69A 1MWSA 3R4KA 5GLDA 4E3MA 4R3JA 4EQ1A 5HPFA 2JBFA 4DMZA 3S7QA 5F83A 4S2PA 3SS4A 3FPWA 2XQZA 2OSUA 1KE4A 3SS5A 1XJ3A 1MY8A 4CLCA 1C3BA 3IF5A 4R6LA 2P08A 2VEAA 1KE3A 3WRTA 3Q1FA 3CI6A 1IYSA 1FQGA 1H8ZA 3C30A 3VP4A 3S7NA 3BY9A 5AQBA 4CLCC 1N9NA 2LB9A 2XF3A 5FDHA 1Y28A 2EX9A 1PI5A 1HVBA 2JKRI 2WGWB 4PKYG 5HDSA 4ID4A 3TSGA 3T4QA 1XJ6A 1EI5A 3L7HA 3HLBA 2V1BA 5AQ9A 3KSIA 3GDIA 1I5QA 4U0XA 4FH2A 2WKIA 2VGJA 2JKTM 4HP9A 4U3TA 2ZQ9A 5EV0A 2J7VA 1K4FA 5IU1A 3IF6A 4KZ4A 3T4SA 3LEQA 4NXBA 4GOGA 2KDKA 3UB6A 1TS8A 1SKFA 2H0YA 2DCFA 5FAQA 4JF4A 4NXGA 3TE8A 4L9GA 2XSSA 1YQSA 3W8KA 4XUZA 5FEGA 4XXRA 3HLCA 3BJNA 4BBTA 4Y13A 1ZG4A 2EWVA 5EUAA 4DE3A 2M1CA 4P6ZS 4X25A 3HLEA 1GA9A 3MQ0A 3FKWA 5FI6A 2HP6A 5CEBA 1BULA 1KDWA 4GCZA 1PNEA 5GHYA 1NJ4A 5HZHA 4AFIA 1PWCA 4EWFA 4QHCA 3LY3A 5L2FA 3GMWA 4XUXA 3SH8A 3IBRA 4UQIS 2C5WB 5HWVA 4JXVA 2K7SA 4KENB 2ZOHA 5C5KA 1KVLA 3NI9A 3CJMA 1E3UD 3EQVA 3BM6A 2PDRA 3BW6A 3EGXC 5FAPA 4CLCB 1IEMA 1S66L 1S1YA 2WKHA 4RA7A 1ES3A 3K2NA 3H9WA 4S2LA 4DKIA 2ZBBA 4MCWA 4N9KA 2P04A 4R38A 3OCLA 1XA7A 3P09A 4KG6A 5EVLA 3KSFA 1ONGA 3LIDA 2WKQA 3VOZA 5CTMA 3EQUA 3QP1A 3LR3A 1J9MA 3O3VA 3C8CA 3SOIA 1JTDA 4LRYC 2FFYA 2VV6A 4G3WA 4E3NA 1Q2QA 3LR0A 1FSYA 5EVIB 3IF6B 3SH9A 5CEDA 2O9AA 1L0DA 5CGSA 2ZQAA 2XLNA 1V9ZA 1D06A 4FD8A 2HF6A 3E98A 2WYXA 3A3EA 2W3GA 4HBUA 4JGQA 3PBTA 2EWWA 3L9KA 1KDSA 1W63Q 4NK3A 4JLFA 1OTEA 2EX2A 4GNUA 3OOVA 3VSKA 4PM6A 1K55C 3BEBA 4KZAA 3IX8A 3Q7ZA 2V9AA 5GHZA 2ZM0A 3NDEA 3NOPC 2Y2QA 1JWPA 3WS0A 2QZ6A 1F2KA 1IOUA 2P74A 1BZAA 3FWLA 5DKKA 1BYWA 3VFHA 5FATA 2B5RA 1DP6A 3ISGA 2WUQA 1P97A 5TBMA 3P7NA 2QHKA 5HAPA 1TS0A 4JGOA 2J9OA 2EFXA 5KSCA 3EEAA 3LICA 4X6TA 4PHTA 3SH7A 1YLTA 3E4PA 1ONHA 1IKGA 2ACGA 4K0WA 1BLPA 4K0XA 3RJUA 1AXBA 3UB5P 2R78A 4P0MA 5FQKA 3PBOA 1W8QA 3VFFA 3OZHA 1YLPA 3SW1A 1N9BA 1LL5A 4HJ6A 4WMCD 2LB5A 2Q9MA 3HUMA 3UE3A 2XROA 4E3IA 4JGPA 3QP8A 4LGWA 5F82A 4KZ5A 1OTIA 3M2JA 1K0KA 3LIEA 1SDNA 1JVJA 2ZJ9A 3E4OA 3DTKA 2VA0A 2A49A 2WZXA 2XR0A 5F6AA 2RCXA 2EA9A 3A0RA 3H7WB 4OH0A 1W79A 4NG2A 3DAVA 2RL3A 5E2HA 4H6JA 1BUEA 3IBJA 1XPBA 1ERMA 5DVAA 4M4XA 3BFFA 2W3FA 4WLAA 2V2FF 2QKPA 3BQ8A 1AWIA 2Q9NA 3JVVA 3QP4A 4MEZA 5AVFA 2Y2IA 4C6YA 4OKPA 1N9LA 4LCMA 2W3DA 1K56A 3VV4A 2VLGA 3QHYA 2GJ3A 4BBVA 1YPRA 1OTAA 4P85A 5HL1A 3NJAA 4WYYA 1WYBA 2PD7A 4JGRA 4HI4A 3ZVWA 3EOIA 1NRJA 4JPMA 1WYCA 4OQHA 2GNXA 3BLMA 1HZOA 1BSGA 4OPYA 1LSVA 1XJ2A 4LV3A 2W3EA 4R3AA 1S4RA 2B02A 2PHYA 4CPKA 5CGWA 4UA9A 3T4TA 1DP9A 3VE4A 3ICYA 4Y2FA 1UGUA 5TBMB 3E4QA 4RX3A 2ZQCA 3BFEA 4GZBA 5HX9A 3LIBA 1ES2A 3MZDA 5G18A 1RP5A 4YNRA 5LBRA 5I94A 1DJAA 1ESIA 5DFXA 1TS6A 3ZG7B 5FASA 4JKTA 3KX0X 4BD1A 4ME4A 3VP1A 5FI2A 1NLZA 5CHMA 4KUKA 2ZC7A 3DWZA 2CC1A 4UEYA 2W27A 2XFTA 2WGWA 1U60A 4QB8A 4WEKA 1SKOA 1PW8A 2HDSA 4OP5A 4I3JA 4X1MA 5DF7A 3MFXA 3IXDA 1W5DA 3ZHHA 1NZUA 4CLCD 1BLSA 3UE1A 3HREA 4HHDA 4R70A 1D1JA 3HLGA 1CEFA 1W8YA 3A3IA 4H6JB 5CTNA 4R1GA 2D01A 3DW0A 2Y91A 3VOYA 5KIZA 4KQQA 3W2ZA 3FC7A 5EFWA 3S22A 2QMIA 4D2OA 2X01A 1KGFA 1DJCA 5TR7A 3PBQA 2Y4AA 3G32A 3C4PA 4E3LA 2JCHA 1H8YA 1IYQA 2JKTI 2ZMFA 2Z6CA 3GVBA 4FSFA 3V39A 1J3WA 3NDGA 2KX6A 4OLDA 1EWZA 4HNBA 3U4LP 1BLHA 1STZA 4Y17A 1PIOA 1K6RA 3DTMA 1A0KA 3IX3A 2R9WA 1CI8A 1VB6A 3G4PA 2ZC3B 3Q07A 4DE1A 2PU2A 4KZ6A 1YLZA 3IWIA 3V3RA 5G4YA 5CX7A 2G2WA 2H28A 4OPZA 3UNWA 1S0WA 5HW3A 1GHIA 4ZTKA 1XFNA 2XD1A 2HDRA 4X56A 3HVFA 4N1XA 3LY4A 5GHXA 2Y2JA 4BBUA 2OAQ1 3UE0A 4QY5A 2P9VA 3MR0A 4CJNA 5FA7A 3MS6A 5I5LA 4N92A 1SKOB 3MZEA 4BL3A 5MC7A 2HDUA 5L09A 4OPRA 1FR1A 1OMEA 1K57A 1XP4A 2EX8A 1I2SA 3B3XA 2H10A 4GW9A 4EUVA 5F68A 4BQMA 5EM1A 4MMNA 5HL6A 3LEZA 5EVIA 5AJGA 2A3UA 1K57C 4KG5A 2W1TA 2VV7A 1ODVA 2XA7M 3T1QB 4DE2A 2WKPA 5EVIC 1ALQA 4DJ3A 3IF6C 3KSHA 4JXWA 3VE3A 3BWLA 5U47A 3K3CA 5F1GA 4LV2A 2GDNA 1CI9A 4EEPA 1FIKA 2E8JA 3P01A 4O7DA 3T50A 4ARZB 4Y15A 3HUNA 1ZG6A 4DN0A 2XFSA 4BENA 1FCNA 1XXMA 5HAQA 4ZJ2A 5F5YA 1M40A 1G6OA 4PM8A 3MFDA 3MXRA 3Q82A 5FDSA 4I5SA 4XT2B 5E2EA 2MJ6A 3LUQA 3B33A 2BLSA 3FZCA 3S7OA 5HPIA 1ERQA 1K6SA 1GSXA 1N9OA 2JN7A 3QNCA 3ZG0A 2I9VA 4H8RA 1XA1A 4ZJ3A 3FKVA 5L10A 2M7UA 1GSWA 3E2LA 4Y5FA 3CPTA 3C4OA 1O07A 4EUZA 1T1CA 2P9VB 1X0OA 4L9EA 3KYEA 3MF0A 3VMAA 1NXYA 5FSRA 3BLSA 2QPNA 3BRMA 2E8IA 2KOIA 4ESPA 1KGEA 3C5AA 2VJWA 3OBFA 1VETA 1YMXA 2EFUA 3K3DA 4NKPA 2V8CA 5G4ZA 4PPRA 2WK0A 4IVIA 4RX2A 3H7WA 4X53A 2BG1A 4Y3IA 3LCEA 3N8RA 2O0YA 3BFCA 1KVMA 3BQAA 2ZC6B 2B18A 5EOOA 5EM0A 1HLUP 5FQIA 5HARA 2IWDA 2X71A 1E4DA 1JTGA 2W1TB 2PBDP 3OCNA 3P98A 1QMEA 2XRNA 4YFMA 5TJJA 2ZC4B 2Y2NA 2OOLA 4ETZA 2K2NA 4NXEA 3WRZA 1LLBA 4B93A 3NY4A 3C7VA 3HLFA 1XJ4A 2HP5A 3D72A 1PWGA 1K54A 3RH8B 5DKLA 5J7EA 1SZVA 2OWJA 3V3SA 1YMSA 5HDDA 5A93A 2FH5A 1ES5A 2HP9A 1DJBA 1K56D 2L1MA 1OT9A 3LI8A 3C2WA 1E25A 1MKIA 4ZRRA 4P6ZM 3HBRA 4YWZA 3ZQ5A 1CJFA 2O9CA 3UB9A 4F3LA 4HH2A 4IBXA 3UDFA 2OAP1 1Z09A 4KZ3A 1KE0A 4R4RA 3LFVA 3CPTB 4KZ7A 3IXGA 4I3IA 4IHQA 4BWIA 4F94A 3EWKA 1LL8A 1H5XA 2HGVA 5DTSA 5HFOA 2ZM8A 1EROA 3MMHA 2WGIA 2VGKA 3TJZC 1VETB 3HL9A 3PAGA 2WADA 3GTCA 1SCWA 5FAOA 1W7FA 1MKMA 1FSWA 2Y2GA 3CWFA 3E0YA 4B4ZA 2G2UA 4E6XA 2FFFB 1F5MA 1BT5A 3H82B 1VEUA 4BD0A 2EXBA
chains in the Genus database with same CATH topology
1I5QA 4U0XA 5FQQA 1CEFA 3Q81A 4FH2A 2WKIA 1W8YA 4KZ8A 5JYOA 3A3IA 2VGJA 1BLCA 2C6WB 3M6BA 1PZPA 2XEPA 4NETA 3IXBA 3RXXA 5CTNA 4U3TA 2ZQ9A 4R1GA 3DW0A 5HAIA 2Y91A 5FI7A 4B88A 2J7VA 1K4FA 4UA7A 3VOYA 3IF6A 4KZ4A 4ZJ1A 4KQQA 1XGJA 4GOGA 3S22A 2QMIA 5EECA 4D2OA 2X01A 1SKFA 2H0YA 3S4XA 2Z2MB 3OPPA 1KGFA 1DJCA 4N1HA 2DCFA 5TR7A 1RGZA 1NRFA 5FAQA 1NYYA 3PBQA 4E3OA 2Y4AA 4JF4A 3G32A 3ITAA 3C4PA 3UO9A 2J9PA 4JXSA 4E3LA 1SDEA 5E2FA 1YQSA 3W8KA 2JCHA 1H8YA 4XUZA 4GB7A 1IYQA 3UDIA 4DDSA 2WKEA 3HLGA 1K55A 2Y55A 3GVBA 5CRFA 4OQIA 4XXRA 4FSFA 3IH9A 3HLCA 3ZG9B 2OLVA 1TDGA 4S2OA 3V39A 2ZQDA 4GKUA 5M18A 2ZC5B 3NDGA 1ZG4A 5EUAA 4DE3A 3HLEA 3M6HA 4OLDA 1EWZA 1GA9A 3O88A 5GLCA 3IHAA 2DRWA 1E3UA 3FKWA 5EPHA 1BLHA 4QD4A 1S6RA 5FI6A 2HP6A 3FYZA 2WZZA 5CEBA 3HUOA 1BULA 1KDWA 1PIOA 3IHBA 1K6RA 3Q7VB 3DTMA 3NBLA 1K54C 4JXGA 5GHYA 2IWBA 1NJ4A 4WZ5A 2R9WA 5TGFA 1CI8A 1PWCA 3G4PA 2ZC3B 4MLLA 4QHCA 4EWFA 3ZNYA 3LY3A 3UY6A 5L2FA 3GMWA 5EE8A 3Q07A 4OONA 1FR6A 2Y2HA 4C75A 4Q8IA 4XUXA 5GLAA 3SH8A 2C5WB 2PU2A 4RYEA 4DE1A 3IWQA 4JXVA 1I2WA 4KZ6A 3UDXA 4EBLA 4KENB 1YLZA 3IWIA 1KVLA 4WZ5C 3NI9A 3V3RA 5KSHA 3CJMA 1E3UD 1RGYA 3CZDA 5DTKA 1HTZA 2G2WA 4OPZA 3EQVA 3C7UA 2Y2LA 1L0EA 5GL9A 3RXWA 3BM6A 3UNWA 3BECA 1G68A 1N4OA 1S0WA 4FH4A 3MBZA 4DRTA 4WM9A 5FAPA 5HW3A 1VQQA 4KG2A 4UAAA 1GHIA 1IEMA 4ZTKA 2XD1A 3SS3A 2HDRA 3WS5A 2ZLYA 3MKFA 2Y2MA 4MBHA 4X56A 5M1AA 1HD8A 3HVFA 2JC7A 4N1XA 3LY4A 4N9LA 2XDMA 5GHXA 2Y2JA 1Z6FA 1RCJA 4QY5A 5E43A 3UE0A 2P9VA 2WKHA 3N8LA 1ES3A 4L0LA 1YT4A 4RA7A 1NY0A 4CJNA 4S2NA 4S2LA 5D3OA 5FA7A 4UHUA 4DKIA 4WBGA 4EV4A 3PAEA 4FCFA 4N9KA 4ZDXA 5AQ7A 3O86A 3GR2A 1WE4A 3OCLA 4N92A 4Y0TA 3IH8A 1XA7A 4Y0OA 3WS1A 3MZEA 4OLGA 4GDNA 4BL3A 3P09A 4S2JA 1IELA 2HDUA 1YLJA 1YLWA 4KG6A 5EVLA 1ONGA 4E6WA 4S2NC 3AGDA 3MKEA 5KMWA 4OPRA 1DY6A 3VOZA 4LV1A 1L0GA 1FR1A 1OMEA 1K57A 3EQUA 5CTMA 1GHMA 1J9MA 3VP3A 3O3VA 3QNBA 1XP4A 2EX8A 1I2SA 4PMAA 3SOIA 1JTDA 3B3XA 2ZM2A 2H10A 2FFYA 1JWZA 4IBRA 5TFQA 4BQMA 4E3NA 3LEZA 5EVIA 3ZG8B 5JYPA 3W4PA 2A3UA 1Q2QA 3N8SA 1FSYA 5A91A 1K57C 2PBYA 3IQAA 4WZ4A 1IYOA 5EVIB 4KG5A 4OQGA 1CEGA 3O87A 3IF6B 3SH9A 5CEDA 4JBFA 1L0DA 3OPLA 5CGSA 5CECA 2ZQAA 3AGEA 2XLNA 4E3JA 2I72A 5A92A 4R4SA 3DWKA 4A5RA 4DE2A 3ZDJA 3GSGA 3FV7A 2V20A 5EVIC 1PW1A 4WELA 1ALQA 4FD8A 3IF6C 4DXBA 1FCOA 4JXWA 2WYXA 4EBPA 3A3EA 4KQOA 1LI9A 5AQAA 5U47A 4HBUA 3GV9A 4HBTA 1MBLA 2JE5A 4LV2A 5F1GA 3PBTA 4S2KA 4R0QA 2ZQ7A 5DF8A 1PZOA 2GDNA 1IYPA 3IXHA 1CI9A 3OC2A 3ZVTA 1KDSA 1O7EA 5CERA 4NK3A 5DTTA 4JLFA 5EVID 2EX2A 4O7DA 1ES4A 2EX6A 3HUNA 4GNUA 1ZG6A 4P6BA 3UN7A 3VSKA 1QMFA 4PM6A 3VP0A 2J8YA 1NYMA 1K55C 3BEBA 4KZAA 2XFSA 4BENA 3Q7ZA 1FCNA 5CHJA 3ITBA 1LL9A 2OLUA 5GHZA 3UPOA 2ZM0A 3NDEA 2OV5A 4KZ9A 5CGXA 1XXMA 3TG9A 2Y2QA 3V5MA 1JWPA 4X68A 3WS0A 5HAQA 2QZ6A 2XD5A 4R23A 4ZJ2A 1K4EA 3LO7A 1M40A 2P74A 1BZAA 4PM8A 3FWLA 3MFDA 3MXRA 3Q82A 1PYYA 5FATA 2B5RA 5CXWA 5DF9A 1G6AA 3VFHA 3W4QA 4DE0A 3ISGA 2WUQA 3OPRA 1IKIA 3CMZA 5E2EA 4WMCA 5HAPA 4GN2A 3NIAA 3VP2A 2J9OA 2EFXA 2IWCA 3PTEA 5KSCA 4X6TA 4R3BA 2BLSA 3SH7A 2Y2KA 3NCKA 3FZCA 4UA6A 3UPPA 1YLTA 4BL2A 2WGVA 2HPBA 2HDQA 1ONHA 1IKGA 1ERQA 2DNSA 3G31A 3I7JA 1K6SA 4K0WA 1BLPA 1GA0A 4K0XA 4X55A 3RJUA 1AXBA 3AGFA 3A3FA 3GQZA 3QNCA 4H8RA 3ZG0A 1XA1A 4LCLA 4P0MA 3FKVA 4ZJ3A 5FQKA 3N6IA 3PBOA 1W8QA 4WEJA 3VFFA 3OZHA 3E2LA 1YLPA 4MNRA 4OOLA 3C4OA 5M19A 1O07A 4HESA 4EUZA 1N9BA 2Y59A 1LL5A 2R9XA 3A3JA 3JYIA 2P9VB 2V1ZA 3V50A 3VMAA 4WMCD 1NXYA 2X02A 5FSRA 3BLSA 2Q9MA 3HUMA 2QPNA 3BRMA 2E8IA 3UE3A 3WS4A 3WS2A 1YLYA 2Y2OA 1KGEA 4E3IA 3C5AA 4P87A 1L2SA 3D4FA 1YMXA 5IHVA 3N7WA 4RVAA 1BTLA 5F82A 2EFUA 3GRJA 4KZ5A 4ZAMA 2ZMAA 4B4XA 2PU4A 3M2JA 4OOMA 1PI4A 1ZC2A 4S2MA 5FQ9A 1XX2A 4PPRA 3OPHA 1LI0A 1SDNA 1XGIA 1JVJA 1TVFA 2WK0A 3PBSA 4IVIA 3W4OA 2ZJ9A 4RX2A 3WWXA 5FQMA 1MWRA 4X53A 3CG5A 4GD8A 2BG1A 3ZFZA 3LCEA 2A49A 3N8RA 2ZQ8A 2WZXA 2XR0A 3BFCA 3G2YA 4OVDA 2RCXA 5EOEA 4Y0UA 1KVMA 4OH0A 1W79A 3HLWA 3E2KA 2RL3A 5E2HA 1ZKJA 2ZC6B 1BUEA 1FCMA 3BFGA 5EOOA 1XPBA 5KZHA 5FQIA 1ERMA 5DVAA 1K25A 5HARA 1Q2PA 4GD6A 2IWDA 3BFFA 2X71A 1E4DA 4IEDA 1JTGA 2V2FF 1MXOA 3G30A 2ZD8A 1TEMA 3OCNA 3P98A 4E3KA 5F1FA 2Q9NA 4DF6A 1MWTA 2WAEA 4MEZA 4HEFA 3ZNTA 2Y2IA 4LENA 1LHYA 4S2IA 1QMEA 4C6YA 4OKPA 4OOYA 1NZOA 3MZFA 4YFMA 4LCMA 3G2ZA 4IVKA 1K56A 2ZC4B 2Y2NA 3QHYA 1KGGA 4Y7PA 2Y2PA 1CK3A 4JF5A 5A90A 4P85A 4LV0A 5HL1A 4C3QA 3WRZA 1GHPA 3G34A 1LLBA 5FQJA 4MBFA 3NY4A 4DDYA 4WYYA 4EQIA 1GCEA 1TDLA 1WYBA 3C7VA 3IWOA 3HLFA 4QY6A 2Z2LB 4PM7A 2HP5A 3PBRA 3ZVWA 4DXCA 4YINA 3BYDA 1MPLA 4JPMA 4M3KA 1M6KA 1WYCA 4OQHA 1PWGA 4BLMA 4KZBA 3BLMA 2XGNA 1K54A 1HZOA 4MBKA 2EXAA 2H5SA 1BSGA 4OPYA 3V3SA 1YMSA 5A93A 4LV3A 1SHVA 2XH9A 1ES5A 3PBNA 4JF6A 4Z9QA 3N4IA 3Q7VA 2HP9A 1DJBA 1K56D 4BJPA 5BOHA 4GDBA 4CPKA 5CGWA 3HLDA 1L0FA 4UA9A 4U0TA 5CHUA 1E25A 3ZGAB 3S1YA 5J8XA 2WAFA 1MKIA 1YM1A 4OP8A 4RX3A 2ZQCA 3BFEA 1VM1A 4GZBA 4OQ0A 5E2GA 5HX9A 3G35A 4X69A 4KQRA 1MWSA 3HBRA 1ES2A 3MZDA 5GLBA 5GLDA 4E3MA 4R3JA 5G18A 1ESUA 2JBFA 4QU3A 3BFDA 1RP5A 1PWDA 4S2PA 5F83A 1K38A 2XQZA 3SS4A 4PM9A 5I94A 2XK1A 1DJAA 2OSUA 1KE4A 1ESIA 3SS5A 4IBXA 3ZG5A 3UDFA 3ZG7B 5FASA 4JKTA 1XKZA 3TOIA 1MY8A 4BD1A 2H0TA 4KZ3A 1Y54A 1C3BA 1KE0A 3IF5A 4R4RA 3VP1A 5FI2A 1KE3A 3WRTA 5CHMA 3A3DA 2ZC7A 4KZ7A 3IXGA 3Q1FA 3DWZA 3VSLA 4F94A 1IYSA 2CC1A 1FQGA 1H8ZA 3VP4A 1H5XA 3MXSA 4EBNA 5DTSA 5HFOA 2ZM8A 1EROA 1FOFA 2XFTA 2WGWA 4OPQA 5AQBA 1U60A 2XF3A 2WGIA 2VGKA 4QB8A 4WEKA 5FDHA 4QJGA 2EX9A 1PI5A 1HVBA 1PW8A 2HDSA 2WGWB 3HL9A 4OP5A 3PAGA 3UPNA 3ZCZA 5DF7A 2WADA 3GTCA 3NC8A 3IXDA 1SCWA 5FAOA 4ZBEA 1W5DA 4ID4A 3TSGA 1W7FA 3ZHHA 1MWUA 1FSWA 2UWXA 1NZUA 2Y2GA 4B4ZA 2G2UA 1EI5A 3HLBA 3IT9A 1BLSA 3M2KA 4E6XA 3UE1A 2FFFB 4PM5A 3HREA 1BT5A 4K91A 5AQ9A 1JWVA 4BD0A 2EXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5Q A;  4U0X A;  5FQQ A;  1CEF A;  3Q81 A;  4FH2 A;  2WKI A;  1W8Y A;  4KZ8 A;  5JYO A;  3A3I A;  2VGJ A;  1BLC A;  2C6W B;  3M6B A;  1PZP A;  2XEP A;  4NET A;  3IXB A;  3RXX A;  5CTN A;  4U3T A;  2ZQ9 A;  4R1G A;  3DW0 A;  5HAI A;  2Y91 A;  5FI7 A;  4B88 A;  2J7V A;  1K4F A;  4UA7 A;  3VOY A;  3IF6 A;  4KZ4 A;  4ZJ1 A;  4KQQ A;  1XGJ A;  4GOG A;  3S22 A;  2QMI A;  5EEC A;  4D2O A;  2X01 A;  1SKF A;  2H0Y A;  3S4X A;  2Z2M B;  3OPP A;  1KGF A;  1DJC A;  4N1H A;  2DCF A;  5TR7 A;  1RGZ A;  1NRF A;  5FAQ A;  1NYY A;  3PBQ A;  4E3O A;  2Y4A A;  4JF4 A;  3G32 A;  3ITA A;  3C4P A;  3UO9 A;  2J9P A;  4JXS A;  4E3L A;  1SDE A;  5E2F A;  1YQS A;  3W8K A;  2JCH A;  1H8Y A;  4XUZ A;  4GB7 A;  1IYQ A;  3UDI A;  4DDS A;  2WKE A;  3HLG A;  1K55 A;  2Y55 A;  3GVB A;  5CRF A;  4OQI A;  4XXR A;  4FSF A;  3IH9 A;  3HLC A;  3ZG9 B;  2OLV A;  1TDG A;  4S2O A;  3V39 A;  2ZQD A;  4GKU A;  5M18 A;  2ZC5 B;  3NDG A;  1ZG4 A;  5EUA A;  4DE3 A;  3HLE A;  3M6H A;  4OLD A;  1EWZ A;  1GA9 A;  3O88 A;  5GLC A;  3IHA A;  2DRW A;  1E3U A;  3FKW A;  5EPH A;  1BLH A;  4QD4 A;  1S6R A;  5FI6 A;  2HP6 A;  3FYZ A;  2WZZ A;  5CEB A;  3HUO A;  1BUL A;  1KDW A;  1PIO A;  3IHB A;  1K6R A;  3Q7V B;  3DTM A;  3NBL A;  1K54 C;  4JXG A;  5GHY A;  2IWB A;  1NJ4 A;  4WZ5 A;  2R9W A;  5TGF A;  1CI8 A;  1PWC A;  3G4P A;  2ZC3 B;  4MLL A;  4QHC A;  4EWF A;  3ZNY A;  3LY3 A;  3UY6 A;  5L2F A;  3GMW A;  5EE8 A;  3Q07 A;  4OON A;  1FR6 A;  2Y2H A;  4C75 A;  4Q8I A;  4XUX A;  5GLA A;  3SH8 A;  2C5W B;  2PU2 A;  4RYE A;  4DE1 A;  3IWQ A;  4JXV A;  1I2W A;  4KZ6 A;  3UDX A;  4EBL A;  4KEN B;  1YLZ A;  3IWI A;  1KVL A;  4WZ5 C;  3NI9 A;  3V3R A;  5KSH A;  3CJM A;  1E3U D;  1RGY A;  3CZD A;  5DTK A;  1HTZ A;  2G2W A;  4OPZ A;  3EQV A;  3C7U A;  2Y2L A;  1L0E A;  5GL9 A;  3RXW A;  3BM6 A;  3UNW A;  3BEC A;  1G68 A;  1N4O A;  1S0W A;  4FH4 A;  3MBZ A;  4DRT A;  4WM9 A;  5FAP A;  5HW3 A;  1VQQ A;  4KG2 A;  4UAA A;  1GHI A;  1IEM A;  4ZTK A;  2XD1 A;  3SS3 A;  2HDR A;  3WS5 A;  2ZLY A;  3MKF A;  2Y2M A;  4MBH A;  4X56 A;  5M1A A;  1HD8 A;  3HVF A;  2JC7 A;  4N1X A;  3LY4 A;  4N9L A;  2XDM A;  5GHX A;  2Y2J A;  1Z6F A;  1RCJ A;  4QY5 A;  5E43 A;  3UE0 A;  2P9V A;  2WKH A;  3N8L A;  1ES3 A;  4L0L A;  1YT4 A;  4RA7 A;  1NY0 A;  4CJN A;  4S2N A;  4S2L A;  5D3O A;  5FA7 A;  4UHU A;  4DKI A;  4WBG A;  4EV4 A;  3PAE A;  4FCF A;  4N9K A;  4ZDX A;  5AQ7 A;  3O86 A;  3GR2 A;  1WE4 A;  3OCL A;  4N92 A;  4Y0T A;  3IH8 A;  1XA7 A;  4Y0O A;  3WS1 A;  3MZE A;  4OLG A;  4GDN A;  4BL3 A;  3P09 A;  4S2J A;  1IEL A;  2HDU A;  1YLJ A;  1YLW A;  4KG6 A;  5EVL A;  1ONG A;  4E6W A;  4S2N C;  3AGD A;  3MKE A;  5KMW A;  4OPR A;  1DY6 A;  3VOZ A;  4LV1 A;  1L0G A;  1FR1 A;  1OME A;  1K57 A;  3EQU A;  5CTM A;  1GHM A;  1J9M A;  3VP3 A;  3O3V A;  3QNB A;  1XP4 A;  2EX8 A;  1I2S A;  4PMA A;  3SOI A;  1JTD A;  3B3X A;  2ZM2 A;  2H10 A;  2FFY A;  1JWZ A;  4IBR A;  5TFQ A;  4BQM A;  4E3N A;  3LEZ A;  5EVI A;  3ZG8 B;  5JYP A;  3W4P A;  2A3U A;  1Q2Q A;  3N8S A;  1FSY A;  5A91 A;  1K57 C;  2PBY A;  3IQA A;  4WZ4 A;  1IYO A;  5EVI B;  4KG5 A;  4OQG A;  1CEG A;  3O87 A;  3IF6 B;  3SH9 A;  5CED A;  4JBF A;  1L0D A;  3OPL A;  5CGS A;  5CEC A;  2ZQA A;  3AGE A;  2XLN A;  4E3J A;  2I72 A;  5A92 A;  4R4S A;  3DWK A;  4A5R A;  4DE2 A;  3ZDJ A;  3GSG A;  3FV7 A;  2V20 A;  5EVI C;  1PW1 A;  4WEL A;  1ALQ A;  4FD8 A;  3IF6 C;  4DXB A;  1FCO A;  4JXW A;  2WYX A;  4EBP A;  3A3E A;  4KQO A;  1LI9 A;  5AQA A;  5U47 A;  4HBU A;  3GV9 A;  4HBT A;  1MBL A;  2JE5 A;  4LV2 A;  5F1G A;  3PBT A;  4S2K A;  4R0Q A;  2ZQ7 A;  5DF8 A;  1PZO A;  2GDN A;  1IYP A;  3IXH A;  1CI9 A;  3OC2 A;  3ZVT A;  1KDS A;  1O7E A;  5CER A;  4NK3 A;  5DTT A;  4JLF A;  5EVI D;  2EX2 A;  4O7D A;  1ES4 A;  2EX6 A;  3HUN A;  4GNU A;  1ZG6 A;  4P6B A;  3UN7 A;  3VSK A;  1QMF A;  4PM6 A;  3VP0 A;  2J8Y A;  1NYM A;  1K55 C;  3BEB A;  4KZA A;  2XFS A;  4BEN A;  3Q7Z A;  1FCN A;  5CHJ A;  3ITB A;  1LL9 A;  2OLU A;  5GHZ A;  3UPO A;  2ZM0 A;  3NDE A;  2OV5 A;  4KZ9 A;  5CGX A;  1XXM A;  3TG9 A;  2Y2Q A;  3V5M A;  1JWP A;  4X68 A;  3WS0 A;  5HAQ A;  2QZ6 A;  2XD5 A;  4R23 A;  4ZJ2 A;  1K4E A;  3LO7 A;  1M40 A;  2P74 A;  1BZA A;  4PM8 A;  3FWL A;  3MFD A;  3MXR A;  3Q82 A;  1PYY A;  5FAT A;  2B5R A;  5CXW A;  5DF9 A;  1G6A A;  3VFH A;  3W4Q A;  4DE0 A;  3ISG A;  2WUQ A;  3OPR A;  1IKI A;  3CMZ A;  5E2E A;  4WMC A;  5HAP A;  4GN2 A;  3NIA A;  3VP2 A;  2J9O A;  2EFX A;  2IWC A;  3PTE A;  5KSC A;  4X6T A;  4R3B A;  2BLS A;  3SH7 A;  2Y2K A;  3NCK A;  3FZC A;  4UA6 A;  3UPP A;  1YLT A;  4BL2 A;  2WGV A;  2HPB A;  2HDQ A;  1ONH A;  1IKG A;  1ERQ A;  2DNS A;  3G31 A;  3I7J A;  1K6S A;  4K0W A;  1BLP A;  1GA0 A;  4K0X A;  4X55 A;  3RJU A;  1AXB A;  3AGF A;  3A3F A;  3GQZ A;  3QNC A;  4H8R A;  3ZG0 A;  1XA1 A;  4LCL A;  4P0M A;  3FKV A;  4ZJ3 A;  5FQK A;  3N6I A;  3PBO A;  1W8Q A;  4WEJ A;  3VFF A;  3OZH A;  3E2L A;  1YLP A;  4MNR A;  4OOL A;  3C4O A;  5M19 A;  1O07 A;  4HES A;  4EUZ A;  1N9B A;  2Y59 A;  1LL5 A;  2R9X A;  3A3J A;  3JYI A;  2P9V B;  2V1Z A;  3V50 A;  3VMA A;  4WMC D;  1NXY A;  2X02 A;  5FSR A;  3BLS A;  2Q9M A;  3HUM A;  2QPN A;  3BRM A;  2E8I A;  3UE3 A;  3WS4 A;  3WS2 A;  1YLY A;  2Y2O A;  1KGE A;  4E3I A;  3C5A A;  4P87 A;  1L2S A;  3D4F A;  1YMX A;  5IHV A;  3N7W A;  4RVA A;  1BTL A;  5F82 A;  2EFU A;  3GRJ A;  4KZ5 A;  4ZAM A;  2ZMA A;  4B4X A;  2PU4 A;  3M2J A;  4OOM A;  1PI4 A;  1ZC2 A;  4S2M A;  5FQ9 A;  1XX2 A;  4PPR A;  3OPH A;  1LI0 A;  1SDN A;  1XGI A;  1JVJ A;  1TVF A;  2WK0 A;  3PBS A;  4IVI A;  3W4O A;  2ZJ9 A;  4RX2 A;  3WWX A;  5FQM A;  1MWR A;  4X53 A;  3CG5 A;  4GD8 A;  2BG1 A;  3ZFZ A;  3LCE A;  2A49 A;  3N8R A;  2ZQ8 A;  2WZX A;  2XR0 A;  3BFC A;  3G2Y A;  4OVD A;  2RCX A;  5EOE A;  4Y0U A;  1KVM A;  4OH0 A;  1W79 A;  3HLW A;  3E2K A;  2RL3 A;  5E2H A;  1ZKJ A;  2ZC6 B;  1BUE A;  1FCM A;  3BFG A;  5EOO A;  1XPB A;  5KZH A;  5FQI A;  1ERM A;  5DVA A;  1K25 A;  5HAR A;  1Q2P A;  4GD6 A;  2IWD A;  3BFF A;  2X71 A;  1E4D A;  4IED A;  1JTG A;  2V2F F;  1MXO A;  3G30 A;  2ZD8 A;  1TEM A;  3OCN A;  3P98 A;  4E3K A;  5F1F A;  2Q9N A;  4DF6 A;  1MWT A;  2WAE A;  4MEZ A;  4HEF A;  3ZNT A;  2Y2I A;  4LEN A;  1LHY A;  4S2I A;  1QME A;  4C6Y A;  4OKP A;  4OOY A;  1NZO A;  3MZF A;  4YFM A;  4LCM A;  3G2Z A;  4IVK A;  1K56 A;  2ZC4 B;  2Y2N A;  3QHY A;  1KGG A;  4Y7P A;  2Y2P A;  1CK3 A;  4JF5 A;  5A90 A;  4P85 A;  4LV0 A;  5HL1 A;  4C3Q A;  3WRZ A;  1GHP A;  3G34 A;  1LLB A;  5FQJ A;  4MBF A;  3NY4 A;  4DDY A;  4WYY A;  4EQI A;  1GCE A;  1TDL A;  1WYB A;  3C7V A;  3IWO A;  3HLF A;  4QY6 A;  2Z2L B;  4PM7 A;  2HP5 A;  3PBR A;  3ZVW A;  4DXC A;  4YIN A;  3BYD A;  1MPL A;  4JPM A;  4M3K A;  1M6K A;  1WYC A;  4OQH A;  1PWG A;  4BLM A;  4KZB A;  3BLM A;  2XGN A;  1K54 A;  1HZO A;  4MBK A;  2EXA A;  2H5S A;  1BSG A;  4OPY A;  3V3S A;  1YMS A;  5A93 A;  4LV3 A;  1SHV A;  2XH9 A;  1ES5 A;  3PBN A;  4JF6 A;  4Z9Q A;  3N4I A;  3Q7V A;  2HP9 A;  1DJB A;  1K56 D;  4BJP A;  5BOH A;  4GDB A;  4CPK A;  5CGW A;  3HLD A;  1L0F A;  4UA9 A;  4U0T A;  5CHU A;  1E25 A;  3ZGA B;  3S1Y A;  5J8X A;  2WAF A;  1MKI A;  1YM1 A;  4OP8 A;  4RX3 A;  2ZQC A;  3BFE A;  1VM1 A;  4GZB A;  4OQ0 A;  5E2G A;  5HX9 A;  3G35 A;  4X69 A;  4KQR A;  1MWS A;  3HBR A;  1ES2 A;  3MZD A;  5GLB A;  5GLD A;  4E3M A;  4R3J A;  5G18 A;  1ESU A;  2JBF A;  4QU3 A;  3BFD A;  1RP5 A;  1PWD A;  4S2P A;  5F83 A;  1K38 A;  2XQZ A;  3SS4 A;  4PM9 A;  5I94 A;  2XK1 A;  1DJA A;  2OSU A;  1KE4 A;  1ESI A;  3SS5 A;  4IBX A;  3ZG5 A;  3UDF A;  3ZG7 B;  5FAS A;  4JKT A;  1XKZ A;  3TOI A;  1MY8 A;  4BD1 A;  2H0T A;  4KZ3 A;  1Y54 A;  1C3B A;  1KE0 A;  3IF5 A;  4R4R A;  3VP1 A;  5FI2 A;  1KE3 A;  3WRT A;  5CHM A;  3A3D A;  2ZC7 A;  4KZ7 A;  3IXG A;  3Q1F A;  3DWZ A;  3VSL A;  4F94 A;  1IYS A;  2CC1 A;  1FQG A;  1H8Z A;  3VP4 A;  1H5X A;  3MXS A;  4EBN A;  5DTS A;  5HFO A;  2ZM8 A;  1ERO A;  1FOF A;  2XFT A;  2WGW A;  4OPQ A;  5AQB A;  1U60 A;  2XF3 A;  2WGI A;  2VGK A;  4QB8 A;  4WEK A;  5FDH A;  4QJG A;  2EX9 A;  1PI5 A;  1HVB A;  1PW8 A;  2HDS A;  2WGW B;  3HL9 A;  4OP5 A;  3PAG A;  3UPN A;  3ZCZ A;  5DF7 A;  2WAD A;  3GTC A;  3NC8 A;  3IXD A;  1SCW A;  5FAO A;  4ZBE A;  1W5D A;  4ID4 A;  3TSG A;  1W7F A;  3ZHH A;  1MWU A;  1FSW A;  2UWX A;  1NZU A;  2Y2G A;  4B4Z A;  2G2U A;  1EI5 A;  3HLB A;  3IT9 A;  1BLS A;  3M2K A;  4E6X A;  3UE1 A;  2FFF B;  4PM5 A;  3HRE A;  1BT5 A;  4K91 A;  5AQ9 A;  1JWV A;  4BD0 A;  2EXB A; 
#chains in the Genus database with same CATH topology
 1PFL A;  4KQD A;  3TW8 A;  3EGD C;  3LIF A;  4KZ8 A;  5JYO A;  3M6B A;  1BLC A;  2C6W B;  4MN7 A;  2XEP A;  4NET A;  3IXB A;  3T1S A;  2GZA A;  2J3W A;  4D60 A;  5HAI A;  4B88 A;  2M7V A;  4UA7 A;  4ZJ1 A;  1XGJ A;  1ZHH B;  3S4X A;  1P9R A;  1NRF A;  1NYY A;  1S4S A;  1NWZ A;  3ITA A;  3UO9 A;  1SDE A;  2VGL S;  5E2F A;  4MN5 A;  3UDI A;  4PAU A;  4II7 A;  5CRF A;  3DTE A;  4OQI A;  2OLV A;  1TDG A;  4S2O A;  4GKU A;  3LYX A;  1LSX A;  5M18 A;  3M6H A;  2DRW A;  4L9F A;  4QD4 A;  3FYZ A;  2WZZ A;  1TF1 A;  3HUO A;  3NOT C;  2DMW A;  4Q0I A;  3ZNY A;  3UY6 A;  1S67 L;  2HJ9 C;  1H8M A;  1FR6 A;  4C75 A;  3D9Y A;  3OLO A;  4RYE A;  3IWQ A;  3UDX A;  1DP8 A;  1P9W A;  1G28 A;  4F3L B;  1RGY A;  1W63 M;  3CZD A;  1HTZ A;  3CLO A;  1YSP A;  1L0E A;  3RXW A;  4DRT A;  4WM9 A;  3LIA A;  1VQQ A;  2AVX A;  3SS3 A;  2ZLY A;  2Y2M A;  4E04 A;  4N9L A;  2XDM A;  1IFQ A;  1Z6F A;  1RCJ A;  5E43 A;  3VOL A;  3N8L A;  3A0S A;  1YT4 A;  1NY0 A;  2BAS A;  4S2N A;  3UB8 A;  5D3O A;  4EV4 A;  3F1P A;  4ZDX A;  5AQ7 A;  3O86 A;  3GR2 A;  1WE4 A;  2FZ0 A;  3HCY A;  4Y0O A;  3WS1 A;  4GDN A;  5FL3 A;  4EET B;  1IEL A;  1YLW A;  4HQA A;  2D02 A;  3T4K A;  4S2N C;  3LGO A;  3AGD A;  5KMW A;  1S1Z A;  4LV1 A;  1L0G A;  1GHM A;  3LI9 A;  5L07 A;  3CUE A;  3VP3 A;  2XA7 S;  3DBA A;  1VEU B;  2ZM2 A;  4IBR A;  1F9I A;  4WF0 A;  5TFQ A;  3ZG8 B;  5JYP A;  3W4P A;  4IJG A;  3KSG A;  5A91 A;  3B42 A;  2PBY A;  3ULF A;  5DJT A;  1ZTU A;  4OQG A;  4JBF A;  3DTI A;  1TS7 A;  4O8G A;  4HIA A;  2I72 A;  5A92 A;  4R4S A;  4FOF A;  3ZDJ A;  3GSG A;  2V20 A;  1PW1 A;  4X1L A;  1FCO A;  4EBP A;  5AQA A;  3GV9 A;  3QP5 A;  2JE5 A;  5K5B A;  1UWP X;  4S2K A;  4R0Q A;  5DF8 A;  3TRC A;  4ARZ A;  1IYP A;  3A0V A;  3ZVT A;  5DTT A;  5EVI D;  3O5Y A;  1ES4 A;  5FEF A;  1QMF A;  3F1N A;  1LSW A;  1LT0 A;  3VP0 A;  2G7U A;  1LL9 A;  2OLU A;  3UPO A;  3LR4 A;  2OV5 A;  4KZ9 A;  3TG9 A;  5HDC A;  2XD5 A;  4XT2 A;  3W4Q A;  5CXW A;  1G6A A;  1P0Z A;  3UE6 A;  3JVU A;  2JKG A;  3CMZ A;  2HZ5 A;  3NIA A;  3VP2 A;  3PTE A;  5HD3 A;  3NCK A;  3UPP A;  2WGV A;  2HPB A;  3I7J A;  1GA0 A;  4GLQ A;  4X55 A;  1MC0 A;  3UMD A;  4LCL A;  1TD5 A;  4EXO A;  4WEJ A;  4MNR A;  4LPZ A;  3PHY A;  4HES A;  2Y59 A;  2R9X A;  3A3J A;  3JYI A;  3V50 A;  2QJ7 A;  2Y2O A;  4P87 A;  3F1P B;  1T1B A;  4HJ3 A;  3D4F A;  3N7W A;  4RVA A;  1BTL A;  5J4E A;  3GRJ A;  1NLY A;  4OOM A;  1YKD A;  1PI4 A;  5FQ9 A;  1OTB A;  2QJ5 A;  3T1X A;  3KYZ A;  1XGI A;  3W4O A;  3NUL A;  1MWR A;  3T12 B;  4GD8 A;  3ZFZ A;  2ZQ8 A;  5EOE A;  3D3O A;  2VZW A;  3PYP A;  2VK3 A;  1ZKJ A;  1FCM A;  5KZH A;  1K25 A;  2QYB A;  1Q2P A;  4GD6 A;  4I3A A;  1YAX A;  1MXO A;  2ZD8 A;  1TEM A;  2L4R A;  3ZNT A;  4HOI A;  4OOY A;  1NZO A;  3G2Z A;  4IVK A;  3MSH A;  2V0U A;  3SZT A;  1KGG A;  2OWH A;  4Y7P A;  2Y2P A;  4LV0 A;  5IT5 A;  4C3Q A;  2PT7 A;  3G34 A;  5FQJ A;  4MBF A;  4WUJ A;  3ZYT A;  4Q0H A;  1GCE A;  3IWO A;  1DRM A;  4PM7 A;  4DXC A;  5DJU A;  1VHM A;  3F1N B;  3BYD A;  1MPL A;  4M3K A;  3F1O A;  1M6K A;  4MN6 A;  2EXA A;  2H5S A;  2YKH A;  3NHQ A;  3RFB A;  2J80 A;  4QPR A;  4Z9Q A;  1SHV A;  2XH9 A;  3PBN A;  2UV0 E;  3N4I A;  3Q7V A;  5BOH A;  4GDB A;  5HD5 A;  3HLD A;  1L0F A;  3S7P A;  2PD8 A;  3T1R A;  5HWT A;  3ZGA B;  1YM1 A;  3B47 A;  4KQR A;  3R7W B;  3PXP A;  5GLB A;  2J3T D;  4Q0J A;  1ESU A;  4QU3 A;  3BFD A;  1PWD A;  1K38 A;  4PM9 A;  2XK1 A;  2Y79 A;  3RTY A;  3ZG5 A;  2JKR M;  5F69 A;  3TOI A;  1XKZ A;  2H0T A;  1Y54 A;  2CMN A;  1GSV A;  1UWN X;  3A3D A;  3VSL A;  4MDZ A;  4WL9 A;  3MXS A;  4EW7 A;  4EBN A;  1FOF A;  3IS2 A;  4OPQ A;  2O9B A;  2PAV P;  4EES A;  4QJG A;  3UPN A;  3MQQ A;  2QWS A;  3ZCZ A;  5L8M A;  5HWW A;  3NC8 A;  4ZBE A;  3H82 A;  1MWU A;  2UWX A;  3HJI A;  3IT9 A;  3M2K A;  3BY8 A;  4PM5 A;  4FTX A;  4CQH A;  4K91 A;  4HJ4 A;  1JWV A;  5FQQ A;  3Q81 A;  3T4L A;  2ZOI A;  3FPV A;  1PZP A;  3RXX A;  4WN5 A;  4I39 A;  4EU0 A;  5FI7 A;  2HJE A;  3U2A A;  4YOF A;  5EEC A;  2Z2M B;  3OPP A;  4N1H A;  2O99 A;  4NXF A;  3T4O A;  1RGZ A;  1CF0 A;  1Y4O A;  2J9P A;  4JXS A;  1L3L A;  4GB7 A;  2NUP C;  4DDS A;  3CHW P;  3T4J A;  2WKE A;  1K55 A;  2Y55 A;  3IH9 A;  3ZG9 B;  1CQA A;  2PYP A;  2ZQD A;  2ZC5 B;  4LFU A;  1G5U A;  3O88 A;  3F1O B;  5GLC A;  2B95 A;  3IHA A;  1E3U A;  4PKY A;  4GJ4 A;  5EPH A;  2J3T C;  1S6R A;  1T18 A;  2Q0O A;  3IHB A;  3Q7V B;  3NBL A;  1K54 C;  4JXG A;  2IWB A;  4WZ5 A;  5TGF A;  4DJ2 A;  4KUO A;  4MLL A;  2W3H A;  2IA2 A;  4HY8 A;  5EE8 A;  1ACF A;  2NUT C;  2V8F A;  4OON A;  2Y2H A;  4Q8I A;  5GLA A;  3KO6 A;  5A8B A;  1I2W A;  4CLC E;  4EBL A;  2A24 A;  4FUW A;  3MJQ A;  4WZ5 C;  5EVE A;  5KSH A;  5DTK A;  5AVE A;  3C7U A;  1WA9 A;  2Y2L A;  5GL9 A;  2JHE A;  1G68 A;  1N4O A;  3BEC A;  4FH4 A;  3MBZ A;  3MQO A;  4UAA A;  4KG2 A;  4E3O A;  3WS5 A;  3MKF A;  4MBH A;  5M1A A;  1HD8 A;  2JC7 A;  4UQI M;  4L0L A;  4UHU A;  4WBG A;  4GHI A;  3IS2 B;  3PAE A;  4FCF A;  2K31 A;  3V67 A;  4Y0T A;  3IH8 A;  2V0W A;  4OLG A;  1T1A A;  4S2J A;  1YLJ A;  2L0W A;  4E6W A;  1OT6 A;  3MKE A;  1DY6 A;  1YSQ A;  1KOU A;  3QNB A;  4PMA A;  3C38 A;  2W1R A;  1JWZ A;  4IUH A;  3KYQ A;  2ZL1 A;  3LR5 A;  3N8S A;  2PRF A;  5J3W A;  4LLO B;  3IQA A;  4WZ4 A;  1IYO A;  3GEC A;  1CEG A;  3O87 A;  1OPX A;  3OPL A;  5CEC A;  3AGE A;  4E3J A;  3DWK A;  4A5R A;  3FV7 A;  4WEL A;  4LRZ E;  4DXB A;  2ZMV A;  4KQO A;  1LI9 A;  4HBT A;  1MBL A;  2ZQ7 A;  1PZO A;  4I38 A;  3IXH A;  3OC2 A;  3HJK A;  1O7E A;  5CER A;  4GS9 A;  2EX6 A;  4LRX C;  3UN7 A;  4P6B A;  2J8Y A;  4RQ9 A;  1NYM A;  5CHJ A;  3ITB A;  3PR6 A;  5CGX A;  3V5M A;  4X68 A;  4R23 A;  3UME A;  1K4E A;  3LO7 A;  1PYY A;  4DE0 A;  5DF9 A;  1V9Y A;  1FIL A;  2W0N A;  3OPR A;  1IKI A;  4WMC A;  4K08 A;  4GN2 A;  2IWC A;  4R3B A;  2Y2K A;  4UA6 A;  4HH3 A;  4BL2 A;  1H0M A;  1H3Q A;  2HDQ A;  5IS1 A;  1OJG A;  2A24 B;  2DNS A;  3G31 A;  2PYR A;  3AGF A;  3GQZ A;  3A3F A;  1OTD A;  4BMW A;  2PR6 A;  3QP2 A;  3N6I A;  2WKR A;  3NEC A;  4OOL A;  2KLI A;  5M19 A;  2VV8 A;  1JNU A;  2P7J A;  3JPU A;  2V1Z A;  3MXQ A;  2X02 A;  3WS2 A;  3WS4 A;  1YLY A;  4GHI B;  1L2S A;  4ETX A;  5IHV A;  4ZAM A;  2ZMA A;  4B4X A;  2PU4 A;  1PRQ A;  1ZC2 A;  4S2M A;  2HV1 A;  1XX2 A;  3OPH A;  1LI0 A;  2Z6D A;  2BTF P;  1TVF A;  3PBS A;  4EEU A;  4IUK A;  3WWX A;  5FQM A;  4O0P A;  3CG5 A;  3EEH A;  3G2Y A;  4OVD A;  4Y0U A;  1EW0 A;  3HLW A;  3E2K A;  3BFG A;  3UB7 A;  3FG8 A;  3CUE C;  3CIT A;  2ZL1 B;  3NOU C;  1OJ5 A;  2JKF A;  4IED A;  3CAX A;  3G30 A;  5F1F A;  4E3K A;  2VKS A;  2Y8H A;  4DF6 A;  2PR5 A;  1MWT A;  2WAE A;  1XFQ A;  3IX4 A;  4HEF A;  1F98 A;  4LEN A;  4S2I A;  1LHY A;  3MZF A;  5DFY A;  1CK3 A;  4JF5 A;  5A90 A;  4G3K A;  4Z1W A;  1T19 A;  1GHP A;  4O01 A;  4GS9 B;  4DDY A;  5HSQ A;  4EQI A;  1TDL A;  4QY6 A;  2Z2L B;  2VX8 A;  3G6O A;  3PBR A;  4YIN A;  1D7E A;  2YKF A;  4BLM A;  4KZB A;  4B9O A;  2A2L A;  2INW A;  2XGN A;  4MBK A;  4EER A;  1MZU A;  4G3V A;  4JF6 A;  4NEE D;  2VGL M;  4HP4 A;  4BJP A;  3QP6 A;  4U0T A;  2GX5 A;  5CHU A;  2V1A A;  4QWO A;  3R7W A;  3S1Y A;  5J8X A;  2WAF A;  4OP8 A;  1VM1 A;  5E2G A;  4OQ0 A;  3G35 A;  4X69 A;  1MWS A;  3R4K A;  5GLD A;  4E3M A;  4R3J A;  4EQ1 A;  5HPF A;  2JBF A;  4DMZ A;  3S7Q A;  5F83 A;  4S2P A;  3SS4 A;  3FPW A;  2XQZ A;  2OSU A;  1KE4 A;  3SS5 A;  1XJ3 A;  1MY8 A;  4CLC A;  1C3B A;  3IF5 A;  4R6L A;  2P08 A;  2VEA A;  1KE3 A;  3WRT A;  3Q1F A;  3CI6 A;  1IYS A;  1FQG A;  1H8Z A;  3C30 A;  3VP4 A;  3S7N A;  3BY9 A;  5AQB A;  4CLC C;  1N9N A;  2LB9 A;  2XF3 A;  5FDH A;  1Y28 A;  2EX9 A;  1PI5 A;  1HVB A;  2JKR I;  2WGW B;  4PKY G;  5HDS A;  4ID4 A;  3TSG A;  3T4Q A;  1XJ6 A;  1EI5 A;  3L7H A;  3HLB A;  2V1B A;  5AQ9 A;  3KSI A;  3GDI A;  1I5Q A;  4U0X A;  4FH2 A;  2WKI A;  2VGJ A;  2JKT M;  4HP9 A;  4U3T A;  2ZQ9 A;  5EV0 A;  2J7V A;  1K4F A;  5IU1 A;  3IF6 A;  4KZ4 A;  3T4S A;  3LEQ A;  4NXB A;  4GOG A;  2KDK A;  3UB6 A;  1TS8 A;  1SKF A;  2H0Y A;  2DCF A;  5FAQ A;  4JF4 A;  4NXG A;  3TE8 A;  4L9G A;  2XSS A;  1YQS A;  3W8K A;  4XUZ A;  5FEG A;  4XXR A;  3HLC A;  3BJN A;  4BBT A;  4Y13 A;  1ZG4 A;  2EWV A;  5EUA A;  4DE3 A;  2M1C A;  4P6Z S;  4X25 A;  3HLE A;  1GA9 A;  3MQ0 A;  3FKW A;  5FI6 A;  2HP6 A;  5CEB A;  1BUL A;  1KDW A;  4GCZ A;  1PNE A;  5GHY A;  1NJ4 A;  5HZH A;  4AFI A;  1PWC A;  4EWF A;  4QHC A;  3LY3 A;  5L2F A;  3GMW A;  4XUX A;  3SH8 A;  3IBR A;  4UQI S;  2C5W B;  5HWV A;  4JXV A;  2K7S A;  4KEN B;  2ZOH A;  5C5K A;  1KVL A;  3NI9 A;  3CJM A;  1E3U D;  3EQV A;  3BM6 A;  2PDR A;  3BW6 A;  3EGX C;  5FAP A;  4CLC B;  1IEM A;  1S66 L;  1S1Y A;  2WKH A;  4RA7 A;  1ES3 A;  3K2N A;  3H9W A;  4S2L A;  4DKI A;  2ZBB A;  4MCW A;  4N9K A;  2P04 A;  4R38 A;  3OCL A;  1XA7 A;  3P09 A;  4KG6 A;  5EVL A;  3KSF A;  1ONG A;  3LID A;  2WKQ A;  3VOZ A;  5CTM A;  3EQU A;  3QP1 A;  3LR3 A;  1J9M A;  3O3V A;  3C8C A;  3SOI A;  1JTD A;  4LRY C;  2FFY A;  2VV6 A;  4G3W A;  4E3N A;  1Q2Q A;  3LR0 A;  1FSY A;  5EVI B;  3IF6 B;  3SH9 A;  5CED A;  2O9A A;  1L0D A;  5CGS A;  2ZQA A;  2XLN A;  1V9Z A;  1D06 A;  4FD8 A;  2HF6 A;  3E98 A;  2WYX A;  3A3E A;  2W3G A;  4HBU A;  4JGQ A;  3PBT A;  2EWW A;  3L9K A;  1KDS A;  1W63 Q;  4NK3 A;  4JLF A;  1OTE A;  2EX2 A;  4GNU A;  3OOV A;  3VSK A;  4PM6 A;  1K55 C;  3BEB A;  4KZA A;  3IX8 A;  3Q7Z A;  2V9A A;  5GHZ A;  2ZM0 A;  3NDE A;  3NOP C;  2Y2Q A;  1JWP A;  3WS0 A;  2QZ6 A;  1F2K A;  1IOU A;  2P74 A;  1BZA A;  3FWL A;  5DKK A;  1BYW A;  3VFH A;  5FAT A;  2B5R A;  1DP6 A;  3ISG A;  2WUQ A;  1P97 A;  5TBM A;  3P7N A;  2QHK A;  5HAP A;  1TS0 A;  4JGO A;  2J9O A;  2EFX A;  5KSC A;  3EEA A;  3LIC A;  4X6T A;  4PHT A;  3SH7 A;  1YLT A;  3E4P A;  1ONH A;  1IKG A;  2ACG A;  4K0W A;  1BLP A;  4K0X A;  3RJU A;  1AXB A;  3UB5 P;  2R78 A;  4P0M A;  5FQK A;  3PBO A;  1W8Q A;  3VFF A;  3OZH A;  1YLP A;  3SW1 A;  1N9B A;  1LL5 A;  4HJ6 A;  4WMC D;  2LB5 A;  2Q9M A;  3HUM A;  3UE3 A;  2XRO A;  4E3I A;  4JGP A;  3QP8 A;  4LGW A;  5F82 A;  4KZ5 A;  1OTI A;  3M2J A;  1K0K A;  3LIE A;  1SDN A;  1JVJ A;  2ZJ9 A;  3E4O A;  3DTK A;  2VA0 A;  2A49 A;  2WZX A;  2XR0 A;  5F6A A;  2RCX A;  2EA9 A;  3A0R A;  3H7W B;  4OH0 A;  1W79 A;  4NG2 A;  3DAV A;  2RL3 A;  5E2H A;  4H6J A;  1BUE A;  3IBJ A;  1XPB A;  1ERM A;  5DVA A;  4M4X A;  3BFF A;  2W3F A;  4WLA A;  2V2F F;  2QKP A;  3BQ8 A;  1AWI A;  2Q9N A;  3JVV A;  3QP4 A;  4MEZ A;  5AVF A;  2Y2I A;  4C6Y A;  4OKP A;  1N9L A;  4LCM A;  2W3D A;  1K56 A;  3VV4 A;  2VLG A;  3QHY A;  2GJ3 A;  4BBV A;  1YPR A;  1OTA A;  4P85 A;  5HL1 A;  3NJA A;  4WYY A;  1WYB A;  2PD7 A;  4JGR A;  4HI4 A;  3ZVW A;  3EOI A;  1NRJ A;  4JPM A;  1WYC A;  4OQH A;  2GNX A;  3BLM A;  1HZO A;  1BSG A;  4OPY A;  1LSV A;  1XJ2 A;  4LV3 A;  2W3E A;  4R3A A;  1S4R A;  2B02 A;  2PHY A;  4CPK A;  5CGW A;  4UA9 A;  3T4T A;  1DP9 A;  3VE4 A;  3ICY A;  4Y2F A;  1UGU A;  5TBM B;  3E4Q A;  4RX3 A;  2ZQC A;  3BFE A;  4GZB A;  5HX9 A;  3LIB A;  1ES2 A;  3MZD A;  5G18 A;  1RP5 A;  4YNR A;  5LBR A;  5I94 A;  1DJA A;  1ESI A;  5DFX A;  1TS6 A;  3ZG7 B;  5FAS A;  4JKT A;  3KX0 X;  4BD1 A;  4ME4 A;  3VP1 A;  5FI2 A;  1NLZ A;  5CHM A;  4KUK A;  2ZC7 A;  3DWZ A;  2CC1 A;  4UEY A;  2W27 A;  2XFT A;  2WGW A;  1U60 A;  4QB8 A;  4WEK A;  1SKO A;  1PW8 A;  2HDS A;  4OP5 A;  4I3J A;  4X1M A;  5DF7 A;  3MFX A;  3IXD A;  1W5D A;  3ZHH A;  1NZU A;  4CLC D;  1BLS A;  3UE1 A;  3HRE A;  4HHD A;  4R70 A;  1D1J A;  3HLG A;  1CEF A;  1W8Y A;  3A3I A;  4H6J B;  5CTN A;  4R1G A;  2D01 A;  3DW0 A;  2Y91 A;  3VOY A;  5KIZ A;  4KQQ A;  3W2Z A;  3FC7 A;  5EFW A;  3S22 A;  2QMI A;  4D2O A;  2X01 A;  1KGF A;  1DJC A;  5TR7 A;  3PBQ A;  2Y4A A;  3G32 A;  3C4P A;  4E3L A;  2JCH A;  1H8Y A;  1IYQ A;  2JKT I;  2ZMF A;  2Z6C A;  3GVB A;  4FSF A;  3V39 A;  1J3W A;  3NDG A;  2KX6 A;  4OLD A;  1EWZ A;  4HNB A;  3U4L P;  1BLH A;  1STZ A;  4Y17 A;  1PIO A;  1K6R A;  3DTM A;  1A0K A;  3IX3 A;  2R9W A;  1CI8 A;  1VB6 A;  3G4P A;  2ZC3 B;  3Q07 A;  4DE1 A;  2PU2 A;  4KZ6 A;  1YLZ A;  3IWI A;  3V3R A;  5G4Y A;  5CX7 A;  2G2W A;  2H28 A;  4OPZ A;  3UNW A;  1S0W A;  5HW3 A;  1GHI A;  4ZTK A;  1XFN A;  2XD1 A;  2HDR A;  4X56 A;  3HVF A;  4N1X A;  3LY4 A;  5GHX A;  2Y2J A;  4BBU A;  2OAQ 1;  3UE0 A;  4QY5 A;  2P9V A;  3MR0 A;  4CJN A;  5FA7 A;  3MS6 A;  5I5L A;  4N92 A;  1SKO B;  3MZE A;  4BL3 A;  5MC7 A;  2HDU A;  5L09 A;  4OPR A;  1FR1 A;  1OME A;  1K57 A;  1XP4 A;  2EX8 A;  1I2S A;  3B3X A;  2H10 A;  4GW9 A;  4EUV A;  5F68 A;  4BQM A;  5EM1 A;  4MMN A;  5HL6 A;  3LEZ A;  5EVI A;  5AJG A;  2A3U A;  1K57 C;  4KG5 A;  2W1T A;  2VV7 A;  1ODV A;  2XA7 M;  3T1Q B;  4DE2 A;  2WKP A;  5EVI C;  1ALQ A;  4DJ3 A;  3IF6 C;  3KSH A;  4JXW A;  3VE3 A;  3BWL A;  5U47 A;  3K3C A;  5F1G A;  4LV2 A;  2GDN A;  1CI9 A;  4EEP A;  1FIK A;  2E8J A;  3P01 A;  4O7D A;  3T50 A;  4ARZ B;  4Y15 A;  3HUN A;  1ZG6 A;  4DN0 A;  2XFS A;  4BEN A;  1FCN A;  1XXM A;  5HAQ A;  4ZJ2 A;  5F5Y A;  1M40 A;  1G6O A;  4PM8 A;  3MFD A;  3MXR A;  3Q82 A;  5FDS A;  4I5S A;  4XT2 B;  5E2E A;  2MJ6 A;  3LUQ A;  3B33 A;  2BLS A;  3FZC A;  3S7O A;  5HPI A;  1ERQ A;  1K6S A;  1GSX A;  1N9O A;  2JN7 A;  3QNC A;  3ZG0 A;  2I9V A;  4H8R A;  1XA1 A;  4ZJ3 A;  3FKV A;  5L10 A;  2M7U A;  1GSW A;  3E2L A;  4Y5F A;  3CPT A;  3C4O A;  1O07 A;  4EUZ A;  1T1C A;  2P9V B;  1X0O A;  4L9E A;  3KYE A;  3MF0 A;  3VMA A;  1NXY A;  5FSR A;  3BLS A;  2QPN A;  3BRM A;  2E8I A;  2KOI A;  4ESP A;  1KGE A;  3C5A A;  2VJW A;  3OBF A;  1VET A;  1YMX A;  2EFU A;  3K3D A;  4NKP A;  2V8C A;  5G4Z A;  4PPR A;  2WK0 A;  4IVI A;  4RX2 A;  3H7W A;  4X53 A;  2BG1 A;  4Y3I A;  3LCE A;  3N8R A;  2O0Y A;  3BFC A;  1KVM A;  3BQA A;  2ZC6 B;  2B18 A;  5EOO A;  5EM0 A;  1HLU P;  5FQI A;  5HAR A;  2IWD A;  2X71 A;  1E4D A;  1JTG A;  2W1T B;  2PBD P;  3OCN A;  3P98 A;  1QME A;  2XRN A;  4YFM A;  5TJJ A;  2ZC4 B;  2Y2N A;  2OOL A;  4ETZ A;  2K2N A;  4NXE A;  3WRZ A;  1LLB A;  4B93 A;  3NY4 A;  3C7V A;  3HLF A;  1XJ4 A;  2HP5 A;  3D72 A;  1PWG A;  1K54 A;  3RH8 B;  5DKL A;  5J7E A;  1SZV A;  2OWJ A;  3V3S A;  1YMS A;  5HDD A;  5A93 A;  2FH5 A;  1ES5 A;  2HP9 A;  1DJB A;  1K56 D;  2L1M A;  1OT9 A;  3LI8 A;  3C2W A;  1E25 A;  1MKI A;  4ZRR A;  4P6Z M;  3HBR A;  4YWZ A;  3ZQ5 A;  1CJF A;  2O9C A;  3UB9 A;  4F3L A;  4HH2 A;  4IBX A;  3UDF A;  2OAP 1;  1Z09 A;  4KZ3 A;  1KE0 A;  4R4R A;  3LFV A;  3CPT B;  4KZ7 A;  3IXG A;  4I3I A;  4IHQ A;  4BWI A;  4F94 A;  3EWK A;  1LL8 A;  1H5X A;  2HGV A;  5DTS A;  5HFO A;  2ZM8 A;  1ERO A;  3MMH A;  2WGI A;  2VGK A;  3TJZ C;  1VET B;  3HL9 A;  3PAG A;  2WAD A;  3GTC A;  1SCW A;  5FAO A;  1W7F A;  1MKM A;  1FSW A;  2Y2G A;  3CWF A;  3E0Y A;  4B4Z A;  2G2U A;  4E6X A;  2FFF B;  1F5M A;  1BT5 A;  3H82 B;  1VEU A;  4BD0 A;  2EXB A; 
#chains in the Genus database with same CATH homology
 1I5Q A;  4U0X A;  5FQQ A;  1CEF A;  3Q81 A;  4FH2 A;  2WKI A;  1W8Y A;  4KZ8 A;  5JYO A;  3A3I A;  2VGJ A;  1BLC A;  2C6W B;  3M6B A;  1PZP A;  2XEP A;  4NET A;  3IXB A;  3RXX A;  5CTN A;  4U3T A;  2ZQ9 A;  4R1G A;  3DW0 A;  5HAI A;  2Y91 A;  5FI7 A;  4B88 A;  2J7V A;  1K4F A;  4UA7 A;  3VOY A;  3IF6 A;  4KZ4 A;  4ZJ1 A;  4KQQ A;  1XGJ A;  4GOG A;  3S22 A;  2QMI A;  5EEC A;  4D2O A;  2X01 A;  1SKF A;  2H0Y A;  3S4X A;  2Z2M B;  3OPP A;  1KGF A;  1DJC A;  4N1H A;  2DCF A;  5TR7 A;  1RGZ A;  1NRF A;  5FAQ A;  1NYY A;  3PBQ A;  4E3O A;  2Y4A A;  4JF4 A;  3G32 A;  3ITA A;  3C4P A;  3UO9 A;  2J9P A;  4JXS A;  4E3L A;  1SDE A;  5E2F A;  1YQS A;  3W8K A;  2JCH A;  1H8Y A;  4XUZ A;  4GB7 A;  1IYQ A;  3UDI A;  4DDS A;  2WKE A;  3HLG A;  1K55 A;  2Y55 A;  3GVB A;  5CRF A;  4OQI A;  4XXR A;  4FSF A;  3IH9 A;  3HLC A;  3ZG9 B;  2OLV A;  1TDG A;  4S2O A;  3V39 A;  2ZQD A;  4GKU A;  5M18 A;  2ZC5 B;  3NDG A;  1ZG4 A;  5EUA A;  4DE3 A;  3HLE A;  3M6H A;  4OLD A;  1EWZ A;  1GA9 A;  3O88 A;  5GLC A;  3IHA A;  2DRW A;  1E3U A;  3FKW A;  5EPH A;  1BLH A;  4QD4 A;  1S6R A;  5FI6 A;  2HP6 A;  3FYZ A;  2WZZ A;  5CEB A;  3HUO A;  1BUL A;  1KDW A;  1PIO A;  3IHB A;  1K6R A;  3Q7V B;  3DTM A;  3NBL A;  1K54 C;  4JXG A;  5GHY A;  2IWB A;  1NJ4 A;  4WZ5 A;  2R9W A;  5TGF A;  1CI8 A;  1PWC A;  3G4P A;  2ZC3 B;  4MLL A;  4QHC A;  4EWF A;  3ZNY A;  3LY3 A;  3UY6 A;  5L2F A;  3GMW A;  5EE8 A;  3Q07 A;  4OON A;  1FR6 A;  2Y2H A;  4C75 A;  4Q8I A;  4XUX A;  5GLA A;  3SH8 A;  2C5W B;  2PU2 A;  4RYE A;  4DE1 A;  3IWQ A;  4JXV A;  1I2W A;  4KZ6 A;  3UDX A;  4EBL A;  4KEN B;  1YLZ A;  3IWI A;  1KVL A;  4WZ5 C;  3NI9 A;  3V3R A;  5KSH A;  3CJM A;  1E3U D;  1RGY A;  3CZD A;  5DTK A;  1HTZ A;  2G2W A;  4OPZ A;  3EQV A;  3C7U A;  2Y2L A;  1L0E A;  5GL9 A;  3RXW A;  3BM6 A;  3UNW A;  3BEC A;  1G68 A;  1N4O A;  1S0W A;  4FH4 A;  3MBZ A;  4DRT A;  4WM9 A;  5FAP A;  5HW3 A;  1VQQ A;  4KG2 A;  4UAA A;  1GHI A;  1IEM A;  4ZTK A;  2XD1 A;  3SS3 A;  2HDR A;  3WS5 A;  2ZLY A;  3MKF A;  2Y2M A;  4MBH A;  4X56 A;  5M1A A;  1HD8 A;  3HVF A;  2JC7 A;  4N1X A;  3LY4 A;  4N9L A;  2XDM A;  5GHX A;  2Y2J A;  1Z6F A;  1RCJ A;  4QY5 A;  5E43 A;  3UE0 A;  2P9V A;  2WKH A;  3N8L A;  1ES3 A;  4L0L A;  1YT4 A;  4RA7 A;  1NY0 A;  4CJN A;  4S2N A;  4S2L A;  5D3O A;  5FA7 A;  4UHU A;  4DKI A;  4WBG A;  4EV4 A;  3PAE A;  4FCF A;  4N9K A;  4ZDX A;  5AQ7 A;  3O86 A;  3GR2 A;  1WE4 A;  3OCL A;  4N92 A;  4Y0T A;  3IH8 A;  1XA7 A;  4Y0O A;  3WS1 A;  3MZE A;  4OLG A;  4GDN A;  4BL3 A;  3P09 A;  4S2J A;  1IEL A;  2HDU A;  1YLJ A;  1YLW A;  4KG6 A;  5EVL A;  1ONG A;  4E6W A;  4S2N C;  3AGD A;  3MKE A;  5KMW A;  4OPR A;  1DY6 A;  3VOZ A;  4LV1 A;  1L0G A;  1FR1 A;  1OME A;  1K57 A;  3EQU A;  5CTM A;  1GHM A;  1J9M A;  3VP3 A;  3O3V A;  3QNB A;  1XP4 A;  2EX8 A;  1I2S A;  4PMA A;  3SOI A;  1JTD A;  3B3X A;  2ZM2 A;  2H10 A;  2FFY A;  1JWZ A;  4IBR A;  5TFQ A;  4BQM A;  4E3N A;  3LEZ A;  5EVI A;  3ZG8 B;  5JYP A;  3W4P A;  2A3U A;  1Q2Q A;  3N8S A;  1FSY A;  5A91 A;  1K57 C;  2PBY A;  3IQA A;  4WZ4 A;  1IYO A;  5EVI B;  4KG5 A;  4OQG A;  1CEG A;  3O87 A;  3IF6 B;  3SH9 A;  5CED A;  4JBF A;  1L0D A;  3OPL A;  5CGS A;  5CEC A;  2ZQA A;  3AGE A;  2XLN A;  4E3J A;  2I72 A;  5A92 A;  4R4S A;  3DWK A;  4A5R A;  4DE2 A;  3ZDJ A;  3GSG A;  3FV7 A;  2V20 A;  5EVI C;  1PW1 A;  4WEL A;  1ALQ A;  4FD8 A;  3IF6 C;  4DXB A;  1FCO A;  4JXW A;  2WYX A;  4EBP A;  3A3E A;  4KQO A;  1LI9 A;  5AQA A;  5U47 A;  4HBU A;  3GV9 A;  4HBT A;  1MBL A;  2JE5 A;  4LV2 A;  5F1G A;  3PBT A;  4S2K A;  4R0Q A;  2ZQ7 A;  5DF8 A;  1PZO A;  2GDN A;  1IYP A;  3IXH A;  1CI9 A;  3OC2 A;  3ZVT A;  1KDS A;  1O7E A;  5CER A;  4NK3 A;  5DTT A;  4JLF A;  5EVI D;  2EX2 A;  4O7D A;  1ES4 A;  2EX6 A;  3HUN A;  4GNU A;  1ZG6 A;  4P6B A;  3UN7 A;  3VSK A;  1QMF A;  4PM6 A;  3VP0 A;  2J8Y A;  1NYM A;  1K55 C;  3BEB A;  4KZA A;  2XFS A;  4BEN A;  3Q7Z A;  1FCN A;  5CHJ A;  3ITB A;  1LL9 A;  2OLU A;  5GHZ A;  3UPO A;  2ZM0 A;  3NDE A;  2OV5 A;  4KZ9 A;  5CGX A;  1XXM A;  3TG9 A;  2Y2Q A;  3V5M A;  1JWP A;  4X68 A;  3WS0 A;  5HAQ A;  2QZ6 A;  2XD5 A;  4R23 A;  4ZJ2 A;  1K4E A;  3LO7 A;  1M40 A;  2P74 A;  1BZA A;  4PM8 A;  3FWL A;  3MFD A;  3MXR A;  3Q82 A;  1PYY A;  5FAT A;  2B5R A;  5CXW A;  5DF9 A;  1G6A A;  3VFH A;  3W4Q A;  4DE0 A;  3ISG A;  2WUQ A;  3OPR A;  1IKI A;  3CMZ A;  5E2E A;  4WMC A;  5HAP A;  4GN2 A;  3NIA A;  3VP2 A;  2J9O A;  2EFX A;  2IWC A;  3PTE A;  5KSC A;  4X6T A;  4R3B A;  2BLS A;  3SH7 A;  2Y2K A;  3NCK A;  3FZC A;  4UA6 A;  3UPP A;  1YLT A;  4BL2 A;  2WGV A;  2HPB A;  2HDQ A;  1ONH A;  1IKG A;  1ERQ A;  2DNS A;  3G31 A;  3I7J A;  1K6S A;  4K0W A;  1BLP A;  1GA0 A;  4K0X A;  4X55 A;  3RJU A;  1AXB A;  3AGF A;  3A3F A;  3GQZ A;  3QNC A;  4H8R A;  3ZG0 A;  1XA1 A;  4LCL A;  4P0M A;  3FKV A;  4ZJ3 A;  5FQK A;  3N6I A;  3PBO A;  1W8Q A;  4WEJ A;  3VFF A;  3OZH A;  3E2L A;  1YLP A;  4MNR A;  4OOL A;  3C4O A;  5M19 A;  1O07 A;  4HES A;  4EUZ A;  1N9B A;  2Y59 A;  1LL5 A;  2R9X A;  3A3J A;  3JYI A;  2P9V B;  2V1Z A;  3V50 A;  3VMA A;  4WMC D;  1NXY A;  2X02 A;  5FSR A;  3BLS A;  2Q9M A;  3HUM A;  2QPN A;  3BRM A;  2E8I A;  3UE3 A;  3WS4 A;  3WS2 A;  1YLY A;  2Y2O A;  1KGE A;  4E3I A;  3C5A A;  4P87 A;  1L2S A;  3D4F A;  1YMX A;  5IHV A;  3N7W A;  4RVA A;  1BTL A;  5F82 A;  2EFU A;  3GRJ A;  4KZ5 A;  4ZAM A;  2ZMA A;  4B4X A;  2PU4 A;  3M2J A;  4OOM A;  1PI4 A;  1ZC2 A;  4S2M A;  5FQ9 A;  1XX2 A;  4PPR A;  3OPH A;  1LI0 A;  1SDN A;  1XGI A;  1JVJ A;  1TVF A;  2WK0 A;  3PBS A;  4IVI A;  3W4O A;  2ZJ9 A;  4RX2 A;  3WWX A;  5FQM A;  1MWR A;  4X53 A;  3CG5 A;  4GD8 A;  2BG1 A;  3ZFZ A;  3LCE A;  2A49 A;  3N8R A;  2ZQ8 A;  2WZX A;  2XR0 A;  3BFC A;  3G2Y A;  4OVD A;  2RCX A;  5EOE A;  4Y0U A;  1KVM A;  4OH0 A;  1W79 A;  3HLW A;  3E2K A;  2RL3 A;  5E2H A;  1ZKJ A;  2ZC6 B;  1BUE A;  1FCM A;  3BFG A;  5EOO A;  1XPB A;  5KZH A;  5FQI A;  1ERM A;  5DVA A;  1K25 A;  5HAR A;  1Q2P A;  4GD6 A;  2IWD A;  3BFF A;  2X71 A;  1E4D A;  4IED A;  1JTG A;  2V2F F;  1MXO A;  3G30 A;  2ZD8 A;  1TEM A;  3OCN A;  3P98 A;  4E3K A;  5F1F A;  2Q9N A;  4DF6 A;  1MWT A;  2WAE A;  4MEZ A;  4HEF A;  3ZNT A;  2Y2I A;  4LEN A;  1LHY A;  4S2I A;  1QME A;  4C6Y A;  4OKP A;  4OOY A;  1NZO A;  3MZF A;  4YFM A;  4LCM A;  3G2Z A;  4IVK A;  1K56 A;  2ZC4 B;  2Y2N A;  3QHY A;  1KGG A;  4Y7P A;  2Y2P A;  1CK3 A;  4JF5 A;  5A90 A;  4P85 A;  4LV0 A;  5HL1 A;  4C3Q A;  3WRZ A;  1GHP A;  3G34 A;  1LLB A;  5FQJ A;  4MBF A;  3NY4 A;  4DDY A;  4WYY A;  4EQI A;  1GCE A;  1TDL A;  1WYB A;  3C7V A;  3IWO A;  3HLF A;  4QY6 A;  2Z2L B;  4PM7 A;  2HP5 A;  3PBR A;  3ZVW A;  4DXC A;  4YIN A;  3BYD A;  1MPL A;  4JPM A;  4M3K A;  1M6K A;  1WYC A;  4OQH A;  1PWG A;  4BLM A;  4KZB A;  3BLM A;  2XGN A;  1K54 A;  1HZO A;  4MBK A;  2EXA A;  2H5S A;  1BSG A;  4OPY A;  3V3S A;  1YMS A;  5A93 A;  4LV3 A;  1SHV A;  2XH9 A;  1ES5 A;  3PBN A;  4JF6 A;  4Z9Q A;  3N4I A;  3Q7V A;  2HP9 A;  1DJB A;  1K56 D;  4BJP A;  5BOH A;  4GDB A;  4CPK A;  5CGW A;  3HLD A;  1L0F A;  4UA9 A;  4U0T A;  5CHU A;  1E25 A;  3ZGA B;  3S1Y A;  5J8X A;  2WAF A;  1MKI A;  1YM1 A;  4OP8 A;  4RX3 A;  2ZQC A;  3BFE A;  1VM1 A;  4GZB A;  4OQ0 A;  5E2G A;  5HX9 A;  3G35 A;  4X69 A;  4KQR A;  1MWS A;  3HBR A;  1ES2 A;  3MZD A;  5GLB A;  5GLD A;  4E3M A;  4R3J A;  5G18 A;  1ESU A;  2JBF A;  4QU3 A;  3BFD A;  1RP5 A;  1PWD A;  4S2P A;  5F83 A;  1K38 A;  2XQZ A;  3SS4 A;  4PM9 A;  5I94 A;  2XK1 A;  1DJA A;  2OSU A;  1KE4 A;  1ESI A;  3SS5 A;  4IBX A;  3ZG5 A;  3UDF A;  3ZG7 B;  5FAS A;  4JKT A;  1XKZ A;  3TOI A;  1MY8 A;  4BD1 A;  2H0T A;  4KZ3 A;  1Y54 A;  1C3B A;  1KE0 A;  3IF5 A;  4R4R A;  3VP1 A;  5FI2 A;  1KE3 A;  3WRT A;  5CHM A;  3A3D A;  2ZC7 A;  4KZ7 A;  3IXG A;  3Q1F A;  3DWZ A;  3VSL A;  4F94 A;  1IYS A;  2CC1 A;  1FQG A;  1H8Z A;  3VP4 A;  1H5X A;  3MXS A;  4EBN A;  5DTS A;  5HFO A;  2ZM8 A;  1ERO A;  1FOF A;  2XFT A;  2WGW A;  4OPQ A;  5AQB A;  1U60 A;  2XF3 A;  2WGI A;  2VGK A;  4QB8 A;  4WEK A;  5FDH A;  4QJG A;  2EX9 A;  1PI5 A;  1HVB A;  1PW8 A;  2HDS A;  2WGW B;  3HL9 A;  4OP5 A;  3PAG A;  3UPN A;  3ZCZ A;  5DF7 A;  2WAD A;  3GTC A;  3NC8 A;  3IXD A;  1SCW A;  5FAO A;  4ZBE A;  1W5D A;  4ID4 A;  3TSG A;  1W7F A;  3ZHH A;  1MWU A;  1FSW A;  2UWX A;  1NZU A;  2Y2G A;  4B4Z A;  2G2U A;  1EI5 A;  3HLB A;  3IT9 A;  1BLS A;  3M2K A;  4E6X A;  3UE1 A;  2FFF B;  4PM5 A;  3HRE A;  1BT5 A;  4K91 A;  5AQ9 A;  1JWV A;  4BD0 A;  2EXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...