1BULA

6alpha-(hydroxypropyl)penicillanate acylated on nmc-a beta-lactamase from enterobacter cloacae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
265
structure length
265
Chain Sequence
b'NTKGIDEIKNLETDFNGRIGVYALDTGSGKSFSYRANERFPLCSSFKGFLAAAVLKGSQDNRLNLNQIVNYNTRSLEFHSPITTKYKDNGMSLGDMAAAALQYSDNGATNIILERYIGGPEGMTKFMRSIGDEDFRLDRWELDLNTAIPGDERDTSTPAAVAKSLKTLALGNILSEHEKETYQTWLKGNTTGAARIRASVPSDWVVGDKTGSCGAYGTANDYAVVWPKNRAPLIISVYTTKNEKEAKHEDKVIAEASRIAIDNLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NMC-A BETA-LACTAMASE
molecule tags Hydrolase
publication title Inhibition of the Nmc-A B-Lactamase by a Penicillanic Acid Derivative, and the Structural Bases for the Increase in Substrate Profile of This Antibiotic Resistance Enzyme
pubmed rcsb
total genus 92
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1bulA00
4E6WA 1NY0A 4X56A 4KZ3A 4OLGA 1DY6A 2WAFA 3VP4A 4GDNA 1DJAA 3Q7VA 5CGXA 4OQGA 3NBLA 1MKIA 1LI0A 2G2UA 3HVFA 3LCEA 1PZPA 4S2KA 5TGFA 3ZNYA 2EFXA 1NRFA 3N6IA 4LV2A 5G18A 2HP6A 4CPKA 4Y0TA 2FFFB 2Y2NA 3DTMA 5GLDA 4BD0A 4BLMA 1K54A 4QHCA 5GHZA 3WWXA 4DDYA 4OOYA 3HLBA 4DDSA 2WKHA 1TVFA 5EVIC 1IEMA 1TDGA 1BTLA 1DJBA 3FWLA 2Y4AA 2B5RA 1W7FA 3A3JA 3G34A 2OLVA 1MPLA 4GKUA 1NZUA 3M6HA 2I72A 3DWZA 2X71A 4X6TA 5EVIB 1S0WA 3NIAA 4N92A 1K6SA 4EV4A 1G68A 1IELA 3ZNTA 4UAAA 1KE3A 2C5WB 1L0EA 5FQQA 3GMWA 4KZ6A 3NC8A 2BG1A 1YLZA 3GR2A 4OONA 2WZZA 1SKFA 5DTTA 2IWCA 2R9WA 1FQGA 5I94A 3G2ZA 3BFGA 2ZM0A 3WS0A 3Q07A 3ZG8B 2HPBA 2OSUA 2ZQ9A 4KQRA 1N4OA 1L0GA 2DRWA 2PU2A 4S2NA 5FA7A 3IF6B 3AGFA 4UA7A 5U47A 1IKIA 3ZGAB 2ZM2A 1ERMA 1E25A 1YMXA 2WGWA 1E3UD 1E4DA 3CMZA 3HLGA 3RXWA 2V20A 1GHPA 1HZOA 2VGJA 2OV5A 4ZJ1A 1U60A 2A49A 3AGDA 4H8RA 3BECA 1L0DA 2ZMAA 1NJ4A 4K0XA 3GV9A 2IWDA 3QHYA 4BL3A 5HAQA 3IWOA 2Q9NA 1W5DA 4R4RA 5FQJA 4FH2A 3ITBA 1FOFA 4L0LA 3NY4A 2XEPA 1ZG4A 3NI9A 2P74A 4JXGA 2WKEA 5CTMA 3QNCA 5GL9A 3UY6A 2HP5A 3UPPA 3PAGA 1BLPA 4R4SA 2Z2MB 4GDBA 3PBTA 1KGGA 1YLTA 2XQZA 1K4EA 1ES4A 5HFOA 1AXBA 3G31A 3ZVWA 3JYIA 4GOGA 2H0TA 2ZM8A 1PWCA 2WYXA 1M40A 2WGWB 4ZDXA 3G32A 4LV0A 1XPBA 4UA6A 1KGFA 3G4PA 3V39A 4MEZA 3P09A 1YLJA 4DXCA 2JE5A 4R1GA 2JC7A 2GDNA 4K91A 2WADA 5CHJA 5GLCA 4GD8A 3UDIA 4WEJA 5FI6A 1BT5A 4DE0A 3ISGA 3FV7A 4C6YA 1XA7A 5F82A 4DE2A 1XP4A 3M6BA 5DF9A 2P9VA 3GSGA 4XUXA 4Y0OA 5A91A 3HLDA 3C7UA 3OPLA 4B4XA 4MBKA 3DW0A 1S6RA 4P85A 1KE0A 2JCHA 4M3KA 4P0MA 4EBNA 4WELA 3A3DA 5F83A 1O07A 4Y7PA 3HREA 3MZEA 4PMAA 5E2FA 3HLEA 1YLPA 1GHMA 4Q8IA 3OPRA 5HAPA 2IWBA 4HBTA 4C3QA 3N8SA 3E2LA 4E3NA 3PBOA 5FATA 4O7DA 1ZC2A 3MXSA 3MZFA 3HBRA 3OCLA 3OC2A 5HX9A 4PM8A 2P9VB 1MWUA 1RGZA 3P98A 2Y2OA 1CI8A 4OLDA 1MWTA 4ZAMA 3NCKA 1PW8A 1HVBA 5FQMA 3VSLA 5EOOA 5BOHA 5D3OA 1KVLA 4ZBEA 5FI2A 1FR6A 4C75A 4KG6A 3Q7VB 4KQQA 3SS4A 2H0YA 1E3UA 3VFFA 3PBQA 5CTNA 3I7JA 5FI7A 3GQZA 3UO9A 4IBRA 2EXBA 5FQKA 1H5XA 3FKWA 1XGIA 5FQIA 2ZD8A 4MLLA 4OPZA 1PI4A 3VFHA 4E3MA 2EX2A 4JXWA 1VQQA 4QY5A 3UDFA 2XGNA 3EQVA 3IF6C 2UWXA 2RCXA 1LL5A 1I2SA 1W79A 1FCMA 2ZJ9A 5A92A 1ES3A 4X55A 3VOYA 2OLUA 1BZAA 2FFYA 2XH9A 3NDGA 2XD5A 1GCEA 1VM1A 4BD1A 2Y91A 4DE1A 3AGEA 3O87A 4E6XA 1ES5A 1H8YA 1SCWA 2Y2GA 1K55C 1K54C 1YT4A 5GHXA 1JWPA 4JXVA 1XGJA 2PU4A 3BFFA 3IH9A 4UA9A 2ZC4B 1N9BA 3MXRA 5CERA 4DKIA 3W4OA 5KMWA 1JWVA 2BLSA 1JWZA 5CECA 3RJUA 3WRZA 1QMFA 5CXWA 1BULA 3GTCA 4F94A 5M19A 3IQAA 4OQHA 1Z6FA 3ZG7B 3ZVTA 2WAEA 3ZCZA 4RA7A 4JF5A 2Y2PA 4S2IA 4DE3A 4MBFA 4S2JA 1DJCA 1MXOA 4RX2A 4BENA 3MZDA 3BM6A 3C5AA 5FAOA 3C7VA 4GB7A 4CJNA 1ZKJA 4OQIA 3IF6A 4WMCD 4JLFA 4X68A 5FASA 4WBGA 3S4XA 3A3EA 5E43A 3UE0A 4PPRA 2J8YA 3C4PA 1YLYA 2ZQCA 2Y59A 3VP0A 4JF6A 3SH8A 3WS4A 3IWQA 3G30A 3HLFA 4XUZA 2QMIA 3IHAA 2WGIA 4KZ9A 4WZ5C 1K4FA 4R0QA 4OP5A 4A5RA 3N8RA 1SDEA 3BFCA 4QD4A 2ZLYA 2XLNA 5J8XA 4FH4A 2XFSA 4KZ4A 3V3RA 1XXMA 2WKIA 4GN2A 2EXAA 4BQMA 4JPMA 4P87A 4MBHA 4EWFA 3ZDJA 1WE4A 4LV1A 1W8YA 3GVBA 2EX8A 3BEBA 3BYDA 4KG5A 1FSYA 1K55A 1PIOA 1K38A 2V2FF 2WGVA 4N9KA 5EE8A 4BL2A 3N8LA 4HBUA 2A3UA 3V3SA 1FCNA 3WRTA 4QJGA 3HLCA 5GLAA 1CEFA 4PM7A 4FSFA 5DVAA 1OMEA 3SH9A 3CJMA 4QY6A 4MNRA 1XX2A 3S22A 3IXHA 4FD8A 5E2EA 4OQ0A 5EOEA 1BUEA 1FSWA 5M1AA 1RCJA 4PM5A 2HP9A 4RVAA 3HL9A 3ZHHA 4NK3A 5KSHA 1O7EA 3W4QA 5AQ7A 2ZC5B 1I5QA 4OH0A 5CGSA 4ID4A 4ZJ3A 2XDMA 3IWIA 3O3VA 2XF3A 5CGWA 5EPHA 4P6BA 1GHIA 1K25A 1C3BA 5M18A 4S2MA 4Z9QA 1ESIA 4D2OA 2ZQ7A 4KQOA 1PWGA 3B3XA 1BSGA 2ZQAA 3PBRA 3UE1A 5JYOA 2DNSA 3CZDA 4EBPA 5F1GA 5DF8A 2Y2KA 3TOIA 4JXSA 4FCFA 1BLCA 5E2HA 4KZAA 3MFDA 4DXBA 1IYOA 1K56A 5HARA 1JTGA 3C4OA 2Y2JA 2Y2IA 3M2JA 3Q81A 5E2GA 5TR7A 1NYMA 4EUZA 1NYYA 4EBLA 4JF4A 5EVID 4IBXA 2EX6A 4N1XA 3W8KA 1LLBA 1MY8A 4U0TA 4ZJ2A 3IHBA 2XR0A 2J9PA 1IYPA 4WEKA 3RXXA 3IT9A 1IKGA 1ES2A 4LCLA 1K57C 1KDSA 4XXRA 3TG9A 4HEFA 4KZ5A 3IXDA 3IXGA 4DF6A 4GNUA 5HL1A 3WS1A 1ESUA 3OPPA 4HESA 4ZTKA 3WS5A 1YLWA 1GA0A 1CEGA 3V50A 4E3JA 5A93A 4OPYA 1MBLA 1G6AA 3MKEA 1Q2QA 5L2FA 3GRJA 3A3FA 5AQ9A 4LV3A 4E3KA 3OCNA 1MWRA 2Y2QA 3UNWA 5FDHA 3OZHA 3N4IA 1SHVA 4OVDA 1XKZA 4U3TA 2X02A 4OOMA 5TFQA 2J9OA 1XA1A 5FSRA 1HD8A 2HDSA 4QB8A 1BLHA 4X53A 1LL9A 1PWDA 3LEZA 1NZOA 1GA9A 5HAIA 2XD1A 1QMEA 4OPRA 3ITAA 2JBFA 4OOLA 5CEBA 1EWZA 4E3LA 2V1ZA 2X01A 2Q9MA 3VMAA 2RL3A 5FAPA 3ZFZA 4Y0UA 1KGEA 3BLMA 5CRFA 2CC1A 3VSKA 3G35A 3VP1A 4N1HA 5JYPA 3LY4A 3WS2A 3SH7A 4B88A 1EI5A 1LHYA 2HDRA 3VP3A 1ZG6A 2Z2LB 1FR1A 2ZQ8A 3PTEA 2R9XA 1ONHA 3E2KA 3NDEA 4IEDA 3V5MA 4E3IA 2ZC3B 3UPNA 1K57A 4RYEA 4KZ8A 3IXBA 1K56D 1WYCA 3IH8A 5A90A 1KDWA 4OKPA 5HW3A 4OP8A 4B4ZA 1J9MA 1PI5A 2XFTA 2EX9A 5KZHA 4R3BA 4DRTA 2WUQA 4S2LA 2Y2HA 2QZ6A 3LY3A 1WYBA 1YQSA 3O86A 4WYYA 1L0FA 2VGKA 5AQBA 1ONGA 1L2SA 2H10A 1IYQA 3D4FA 3S1YA 3SS3A 1Q2PA 3HUMA 3VOZA 5CHMA 3W4PA 3HUOA 1K6RA 1JVJA 2ZC7A 4KENB 3VP2A 4R3JA 3MKFA 3BFDA 3MBZA 2WZXA 3PBNA 3PBSA 3Q7ZA 3QNBA 3SOIA 3ZG0A 4NETA 5EVLA 3HLWA 5F1FA 1I2WA 4KZ7A 4E3OA 4LENA 3UPOA 3Q82A 4YFMA 4EQIA 3FZCA 1MWSA 4JBFA 4WM9A 1YMSA 5DTKA 2EFUA 5EUAA 1PW1A 3TSGA 3O88A 1FCOA 4OPQA 2DCFA 4GD6A 2ZQDA 4BJPA 1TDLA 3BRMA 3A3IA 1RGYA 3UDXA 3ZG9B 4R23A 1ERQA 3N7WA 3LO7A 5AQAA 1CI9A 5FAQA 5FQ9A 2XK1A 3UE3A 1YM1A 1HTZA 4QU3A 4KG2A 4RX3A 5DF7A 4S2PA 5CEDA 3FKVA 2ZC6B 1EROA 4K0WA 4S2OA 1IYSA 3G2YA 4PM6A 5EVIA 1RP5A 3Q1FA 1PZOA 4KZBA 3UN7A 2E8IA 2HDUA 5GHYA 2PBYA 3PAEA 5IHVA 1W8QA 2J7VA 2C6WB 5EECA 2QPNA 3BFEA 2HDQA 3DWKA 3EQUA 1ALQA 1H8ZA 1M6KA 3BLSA 3CG5A 1JTDA 4LCMA 2H5SA 4IVIA 4X69A 2WK0A 4N9LA 3SS5A 1KVMA 4PM9A 1KE4A 3HUNA 2Y55A 3ZG5A 5GLBA 4JKTA 1LI9A 1PYYA 4GZBA 2Y2MA 4S2NC 4UHUA 1TEMA 4WZ5A 4U0XA 1SDNA 1BLSA 2G2WA 2Y2LA 5DTSA 4WMCA 1Y54A 5KSCA 4IVKA 5CHUA 3OPHA 4YINA 3IF5A 1NXYA 3FYZA 1CK3A 3M2KA 4WZ4A
chains in the Genus database with same CATH superfamily
1G6OA 1GSXA 4KZ3A 4BBUA 2WAFA 5DFYA 3VP4A 4GDNA 4H6JA 1LSWA 3NBLA 2EA9A 4F3LA 3LCEA 2L1MA 4CPKA 4Y0TA 3DTMA 4BD0A 4Y2FA 1K54A 4QHCA 3WWXA 5EVIC 2Y4AA 4GKUA 2I72A 2X71A 4EV4A 1K0KA 2D02A 4KZ6A 3GR2A 1OTEA 1SKFA 5EFWA 4KUKA 3BFGA 3NJAA 3ULFA 2OSUA 2DRWA 2O9AA 4UA7A 3KSFA 1E25A 2WGWA 4I3AA 1S4RA 3RXWA 1GHPA 3SW1A 1F9IA 3P7NA 2A49A 3AGDA 4PAUA 3BECA 5HZHA 1L0DA 2VK3A 4NXEA 4HP9A 3T4SA 4BL3A 5HAQA 4R4RA 3LGOA 2GZAA 4L0LA 1W63Q 4CQHA 3NI9A 1YSPA 3R7WB 3PAGA 4IHQA 4GDBA 2CMNA 1KGGA 3CAXA 1ES4A 1K4EA 1AXBA 3G31A 2A2LA 3IBRA 4GOGA 1VEUB 1PWCA 2WGWB 1KGFA 2O9BA 3OOVA 4R1GA 2GDNA 3ICYA 5TBMA 3T4KA 4HH2A 4K91A 2WADA 4EERA 5KIZA 5FI6A 1BT5A 3T50A 3T4QA 4C6YA 5DF9A 5C5KA 3KO6A 4Y0OA 2KDKA 3UB8A 3KSGA 4B4XA 2PD8A 3LUQA 3T1SA 3HJIA 3HLEA 1MKMA 1YLPA 4Q8IA 2IWBA 1JNUA 2W1TA 3HCYA 2OOLA 3MZFA 3HBRA 4II7A 3OC2A 2KLIA 4H6JB 2K31A 2P9VB 2Y2OA 2A24B 4XT2B 1CI8A 1HVBA 5FQMA 5EOOA 5FI2A 4KQQA 3Q7VB 1OT9A 2JKRM 3VFFA 3PBQA 5CTNA 1YPRA 1OTIA 2HV1A 3UO9A 1Y4OA 2EXBA 4ETZA 1XGIA 5FQIA 2ZD8A 3EOIA 3HJKA 2HZ5A 3LEQA 5DJUA 3VFHA 1LL5A 5A92A 4Y3IA 4X55A 3VOYA 1BZAA 2FFYA 2XH9A 4X25A 3NOPC 2XD5A 4FTXA 3LR5A 4BD1A 3GECA 1YT4A 5G4ZA 1K54C 3A0SA 3MXRA 4DKIA 5L10A 3V67A 3RJUA 4EESA 1QMFA 3MFXA 5CXWA 1V9ZA 3ZVTA 4JF5A 4S2IA 1MXOA 3JVUA 3C5AA 4JLFA 3CHWP 3VP0A 1CQAA 4ESPA 2ZMFA 4OP5A 4A5RA 3BFCA 4KZ4A 3E4QA 1XXMA 4MN7A 4D60A 4HIAA 4MBHA 3ZDJA 4LV1A 3QP5A 5EE8A 2WGVA 4N9KA 4HBUA 1F5MA 4QJGA 4PM7A 4FSFA 1OMEA 3SH9A 3CJMA 4QY6A 4MNRA 3S22A 2V1BA 5E2EA 4OQ0A 3CUEA 4G3KA 5AQ7A 1I5QA 4ZJ3A 3O3VA 3ZYTA 1ESIA 4D2OA 4KQOA 2ZQAA 1LT0A 5J7EA 4WN5A 3CLOA 3MFDA 4Z1WA 5TR7A 1NYMA 1P9WA 4IBXA 4N1XA 4GS9A 1LLBA 3IS2B 4YOFA 3IHBA 2XR0A 1IYPA 2YKHA 1IKGA 4XXRA 3TG9A 1KDSA 3U2AA 3IXGA 4DF6A 5HL1A 2K2NA 3WS5A 1YLWA 2L0WA 1L3LA 1CEGA 4E3JA 3LIBA 1MBLA 3MKEA 1N9NA 5K5BA 2Y2QA 5FDHA 3OZHA 3F1PA 3N4IA 4OOMA 1G5UA 4QB8A 2VGLM 4X53A 4R70A 4LPZA 4LRZE 3LEZA 2W1RA 4OPRA 2P08A 3R4KA 4PKYA 2X01A 2NUTC 3VMAA 3DBAA 4Y0UA 1KGEA 3VSKA 1T1CA 3VP1A 4R38A 3T1QB 5JYPA 2XRNA 3SH7A 1LHYA 2ZQ8A 4KZ8A 3IXBA 3H82A 2VEAA 1KDWA 4OP8A 1J9MA 2EX9A 2OWJA 4LGWA 1S66L 4DRTA 2WUQA 2Y2HA 1YQSA 1L2SA 2H10A 3S1YA 1P9RA 5HPFA 5CHMA 3W4PA 1JVJA 2ZC7A 4KENB 3VP2A 3PBSA 3SOIA 5EVLA 5F1FA 3MJQA 2VA0A 3Q82A 4JBFA 4Y15A 3H7WA 4WM9A 2LB5A 3RFBA 2EFUA 3TSGA 1FCOA 2ZQDA 4BJPA 3A3IA 3LO7A 5AQAA 1CI9A 2FZ0A 5FQ9A 3T4OA 4KG2A 2H28A 2B02A 2ZC6B 1NLYA 4PM6A 5GHYA 2PBYA 1ZTUA 3PAEA 5IHVA 2J7VA 2PT7A 1TD5A 3TE8A 3EQUA 4HHDA 1ALQA 3CG5A 1DRMA 3P01A 3ZG5A 5IS1A 3T1RA 3DAVA 4WZ5A 2Y2LA 4YINA 2PRFA 4X56A 5EM0A 3NHQA 4I39A 4Q0HA 1FIKA 2G2UA 3HVFA 3ZNYA 2EFXA 1NRFA 3CPTA 4LV2A 2FFFB 4BLMA 4DDYA 4OOYA 4DDSA 1IEMA 1TDGA 3G34A 1XFQA 3M6HA 3DWZA 2L4RA 1S0WA 3NIAA 4L9FA 1G68A 4WL9A 4GW9A 1KE3A 5HSQA 4OONA 3CPTB 2R9WA 1FQGA 4L9EA 2PD7A 5I94A 1HLUP 4YWZA 3ZG8B 2V8CA 3E4PA 1N4OA 3T4TA 1VETB 2VV7A 3IF6B 3AGFA 1VETA 5U47A 1IKIA 3ZGAB 1E3UD 1E4DA 3CMZA 1XJ2A 2OV5A 3BWLA 4ZJ1A 2ZMAA 3GV9A 3IX8A 4LRYC 1W5DA 3NY4A 2XEPA 5FDSA 2P74A 3MR0A 3UY6A 3A0VA 4R4SA 4ETXA 2M7UA 2XQZA 2H0TA 4EEUA 1DP8A 2J3WA 1OTBA 1M40A 1XPBA 3G4PA 1YLJA 3FPVA 2JC7A 4Q0JA 1KOUA 2XA7S 4DE0A 4DE2A 2QJ5A 3M6BA 2GNXA 4LFUA 4HJ6A 3HLDA 3C7UA 5DKLA 3UB5P 1GSVA 3DW0A 4Y17A 5HDCA 1S6RA 4P85A 3UB9A 4M3KA 2JCHA 4P0MA 4EBNA 3A3DA 2XROA 3LFVA 4P6ZM 3N8SA 3E2LA 3PBOA 5HX9A 3MXSA 1MWUA 1RGZA 4EW7A 5DKKA 4DN0A 5BOHA 1FR6A 4C75A 3GQZA 3FKWA 2VGLS 1PI4A 4JXWA 1VQQA 2ACGA 3IF6C 2RCXA 1W79A 2HGVA 1FCMA 4DE1A 3D3OA 3AGEA 3QP1A 3NOTC 1SCWA 2Y2GA 1K55C 1DP6A 5GHXA 1TS8A 1JWPA 3PXPA 2G7UA 4JXVA 2PU4A 2ZC4B 5CERA 1JWVA 1D06A 2W3EA 2M7VA 2V0UA 1Y28A 4OQHA 1Z6FA 5HWTA 3ZCZA 4RA7A 1F98A 4S2JA 1DJCA 3VV4A 2BASA 4BENA 3EGXC 1ZKJA 4ZRRA 3IF6A 4WBGA 3A3EA 5L09A 3G30A 1TS0A 2QMIA 2WGIA 4KZ9A 1SDEA 2XLNA 1LSVA 3BY9A 4P87A 5AVFA 4EU0A 1LL8A 3BQ8A 3BYDA 2VV8A 1FSYA 1PIOA 1K38A 4BL2A 3N8LA 5J3WA 3V3SA 1XJ6A 3CITA 4GS9B 2JHEA 1XX2A 4FD8A 5M1AA 2VV6A 4PM5A 1YSQA 2HP9A 4RVAA 5KSHA 5CGSA 2GX5A 1GHIA 2KX6A 4MMNA 5M18A 3CWFA 4S2MA 1PWGA 3B3XA 3PBRA 3CZDA 4JXSA 1K56A 3C4OA 2Y2JA 4Y5FA 3Q81A 4KQDA 3K3CA 1H3QA 5HWWA 4NG2A 3VE3A 2PBDP 2J9PA 3VE4A 4WEKA 3IT9A 1ES2A 1K57C 3T12B 3WS1A 3T1XA 1ESUA 3OPPA 4HESA 1GA0A 3EGDC 3IS2A 5HL6A 5AQ9A 4E3KA 1MWRA 4GHIA 2J3TC 2PR6A 2X02A 4M4XA 2J9OA 4CLCE 1HD8A 3CI6A 3O5YA 3BQAA 1BLHA 1GA9A 4X1MA 4OOLA 5CEBA 4E3LA 2O99A 2Q9MA 5FAPA 3ZFZA 5CRFA 3G35A 1NLZA 3LR3A 4K08A 4L9GA 5CX7A 4P6ZS 3DTIA 1ONHA 2V1AA 1ODVA 3MF0A 2ZC3B 2J80A 1WYCA 3IH8A 4IJGA 5L07A 4S2LA 3FC7A 4O01A 1WYBA 1F2KA 2VGKA 2OWHA 3SS3A 3PBNA 3Q7ZA 3ZG0A 1I2WA 4FUWA 4KZ7A 1S1YA 4XT2A 1YMSA 5DTKA 4PHTA 3NULA 3O88A 1FILA 2DCFA 4HNBA 4GD6A 3BRMA 3UDXA 3F1NA 4RX3A 5DF7A 2WKRA 4R6LA 1RP5A 1PZOA 2E8IA 5G4YA 1A0KA 3LIFA 1W8QA 1T1BA 2VX8A 2C6WB 2QPNA 2HDQA 3DWKA 1M6KA 1ACFA 3DTEA 2FH5A 4N9LA 1S1ZA 3F1OB 1KE4A 5DJTA 5GLBA 4JKTA 4S2NC 1TEMA 1BLSA 2G2WA 2AVXA 5DTSA 4WMCA 1IOUA 3IF5A 3MZEA 1CK3A 4WZ4A 1NRJA 1NY0A 4UEYA 3K3DA 2W3FA 1DJAA 3Q7VA 5CGXA 2JKGA 4OQGA 2Z6DA 4S2KA 4BWIA 5TGFA 3N6IA 5G18A 2HP6A 4I38A 2Y2NA 1UWNX 1XFNA 1XJ3A 3HLBA 2WKHA 1TVFA 3W2ZA 1BTLA 3F1NB 2B5RA 1W7FA 3A0RA 3B42A 1NZUA 3MXQA 4X6TA 5EVIB 1K6SA 1IELA 2C5WB 5FQQA 3GMWA 1YLZA 4HY8A 1S67L 5DTTA 2IWCA 3G2ZA 2ZM0A 3WS0A 3Q07A 2ZQ9A 2W3DA 1L0GA 1D1JA 3LI8A 1MC0A 1ERMA 1YMXA 2V9AA 2GJ3A 2V20A 1HZOA 2VGJA 2ZOHA 1U60A 4H8RA 4K0XA 5HPIA 4FH2A 2Y8HA 1FOFA 3ITBA 2JKTM 1ZG4A 1OJGA 3B47A 3B33A 4JXGA 1TS6A 3PBTA 1YLTA 5HFOA 3ZVWA 3L9KA 1OPXA 3JYIA 1EW0A 2ZM8A 3T4LA 2WYXA 4ZDXA 4UA6A 3V39A 3P09A 3H7WB 2HF6A 1GSWA 3F1PB 1H8MA 1WA9A 3VOLA 3UE6A 3ISGA 1XA7A 2P9VA 4B93A 3S7OA 3OPLA 5I5LA 2VLGA 4AFIA 4WELA 3DTKA 1O07A 4Y7PA 5E2FA 5HAPA 4E04A 1BYWA 1OTDA 4HBTA 5MC7A 4E3NA 4O0PA 4O7DA 1ZC2A 3OCLA 4PM8A 3P98A 3PHYA 1H0MA 2HJ9C 3NCKA 4MCWA 2DMWA 5D3OA 1KVLA 3SS4A 1E3UA 4IBRA 3D9YA 2PYRA 5FEFA 4MLLA 5FEGA 2EX2A 2XGNA 3CUEC 1OT6A 1ES3A 3LYXA 3NDGA 4BMWA 1J3WA 4I3JA 4GCZA 1XGJA 4EXOA 3BFFA 2BLSA 1T18A 5CECA 1NWZA 3GDIA 4MN6A 3WRZA 1BULA 3GTCA 4F94A 3IQAA 2JKTI 2WAEA 3MQ0A 4DE3A 4MBFA 3MZDA 3BM6A 5FAOA 3C7VA 1PRQA 4OQIA 3OBFA 3S4XA 4PPRA 1YLYA 3WS4A 4JF6A 4KUOA 1XJ4A 4WZ5C 3U4LP 1ZHHB 4R0QA 3N8RA 1W63M 4QD4A 4FH4A 4NXGA 2XFSA 2M1CA 2WKIA 2QHKA 2EXAA 4BQMA 4JPMA 3S7QA 2W27A 3JPUA 3GVBA 4G3WA 3BEBA 1K55A 3WRTA 2V8FA 3HLCA 4PKYG 5GLAA 4B9OA 1CEFA 1CF0A 3OLOA 1N9OA 4HI4A 1VB6A 4UQIS 1RCJA 3ZHHA 1O7EA 4ID4A 2PDRA 2XDMA 3IWIA 2XF3A 5EPHA 1D7EA 3LIAA 1MZUA 2QKPA 1K25A 4Z9QA 2ZQ7A 3H9WA 3UE1A 5JYOA 2DNSA 3PYPA 2Y2KA 3EEHA 1BLCA 5E2HA 4KZAA 4DXBA 1IYOA 1JTGA 3M2JA 4EUZA 1NYYA 3C30A 4JF4A 5EVID 3MQOA 3W8KA 1MY8A 4U0TA 2INWA 4ZJ2A 3RXXA 4KZ5A 5IU1A 4ZTKA 4OPYA 1Q2QA 5L2FA 3GRJA 3A3FA 4Y13A 3TJZC 4OVDA 1XKZA 4U3TA 2IA2A 1XA1A 2PYPA 5FSRA 2HDSA 1LL9A 4WF0A 2XD1A 2JBFA 1V9YA 2V1ZA 2RL3A 2J3TD 5DFXA 3BLMA 2CC1A 4IUHA 3BY8A 3WS2A 3E0YA 4B88A 1EI5A 3VP3A 2Z2LB 1FR1A 5HD5A 2R9XA 4IEDA 3V5MA 4E3IA 3UPNA 1K57A 3T4JA 4OKPA 4YNRA 3LY3A 3O86A 1L0FA 5J4EA 1IYQA 3D4FA 1Q2PA 1K6RA 4QWOA 3C38A 4R3JA 3MKFA 2K7SA 3BFDA 2P7JA 2WZXA 3S7PA 3HLWA 4BBVA 2VJWA 4E3OA 4LENA 3UPOA 4IUKA 4YFMA 4EQIA 2P04A 5EUAA 1PW1A 1IFQA 3RTYA 3ZG9B 4R23A 1VEUA 3N7WA 3UE3A 2BTFP 4QU3A 4S2OA 1IYSA 3G2YA 5EVIA 3Q1FA 4KZBA 3UN7A 2QYBA 1PFLA 4F3LB 5EECA 3C2WA 4LCMA 1JTDA 2PR5A 2ZL1A 4QPRA 4PM9A 3HUNA 2Y55A 2I9VA 1PYYA 4UHUA 1YKDA 1SDNA 5KSCA 1Y54A 3JVVA 5CHUA 1NXYA 3UB7A 1UGUA 3M2KA 4E6WA 3KSHA 4HJ4A 2W3HA 4OLGA 1DY6A 1MKIA 2PAVP 1LI0A 2ZL1B 1PZPA 4EEPA 5GLDA 5GHZA 1SKOB 1DJBA 3NOUC 2ZMVA 3FWLA 2OAP1 3A3JA 3IX4A 2OLVA 1MPLA 3LR0A 4N92A 4O8GA 3ZNTA 4NKPA 1VHMA 4UAAA 4DJ2A 4ARZA 1L0EA 3NC8A 2BG1A 5HWVA 2WZZA 2HPBA 4KQRA 2PU2A 4S2NA 4UQIM 5FA7A 2NUPC 2ZM2A 2V0WA 3HLGA 4G3VA 4HH3A 4JGRA 5A8BA 4GLQA 1NJ4A 4CLCD 2IWDA 3QHYA 4CLCA 3IWOA 1PNEA 1SZVA 2Q9NA 2XA7M 5FQJA 5HD3A 4X1LA 4EQ1A 3BJNA 2WKEA 5CTMA 3QNCA 5GL9A 2HP5A 3UPPA 1BLPA 2Z2MB 2O0YA 3S7NA 2EWVA 3G32A 4LV0A 4MEZA 3LICA 4DXCA 2JE5A 1OJ5A 5CHJA 5F5YA 5GLCA 3UB6A 4GD8A 3UDIA 4WEJA 3L7HA 3FV7A 5F82A 1XP4A 3GSGA 4XUXA 4GHIB 5A91A 4EUVA 4MBKA 2W1TB 5EVEA 1KE0A 3QP2A 5F83A 3E98A 3G6OA 3HREA 4PMAA 2ZOIA 1GHMA 4MN5A 1AWIA 3OPRA 4C3QA 1T19A 3UMDA 5FATA 2D01A 2E8JA 5EM1A 3D72A 3MMHA 1MWTA 4OLDA 4RQ9A 1PW8A 4ZAMA 2W0NA 3VSLA 4ZBEA 4KG6A 4JGPA 2H0YA 3I7JA 5FI7A 4HQAA 5FQKA 1H5XA 4OPZA 4E3MA 1TS7A 4QY5A 3UDFA 3LI9A 3EQVA 2UWXA 1I2SA 1DP9A 2MJ6A 2ZJ9A 4FOFA 3TW8A 5F68A 5LBRA 2OLUA 3ZQ5A 5HDSA 2EWWA 1GCEA 1VM1A 2Y91A 3O87A 4E6XA 3R7WA 1ES5A 1H8YA 3QP4A 1N9LA 5IT5A 3IH9A 4UA9A 1N9BA 3W4OA 5KMWA 2QJ7A 3IBJA 1JWZA 3FPWA 5M19A 3ZG7B 3PR6A 2Y2PA 5AVEA 2JKFA 4RX2A 2B95A 4GB7A 4CJNA 4WMCD 4X68A 5FASA 5E43A 3UE0A 2J8YA 3C4PA 2ZQCA 2Y59A 4Q0IA 2LB9A 3SH8A 4HP4A 3IWQA 3HLFA 4XUZA 3IX3A 3IHAA 1K4FA 2XSSA 2KOIA 2HJEA 2ZLYA 2VZWA 4WUJA 5J8XA 3V3RA 3H82B 4HOIA 3UMEA 4GN2A 4EWFA 1WE4A 3LIEA 1W8YA 1P0ZA 2EX8A 2O9CA 4KG5A 2V2FF 5FL3A 2A3UA 1FCNA 1SKOA 2QWSA 5DVAA 3LIDA 3IXHA 5EOEA 2VKSA 1BUEA 1FSWA 4LRXC 3HL9A 4NK3A 3W4QA 4GJ4A 2ZC5B 4OH0A 1Z09A 3LR4A 2JN7A 5CGWA 4P6BA 1C3BA 3KYQA 3MS6A 2UV0E 1BSGA 4I3IA 4EBPA 5F1GA 5DF8A 5AJGA 3TOIA 4FCFA 2A24A 3FG8A 3MQQA 5HARA 2Y2IA 5E2GA 4EBLA 3SZTA 2EX6A 4BBTA 4EETB 4NXFA 2PHYA 4LCLA 1P97A 4HEFA 3IXDA 4GNUA 5A93A 3V50A 4DMZA 1G6AA 1X0OA 1TF1A 2Y79A 4LV3A 3OCNA 3KX0X 3UNWA 3BW6A 1SHVA 5TBMB 5TFQA 3RH8B 1OTAA 3K2NA 1PWDA 3C8CA 1NZOA 5HAIA 5F69A 1QMEA 4JGQA 3ITAA 1EWZA 2B18A 3QP8A 4MDZA 4R3AA 3TRCA 3F1OA 2ZBBA 1STZA 2R78A 4N1HA 3LY4A 2HDRA 1ZG6A 4CLCC 3PTEA 3E2KA 3NDEA 1LSXA 3MSHA 1YAXA 4RYEA 5EV0A 1K56D 3EEAA 5A90A 5HW3A 4B4ZA 2XFTA 1PI5A 1CJFA 5KZHA 3NECA 4R3BA 2QZ6A 5TJJA 2YKFA 4DJ3A 3QP6A 4WYYA 5AQBA 1ONGA 4JGOA 2Z6CA 3VOZA 3KYEA 3HUMA 4WLAA 3HUOA 1G28A 3MBZA 3QNBA 4NETA 2OAQ1 3FZCA 1MWSA 3KSIA 4ARZB 4OPQA 1TDLA 5F6AA 4ME4A 1RGYA 1ERQA 4NEED 5FAQA 2XK1A 1YM1A 1HTZA 4NXBA 5CEDA 4S2PA 3FKVA 1EROA 4K0WA 3EWKA 2HDUA 2WKQA 2W3GA 1UWPX 3E4OA 4I5SA 2JKRI 3KYZA 1T1AA 3BFEA 1H8ZA 3BLSA 2Q0OA 1S4SA 2H5SA 4LLOB 4IVIA 2WKPA 4X69A 4CLCB 2WK0A 3SS5A 1KVMA 1LI9A 4GZBA 2Y2MA 4U0XA 4IVKA 3OPHA 4HJ3A 5HDDA 3FYZA 5L8MA
chains in the Genus database with same CATH topology
4E6WA 1NY0A 4X56A 4KZ3A 4OLGA 1DY6A 2WAFA 3VP4A 4GDNA 1DJAA 3Q7VA 5CGXA 4OQGA 3NBLA 1MKIA 1LI0A 2G2UA 3HVFA 3LCEA 1PZPA 4S2KA 5TGFA 3ZNYA 2EFXA 1NRFA 3N6IA 4LV2A 5G18A 2HP6A 4CPKA 4Y0TA 2FFFB 2Y2NA 3DTMA 5GLDA 4BD0A 4BLMA 1K54A 4QHCA 5GHZA 3WWXA 4DDYA 4OOYA 3HLBA 4DDSA 2WKHA 1TVFA 5EVIC 1IEMA 1TDGA 1BTLA 1DJBA 3FWLA 2Y4AA 2B5RA 1W7FA 3A3JA 3G34A 2OLVA 1MPLA 4GKUA 1NZUA 3M6HA 2I72A 3DWZA 2X71A 4X6TA 5EVIB 1S0WA 3NIAA 4N92A 1K6SA 4EV4A 1G68A 1IELA 3ZNTA 4UAAA 1KE3A 2C5WB 1L0EA 5FQQA 3GMWA 4KZ6A 3NC8A 2BG1A 1YLZA 3GR2A 4OONA 2WZZA 1SKFA 5DTTA 2IWCA 2R9WA 1FQGA 5I94A 3G2ZA 3BFGA 2ZM0A 3WS0A 3Q07A 3ZG8B 2HPBA 2OSUA 2ZQ9A 4KQRA 1N4OA 1L0GA 2DRWA 2PU2A 4S2NA 5FA7A 3IF6B 3AGFA 4UA7A 5U47A 1IKIA 3ZGAB 2ZM2A 1ERMA 1E25A 1YMXA 2WGWA 1E3UD 1E4DA 3CMZA 3HLGA 3RXWA 2V20A 1GHPA 1HZOA 2VGJA 2OV5A 4ZJ1A 1U60A 2A49A 3AGDA 4H8RA 3BECA 1L0DA 2ZMAA 1NJ4A 4K0XA 3GV9A 2IWDA 3QHYA 4BL3A 5HAQA 3IWOA 2Q9NA 1W5DA 4R4RA 5FQJA 4FH2A 3ITBA 1FOFA 4L0LA 3NY4A 2XEPA 1ZG4A 3NI9A 2P74A 4JXGA 2WKEA 5CTMA 3QNCA 5GL9A 3UY6A 2HP5A 3UPPA 3PAGA 1BLPA 4R4SA 2Z2MB 4GDBA 3PBTA 1KGGA 1YLTA 2XQZA 1K4EA 1ES4A 5HFOA 1AXBA 3G31A 3ZVWA 3JYIA 4GOGA 2H0TA 2ZM8A 1PWCA 2WYXA 1M40A 2WGWB 4ZDXA 3G32A 4LV0A 1XPBA 4UA6A 1KGFA 3G4PA 3V39A 4MEZA 3P09A 1YLJA 4DXCA 2JE5A 4R1GA 2JC7A 2GDNA 4K91A 2WADA 5CHJA 5GLCA 4GD8A 3UDIA 4WEJA 5FI6A 1BT5A 4DE0A 3ISGA 3FV7A 4C6YA 1XA7A 5F82A 4DE2A 1XP4A 3M6BA 5DF9A 2P9VA 3GSGA 4XUXA 4Y0OA 5A91A 3HLDA 3C7UA 3OPLA 4B4XA 4MBKA 3DW0A 1S6RA 4P85A 1KE0A 2JCHA 4M3KA 4P0MA 4EBNA 4WELA 3A3DA 5F83A 1O07A 4Y7PA 3HREA 3MZEA 4PMAA 5E2FA 3HLEA 1YLPA 1GHMA 4Q8IA 3OPRA 5HAPA 2IWBA 4HBTA 4C3QA 3N8SA 3E2LA 4E3NA 3PBOA 5FATA 4O7DA 1ZC2A 3MXSA 3MZFA 3HBRA 3OCLA 3OC2A 5HX9A 4PM8A 2P9VB 1MWUA 1RGZA 3P98A 2Y2OA 1CI8A 4OLDA 1MWTA 4ZAMA 3NCKA 1PW8A 1HVBA 5FQMA 3VSLA 5EOOA 5BOHA 5D3OA 1KVLA 4ZBEA 5FI2A 1FR6A 4C75A 4KG6A 3Q7VB 4KQQA 3SS4A 2H0YA 1E3UA 3VFFA 3PBQA 5CTNA 3I7JA 5FI7A 3GQZA 3UO9A 4IBRA 2EXBA 5FQKA 1H5XA 3FKWA 1XGIA 5FQIA 2ZD8A 4MLLA 4OPZA 1PI4A 3VFHA 4E3MA 2EX2A 4JXWA 1VQQA 4QY5A 3UDFA 2XGNA 3EQVA 3IF6C 2UWXA 2RCXA 1LL5A 1I2SA 1W79A 1FCMA 2ZJ9A 5A92A 1ES3A 4X55A 3VOYA 2OLUA 1BZAA 2FFYA 2XH9A 3NDGA 2XD5A 1GCEA 1VM1A 4BD1A 2Y91A 4DE1A 3AGEA 3O87A 4E6XA 1ES5A 1H8YA 1SCWA 2Y2GA 1K55C 1K54C 1YT4A 5GHXA 1JWPA 4JXVA 1XGJA 2PU4A 3BFFA 3IH9A 4UA9A 2ZC4B 1N9BA 3MXRA 5CERA 4DKIA 3W4OA 5KMWA 1JWVA 2BLSA 1JWZA 5CECA 3RJUA 3WRZA 1QMFA 5CXWA 1BULA 3GTCA 4F94A 5M19A 3IQAA 4OQHA 1Z6FA 3ZG7B 3ZVTA 2WAEA 3ZCZA 4RA7A 4JF5A 2Y2PA 4S2IA 4DE3A 4MBFA 4S2JA 1DJCA 1MXOA 4RX2A 4BENA 3MZDA 3BM6A 3C5AA 5FAOA 3C7VA 4GB7A 4CJNA 1ZKJA 4OQIA 3IF6A 4WMCD 4JLFA 4X68A 5FASA 4WBGA 3S4XA 3A3EA 5E43A 3UE0A 4PPRA 2J8YA 3C4PA 1YLYA 2ZQCA 2Y59A 3VP0A 4JF6A 3SH8A 3WS4A 3IWQA 3G30A 3HLFA 4XUZA 2QMIA 3IHAA 2WGIA 4KZ9A 4WZ5C 1K4FA 4R0QA 4OP5A 4A5RA 3N8RA 1SDEA 3BFCA 4QD4A 2ZLYA 2XLNA 5J8XA 4FH4A 2XFSA 4KZ4A 3V3RA 1XXMA 2WKIA 4GN2A 2EXAA 4BQMA 4JPMA 4P87A 4MBHA 4EWFA 3ZDJA 1WE4A 4LV1A 1W8YA 3GVBA 2EX8A 3BEBA 3BYDA 4KG5A 1FSYA 1K55A 1PIOA 1K38A 2V2FF 2WGVA 4N9KA 5EE8A 4BL2A 3N8LA 4HBUA 2A3UA 3V3SA 1FCNA 3WRTA 4QJGA 3HLCA 5GLAA 1CEFA 4PM7A 4FSFA 5DVAA 1OMEA 3SH9A 3CJMA 4QY6A 4MNRA 1XX2A 3S22A 3IXHA 4FD8A 5E2EA 4OQ0A 5EOEA 1BUEA 1FSWA 5M1AA 1RCJA 4PM5A 2HP9A 4RVAA 3HL9A 3ZHHA 4NK3A 5KSHA 1O7EA 3W4QA 5AQ7A 2ZC5B 1I5QA 4OH0A 5CGSA 4ID4A 4ZJ3A 2XDMA 3IWIA 3O3VA 2XF3A 5CGWA 5EPHA 4P6BA 1GHIA 1K25A 1C3BA 5M18A 4S2MA 4Z9QA 1ESIA 4D2OA 2ZQ7A 4KQOA 1PWGA 3B3XA 1BSGA 2ZQAA 3PBRA 3UE1A 5JYOA 2DNSA 3CZDA 4EBPA 5F1GA 5DF8A 2Y2KA 3TOIA 4JXSA 4FCFA 1BLCA 5E2HA 4KZAA 3MFDA 4DXBA 1IYOA 1K56A 5HARA 1JTGA 3C4OA 2Y2JA 2Y2IA 3M2JA 3Q81A 5E2GA 5TR7A 1NYMA 4EUZA 1NYYA 4EBLA 4JF4A 5EVID 4IBXA 2EX6A 4N1XA 3W8KA 1LLBA 1MY8A 4U0TA 4ZJ2A 3IHBA 2XR0A 2J9PA 1IYPA 4WEKA 3RXXA 3IT9A 1IKGA 1ES2A 4LCLA 1K57C 1KDSA 4XXRA 3TG9A 4HEFA 4KZ5A 3IXDA 3IXGA 4DF6A 4GNUA 5HL1A 3WS1A 1ESUA 3OPPA 4HESA 4ZTKA 3WS5A 1YLWA 1GA0A 1CEGA 3V50A 4E3JA 5A93A 4OPYA 1MBLA 1G6AA 3MKEA 1Q2QA 5L2FA 3GRJA 3A3FA 5AQ9A 4LV3A 4E3KA 3OCNA 1MWRA 2Y2QA 3UNWA 5FDHA 3OZHA 3N4IA 1SHVA 4OVDA 1XKZA 4U3TA 2X02A 4OOMA 5TFQA 2J9OA 1XA1A 5FSRA 1HD8A 2HDSA 4QB8A 1BLHA 4X53A 1LL9A 1PWDA 3LEZA 1NZOA 1GA9A 5HAIA 2XD1A 1QMEA 4OPRA 3ITAA 2JBFA 4OOLA 5CEBA 1EWZA 4E3LA 2V1ZA 2X01A 2Q9MA 3VMAA 2RL3A 5FAPA 3ZFZA 4Y0UA 1KGEA 3BLMA 5CRFA 2CC1A 3VSKA 3G35A 3VP1A 4N1HA 5JYPA 3LY4A 3WS2A 3SH7A 4B88A 1EI5A 1LHYA 2HDRA 3VP3A 1ZG6A 2Z2LB 1FR1A 2ZQ8A 3PTEA 2R9XA 1ONHA 3E2KA 3NDEA 4IEDA 3V5MA 4E3IA 2ZC3B 3UPNA 1K57A 4RYEA 4KZ8A 3IXBA 1K56D 1WYCA 3IH8A 5A90A 1KDWA 4OKPA 5HW3A 4OP8A 4B4ZA 1J9MA 1PI5A 2XFTA 2EX9A 5KZHA 4R3BA 4DRTA 2WUQA 4S2LA 2Y2HA 2QZ6A 3LY3A 1WYBA 1YQSA 3O86A 4WYYA 1L0FA 2VGKA 5AQBA 1ONGA 1L2SA 2H10A 1IYQA 3D4FA 3S1YA 3SS3A 1Q2PA 3HUMA 3VOZA 5CHMA 3W4PA 3HUOA 1K6RA 1JVJA 2ZC7A 4KENB 3VP2A 4R3JA 3MKFA 3BFDA 3MBZA 2WZXA 3PBNA 3PBSA 3Q7ZA 3QNBA 3SOIA 3ZG0A 4NETA 5EVLA 3HLWA 5F1FA 1I2WA 4KZ7A 4E3OA 4LENA 3UPOA 3Q82A 4YFMA 4EQIA 3FZCA 1MWSA 4JBFA 4WM9A 1YMSA 5DTKA 2EFUA 5EUAA 1PW1A 3TSGA 3O88A 1FCOA 4OPQA 2DCFA 4GD6A 2ZQDA 4BJPA 1TDLA 3BRMA 3A3IA 1RGYA 3UDXA 3ZG9B 4R23A 1ERQA 3N7WA 3LO7A 5AQAA 1CI9A 5FAQA 5FQ9A 2XK1A 3UE3A 1YM1A 1HTZA 4QU3A 4KG2A 4RX3A 5DF7A 4S2PA 5CEDA 3FKVA 2ZC6B 1EROA 4K0WA 4S2OA 1IYSA 3G2YA 4PM6A 5EVIA 1RP5A 3Q1FA 1PZOA 4KZBA 3UN7A 2E8IA 2HDUA 5GHYA 2PBYA 3PAEA 5IHVA 1W8QA 2J7VA 2C6WB 5EECA 2QPNA 3BFEA 2HDQA 3DWKA 3EQUA 1ALQA 1H8ZA 1M6KA 3BLSA 3CG5A 1JTDA 4LCMA 2H5SA 4IVIA 4X69A 2WK0A 4N9LA 3SS5A 1KVMA 4PM9A 1KE4A 3HUNA 2Y55A 3ZG5A 5GLBA 4JKTA 1LI9A 1PYYA 4GZBA 2Y2MA 4S2NC 4UHUA 1TEMA 4WZ5A 4U0XA 1SDNA 1BLSA 2G2WA 2Y2LA 5DTSA 4WMCA 1Y54A 5KSCA 4IVKA 5CHUA 3OPHA 4YINA 3IF5A 1NXYA 3FYZA 1CK3A 3M2KA 4WZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6W A;  1NY0 A;  4X56 A;  4KZ3 A;  4OLG A;  1DY6 A;  2WAF A;  3VP4 A;  4GDN A;  1DJA A;  3Q7V A;  5CGX A;  4OQG A;  3NBL A;  1MKI A;  1LI0 A;  2G2U A;  3HVF A;  3LCE A;  1PZP A;  4S2K A;  5TGF A;  3ZNY A;  2EFX A;  1NRF A;  3N6I A;  4LV2 A;  5G18 A;  2HP6 A;  4CPK A;  4Y0T A;  2FFF B;  2Y2N A;  3DTM A;  5GLD A;  4BD0 A;  4BLM A;  1K54 A;  4QHC A;  5GHZ A;  3WWX A;  4DDY A;  4OOY A;  3HLB A;  4DDS A;  2WKH A;  1TVF A;  5EVI C;  1IEM A;  1TDG A;  1BTL A;  1DJB A;  3FWL A;  2Y4A A;  2B5R A;  1W7F A;  3A3J A;  3G34 A;  2OLV A;  1MPL A;  4GKU A;  1NZU A;  3M6H A;  2I72 A;  3DWZ A;  2X71 A;  4X6T A;  5EVI B;  1S0W A;  3NIA A;  4N92 A;  1K6S A;  4EV4 A;  1G68 A;  1IEL A;  3ZNT A;  4UAA A;  1KE3 A;  2C5W B;  1L0E A;  5FQQ A;  3GMW A;  4KZ6 A;  3NC8 A;  2BG1 A;  1YLZ A;  3GR2 A;  4OON A;  2WZZ A;  1SKF A;  5DTT A;  2IWC A;  2R9W A;  1FQG A;  5I94 A;  3G2Z A;  3BFG A;  2ZM0 A;  3WS0 A;  3Q07 A;  3ZG8 B;  2HPB A;  2OSU A;  2ZQ9 A;  4KQR A;  1N4O A;  1L0G A;  2DRW A;  2PU2 A;  4S2N A;  5FA7 A;  3IF6 B;  3AGF A;  4UA7 A;  5U47 A;  1IKI A;  3ZGA B;  2ZM2 A;  1ERM A;  1E25 A;  1YMX A;  2WGW A;  1E3U D;  1E4D A;  3CMZ A;  3HLG A;  3RXW A;  2V20 A;  1GHP A;  1HZO A;  2VGJ A;  2OV5 A;  4ZJ1 A;  1U60 A;  2A49 A;  3AGD A;  4H8R A;  3BEC A;  1L0D A;  2ZMA A;  1NJ4 A;  4K0X A;  3GV9 A;  2IWD A;  3QHY A;  4BL3 A;  5HAQ A;  3IWO A;  2Q9N A;  1W5D A;  4R4R A;  5FQJ A;  4FH2 A;  3ITB A;  1FOF A;  4L0L A;  3NY4 A;  2XEP A;  1ZG4 A;  3NI9 A;  2P74 A;  4JXG A;  2WKE A;  5CTM A;  3QNC A;  5GL9 A;  3UY6 A;  2HP5 A;  3UPP A;  3PAG A;  1BLP A;  4R4S A;  2Z2M B;  4GDB A;  3PBT A;  1KGG A;  1YLT A;  2XQZ A;  1K4E A;  1ES4 A;  5HFO A;  1AXB A;  3G31 A;  3ZVW A;  3JYI A;  4GOG A;  2H0T A;  2ZM8 A;  1PWC A;  2WYX A;  1M40 A;  2WGW B;  4ZDX A;  3G32 A;  4LV0 A;  1XPB A;  4UA6 A;  1KGF A;  3G4P A;  3V39 A;  4MEZ A;  3P09 A;  1YLJ A;  4DXC A;  2JE5 A;  4R1G A;  2JC7 A;  2GDN A;  4K91 A;  2WAD A;  5CHJ A;  5GLC A;  4GD8 A;  3UDI A;  4WEJ A;  5FI6 A;  1BT5 A;  4DE0 A;  3ISG A;  3FV7 A;  4C6Y A;  1XA7 A;  5F82 A;  4DE2 A;  1XP4 A;  3M6B A;  5DF9 A;  2P9V A;  3GSG A;  4XUX A;  4Y0O A;  5A91 A;  3HLD A;  3C7U A;  3OPL A;  4B4X A;  4MBK A;  3DW0 A;  1S6R A;  4P85 A;  1KE0 A;  2JCH A;  4M3K A;  4P0M A;  4EBN A;  4WEL A;  3A3D A;  5F83 A;  1O07 A;  4Y7P A;  3HRE A;  3MZE A;  4PMA A;  5E2F A;  3HLE A;  1YLP A;  1GHM A;  4Q8I A;  3OPR A;  5HAP A;  2IWB A;  4HBT A;  4C3Q A;  3N8S A;  3E2L A;  4E3N A;  3PBO A;  5FAT A;  4O7D A;  1ZC2 A;  3MXS A;  3MZF A;  3HBR A;  3OCL A;  3OC2 A;  5HX9 A;  4PM8 A;  2P9V B;  1MWU A;  1RGZ A;  3P98 A;  2Y2O A;  1CI8 A;  4OLD A;  1MWT A;  4ZAM A;  3NCK A;  1PW8 A;  1HVB A;  5FQM A;  3VSL A;  5EOO A;  5BOH A;  5D3O A;  1KVL A;  4ZBE A;  5FI2 A;  1FR6 A;  4C75 A;  4KG6 A;  3Q7V B;  4KQQ A;  3SS4 A;  2H0Y A;  1E3U A;  3VFF A;  3PBQ A;  5CTN A;  3I7J A;  5FI7 A;  3GQZ A;  3UO9 A;  4IBR A;  2EXB A;  5FQK A;  1H5X A;  3FKW A;  1XGI A;  5FQI A;  2ZD8 A;  4MLL A;  4OPZ A;  1PI4 A;  3VFH A;  4E3M A;  2EX2 A;  4JXW A;  1VQQ A;  4QY5 A;  3UDF A;  2XGN A;  3EQV A;  3IF6 C;  2UWX A;  2RCX A;  1LL5 A;  1I2S A;  1W79 A;  1FCM A;  2ZJ9 A;  5A92 A;  1ES3 A;  4X55 A;  3VOY A;  2OLU A;  1BZA A;  2FFY A;  2XH9 A;  3NDG A;  2XD5 A;  1GCE A;  1VM1 A;  4BD1 A;  2Y91 A;  4DE1 A;  3AGE A;  3O87 A;  4E6X A;  1ES5 A;  1H8Y A;  1SCW A;  2Y2G A;  1K55 C;  1K54 C;  1YT4 A;  5GHX A;  1JWP A;  4JXV A;  1XGJ A;  2PU4 A;  3BFF A;  3IH9 A;  4UA9 A;  2ZC4 B;  1N9B A;  3MXR A;  5CER A;  4DKI A;  3W4O A;  5KMW A;  1JWV A;  2BLS A;  1JWZ A;  5CEC A;  3RJU A;  3WRZ A;  1QMF A;  5CXW A;  1BUL A;  3GTC A;  4F94 A;  5M19 A;  3IQA A;  4OQH A;  1Z6F A;  3ZG7 B;  3ZVT A;  2WAE A;  3ZCZ A;  4RA7 A;  4JF5 A;  2Y2P A;  4S2I A;  4DE3 A;  4MBF A;  4S2J A;  1DJC A;  1MXO A;  4RX2 A;  4BEN A;  3MZD A;  3BM6 A;  3C5A A;  5FAO A;  3C7V A;  4GB7 A;  4CJN A;  1ZKJ A;  4OQI A;  3IF6 A;  4WMC D;  4JLF A;  4X68 A;  5FAS A;  4WBG A;  3S4X A;  3A3E A;  5E43 A;  3UE0 A;  4PPR A;  2J8Y A;  3C4P A;  1YLY A;  2ZQC A;  2Y59 A;  3VP0 A;  4JF6 A;  3SH8 A;  3WS4 A;  3IWQ A;  3G30 A;  3HLF A;  4XUZ A;  2QMI A;  3IHA A;  2WGI A;  4KZ9 A;  4WZ5 C;  1K4F A;  4R0Q A;  4OP5 A;  4A5R A;  3N8R A;  1SDE A;  3BFC A;  4QD4 A;  2ZLY A;  2XLN A;  5J8X A;  4FH4 A;  2XFS A;  4KZ4 A;  3V3R A;  1XXM A;  2WKI A;  4GN2 A;  2EXA A;  4BQM A;  4JPM A;  4P87 A;  4MBH A;  4EWF A;  3ZDJ A;  1WE4 A;  4LV1 A;  1W8Y A;  3GVB A;  2EX8 A;  3BEB A;  3BYD A;  4KG5 A;  1FSY A;  1K55 A;  1PIO A;  1K38 A;  2V2F F;  2WGV A;  4N9K A;  5EE8 A;  4BL2 A;  3N8L A;  4HBU A;  2A3U A;  3V3S A;  1FCN A;  3WRT A;  4QJG A;  3HLC A;  5GLA A;  1CEF A;  4PM7 A;  4FSF A;  5DVA A;  1OME A;  3SH9 A;  3CJM A;  4QY6 A;  4MNR A;  1XX2 A;  3S22 A;  3IXH A;  4FD8 A;  5E2E A;  4OQ0 A;  5EOE A;  1BUE A;  1FSW A;  5M1A A;  1RCJ A;  4PM5 A;  2HP9 A;  4RVA A;  3HL9 A;  3ZHH A;  4NK3 A;  5KSH A;  1O7E A;  3W4Q A;  5AQ7 A;  2ZC5 B;  1I5Q A;  4OH0 A;  5CGS A;  4ID4 A;  4ZJ3 A;  2XDM A;  3IWI A;  3O3V A;  2XF3 A;  5CGW A;  5EPH A;  4P6B A;  1GHI A;  1K25 A;  1C3B A;  5M18 A;  4S2M A;  4Z9Q A;  1ESI A;  4D2O A;  2ZQ7 A;  4KQO A;  1PWG A;  3B3X A;  1BSG A;  2ZQA A;  3PBR A;  3UE1 A;  5JYO A;  2DNS A;  3CZD A;  4EBP A;  5F1G A;  5DF8 A;  2Y2K A;  3TOI A;  4JXS A;  4FCF A;  1BLC A;  5E2H A;  4KZA A;  3MFD A;  4DXB A;  1IYO A;  1K56 A;  5HAR A;  1JTG A;  3C4O A;  2Y2J A;  2Y2I A;  3M2J A;  3Q81 A;  5E2G A;  5TR7 A;  1NYM A;  4EUZ A;  1NYY A;  4EBL A;  4JF4 A;  5EVI D;  4IBX A;  2EX6 A;  4N1X A;  3W8K A;  1LLB A;  1MY8 A;  4U0T A;  4ZJ2 A;  3IHB A;  2XR0 A;  2J9P A;  1IYP A;  4WEK A;  3RXX A;  3IT9 A;  1IKG A;  1ES2 A;  4LCL A;  1K57 C;  1KDS A;  4XXR A;  3TG9 A;  4HEF A;  4KZ5 A;  3IXD A;  3IXG A;  4DF6 A;  4GNU A;  5HL1 A;  3WS1 A;  1ESU A;  3OPP A;  4HES A;  4ZTK A;  3WS5 A;  1YLW A;  1GA0 A;  1CEG A;  3V50 A;  4E3J A;  5A93 A;  4OPY A;  1MBL A;  1G6A A;  3MKE A;  1Q2Q A;  5L2F A;  3GRJ A;  3A3F A;  5AQ9 A;  4LV3 A;  4E3K A;  3OCN A;  1MWR A;  2Y2Q A;  3UNW A;  5FDH A;  3OZH A;  3N4I A;  1SHV A;  4OVD A;  1XKZ A;  4U3T A;  2X02 A;  4OOM A;  5TFQ A;  2J9O A;  1XA1 A;  5FSR A;  1HD8 A;  2HDS A;  4QB8 A;  1BLH A;  4X53 A;  1LL9 A;  1PWD A;  3LEZ A;  1NZO A;  1GA9 A;  5HAI A;  2XD1 A;  1QME A;  4OPR A;  3ITA A;  2JBF A;  4OOL A;  5CEB A;  1EWZ A;  4E3L A;  2V1Z A;  2X01 A;  2Q9M A;  3VMA A;  2RL3 A;  5FAP A;  3ZFZ A;  4Y0U A;  1KGE A;  3BLM A;  5CRF A;  2CC1 A;  3VSK A;  3G35 A;  3VP1 A;  4N1H A;  5JYP A;  3LY4 A;  3WS2 A;  3SH7 A;  4B88 A;  1EI5 A;  1LHY A;  2HDR A;  3VP3 A;  1ZG6 A;  2Z2L B;  1FR1 A;  2ZQ8 A;  3PTE A;  2R9X A;  1ONH A;  3E2K A;  3NDE A;  4IED A;  3V5M A;  4E3I A;  2ZC3 B;  3UPN A;  1K57 A;  4RYE A;  4KZ8 A;  3IXB A;  1K56 D;  1WYC A;  3IH8 A;  5A90 A;  1KDW A;  4OKP A;  5HW3 A;  4OP8 A;  4B4Z A;  1J9M A;  1PI5 A;  2XFT A;  2EX9 A;  5KZH A;  4R3B A;  4DRT A;  2WUQ A;  4S2L A;  2Y2H A;  2QZ6 A;  3LY3 A;  1WYB A;  1YQS A;  3O86 A;  4WYY A;  1L0F A;  2VGK A;  5AQB A;  1ONG A;  1L2S A;  2H10 A;  1IYQ A;  3D4F A;  3S1Y A;  3SS3 A;  1Q2P A;  3HUM A;  3VOZ A;  5CHM A;  3W4P A;  3HUO A;  1K6R A;  1JVJ A;  2ZC7 A;  4KEN B;  3VP2 A;  4R3J A;  3MKF A;  3BFD A;  3MBZ A;  2WZX A;  3PBN A;  3PBS A;  3Q7Z A;  3QNB A;  3SOI A;  3ZG0 A;  4NET A;  5EVL A;  3HLW A;  5F1F A;  1I2W A;  4KZ7 A;  4E3O A;  4LEN A;  3UPO A;  3Q82 A;  4YFM A;  4EQI A;  3FZC A;  1MWS A;  4JBF A;  4WM9 A;  1YMS A;  5DTK A;  2EFU A;  5EUA A;  1PW1 A;  3TSG A;  3O88 A;  1FCO A;  4OPQ A;  2DCF A;  4GD6 A;  2ZQD A;  4BJP A;  1TDL A;  3BRM A;  3A3I A;  1RGY A;  3UDX A;  3ZG9 B;  4R23 A;  1ERQ A;  3N7W A;  3LO7 A;  5AQA A;  1CI9 A;  5FAQ A;  5FQ9 A;  2XK1 A;  3UE3 A;  1YM1 A;  1HTZ A;  4QU3 A;  4KG2 A;  4RX3 A;  5DF7 A;  4S2P A;  5CED A;  3FKV A;  2ZC6 B;  1ERO A;  4K0W A;  4S2O A;  1IYS A;  3G2Y A;  4PM6 A;  5EVI A;  1RP5 A;  3Q1F A;  1PZO A;  4KZB A;  3UN7 A;  2E8I A;  2HDU A;  5GHY A;  2PBY A;  3PAE A;  5IHV A;  1W8Q A;  2J7V A;  2C6W B;  5EEC A;  2QPN A;  3BFE A;  2HDQ A;  3DWK A;  3EQU A;  1ALQ A;  1H8Z A;  1M6K A;  3BLS A;  3CG5 A;  1JTD A;  4LCM A;  2H5S A;  4IVI A;  4X69 A;  2WK0 A;  4N9L A;  3SS5 A;  1KVM A;  4PM9 A;  1KE4 A;  3HUN A;  2Y55 A;  3ZG5 A;  5GLB A;  4JKT A;  1LI9 A;  1PYY A;  4GZB A;  2Y2M A;  4S2N C;  4UHU A;  1TEM A;  4WZ5 A;  4U0X A;  1SDN A;  1BLS A;  2G2W A;  2Y2L A;  5DTS A;  4WMC A;  1Y54 A;  5KSC A;  4IVK A;  5CHU A;  3OPH A;  4YIN A;  3IF5 A;  1NXY A;  3FYZ A;  1CK3 A;  3M2K A;  4WZ4 A; 
#chains in the Genus database with same CATH topology
 1G6O A;  1GSX A;  4KZ3 A;  4BBU A;  2WAF A;  5DFY A;  3VP4 A;  4GDN A;  4H6J A;  1LSW A;  3NBL A;  2EA9 A;  4F3L A;  3LCE A;  2L1M A;  4CPK A;  4Y0T A;  3DTM A;  4BD0 A;  4Y2F A;  1K54 A;  4QHC A;  3WWX A;  5EVI C;  2Y4A A;  4GKU A;  2I72 A;  2X71 A;  4EV4 A;  1K0K A;  2D02 A;  4KZ6 A;  3GR2 A;  1OTE A;  1SKF A;  5EFW A;  4KUK A;  3BFG A;  3NJA A;  3ULF A;  2OSU A;  2DRW A;  2O9A A;  4UA7 A;  3KSF A;  1E25 A;  2WGW A;  4I3A A;  1S4R A;  3RXW A;  1GHP A;  3SW1 A;  1F9I A;  3P7N A;  2A49 A;  3AGD A;  4PAU A;  3BEC A;  5HZH A;  1L0D A;  2VK3 A;  4NXE A;  4HP9 A;  3T4S A;  4BL3 A;  5HAQ A;  4R4R A;  3LGO A;  2GZA A;  4L0L A;  1W63 Q;  4CQH A;  3NI9 A;  1YSP A;  3R7W B;  3PAG A;  4IHQ A;  4GDB A;  2CMN A;  1KGG A;  3CAX A;  1ES4 A;  1K4E A;  1AXB A;  3G31 A;  2A2L A;  3IBR A;  4GOG A;  1VEU B;  1PWC A;  2WGW B;  1KGF A;  2O9B A;  3OOV A;  4R1G A;  2GDN A;  3ICY A;  5TBM A;  3T4K A;  4HH2 A;  4K91 A;  2WAD A;  4EER A;  5KIZ A;  5FI6 A;  1BT5 A;  3T50 A;  3T4Q A;  4C6Y A;  5DF9 A;  5C5K A;  3KO6 A;  4Y0O A;  2KDK A;  3UB8 A;  3KSG A;  4B4X A;  2PD8 A;  3LUQ A;  3T1S A;  3HJI A;  3HLE A;  1MKM A;  1YLP A;  4Q8I A;  2IWB A;  1JNU A;  2W1T A;  3HCY A;  2OOL A;  3MZF A;  3HBR A;  4II7 A;  3OC2 A;  2KLI A;  4H6J B;  2K31 A;  2P9V B;  2Y2O A;  2A24 B;  4XT2 B;  1CI8 A;  1HVB A;  5FQM A;  5EOO A;  5FI2 A;  4KQQ A;  3Q7V B;  1OT9 A;  2JKR M;  3VFF A;  3PBQ A;  5CTN A;  1YPR A;  1OTI A;  2HV1 A;  3UO9 A;  1Y4O A;  2EXB A;  4ETZ A;  1XGI A;  5FQI A;  2ZD8 A;  3EOI A;  3HJK A;  2HZ5 A;  3LEQ A;  5DJU A;  3VFH A;  1LL5 A;  5A92 A;  4Y3I A;  4X55 A;  3VOY A;  1BZA A;  2FFY A;  2XH9 A;  4X25 A;  3NOP C;  2XD5 A;  4FTX A;  3LR5 A;  4BD1 A;  3GEC A;  1YT4 A;  5G4Z A;  1K54 C;  3A0S A;  3MXR A;  4DKI A;  5L10 A;  3V67 A;  3RJU A;  4EES A;  1QMF A;  3MFX A;  5CXW A;  1V9Z A;  3ZVT A;  4JF5 A;  4S2I A;  1MXO A;  3JVU A;  3C5A A;  4JLF A;  3CHW P;  3VP0 A;  1CQA A;  4ESP A;  2ZMF A;  4OP5 A;  4A5R A;  3BFC A;  4KZ4 A;  3E4Q A;  1XXM A;  4MN7 A;  4D60 A;  4HIA A;  4MBH A;  3ZDJ A;  4LV1 A;  3QP5 A;  5EE8 A;  2WGV A;  4N9K A;  4HBU A;  1F5M A;  4QJG A;  4PM7 A;  4FSF A;  1OME A;  3SH9 A;  3CJM A;  4QY6 A;  4MNR A;  3S22 A;  2V1B A;  5E2E A;  4OQ0 A;  3CUE A;  4G3K A;  5AQ7 A;  1I5Q A;  4ZJ3 A;  3O3V A;  3ZYT A;  1ESI A;  4D2O A;  4KQO A;  2ZQA A;  1LT0 A;  5J7E A;  4WN5 A;  3CLO A;  3MFD A;  4Z1W A;  5TR7 A;  1NYM A;  1P9W A;  4IBX A;  4N1X A;  4GS9 A;  1LLB A;  3IS2 B;  4YOF A;  3IHB A;  2XR0 A;  1IYP A;  2YKH A;  1IKG A;  4XXR A;  3TG9 A;  1KDS A;  3U2A A;  3IXG A;  4DF6 A;  5HL1 A;  2K2N A;  3WS5 A;  1YLW A;  2L0W A;  1L3L A;  1CEG A;  4E3J A;  3LIB A;  1MBL A;  3MKE A;  1N9N A;  5K5B A;  2Y2Q A;  5FDH A;  3OZH A;  3F1P A;  3N4I A;  4OOM A;  1G5U A;  4QB8 A;  2VGL M;  4X53 A;  4R70 A;  4LPZ A;  4LRZ E;  3LEZ A;  2W1R A;  4OPR A;  2P08 A;  3R4K A;  4PKY A;  2X01 A;  2NUT C;  3VMA A;  3DBA A;  4Y0U A;  1KGE A;  3VSK A;  1T1C A;  3VP1 A;  4R38 A;  3T1Q B;  5JYP A;  2XRN A;  3SH7 A;  1LHY A;  2ZQ8 A;  4KZ8 A;  3IXB A;  3H82 A;  2VEA A;  1KDW A;  4OP8 A;  1J9M A;  2EX9 A;  2OWJ A;  4LGW A;  1S66 L;  4DRT A;  2WUQ A;  2Y2H A;  1YQS A;  1L2S A;  2H10 A;  3S1Y A;  1P9R A;  5HPF A;  5CHM A;  3W4P A;  1JVJ A;  2ZC7 A;  4KEN B;  3VP2 A;  3PBS A;  3SOI A;  5EVL A;  5F1F A;  3MJQ A;  2VA0 A;  3Q82 A;  4JBF A;  4Y15 A;  3H7W A;  4WM9 A;  2LB5 A;  3RFB A;  2EFU A;  3TSG A;  1FCO A;  2ZQD A;  4BJP A;  3A3I A;  3LO7 A;  5AQA A;  1CI9 A;  2FZ0 A;  5FQ9 A;  3T4O A;  4KG2 A;  2H28 A;  2B02 A;  2ZC6 B;  1NLY A;  4PM6 A;  5GHY A;  2PBY A;  1ZTU A;  3PAE A;  5IHV A;  2J7V A;  2PT7 A;  1TD5 A;  3TE8 A;  3EQU A;  4HHD A;  1ALQ A;  3CG5 A;  1DRM A;  3P01 A;  3ZG5 A;  5IS1 A;  3T1R A;  3DAV A;  4WZ5 A;  2Y2L A;  4YIN A;  2PRF A;  4X56 A;  5EM0 A;  3NHQ A;  4I39 A;  4Q0H A;  1FIK A;  2G2U A;  3HVF A;  3ZNY A;  2EFX A;  1NRF A;  3CPT A;  4LV2 A;  2FFF B;  4BLM A;  4DDY A;  4OOY A;  4DDS A;  1IEM A;  1TDG A;  3G34 A;  1XFQ A;  3M6H A;  3DWZ A;  2L4R A;  1S0W A;  3NIA A;  4L9F A;  1G68 A;  4WL9 A;  4GW9 A;  1KE3 A;  5HSQ A;  4OON A;  3CPT B;  2R9W A;  1FQG A;  4L9E A;  2PD7 A;  5I94 A;  1HLU P;  4YWZ A;  3ZG8 B;  2V8C A;  3E4P A;  1N4O A;  3T4T A;  1VET B;  2VV7 A;  3IF6 B;  3AGF A;  1VET A;  5U47 A;  1IKI A;  3ZGA B;  1E3U D;  1E4D A;  3CMZ A;  1XJ2 A;  2OV5 A;  3BWL A;  4ZJ1 A;  2ZMA A;  3GV9 A;  3IX8 A;  4LRY C;  1W5D A;  3NY4 A;  2XEP A;  5FDS A;  2P74 A;  3MR0 A;  3UY6 A;  3A0V A;  4R4S A;  4ETX A;  2M7U A;  2XQZ A;  2H0T A;  4EEU A;  1DP8 A;  2J3W A;  1OTB A;  1M40 A;  1XPB A;  3G4P A;  1YLJ A;  3FPV A;  2JC7 A;  4Q0J A;  1KOU A;  2XA7 S;  4DE0 A;  4DE2 A;  2QJ5 A;  3M6B A;  2GNX A;  4LFU A;  4HJ6 A;  3HLD A;  3C7U A;  5DKL A;  3UB5 P;  1GSV A;  3DW0 A;  4Y17 A;  5HDC A;  1S6R A;  4P85 A;  3UB9 A;  4M3K A;  2JCH A;  4P0M A;  4EBN A;  3A3D A;  2XRO A;  3LFV A;  4P6Z M;  3N8S A;  3E2L A;  3PBO A;  5HX9 A;  3MXS A;  1MWU A;  1RGZ A;  4EW7 A;  5DKK A;  4DN0 A;  5BOH A;  1FR6 A;  4C75 A;  3GQZ A;  3FKW A;  2VGL S;  1PI4 A;  4JXW A;  1VQQ A;  2ACG A;  3IF6 C;  2RCX A;  1W79 A;  2HGV A;  1FCM A;  4DE1 A;  3D3O A;  3AGE A;  3QP1 A;  3NOT C;  1SCW A;  2Y2G A;  1K55 C;  1DP6 A;  5GHX A;  1TS8 A;  1JWP A;  3PXP A;  2G7U A;  4JXV A;  2PU4 A;  2ZC4 B;  5CER A;  1JWV A;  1D06 A;  2W3E A;  2M7V A;  2V0U A;  1Y28 A;  4OQH A;  1Z6F A;  5HWT A;  3ZCZ A;  4RA7 A;  1F98 A;  4S2J A;  1DJC A;  3VV4 A;  2BAS A;  4BEN A;  3EGX C;  1ZKJ A;  4ZRR A;  3IF6 A;  4WBG A;  3A3E A;  5L09 A;  3G30 A;  1TS0 A;  2QMI A;  2WGI A;  4KZ9 A;  1SDE A;  2XLN A;  1LSV A;  3BY9 A;  4P87 A;  5AVF A;  4EU0 A;  1LL8 A;  3BQ8 A;  3BYD A;  2VV8 A;  1FSY A;  1PIO A;  1K38 A;  4BL2 A;  3N8L A;  5J3W A;  3V3S A;  1XJ6 A;  3CIT A;  4GS9 B;  2JHE A;  1XX2 A;  4FD8 A;  5M1A A;  2VV6 A;  4PM5 A;  1YSQ A;  2HP9 A;  4RVA A;  5KSH A;  5CGS A;  2GX5 A;  1GHI A;  2KX6 A;  4MMN A;  5M18 A;  3CWF A;  4S2M A;  1PWG A;  3B3X A;  3PBR A;  3CZD A;  4JXS A;  1K56 A;  3C4O A;  2Y2J A;  4Y5F A;  3Q81 A;  4KQD A;  3K3C A;  1H3Q A;  5HWW A;  4NG2 A;  3VE3 A;  2PBD P;  2J9P A;  3VE4 A;  4WEK A;  3IT9 A;  1ES2 A;  1K57 C;  3T12 B;  3WS1 A;  3T1X A;  1ESU A;  3OPP A;  4HES A;  1GA0 A;  3EGD C;  3IS2 A;  5HL6 A;  5AQ9 A;  4E3K A;  1MWR A;  4GHI A;  2J3T C;  2PR6 A;  2X02 A;  4M4X A;  2J9O A;  4CLC E;  1HD8 A;  3CI6 A;  3O5Y A;  3BQA A;  1BLH A;  1GA9 A;  4X1M A;  4OOL A;  5CEB A;  4E3L A;  2O99 A;  2Q9M A;  5FAP A;  3ZFZ A;  5CRF A;  3G35 A;  1NLZ A;  3LR3 A;  4K08 A;  4L9G A;  5CX7 A;  4P6Z S;  3DTI A;  1ONH A;  2V1A A;  1ODV A;  3MF0 A;  2ZC3 B;  2J80 A;  1WYC A;  3IH8 A;  4IJG A;  5L07 A;  4S2L A;  3FC7 A;  4O01 A;  1WYB A;  1F2K A;  2VGK A;  2OWH A;  3SS3 A;  3PBN A;  3Q7Z A;  3ZG0 A;  1I2W A;  4FUW A;  4KZ7 A;  1S1Y A;  4XT2 A;  1YMS A;  5DTK A;  4PHT A;  3NUL A;  3O88 A;  1FIL A;  2DCF A;  4HNB A;  4GD6 A;  3BRM A;  3UDX A;  3F1N A;  4RX3 A;  5DF7 A;  2WKR A;  4R6L A;  1RP5 A;  1PZO A;  2E8I A;  5G4Y A;  1A0K A;  3LIF A;  1W8Q A;  1T1B A;  2VX8 A;  2C6W B;  2QPN A;  2HDQ A;  3DWK A;  1M6K A;  1ACF A;  3DTE A;  2FH5 A;  4N9L A;  1S1Z A;  3F1O B;  1KE4 A;  5DJT A;  5GLB A;  4JKT A;  4S2N C;  1TEM A;  1BLS A;  2G2W A;  2AVX A;  5DTS A;  4WMC A;  1IOU A;  3IF5 A;  3MZE A;  1CK3 A;  4WZ4 A;  1NRJ A;  1NY0 A;  4UEY A;  3K3D A;  2W3F A;  1DJA A;  3Q7V A;  5CGX A;  2JKG A;  4OQG A;  2Z6D A;  4S2K A;  4BWI A;  5TGF A;  3N6I A;  5G18 A;  2HP6 A;  4I38 A;  2Y2N A;  1UWN X;  1XFN A;  1XJ3 A;  3HLB A;  2WKH A;  1TVF A;  3W2Z A;  1BTL A;  3F1N B;  2B5R A;  1W7F A;  3A0R A;  3B42 A;  1NZU A;  3MXQ A;  4X6T A;  5EVI B;  1K6S A;  1IEL A;  2C5W B;  5FQQ A;  3GMW A;  1YLZ A;  4HY8 A;  1S67 L;  5DTT A;  2IWC A;  3G2Z A;  2ZM0 A;  3WS0 A;  3Q07 A;  2ZQ9 A;  2W3D A;  1L0G A;  1D1J A;  3LI8 A;  1MC0 A;  1ERM A;  1YMX A;  2V9A A;  2GJ3 A;  2V20 A;  1HZO A;  2VGJ A;  2ZOH A;  1U60 A;  4H8R A;  4K0X A;  5HPI A;  4FH2 A;  2Y8H A;  1FOF A;  3ITB A;  2JKT M;  1ZG4 A;  1OJG A;  3B47 A;  3B33 A;  4JXG A;  1TS6 A;  3PBT A;  1YLT A;  5HFO A;  3ZVW A;  3L9K A;  1OPX A;  3JYI A;  1EW0 A;  2ZM8 A;  3T4L A;  2WYX A;  4ZDX A;  4UA6 A;  3V39 A;  3P09 A;  3H7W B;  2HF6 A;  1GSW A;  3F1P B;  1H8M A;  1WA9 A;  3VOL A;  3UE6 A;  3ISG A;  1XA7 A;  2P9V A;  4B93 A;  3S7O A;  3OPL A;  5I5L A;  2VLG A;  4AFI A;  4WEL A;  3DTK A;  1O07 A;  4Y7P A;  5E2F A;  5HAP A;  4E04 A;  1BYW A;  1OTD A;  4HBT A;  5MC7 A;  4E3N A;  4O0P A;  4O7D A;  1ZC2 A;  3OCL A;  4PM8 A;  3P98 A;  3PHY A;  1H0M A;  2HJ9 C;  3NCK A;  4MCW A;  2DMW A;  5D3O A;  1KVL A;  3SS4 A;  1E3U A;  4IBR A;  3D9Y A;  2PYR A;  5FEF A;  4MLL A;  5FEG A;  2EX2 A;  2XGN A;  3CUE C;  1OT6 A;  1ES3 A;  3LYX A;  3NDG A;  4BMW A;  1J3W A;  4I3J A;  4GCZ A;  1XGJ A;  4EXO A;  3BFF A;  2BLS A;  1T18 A;  5CEC A;  1NWZ A;  3GDI A;  4MN6 A;  3WRZ A;  1BUL A;  3GTC A;  4F94 A;  3IQA A;  2JKT I;  2WAE A;  3MQ0 A;  4DE3 A;  4MBF A;  3MZD A;  3BM6 A;  5FAO A;  3C7V A;  1PRQ A;  4OQI A;  3OBF A;  3S4X A;  4PPR A;  1YLY A;  3WS4 A;  4JF6 A;  4KUO A;  1XJ4 A;  4WZ5 C;  3U4L P;  1ZHH B;  4R0Q A;  3N8R A;  1W63 M;  4QD4 A;  4FH4 A;  4NXG A;  2XFS A;  2M1C A;  2WKI A;  2QHK A;  2EXA A;  4BQM A;  4JPM A;  3S7Q A;  2W27 A;  3JPU A;  3GVB A;  4G3W A;  3BEB A;  1K55 A;  3WRT A;  2V8F A;  3HLC A;  4PKY G;  5GLA A;  4B9O A;  1CEF A;  1CF0 A;  3OLO A;  1N9O A;  4HI4 A;  1VB6 A;  4UQI S;  1RCJ A;  3ZHH A;  1O7E A;  4ID4 A;  2PDR A;  2XDM A;  3IWI A;  2XF3 A;  5EPH A;  1D7E A;  3LIA A;  1MZU A;  2QKP A;  1K25 A;  4Z9Q A;  2ZQ7 A;  3H9W A;  3UE1 A;  5JYO A;  2DNS A;  3PYP A;  2Y2K A;  3EEH A;  1BLC A;  5E2H A;  4KZA A;  4DXB A;  1IYO A;  1JTG A;  3M2J A;  4EUZ A;  1NYY A;  3C30 A;  4JF4 A;  5EVI D;  3MQO A;  3W8K A;  1MY8 A;  4U0T A;  2INW A;  4ZJ2 A;  3RXX A;  4KZ5 A;  5IU1 A;  4ZTK A;  4OPY A;  1Q2Q A;  5L2F A;  3GRJ A;  3A3F A;  4Y13 A;  3TJZ C;  4OVD A;  1XKZ A;  4U3T A;  2IA2 A;  1XA1 A;  2PYP A;  5FSR A;  2HDS A;  1LL9 A;  4WF0 A;  2XD1 A;  2JBF A;  1V9Y A;  2V1Z A;  2RL3 A;  2J3T D;  5DFX A;  3BLM A;  2CC1 A;  4IUH A;  3BY8 A;  3WS2 A;  3E0Y A;  4B88 A;  1EI5 A;  3VP3 A;  2Z2L B;  1FR1 A;  5HD5 A;  2R9X A;  4IED A;  3V5M A;  4E3I A;  3UPN A;  1K57 A;  3T4J A;  4OKP A;  4YNR A;  3LY3 A;  3O86 A;  1L0F A;  5J4E A;  1IYQ A;  3D4F A;  1Q2P A;  1K6R A;  4QWO A;  3C38 A;  4R3J A;  3MKF A;  2K7S A;  3BFD A;  2P7J A;  2WZX A;  3S7P A;  3HLW A;  4BBV A;  2VJW A;  4E3O A;  4LEN A;  3UPO A;  4IUK A;  4YFM A;  4EQI A;  2P04 A;  5EUA A;  1PW1 A;  1IFQ A;  3RTY A;  3ZG9 B;  4R23 A;  1VEU A;  3N7W A;  3UE3 A;  2BTF P;  4QU3 A;  4S2O A;  1IYS A;  3G2Y A;  5EVI A;  3Q1F A;  4KZB A;  3UN7 A;  2QYB A;  1PFL A;  4F3L B;  5EEC A;  3C2W A;  4LCM A;  1JTD A;  2PR5 A;  2ZL1 A;  4QPR A;  4PM9 A;  3HUN A;  2Y55 A;  2I9V A;  1PYY A;  4UHU A;  1YKD A;  1SDN A;  5KSC A;  1Y54 A;  3JVV A;  5CHU A;  1NXY A;  3UB7 A;  1UGU A;  3M2K A;  4E6W A;  3KSH A;  4HJ4 A;  2W3H A;  4OLG A;  1DY6 A;  1MKI A;  2PAV P;  1LI0 A;  2ZL1 B;  1PZP A;  4EEP A;  5GLD A;  5GHZ A;  1SKO B;  1DJB A;  3NOU C;  2ZMV A;  3FWL A;  2OAP 1;  3A3J A;  3IX4 A;  2OLV A;  1MPL A;  3LR0 A;  4N92 A;  4O8G A;  3ZNT A;  4NKP A;  1VHM A;  4UAA A;  4DJ2 A;  4ARZ A;  1L0E A;  3NC8 A;  2BG1 A;  5HWV A;  2WZZ A;  2HPB A;  4KQR A;  2PU2 A;  4S2N A;  4UQI M;  5FA7 A;  2NUP C;  2ZM2 A;  2V0W A;  3HLG A;  4G3V A;  4HH3 A;  4JGR A;  5A8B A;  4GLQ A;  1NJ4 A;  4CLC D;  2IWD A;  3QHY A;  4CLC A;  3IWO A;  1PNE A;  1SZV A;  2Q9N A;  2XA7 M;  5FQJ A;  5HD3 A;  4X1L A;  4EQ1 A;  3BJN A;  2WKE A;  5CTM A;  3QNC A;  5GL9 A;  2HP5 A;  3UPP A;  1BLP A;  2Z2M B;  2O0Y A;  3S7N A;  2EWV A;  3G32 A;  4LV0 A;  4MEZ A;  3LIC A;  4DXC A;  2JE5 A;  1OJ5 A;  5CHJ A;  5F5Y A;  5GLC A;  3UB6 A;  4GD8 A;  3UDI A;  4WEJ A;  3L7H A;  3FV7 A;  5F82 A;  1XP4 A;  3GSG A;  4XUX A;  4GHI B;  5A91 A;  4EUV A;  4MBK A;  2W1T B;  5EVE A;  1KE0 A;  3QP2 A;  5F83 A;  3E98 A;  3G6O A;  3HRE A;  4PMA A;  2ZOI A;  1GHM A;  4MN5 A;  1AWI A;  3OPR A;  4C3Q A;  1T19 A;  3UMD A;  5FAT A;  2D01 A;  2E8J A;  5EM1 A;  3D72 A;  3MMH A;  1MWT A;  4OLD A;  4RQ9 A;  1PW8 A;  4ZAM A;  2W0N A;  3VSL A;  4ZBE A;  4KG6 A;  4JGP A;  2H0Y A;  3I7J A;  5FI7 A;  4HQA A;  5FQK A;  1H5X A;  4OPZ A;  4E3M A;  1TS7 A;  4QY5 A;  3UDF A;  3LI9 A;  3EQV A;  2UWX A;  1I2S A;  1DP9 A;  2MJ6 A;  2ZJ9 A;  4FOF A;  3TW8 A;  5F68 A;  5LBR A;  2OLU A;  3ZQ5 A;  5HDS A;  2EWW A;  1GCE A;  1VM1 A;  2Y91 A;  3O87 A;  4E6X A;  3R7W A;  1ES5 A;  1H8Y A;  3QP4 A;  1N9L A;  5IT5 A;  3IH9 A;  4UA9 A;  1N9B A;  3W4O A;  5KMW A;  2QJ7 A;  3IBJ A;  1JWZ A;  3FPW A;  5M19 A;  3ZG7 B;  3PR6 A;  2Y2P A;  5AVE A;  2JKF A;  4RX2 A;  2B95 A;  4GB7 A;  4CJN A;  4WMC D;  4X68 A;  5FAS A;  5E43 A;  3UE0 A;  2J8Y A;  3C4P A;  2ZQC A;  2Y59 A;  4Q0I A;  2LB9 A;  3SH8 A;  4HP4 A;  3IWQ A;  3HLF A;  4XUZ A;  3IX3 A;  3IHA A;  1K4F A;  2XSS A;  2KOI A;  2HJE A;  2ZLY A;  2VZW A;  4WUJ A;  5J8X A;  3V3R A;  3H82 B;  4HOI A;  3UME A;  4GN2 A;  4EWF A;  1WE4 A;  3LIE A;  1W8Y A;  1P0Z A;  2EX8 A;  2O9C A;  4KG5 A;  2V2F F;  5FL3 A;  2A3U A;  1FCN A;  1SKO A;  2QWS A;  5DVA A;  3LID A;  3IXH A;  5EOE A;  2VKS A;  1BUE A;  1FSW A;  4LRX C;  3HL9 A;  4NK3 A;  3W4Q A;  4GJ4 A;  2ZC5 B;  4OH0 A;  1Z09 A;  3LR4 A;  2JN7 A;  5CGW A;  4P6B A;  1C3B A;  3KYQ A;  3MS6 A;  2UV0 E;  1BSG A;  4I3I A;  4EBP A;  5F1G A;  5DF8 A;  5AJG A;  3TOI A;  4FCF A;  2A24 A;  3FG8 A;  3MQQ A;  5HAR A;  2Y2I A;  5E2G A;  4EBL A;  3SZT A;  2EX6 A;  4BBT A;  4EET B;  4NXF A;  2PHY A;  4LCL A;  1P97 A;  4HEF A;  3IXD A;  4GNU A;  5A93 A;  3V50 A;  4DMZ A;  1G6A A;  1X0O A;  1TF1 A;  2Y79 A;  4LV3 A;  3OCN A;  3KX0 X;  3UNW A;  3BW6 A;  1SHV A;  5TBM B;  5TFQ A;  3RH8 B;  1OTA A;  3K2N A;  1PWD A;  3C8C A;  1NZO A;  5HAI A;  5F69 A;  1QME A;  4JGQ A;  3ITA A;  1EWZ A;  2B18 A;  3QP8 A;  4MDZ A;  4R3A A;  3TRC A;  3F1O A;  2ZBB A;  1STZ A;  2R78 A;  4N1H A;  3LY4 A;  2HDR A;  1ZG6 A;  4CLC C;  3PTE A;  3E2K A;  3NDE A;  1LSX A;  3MSH A;  1YAX A;  4RYE A;  5EV0 A;  1K56 D;  3EEA A;  5A90 A;  5HW3 A;  4B4Z A;  2XFT A;  1PI5 A;  1CJF A;  5KZH A;  3NEC A;  4R3B A;  2QZ6 A;  5TJJ A;  2YKF A;  4DJ3 A;  3QP6 A;  4WYY A;  5AQB A;  1ONG A;  4JGO A;  2Z6C A;  3VOZ A;  3KYE A;  3HUM A;  4WLA A;  3HUO A;  1G28 A;  3MBZ A;  3QNB A;  4NET A;  2OAQ 1;  3FZC A;  1MWS A;  3KSI A;  4ARZ B;  4OPQ A;  1TDL A;  5F6A A;  4ME4 A;  1RGY A;  1ERQ A;  4NEE D;  5FAQ A;  2XK1 A;  1YM1 A;  1HTZ A;  4NXB A;  5CED A;  4S2P A;  3FKV A;  1ERO A;  4K0W A;  3EWK A;  2HDU A;  2WKQ A;  2W3G A;  1UWP X;  3E4O A;  4I5S A;  2JKR I;  3KYZ A;  1T1A A;  3BFE A;  1H8Z A;  3BLS A;  2Q0O A;  1S4S A;  2H5S A;  4LLO B;  4IVI A;  2WKP A;  4X69 A;  4CLC B;  2WK0 A;  3SS5 A;  1KVM A;  1LI9 A;  4GZB A;  2Y2M A;  4U0X A;  4IVK A;  3OPH A;  4HJ3 A;  5HDD A;  3FYZ A;  5L8M A; 
#chains in the Genus database with same CATH homology
 4E6W A;  1NY0 A;  4X56 A;  4KZ3 A;  4OLG A;  1DY6 A;  2WAF A;  3VP4 A;  4GDN A;  1DJA A;  3Q7V A;  5CGX A;  4OQG A;  3NBL A;  1MKI A;  1LI0 A;  2G2U A;  3HVF A;  3LCE A;  1PZP A;  4S2K A;  5TGF A;  3ZNY A;  2EFX A;  1NRF A;  3N6I A;  4LV2 A;  5G18 A;  2HP6 A;  4CPK A;  4Y0T A;  2FFF B;  2Y2N A;  3DTM A;  5GLD A;  4BD0 A;  4BLM A;  1K54 A;  4QHC A;  5GHZ A;  3WWX A;  4DDY A;  4OOY A;  3HLB A;  4DDS A;  2WKH A;  1TVF A;  5EVI C;  1IEM A;  1TDG A;  1BTL A;  1DJB A;  3FWL A;  2Y4A A;  2B5R A;  1W7F A;  3A3J A;  3G34 A;  2OLV A;  1MPL A;  4GKU A;  1NZU A;  3M6H A;  2I72 A;  3DWZ A;  2X71 A;  4X6T A;  5EVI B;  1S0W A;  3NIA A;  4N92 A;  1K6S A;  4EV4 A;  1G68 A;  1IEL A;  3ZNT A;  4UAA A;  1KE3 A;  2C5W B;  1L0E A;  5FQQ A;  3GMW A;  4KZ6 A;  3NC8 A;  2BG1 A;  1YLZ A;  3GR2 A;  4OON A;  2WZZ A;  1SKF A;  5DTT A;  2IWC A;  2R9W A;  1FQG A;  5I94 A;  3G2Z A;  3BFG A;  2ZM0 A;  3WS0 A;  3Q07 A;  3ZG8 B;  2HPB A;  2OSU A;  2ZQ9 A;  4KQR A;  1N4O A;  1L0G A;  2DRW A;  2PU2 A;  4S2N A;  5FA7 A;  3IF6 B;  3AGF A;  4UA7 A;  5U47 A;  1IKI A;  3ZGA B;  2ZM2 A;  1ERM A;  1E25 A;  1YMX A;  2WGW A;  1E3U D;  1E4D A;  3CMZ A;  3HLG A;  3RXW A;  2V20 A;  1GHP A;  1HZO A;  2VGJ A;  2OV5 A;  4ZJ1 A;  1U60 A;  2A49 A;  3AGD A;  4H8R A;  3BEC A;  1L0D A;  2ZMA A;  1NJ4 A;  4K0X A;  3GV9 A;  2IWD A;  3QHY A;  4BL3 A;  5HAQ A;  3IWO A;  2Q9N A;  1W5D A;  4R4R A;  5FQJ A;  4FH2 A;  3ITB A;  1FOF A;  4L0L A;  3NY4 A;  2XEP A;  1ZG4 A;  3NI9 A;  2P74 A;  4JXG A;  2WKE A;  5CTM A;  3QNC A;  5GL9 A;  3UY6 A;  2HP5 A;  3UPP A;  3PAG A;  1BLP A;  4R4S A;  2Z2M B;  4GDB A;  3PBT A;  1KGG A;  1YLT A;  2XQZ A;  1K4E A;  1ES4 A;  5HFO A;  1AXB A;  3G31 A;  3ZVW A;  3JYI A;  4GOG A;  2H0T A;  2ZM8 A;  1PWC A;  2WYX A;  1M40 A;  2WGW B;  4ZDX A;  3G32 A;  4LV0 A;  1XPB A;  4UA6 A;  1KGF A;  3G4P A;  3V39 A;  4MEZ A;  3P09 A;  1YLJ A;  4DXC A;  2JE5 A;  4R1G A;  2JC7 A;  2GDN A;  4K91 A;  2WAD A;  5CHJ A;  5GLC A;  4GD8 A;  3UDI A;  4WEJ A;  5FI6 A;  1BT5 A;  4DE0 A;  3ISG A;  3FV7 A;  4C6Y A;  1XA7 A;  5F82 A;  4DE2 A;  1XP4 A;  3M6B A;  5DF9 A;  2P9V A;  3GSG A;  4XUX A;  4Y0O A;  5A91 A;  3HLD A;  3C7U A;  3OPL A;  4B4X A;  4MBK A;  3DW0 A;  1S6R A;  4P85 A;  1KE0 A;  2JCH A;  4M3K A;  4P0M A;  4EBN A;  4WEL A;  3A3D A;  5F83 A;  1O07 A;  4Y7P A;  3HRE A;  3MZE A;  4PMA A;  5E2F A;  3HLE A;  1YLP A;  1GHM A;  4Q8I A;  3OPR A;  5HAP A;  2IWB A;  4HBT A;  4C3Q A;  3N8S A;  3E2L A;  4E3N A;  3PBO A;  5FAT A;  4O7D A;  1ZC2 A;  3MXS A;  3MZF A;  3HBR A;  3OCL A;  3OC2 A;  5HX9 A;  4PM8 A;  2P9V B;  1MWU A;  1RGZ A;  3P98 A;  2Y2O A;  1CI8 A;  4OLD A;  1MWT A;  4ZAM A;  3NCK A;  1PW8 A;  1HVB A;  5FQM A;  3VSL A;  5EOO A;  5BOH A;  5D3O A;  1KVL A;  4ZBE A;  5FI2 A;  1FR6 A;  4C75 A;  4KG6 A;  3Q7V B;  4KQQ A;  3SS4 A;  2H0Y A;  1E3U A;  3VFF A;  3PBQ A;  5CTN A;  3I7J A;  5FI7 A;  3GQZ A;  3UO9 A;  4IBR A;  2EXB A;  5FQK A;  1H5X A;  3FKW A;  1XGI A;  5FQI A;  2ZD8 A;  4MLL A;  4OPZ A;  1PI4 A;  3VFH A;  4E3M A;  2EX2 A;  4JXW A;  1VQQ A;  4QY5 A;  3UDF A;  2XGN A;  3EQV A;  3IF6 C;  2UWX A;  2RCX A;  1LL5 A;  1I2S A;  1W79 A;  1FCM A;  2ZJ9 A;  5A92 A;  1ES3 A;  4X55 A;  3VOY A;  2OLU A;  1BZA A;  2FFY A;  2XH9 A;  3NDG A;  2XD5 A;  1GCE A;  1VM1 A;  4BD1 A;  2Y91 A;  4DE1 A;  3AGE A;  3O87 A;  4E6X A;  1ES5 A;  1H8Y A;  1SCW A;  2Y2G A;  1K55 C;  1K54 C;  1YT4 A;  5GHX A;  1JWP A;  4JXV A;  1XGJ A;  2PU4 A;  3BFF A;  3IH9 A;  4UA9 A;  2ZC4 B;  1N9B A;  3MXR A;  5CER A;  4DKI A;  3W4O A;  5KMW A;  1JWV A;  2BLS A;  1JWZ A;  5CEC A;  3RJU A;  3WRZ A;  1QMF A;  5CXW A;  1BUL A;  3GTC A;  4F94 A;  5M19 A;  3IQA A;  4OQH A;  1Z6F A;  3ZG7 B;  3ZVT A;  2WAE A;  3ZCZ A;  4RA7 A;  4JF5 A;  2Y2P A;  4S2I A;  4DE3 A;  4MBF A;  4S2J A;  1DJC A;  1MXO A;  4RX2 A;  4BEN A;  3MZD A;  3BM6 A;  3C5A A;  5FAO A;  3C7V A;  4GB7 A;  4CJN A;  1ZKJ A;  4OQI A;  3IF6 A;  4WMC D;  4JLF A;  4X68 A;  5FAS A;  4WBG A;  3S4X A;  3A3E A;  5E43 A;  3UE0 A;  4PPR A;  2J8Y A;  3C4P A;  1YLY A;  2ZQC A;  2Y59 A;  3VP0 A;  4JF6 A;  3SH8 A;  3WS4 A;  3IWQ A;  3G30 A;  3HLF A;  4XUZ A;  2QMI A;  3IHA A;  2WGI A;  4KZ9 A;  4WZ5 C;  1K4F A;  4R0Q A;  4OP5 A;  4A5R A;  3N8R A;  1SDE A;  3BFC A;  4QD4 A;  2ZLY A;  2XLN A;  5J8X A;  4FH4 A;  2XFS A;  4KZ4 A;  3V3R A;  1XXM A;  2WKI A;  4GN2 A;  2EXA A;  4BQM A;  4JPM A;  4P87 A;  4MBH A;  4EWF A;  3ZDJ A;  1WE4 A;  4LV1 A;  1W8Y A;  3GVB A;  2EX8 A;  3BEB A;  3BYD A;  4KG5 A;  1FSY A;  1K55 A;  1PIO A;  1K38 A;  2V2F F;  2WGV A;  4N9K A;  5EE8 A;  4BL2 A;  3N8L A;  4HBU A;  2A3U A;  3V3S A;  1FCN A;  3WRT A;  4QJG A;  3HLC A;  5GLA A;  1CEF A;  4PM7 A;  4FSF A;  5DVA A;  1OME A;  3SH9 A;  3CJM A;  4QY6 A;  4MNR A;  1XX2 A;  3S22 A;  3IXH A;  4FD8 A;  5E2E A;  4OQ0 A;  5EOE A;  1BUE A;  1FSW A;  5M1A A;  1RCJ A;  4PM5 A;  2HP9 A;  4RVA A;  3HL9 A;  3ZHH A;  4NK3 A;  5KSH A;  1O7E A;  3W4Q A;  5AQ7 A;  2ZC5 B;  1I5Q A;  4OH0 A;  5CGS A;  4ID4 A;  4ZJ3 A;  2XDM A;  3IWI A;  3O3V A;  2XF3 A;  5CGW A;  5EPH A;  4P6B A;  1GHI A;  1K25 A;  1C3B A;  5M18 A;  4S2M A;  4Z9Q A;  1ESI A;  4D2O A;  2ZQ7 A;  4KQO A;  1PWG A;  3B3X A;  1BSG A;  2ZQA A;  3PBR A;  3UE1 A;  5JYO A;  2DNS A;  3CZD A;  4EBP A;  5F1G A;  5DF8 A;  2Y2K A;  3TOI A;  4JXS A;  4FCF A;  1BLC A;  5E2H A;  4KZA A;  3MFD A;  4DXB A;  1IYO A;  1K56 A;  5HAR A;  1JTG A;  3C4O A;  2Y2J A;  2Y2I A;  3M2J A;  3Q81 A;  5E2G A;  5TR7 A;  1NYM A;  4EUZ A;  1NYY A;  4EBL A;  4JF4 A;  5EVI D;  4IBX A;  2EX6 A;  4N1X A;  3W8K A;  1LLB A;  1MY8 A;  4U0T A;  4ZJ2 A;  3IHB A;  2XR0 A;  2J9P A;  1IYP A;  4WEK A;  3RXX A;  3IT9 A;  1IKG A;  1ES2 A;  4LCL A;  1K57 C;  1KDS A;  4XXR A;  3TG9 A;  4HEF A;  4KZ5 A;  3IXD A;  3IXG A;  4DF6 A;  4GNU A;  5HL1 A;  3WS1 A;  1ESU A;  3OPP A;  4HES A;  4ZTK A;  3WS5 A;  1YLW A;  1GA0 A;  1CEG A;  3V50 A;  4E3J A;  5A93 A;  4OPY A;  1MBL A;  1G6A A;  3MKE A;  1Q2Q A;  5L2F A;  3GRJ A;  3A3F A;  5AQ9 A;  4LV3 A;  4E3K A;  3OCN A;  1MWR A;  2Y2Q A;  3UNW A;  5FDH A;  3OZH A;  3N4I A;  1SHV A;  4OVD A;  1XKZ A;  4U3T A;  2X02 A;  4OOM A;  5TFQ A;  2J9O A;  1XA1 A;  5FSR A;  1HD8 A;  2HDS A;  4QB8 A;  1BLH A;  4X53 A;  1LL9 A;  1PWD A;  3LEZ A;  1NZO A;  1GA9 A;  5HAI A;  2XD1 A;  1QME A;  4OPR A;  3ITA A;  2JBF A;  4OOL A;  5CEB A;  1EWZ A;  4E3L A;  2V1Z A;  2X01 A;  2Q9M A;  3VMA A;  2RL3 A;  5FAP A;  3ZFZ A;  4Y0U A;  1KGE A;  3BLM A;  5CRF A;  2CC1 A;  3VSK A;  3G35 A;  3VP1 A;  4N1H A;  5JYP A;  3LY4 A;  3WS2 A;  3SH7 A;  4B88 A;  1EI5 A;  1LHY A;  2HDR A;  3VP3 A;  1ZG6 A;  2Z2L B;  1FR1 A;  2ZQ8 A;  3PTE A;  2R9X A;  1ONH A;  3E2K A;  3NDE A;  4IED A;  3V5M A;  4E3I A;  2ZC3 B;  3UPN A;  1K57 A;  4RYE A;  4KZ8 A;  3IXB A;  1K56 D;  1WYC A;  3IH8 A;  5A90 A;  1KDW A;  4OKP A;  5HW3 A;  4OP8 A;  4B4Z A;  1J9M A;  1PI5 A;  2XFT A;  2EX9 A;  5KZH A;  4R3B A;  4DRT A;  2WUQ A;  4S2L A;  2Y2H A;  2QZ6 A;  3LY3 A;  1WYB A;  1YQS A;  3O86 A;  4WYY A;  1L0F A;  2VGK A;  5AQB A;  1ONG A;  1L2S A;  2H10 A;  1IYQ A;  3D4F A;  3S1Y A;  3SS3 A;  1Q2P A;  3HUM A;  3VOZ A;  5CHM A;  3W4P A;  3HUO A;  1K6R A;  1JVJ A;  2ZC7 A;  4KEN B;  3VP2 A;  4R3J A;  3MKF A;  3BFD A;  3MBZ A;  2WZX A;  3PBN A;  3PBS A;  3Q7Z A;  3QNB A;  3SOI A;  3ZG0 A;  4NET A;  5EVL A;  3HLW A;  5F1F A;  1I2W A;  4KZ7 A;  4E3O A;  4LEN A;  3UPO A;  3Q82 A;  4YFM A;  4EQI A;  3FZC A;  1MWS A;  4JBF A;  4WM9 A;  1YMS A;  5DTK A;  2EFU A;  5EUA A;  1PW1 A;  3TSG A;  3O88 A;  1FCO A;  4OPQ A;  2DCF A;  4GD6 A;  2ZQD A;  4BJP A;  1TDL A;  3BRM A;  3A3I A;  1RGY A;  3UDX A;  3ZG9 B;  4R23 A;  1ERQ A;  3N7W A;  3LO7 A;  5AQA A;  1CI9 A;  5FAQ A;  5FQ9 A;  2XK1 A;  3UE3 A;  1YM1 A;  1HTZ A;  4QU3 A;  4KG2 A;  4RX3 A;  5DF7 A;  4S2P A;  5CED A;  3FKV A;  2ZC6 B;  1ERO A;  4K0W A;  4S2O A;  1IYS A;  3G2Y A;  4PM6 A;  5EVI A;  1RP5 A;  3Q1F A;  1PZO A;  4KZB A;  3UN7 A;  2E8I A;  2HDU A;  5GHY A;  2PBY A;  3PAE A;  5IHV A;  1W8Q A;  2J7V A;  2C6W B;  5EEC A;  2QPN A;  3BFE A;  2HDQ A;  3DWK A;  3EQU A;  1ALQ A;  1H8Z A;  1M6K A;  3BLS A;  3CG5 A;  1JTD A;  4LCM A;  2H5S A;  4IVI A;  4X69 A;  2WK0 A;  4N9L A;  3SS5 A;  1KVM A;  4PM9 A;  1KE4 A;  3HUN A;  2Y55 A;  3ZG5 A;  5GLB A;  4JKT A;  1LI9 A;  1PYY A;  4GZB A;  2Y2M A;  4S2N C;  4UHU A;  1TEM A;  4WZ5 A;  4U0X A;  1SDN A;  1BLS A;  2G2W A;  2Y2L A;  5DTS A;  4WMC A;  1Y54 A;  5KSC A;  4IVK A;  5CHU A;  3OPH A;  4YIN A;  3IF5 A;  1NXY A;  3FYZ A;  1CK3 A;  3M2K A;  4WZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...