1BVVA

Sugar ring distortion in the glycosyl-enzyme intermediate of a family g/11 xylanase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
185
Chain Sequence
b'ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Sugar ring distortion in the glycosyl-enzyme intermediate of a family G/11 xylanase.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 51
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1bvvA00
1OA2A 4HKOA 2VUJA 1OLRA 4HKLA 5K7PA 4HK9A 4HK8A 5HXVA 1M4WA 3MFAA 3VL9A 4XQWA 3ZSEA 2NLRA 3VGIA 1HV1A 3WX5A 3HD8B 4XPVA 2B45X 5EJ3A 3VHOA 4H7MA 1ENXA 4S2FA 3WXPA 1H0BA 1UU5A 2JEMA 3VZNA 4XQDA 1F5JA 2Z79A 1HIXA 3VZLA 2VULA 1BK1A 3VLBB 3VL8A 3RI9A 3O7OA 3MF6A 1UU6A 1XNCA 3WY6A 1QH7A 3WP3A 1XNBA 3EXUA 2DCJA 1PVXA 1REDA 3MFCA 1UKRA 3WR0A 3AMNA 3B7MA 3AMMA 1BVVA 2BWCA 2QZ3A 3AKSA 1OA4A 1XNDA 2DCYA 4NPRA 5K9YA 3VHPA 2B46X 1TE1B 1QH6A 2DCZA 3WQ7A 2F6BA 1AXKA 3B5LB 1HV0A 2B42B 3WT3A 3AKQA 1C5IA 1REEA 2BW8A 1XNKA 3WQ0A 2DCKA 3AMQA 4S2GA 1H8VA 2C1FA 3VZOA 4S2DA 3AMHA 4HKWA 3AKPA 4S2HA 1NLRA 3VHNA 3AKRA 2D97A 3VZKA 3LGRA 1XYNA 2JENA 1OA3A 3WP5A 2D98A 2BWAA 1H4HA 3WP6A 1XXNA 4XQ4A 1W2UA 1KS4A 2BVVA 1C5HA 1UU4A 2DFCA 2QZ2A 1IGOA 1YNAA 3WQ1A 3M4FA 4IXLA 1XYOA 1BCXA 1XYPA 1REFA 2JICA 3AKTA 3MF9A 1OLQA 1T6GC 3LB9A 2VG9A 3VZMA 3AMPA 1H4GA 1H1AA 3VZJA 2NQYA 1KS5A 3RI8A 2VGDA 3WP4A 2DFBA
chains in the Genus database with same CATH superfamily
1NCQB 4FBFA 1R093 3MV01 4BMEA 1S0JA 4HN0A 3POEA 3H3UA 1MEC2 3DKWA 3SCHA 3CJIA 3K46A 3OBAA 5FYSA 4K40A 3A0KA 3OJBA 1CZTA 2K9ZA 1AXZA 4JAAA 5IHRA 2WAOA 4CCNA 2DVFA 4DNYA 1H2KA 2GMEA 4KGQA 2OIIA 1TQ5A 3VBFA 3W58A 3ZSLA 5FCCA 5FYYA 3H42B 3MW3A 4CXXA 2DU1A 1SHWB 2QQOA 1F5JA 4QPIA 5EJ1B 3WV6A 1C8M1 2XJRA 4YW1A 2HBUA 3E5UA 3GGLA 5FYZA 5JLVA 2DVGA 4BQ2A 4WVWA 3ZYBA 1NX9A 4WBBA 5KXDA 2XWJB 1AR91 5F6KA 4UF0A 1LHVA 3ZIXA 3AX4A 4LE4A 3ZXEA 3H8UA 1LCLA 2J1EA 2XMLA 3VD3A 5FZCA 5BNPC 5FPUA 3HR9A 3WG3A 4ARYA 4XBLA 1LGBA 2BPA2 1R1A1 4LNVA 1JTZX 4LORA 1N1SA 4M3CF 3ZSJA 3KV6A 4ISRA 3EHKA 4CEWB 1E5SA 5BNOA 5FMDA 1UY4A 2A6ZA 4LIUA 4CDXC 2NMOA 2PLV1 4XFAA 2GH2A 2J1SA 3B69A 4XYXA 2RM21 4F7ZA 5JZGB 4QPGC 2V09A 3AXEA 2YFUA 1H8TC 3B94A 4D6RA 2VJXA 3KS7A 4JKMA 3EJKA 3OY8B 3OPTA 5J1XA 1WD4A 2VW0A 2ZX3A 3APBA 1G8WA 4PI2A 3FX3A 4JV4A 1UX6A 3Q8EA 2YGLA 1OHFA 2ZHNA 1NY71 1ZBE2 2B5HA 2J1RA 4BMBA 4DEQA 2G9ZA 2VD7A 1HB1A 4CP1A 3AKPA 3SEPA 2QQPA 3BU0A 1J84A 2R072 5FZIA 2JB4A 3AXDA 2A6WA 4XMAA 4C0BA 3PHMA 3ZXLA 2RR13 4OHYA 1F4HA 1FI2A 2E7AA 5AVAA 5FUPA 3BALA 3RZGA 1GOGA 4BIFA 4Y3OA 4PIZA 4M3CA 2D6OX 4PDWC 4CEYA 3IT8A 4RFRB 1OSGA 2GNBA 3GZAA 4KMQA 4XDOA 2WNVC 3SH5A 2JX9A 2VMHA 1Y9GA 2PFWA 3OCPA 4AEDA 1WLCA 2HEVF 1ZBA2 2QDRA 1YC61 1DGWA 4PF1A 2JDKA 2WO2A 4ASLA 2P6HA 5GLTA 1FATA 3M3IA 4J6GA 1T6GC 4PI0A 1D4M1 1PIV2 1SCRA 3A7QA 4BLJA 1IS3A 3V0AA 2YG0A 2VXRA 1YI7A 2VQAA 2WJSA 3OGGA 3ILFA 1QXPA 4D0QA 4A7ZA 1U0AA 1BBT2 2WT1A 5DZGA 4BA6A 1ZZ8A 2WZR1 1W9YA 5FUIA 4IEWA 5T5JA 2VBBA 3WQ7A 3AYAA 4C0HA 4BJ0A 1GV9A 5FREA 2C6SA 4KQ7A 1O91A 1BMV1 3HQRA 1V9U1 3HT1A 1RHI3 2UWBA 5DPNA 5IW0A 5FP9A 3AC0A 1QMJA 3NQHA 1A8MA 3MLKA 4FOWA 2C4XA 2DTYA 2VW1A 3LPGA 4Y20B 4FOVA 4E2QA 5IVCA 1Z7S3 2RDRA 2PXJA 4AVVA 5ERLA 3W59A 5ACA2 2P6CA 5JOXA 1ZREA 2WWSA 3U75A 2JECA 1NCQA 5J48A 1DQ1A 1SZBA 4AEMA 2Z79A 4LULA 1RUD3 3POGA 3LDKA 4M0NA 1PVC1 2XVKA 2RS31 3ES1A 4YZ2A 5AVPA 1GOFA 2JG9C 5JIUA 4O65A 1QH7A 5F5QA 1G9CA 4CP9B 5FP8A 1VBB3 2GSYA 3UGHA 2BNMA 4OLLA 2ZGRA 2WQ4A 4COVA 2WLPA 3PJYA 2LALA 4RR3B 3JU9A 4JQRA 1NCRA 5JPMB 2CGOA 3WW4A 2D40A 2X5IC 1YJLA 1RUH2 5IT6A 1PO23 4INDA 1MEC1 5JOZA 3ZFFA 1MVEA 3MIEA 3I97A 5IVBA 2VUAA 1QJU2 4OULA 5IJRA 3K77A 4F8AA 2IFWA 3KF5A 5GALA 3D0JA 1LHNA 3AJZA 1FV2A 1D0HA 4A2UA 1AR82 2VE1A 1W99A 4YM3A 5IATA 2PHTA 2Y6GA 2GP3A 3VKFC 1REEA 3URFA 4C1WA 4JGZB 3CJIC 3WW1A 1RVF2 1WLDA 4AL9A 4LO6B 1AJKA 1A78A 1FMD3 1W6NB 2WC2A 4UI9L 4MGKE 5DAVA 1QIQA 4CSWA 1KRIA 1AR63 4CP2A 4CEWA 5FQ0A 2R16A 1AYN2 3VBFC 1GANA 4CCEA 1UWWA 3BYWA 4ES8A 3E97A 5FMBA 4QX8A 1O59A 3KV9A 4RYDA 1OBNA 3S7IA 3WNKA 5JZGA 4IQPA 1ULOA 2D97A 4PBPA 4XIKA 4QPIC 1O5UA 3RS6A 1Q43A 2J1AA 3OGVA 4FPCA 3OY8A 4HVOA 3GM8A 2WS93 5LWBA 3OBTA 4XFCA 4E2SA 2RMU2 5A3PA 2ET7A 3FLRA 1Y3TA 3B9IA 3NKTA 3RG0A 3FBMA 2G19A 5JSRA 1OOPB 1GBGA 1RC6A 2B39A 4IE7A 4IEQA 4RL7A 4LTAA 1XNAA 2FDFA 1BK0A 4BQYA 1QXRA 2OQ7A 3QH6A 2IWGB 1RUF2 5FO7B 5A7NA 1OFNA 4GAZA 1BCXA 4Y26A 5I0RA 5JIAA 4BK4A 2P1BA 2WNOA 3JZVA 2VU9A 3KF3A 1BXHA 2D6NA 2ZGKA 3M3EA 3N4MA 3ZO0B 5BNOC 4EWDA 3LB9A 3UJQA 1NOVA 1PMHX 4IDZA 4YG6A 1DQ0A 4EQVA 2AEZA 5A33B 4R52A 4IEYA 1POV0 5CIRA 5CZKA 1H2MA 1ZBE1 1GWLA 4R4ZA 5DN2A 3J4UH 1AYM3 2NYYA 2QQVA 3K4ZA 4HVRA 4ARXA 3ILRA 1QJY3 1EPZA 3I3BA 2R071 5IK7A 2QKDA 2VZOA 5FP4A 4FOYA 2FQPA 4IGPA 4N9IA 3ZN5A 1HRV1 4AXOA 3RQ0A 5K7PA 5FYTA 4ZU4A 1DLCA 1UN1A 5FZ9A 4GKYA 2Q1MA 2VVEA 2Q8CA 4AW7A 5KC5A 1ASJ1 1US3A 2AC1A 4A44A 4COZA 4QXBA 2E53A 3WSOA 2O14A 4Z1VA 1IPKA 1H9PA 3H7YA 2UY9A 4BZ4A 1HW5A 1O7FA 2ARCA 2ZX2A 4YARA 5L73A 5HV4A 1UU5A 4FFFA 3LEMA 1ZBA1 2JIGA 4XHXA 1R092 5F5CA 2HWD1 4QHBA 2GC1A 1C4RA 4HG6B 4CEYC 5FLJA 1PIV1 3EB7A 3FE5A 2DUOA 4UWDA 5IK8A 2VUDA 3HNYM 2FDIA 3POFA 5IVJA 3O5SA 2YBPA 3RDIA 2ZJCA 5JAXA 1FAYA 4GB32 3VDDB 4P9GA 4AEDC 5C33A 5KHJA 3H8XA 1BBT1 1QJX1 4Y20A 3ZXKA 3LA3A 4UW4A 3JQWA 5C8WA 2DVBA 1LU2A 2OKXA 2RHPA 2VZTA 3TYJA 2ZMNA 1B35B 1LENA 5FYVA 2QZ3A 3NV1A 2JKXA 3PDQA 4YFZA 5FDBA 3C7GA 2JDMA 5F3GA 5FLHA 4ZXKA 4CU6A 1Q3EA 2BYVE 1ZRCA 1WW4A 2VMCA 5ANNA 4JKLA 4YLZA 1HRI3 2Q30A 4CP9A 2DTWA 3WDUA 4BQ1A 1LB2A 2GU9A 2B42B 5ACA1 5CISA 4LUMA 1C5IA 2IXIA 4RR3A 4CA9A 1XNKA 1LEMA 4LT5A 5LRRA 3UK9A 3ZYFA 1H8VA 3WW2A 4IV3A 4TN7A 1LHUA 2WZ8A 1YJKA 3PVNA 3U4SA 2YY1A 4AVCA 4UAPA 5A70A 1ND2B 2YPDA 1NCQC 5EXOA 2BOJA 1KXGA 1XYNA 2Y6JA 4OVEA 3ECQA 4O9EA 1WCUA 5FXZA 4AFCA 2ADEA 4DY5A 3ZMOA 2WZR3 2K0GA 2YC0A 1RUH1 4R4XA 2R041 2IXLA 2WA4A 1VIWB 3IMMA 4MYEA 5APAA 2OVUA 5FK7A 3PL0A 2Q8OA 2DYCA 1QJU1 3DYPA 5ANQA 4MSVA 4DZGA 3HNMA 3K3NA 1N3OA 4IXLA 1RIRA 2JDAA 1NCRC 1W9TA 5LA1A 3FFQA 1PNGA 2ZOEB 3MUZ1 4IE6A 1POV1 1Q5OA 3I2KA 3VB9A 2UURA 5F2WA 2EXHA 5IFTA 2XLAA 1V00A 3MDPA 1RVF1 1YFUA 1JW6A 4BLIA 2VVDA 5CFDB 3RYKA 3VZMA 2UWCA 3NAPB 4W65A 3ZDSA 5CYYA 5T54A 2HWF1 4HOOA 3U1XA 1WBFA 4XUPA 3VD7A 2ZX4A 4YGDA 2E9QA 3B3QE 3IAPA 3PTRB 3AYEA 1NQJA 1UIKA 4NR1A 2V73A 5A1FA 3VUOA 1RUG3 2P17A 3VBOB 4X8NA 1LOFA 4B4RA 2J22A 1ND3B 3WNNA 1AXYA 2EIDA 1DGLA 1LESA 2VCAA 2CWMA 4CEWC 5EQUA 5FZOB 2RMU1 2QQNA 1WZXA 3H9AA 3GHNA 1LOGA 1EPWA 1S55A 3MIFA 5JZGC 4BH9A 1QKQA 4JHTA 4ZZ8A 2G1MA 4AI0A 1RUF1 3DGTA 4CUCA 5F3CA 2BVBA 4E4DX 4LBNA 1RHI2 5FPLA 3O1SA 3KHCA 2CYFA 1W6MB 5H9PA 1L7RA 3PJQA 5I0UA 1JUHA 3AZYA 5JOWA 1Z7S2 3WP3A 2YYOA 2GC2A 1XE0A 1REDA 4G4FA 4XFHA 4F83A 5LEKA 1OD5A 4NAMA 3O1RA 2A6XA 3AM2A 4HFSA 1OXCA 3UETA 1JUIA 4QHZA 1RUD2 2W1WA 3NSTA 3PMEA 3R0RA 4CDQB 4CYDA 1EUUA 2QNKA 1IKPA 4N8MA 1RMU3 5AFEA 4B3NA 3UGFA 2W9XA 5JOYA 4FXGB 3ZXDA 1VBB2 4XUOA 3J8F1 1N47A 3P3PA 1ULGA 1OVPA 3USUB 4XBQA 3VDDA 3G6JB 5G05L 2D3RA 1YEWA 3PUIA 4XFFA 1N1VA 1OF3A 2LM3A 2WWUA 2OPKA 2JIJA 3O12A 3I3DA 3L9JT 1B35A 1PO22 1DZTA 1WW7A 3TNPB 2JE8A 1W0OA 4I0WB 4RQPB 5FZGA 3VDAA 4A7YA 3OUHA 1W28A 2VNGA 3HWJA 4K9SA 1HXS3 4KWLA 4X8PA 1WCQA 3JUUA 3RZZA 3ZN6A 5FKCA 3THPA 3DV8A 3AP4A 4NJ4A 1TNFA 2QQKA 4HXCA 1OFSA 1DGWX 5DZEA 1WWYA 3B9CA 4NWWA 1ZZ6A 1AL23 1CIWA 1C28A 1FMD2 1LKNA 2IXHA 5FY7A 1VBD2 1T6BX 2BBVA 1SLTA 4XF1A 3HN1A 4I01A 4RS5B 4QPYA 1AR62 3HOBA 4AHXA 5GJ6A 1UU4A 3RSJA 1UYYA 4XEZA 3ZKUA 1IGOA 1U5XA 2WSUA 4N9HA 4A4AA 1UYPA 3KMHA 1CJPA 3CZUA 2XJQA 2QFEA 3LFMA 4KU7A 4O61A 4XF4A 1ND2A 1REFA 2GNMA 1XE7A 3UYJA 2Y6KA 3SCFA 3MIDA 3MF9A 3O0WA 5A6QA 5HXMA 4XVHA 3O1OA 1NUKA 1SLIA 2MEV3 5EPAA 2WS92 3I54A 3OPZA 4YGCA 5LASA 1YLLA 2TEPA 3AMPA 4NPLA 4CCJA 1X8EA 2BV4A 2E6VA 2VZ1A 3KCCA 1GP5A 3VBRB 2WINB 3LIHA 2HWD3 3AVRA 3GXUA 4Q4Y1 4XAEA 2DF7A 4C8DA 4LK6A 3CBNA 4UFHA 4PQQA 4EN8B 4RR3C 5DDJ3 2XLFA 3ZFGA 4FTBA 4OHWA 2Q1FA 3LWCA 4PBOA 2MNGA 4GALA 5FYBA 4LK7A 2JKBA 2ZA9A 3NKGA 2VPVA 3UKVA 1QJX3 1LODA 4FFIA 1VP6A 4X6QB 5CFDA 4G3YC 4HLTA 5HCFA 3NAPA 2ZX1A 5E16A 4MV2A 5FPVA 1W6PB 2XR4A 3MZHA 4CDUB 4IEXA 2BDRA 1U5YA 2R7EB 1JOPA 4JDNA 5EJ3A 5KHHA 4AVSA 1QJY2 4H7MA 4CPBD 1GKBA 1UMZA 1AX0A 2A6YA 4K20A 4LO5B 4B4PA 2ZEXA 2RR11 4LQRA 4MH0E 3VBOA 3SLIA 1NG0A 2BFUL 1GQPA 5TSWA 3WZ1A 1ND3A 2JDHA 2VULA 1QJEA 4LMFA 3VL8A 5I0DA 4JX0A 2QQIA 1YO8A 5F6LB 1Y9QA 2OZ6A 1G9BA 1RUE3 1VB2A 1XNBA 2ID4A 5A3WA 1QNYA 1VR3A 1XQNA 4GIQA 3JCIA 2AREA 2FDJA 3AL6A 1SFPA 4IERA 5KXCA 4QX0A 4L9BA 3GZUC 2RJKA 1VBC1 2PLV2 5DQ0A 4M4RA 1CAWB 4D94A 3C3VA 3NL1A 2A7AA 3OGJA 1W6MA 1W2NA 2HWB3 5A7OA 2W68A 3GBWA 1JXNA 1W8OA 2W52A 1X36A 5FZAA 5FMOS 1LOFC 1V6OA 2ADDA 4Q1RA 5FYUA 3BGAA 3V0BB 2R043 5JXIA 1NY72 3LOIA 3JD73 2FMDA 3ZVXA 3WQ0A 1YWKA 2W87A 1RHI1 4EWAA 2VQTA 4S2GA 1A34A 4CDQA 5JXGA 1C1FA 1ODNA 2PAEA 4XOGA 3VZOA 4IETA 3N3HA 3VD5A 2O8OA 1S1AA 1Z7S1 4YW6A 1XSRA 5F39A 3K2OA 1KFUL 4DS0A 1AJOA 1NLRA 2VECA 2R0HA 3USUA 1JZ7A 3KQRA 4WVMB 4L11A 2HWF3 3I59A 4U36A 2CSGA 2ZMKA 3D3AA 2ZGNA 4Z92B 5ABJB 1MZEA 3SKVA 5JUVA 4B29A 4KGGA 1JODA 1RUD1 2XQRA 2VW2A 1SFNA 1I3HA 1LTEA 2ENRA 3CQOA 3NVCA 2IXKA 4OZOA 3RVHA 5FR3A 3IMNA 2QE3A 2R6QA 1VBB1 1XC6A 2HEWF 4UW3A 1GP6A 2UWAA 2ARXA 2VMEA 3VV1A 2QJVA 1W0PA 4Y22A 1QOOA 3EQEA 2JICA 3AKTA 5LBEA 5HBAA 4CXWA 5T5PA 4LIVA 2WZR2 5F8PA 4YYOA 4NVPA 1GNYA 4P9IA 1WMFA 3BTZA 2VG9A 4A3XA 2NN8A 2PQQA 2RS13 3WQBA 5L7OB 2ZKLA 1C1LA 5CU1A 3VDDC 1UF2C 3PU8A 1ZA4A 1V9U2 3ZKYA 1OQEA 4CDWB 5AC93 5A3OA 3IPVB 5EHDA 2YXSA 1HB2A 1OUSA 4NIIA 1D7PM 5LRSA 4XABA 4K6BA 4TZDA 4MO3M 1B35C 4GULA 3NWKA 5L36A 4TWTA 4ZPIA 1GICA 1RUC1 1FMD1 4KI5M 5A3TA 2WQZC 1SPPA 1ZX5A 2QVSB 3HT2A 4Y1YA 4EWEA 2ZGUA 1DHKB 3TEZA 5EWSA 1NA1B 3DN7A 4L2NA 2OT7A 3ST7A 3VBRA 5HI0A 3FLPA 1C8NA 1ENXA 1MACA 1RUG2 4Q5OA 2A3XA 1TG7A 3IDCB 3CJXA 2HEYF 5IAXA 1WLTA 4IV1B 3MEPA 3WF0A 4UFKA 3BVCA 3J8F3 1LRHA 2WS91 3NO8A 1XB9A 1CPMA 3WNXA 1OPMA 2W1QA 3DF0A 3JB8A 2OXBA 1NT0A 3LEGA 3NRUA 1MZ6A 1YXWA 3HJRA 1JS9A 1POQA 2DURA 2VZVA 1MZFA 1W6PA 2IVIB 4XE9A 3NJZA 2A70A 3WNMA 1O6UA 3MFCA 1ND2C 4FT8A 4K8FA 4CDUA 5FXVA 3WR0A 1MZ5A 2PQSA 3CNAA 4N53B 5FP3A 4MUVA 2DU0A 4BIOA 2CHHA 3FBYA 5DAQA 2X8KA 3ES4A 1WD3A 5FZ1A 4Z8BA 1YFXA 4Q0SA 4W6XA 1L7LA 3I2JA 1PK6B 4QGNA 5FZHA 2CU5A 2P2KA 3MYXA 5J36A 4M4PA 3KV4A 4Q0QA 1GQHA 3WNPA 3VHRA 2CGNA 4HPKA 1AYM1 2BEOA 1O3QA 2D3SA 3ZFGC 5FPAA 1QJY1 3DKQA 4JRLA 2GMPA 3MLLA 2TNFA 1GWMA 4OI0A 2OS2A 4YFWA 4AHZA 3ELNA 4QAWA 2EICA 1FOD3 5CFDC 2KM2A 1SBFA 3NAPC 1G9AA 3FMGA 4W8JA 3WDYA 2WAAA 5FPXA 3SITA 3AMHA 1GOHA 1IHMA 3P1IA 5HCBA 1IQDC 3T2TA 2LUWA 5FO8B 2ZS6B 4F3JA 4DMIA 4QKFA 3VBOC 3VZKA 1ULDA 5FY1A 3RZMA 1OKQA 3WDWA 4AQTA 3V0BA 1ND3C 2VZRA 3CZJA 3VKOA 2UYBA 1K12A 1PGSA 2LTNA 2ZAHA 4Q4Y3 1OQDA 2BJSA 1IPSA 2A6VA 2CAVA 4GWNA 4LBQD 3U07A 3BKZA 1HXS2 4PIYA 5D8AA 3GCWA 3I2OA 4Y33A 3WQ1A 3UKNA 5CFCB 3POYA 1ENSA 3VBUB 5J37A 5CKMA 4OI1A 2ORZA 2XKPA 5A80A 4QB2A 2ET1A 1SG3A 2VCBA 3E1F1 4LOTA 2JDNA 3HQXA 4WVMA 5FZDA 1VRH1 1R64A 2ZAAA 2EVXA 1YQ5A 4AAPA 1KFXL 5CVRA 4BHPA 4IE0A 1QNWA 4EE2A 5GLWA 1HRV2 5LBFA 1IS6A 1HRI1 3RI8A 1W06A 3M3CA 2IUWA 4MLOA 2GC0A 4FP2A 4JDOA 1IKQA 1W6QB 1ASJ2 4HKOA 4WVZA 4E27A 3SKJE 2ZTNA 1GQGA 1FNZA 3RFRA 3ZXGA 2MEV2 4XXPA 1IOAA 2E51A 2PA7A 3WW3A 4CDQC 1HDKA 3M70A 2JB8A 3ZPYA 1HLCA 4P9WA 2CTVA 5EYXA 2WFPA 3ROUA 5L7OA 5ISLA 4FQ4A 2HWD2 4XZPA 1S0GA 2Y60A 1VBC3 4HONA 3VKMA 1CZSA 5FBJA 5FYCA 4NIDA 4CDWA 3MUY1 1V0AA 3ZX7A 3IPVA 2CV6A 1DU3D 1VE0A 5C9AB 2ZXQA 3IB3A 1ZVFA 1QY4A 1MS3A 1QJX2 1HIXA 1DQ5A 1JN2P 3AZZA 4LLOA 4R9BA 4QB6A 1UZWA 3VLBB 2P3YA 3PMSA 3RI9A 1ZZCA 3O7OA 3UL2A 5I8TA 1HN1A 2VZQA 2WT2A 3WY6A 2A75A 5KR7A 3INAA 4UOJA 1WLWA 1PHMA 1W8HA 1GZWB 1CWPA 1CQ9A 2JDUA 1VAKA 5A32A 1WUVA 1UMHA 1JU4A 3E6BA 1OUXA 5LA9A 3ZYPA 4IV1A 4NUBA 1ZZBA 2MHFA 2EALA 5K9YA 3W5NA 3ZN4A 2V5YA 1RUE2 1CVNA 4I02A 5I93A 2FDHA 1VBA3 1JU3A 1LR5A 5FOJB 2DDUA 4AVAA 4YZ5A 3NMBA 4P9YA 1F9KA 4NIHA 4WM7B 1RUG1 1SBDA 3I7DA 3OD0A 1W9FA 1CJDA 3NV3A 3POIA 1X7NA 1Z78A 4N53A 4Q29A 4R9DA 4YW3A 3ZIWA 1L3JA 3AFKA 1F8VA 2VOWA 1FYUA 2F4PA 3NJYA 5GZEA 2OPWA 1DYOA 4Q4X3 5CBLA 3BPSA 1MS4A 2C9AA 3VBRC 3J7NA 4Q1PA 5T52A 2XB6C 3ZSKA 4BDVB 4GMP3 1ZRDA 3H50A 4GH4B 1OVSA 1GR3A 1FNYA 2XG3A 4OQ9A 3EO6A 4TTGA 2R042 4CU9A 4Q27A 3WLUA 3JD72 2BNOA 4GD4A 1DLLA 4LKFA 1RJ7A 3HQUA 4C90A 2IFRA 2VMDA 1D2SA 5E1RA 3WF2A 4BISA 1AUYA 2R063 4KH9A 4N43B 4BK5A 2HWE1 3LF7A 4CCCA 4QPWA 2RDNA 1W05A 1V6LA 1YIFA 4CDUC 2VBDA 2YU2A 1QJFA 1UX7A 2J7MA 1S0BA 1TEIA 1RUC3 5FZMA 1XOYA 2GALA 1HQWA 1UAIA 1LOEA 2CNAA 3C7HA 3ZXJA 4AZZA 1COV3 3S5AA 2HWF2 2WSVA 1U5IA 1PMJX 2VZSA 4ZU5A 1RMU1 1LNSA 2FDGA 4QM8A 4MGYE 4ZKTB 2RJLA 4MX3A 4LBQB 4XBNA 3RZLA 4SBVA 3A21A 4CTEA 2D7FA 5FPZA 4WZFA 4O9GA 4YGBA 2ZEYA 3POJA 5CFCA 1URXA 3KVBA 3ZYJB 2B9VA 5KBFA 1OT5A 2WRAA 4RFT0 1JOBA 2WA3A 4JRAA 1M4WA 3MFAA 3IDAA 3WHUA 2KA3A 1HXS1 4HMZA 4M00A 5JR7B 4AI2A 2JJ6A 4TXWA 5AC92 4AI3A 5J7MA 3AZVA 3H1WA 5T50A 2BRTA 2JEMA 2HBTA 2O0OA 3PLQA 4NIGA 2XJUA 4QWNA 1SDDB 2OUHA 4D6SA 5J3UA 3THCA 3WVJA 1RUNA 1AL21 2G9GA 4CUAA 1BK1A 5D8AC 5LA0A 4LLFA 5A3UA 3A4UA 4BOWA 1AR73 1MPXA 3EMRA 2XBO3 2DCJA 5I8YA 4FPLA 1LAJA 1PVXA 2CAUA 2GDFA 3VDCA 4Q8KA 1QWRA 3ATGA 5F37A 4MZUA 2R32A 4LHSA 4YVSB 3IN9A 4LHLA 4FAHA 3HPNA 3NV4A 5GLZA 3PTYA 2MEV1 2W94A 3J8F2 2P4EA 1W90A 1GZ9A 3AKSA 4XHBA 2VMGA 3KT4A 4J1WA 4LHNA 4QXKA 5JXJA 4ATEA 5HPOA 1GSLA 3S6PA 2B46X 5LA2A 1N3PA 4MGIE 1SBEA 1AXKA 2MPFA 3T3YA 1RB8G 2BGCA 1GZWA 2EIGA 3BIEA 4MGTA 5DDJ1 3OOXA 3VKNA 2XXZA 3Q8FA 3POBA 4A6OA 4YG0A 5IVYA 2VZ3A 4RGGA 4FPJA 4O7XA 4OUSA 4URAA 3WD5A 1JH5A 2FHRA 2Z42A 1TNRA 5L7OC 1PZ9A 5CA6A 4MOAA 1N1YA 5C7GA 1BVP1 1Y9MA 5JI9A 4CDWC 1CX1A 3BTYA 5F7UA 5CKQA 1UY1A 1VRH3 3PVEA 1W8WA 5IK4A 5DUXA 3LSDA 5L9BA 3WCSA 1LHOA 2ZGOA 1CPNA 2D43A 4MGQA 3K3OA 3MICA 2FDKA 2BWAA 3QOPA 4I0AA 1OKOA 3J7HA 3O0XA 5IWFA 5GLVA 4D69A 1W8ZA 3LOBA 4KG0A 1NXMA 3AVSA 2BVVA 5IVVA 4BCUA 1RUE1 5C3OA 4PF5A 3U4XA 1V6KA 1FT9A 1LOAA 2DVAA 2OUJA 4OUEA 2PAMA 5FJKA 5A3LA 4AHWA 2ETEA 1XU1A 1ZYBA 2WQ8A 1IZ3A 4DQAA 3USSA 3H8RA 1UY0A 4QKNA 1XYPA 1F2NA 4Q26A 4V1PA 3PNAA 4IV1C 1W03A 4XIOA 2XKOA 3Q9OA 4Q4Y2 4OHZA 3M2MA 4DUXA 4Q8LA 3RJ2X 3LZZA 4BM8A 4N43A 4L0PA 2HWB1 1S0EA 2VR4A 2BGOA 3GCXA 3T2PA 3BPZA 1IS4A 4Y24A 2AGSA 1VPHA 2Y26A 2DFBA 3KHBA 3N36A 4MHRA 4JQTA 4JGZA 3J7MA 2Y0IA 4N53C 4IEZA 4JTOA 1W6NA 3W21A 4CP0A 3JD71 1W8UA 2D6PA 4XJWA 2Q1ZB 3RRDA 4BWOA 2BBAA 3I2HA 1K42A 1Q8SA 3OSDA 3T2OA 1UL9A 3ZSEA 2IXJA 5C3PA 2RR12 2W39A 5C3SA 1MS9A 3NW4A 4IEPA 4R8HA 4QX1A 4NHXA 2ZGTA 4FVVA 1OLME 3J7LA 4OQ8A 1HB3A 4JDMA 5E6HA 5EFUA 1GUIA 1O8SA 1ULEA 1UZYA 2PHFA 4GZ9A 4E9KA 5LATA 4J1XA 1OOPA 5FFOC 5C3RA 2C9KA 3MGUA 4GKXA 1XNCA 1Z0HA 2AENA 2E31A 4EN0A 1T2XA 4M3CE 3OG2A 4OZXA 1KEXA 3TRSB 3UT0A 4ATFA 1NZCA 1VBC2 1CR7A 3KLSA 1J1TA 5JMOA 5L19A 4PHZA 4RSUA 4HSJA 1TMF3 2IXCA 4NHKA 1BVVA 1YHFA 4B7EA 5FMCA 5A33A 3T09A 3UJOA 4UFJA 3BCWA 3LDRA 3CHXA 3N7KA 4LPLA 2RDQA 4YPJA 4QU1A 1RUI3 1QOTA 4AEJA 1UD1A 1X8MA 2RS11 5DG2A 1BHGA 3H7JA 3CO2A 5AC91 5F32A 3SQOA 5CFCC 2FCUA 3K51A 3AKQA 2HWE3 2XL7A 3PUQA 4HVQA 3DYOA 4WZCA 3DCQA 4YVSA 4XDPA 1UKGA 2DCTA 2W1UA 1YFYA 3QLQA 2W08A 2WYSA 3F2ZA 4CUBA 1MQTB 4OFGA 1QJZA 2X29A 3ETQA 4Q0UA 3P3NA 5K4LA 4RHV3 3OGRA 4FP3A 4Y4YA 4H7LA 3TNQA 1PX4A 4HKWA 4NROA 2IC1A 2HWC3 4NAOA 4GA9A 1W2OA 3FHQA 1E5RA 2D93A 4PCRA 5FRAA 2J1VA 3E5XA 3KQ4B 3MI8A 4FTEA 3IAQA 1NE4A 1QDCA 4QMAA 1JYVA 4XJUA 4UW6A 2ATFA 4XQ4A 5LB6A 5BXXA 5LW9A 3N35A 5T5OA 4K8RB 1M06G 5A6YA 1F5FA 2AZ5A 1DGRA 2ARAA 4E8DA 2YHJA 2A1XA 5LY1A 5KXEA 4BQ3A 1NE6A 4AGRA 3I2FA 4DY3A 4ZONA 1ZRFA 2GC3A 2RJ2A 3KB5A 4LBOA 2YUEA 4HN1A 5DUVA 4DO0A 3PIGA 4FXKB 4W50A 3IWZA 1Q8OA 3U14A 3AYDA 3KGZA 3UV9A 4IE4A 4AQ2A 1LJ7A 2OA2A 2R062 1J3RA 2KD7A 3SMHA 3ABZA 1H1AA 4RD7A 2VTFA 2WO7A 4MG2A 2FCVA 3SISA 1UZVA 3D4KA 4IESA 1A3KA 1HN0A 1SCSA 1RUC2 4AFAA 3RYRA 3SHRA 3RZHA 4P5YA 1COV2 3ZM8A 1AHSA 1EUTA 4AQSA 5C8CB 4W6WA 4RA0A 2XGXA 3ACIA 4KNCA 3TN93 4LO8A 1UYXA 1ULPA 1FOD1 2R1DA 5SV5A 4DPNA 3RZKA 3IKWA 2VTXA 3VL9A 5J09A 5FZEA 3ZR6A 2ZBJA 1P8JA 4AFMA 5FIXA 3ETPA 3M3QA 4LBJA 1HB4A 1EV13 4QDSA 4QKDA 1DQ4A 4UXAA 2L9LA 1GZTA 1UQXA 4YZ3A 3VHOA 4BQWA 3MW2A 2FD8A 2QQJA 2P3KA 4WM7C 1H0BA 4IEUA 3WXPA 2YROA 4HETA 1K5JA 4FSJA 3AP9A 3O14A 1MS0A 3KCXA 4GMP0 5KHGA 2ZZJA 3NNGA 3O1VA 2WDBA 3NNFA 5GM0A 4CU7A 3WG1A 4EZ4A 4XCAA 1UW8A 1W04A 2R49A 5HCAA 2RS53 2XJSA 3M8LA 4LXLA 2G4IA 3RNSA 1Q8PA 1CAUB 1UZZA 2VOTA 1NLSA 2QDNA 2JG9B 5FZFA 1RINA 3B7MA 3AMMA 4YGEA 1YCIA 5FTTC 1PGW2 5F1RA 3OUIA 5B4NA 4ONUA 2BU9A 2BWCA 3PVBB 5H9QA 1AYM2 1S4CA 3N9PA 2OX0A 2WFF3 4N43C 2XVLA 5LY2A 2WZEA 2PMWB 3HMYA 1BZWA 4JKKA 3V56A 1AR72 2QQWA 1CAXB 4MXWB 4JGZC 2C0ZA 2QQUA 5A7SA 3VN4A 3ZMNA 1CZVA 3PIJA 4AYUA 4IW3A 3V65A 4DUVA 1WW5A 4M01A 5A7WB 3ACGA 5FXXA 4R9CA 5GZCA 2FCTA 1O4YA 2DBNA 2HLEA 5FZOA 1LECA 4BYYA 3THTA 5CG9A 2D6LX 1AX1A 2CGPA 3B00A 4PLOA 3AMQA 1K5MB 2WWJA 3B93A 2W47A 3PURA 1O3RA 3QACA 1JHNA 3AFGA 4Q4W3 2NMNA 1GNHA 5LK7B 2YC2A 3OB8A 1HJFA 3CJIB 1OQ1A 2ERFA 5C3QA 5F9TA 4QB1A 2GMMA 1SLCA 5A6ZA 3DUIA 3AKRA 1CAVB 2YGMA 2DV9A 3K4AA 2JENA 3KT1A 5FOBB 4I3PA 1F4AA 2I07B 4FPEA 1OOPC 3C7OA 1WCSA 2VY0A 2WUHA 2BOIA 1ULFA 4CE8A 5DUUA 2ZEZA 3ITQA 4G9SB 4I09A 1QOSA 2QTWB 2DFCA 2E33A 2ZEWA 4DB5A 2DVDA 2QZ2A 1I5ZA 1YNAA 1VRH2 4K21A 3ZOIA 3TEYA 3M4FA 4AFDA 1XYOA 2W2IA 1UIJA 4KWUA 3UKTA 1HRI2 4E4ZA 5CG8A 2NP0A 1SFYA 5L9RA 2V4AA 2GP5A 3OBZA 5DUWA 4PLMA 4BU2A 4PJYA 4YM0A 2FMYA 5LK5A 4GWJA 2Q8DA 3T4HB 4AAXA 1VBA1 2Y8KA 4KBZA 4Z82A 5BNOB 1N1TA 3MLJA 1J1LA 1MVQA 3ZPOA 5C5TA 4BE3A 5JSPA 4UYBA 4YVSC 1OI6A 3Q8CA 4Y1XA 3S7EA 1JZ6A 3OYWB 4Z2AA 5FZ3A 4RQPA 4BQ4A 1U12A 2I2SA 2Z4FA 1L7QA 3AL5A 3ACFA 3OBRA 4H2AA 1ZZ9A 4ITCA 3KZ4C 2GNDA 4Q4X1 5FBZA 3JBG3 3ZYHA 4SLIA 3OGSA 3Q8AA 1PM4A 2YBSA 2KXLA 3IDBB 4GMP1 4IEOA 4P5HA 2V72A 4EN9B 3M1HA 5KHIA 3N7MA 5CNAA 1KD7A 4M0HA 4XILA 4XC9A 3WF3A 3CLPA 1AYN3 4GWIA 3BOPA 4RS5A 5C8CA 5KXBA 2PN5A 3LSEA 5FZ4A 4UBGA 4W6YA 4QGLA 4QXHA 2R061 2JDZA 1RXFA 5EV7A 3HN3A 1ENQA 3H0OA 5DZFA 3TAYA 2I74A 3LKJA 4M3CB 1HQNA 2BQPA 5GZDA 2CDOA 2C5DA 4UFIA 4HBNA 1TZOA 5F2SA 1QGLA 4D3WA 4C1XA 2ES3A 3C2UA 2HYKA 4LO4B 1COV1 1XBFA 3RGBA 4P14A 1XNTA 3KM5A 2Y34A 2AR6A 3K4DA 2HKXA 4WV8A 1LGNA 4AOCA 1G6NA 1JZ2A 2VOVA 1JYCA 4QX2A 1K45A 1J3PA 2VUCA 3NNLA 4NOTA 1QH6A 5FZ7A 2ZCWA 3B01A 4B7KA 3ON7A 5FPBA 4IGOA 2LRPA 1CAUA 1RTVA 1W9SA 1TMF2 1YYNA 2E7TA 4MHUA 2D44A 4OMCA 5T55A 3VBHB 4E4SA 3AJYA 5DG1A 5CADA 5IAVA 1BQPA 1VALA 2GN7A 4LITA 1RUI2 3I3EA 2FBEA 4K7JA 1KDMA 3LCPA 1DZQA 1ZM1A 5SV8A 4LO7A 3T1MA 5FYIA 1WCDJ 2XLGA 1DYPA 2Y6LA 4BPZA 5AFBA 4YWAA 3HBZA 2XHKA 3N7LA 4MXWA 1G86A 1MS8A 2XH6A 2HWE2 1MS5A 3D5OA 4K1YA 5GLUA 1OC1A 2WBKA 2JG8B 4NHYA 4NO4A 4GJYA 1PGW1 1VJ2A 4V2WA 4XFIA 2VZUA 2EIEA 5A7WA 1XXNA 4XAAA 1O3TA 1XE8A 4OI2A 4YM2A 4P9LA 5GKAC 2EAAA 4RHV2 3IIAA 1K5MA 5CKNA 4ZHNA 5C70A 5EP9A 1AR71 1DGRN 2P3JA 4N7UA 4H14A 2XBO1 3ORJA 3KT7A 2XVGA 2HWC2 3FN9A 2YBKA 2ZHLA 1RMU2 2P37A 2X05A 5FY4A 1CAWA 3I3MA 1W8NA 4AE2A 4GB33 4CRQA 1CAVA 1LU1A 4FPOB 4WM8B 4LOSA 4XURA 5FP7A 4FPHA 1EY2A 3BB6A 4UT5A 1PMIA 1NCRB 1JHJA 1NAEA 1QEXA 2DUPA 5F5AA 4UFMA 5BYNA 3RZJA 2W92A 1QQP3 4L8QA 4YW5A 4XUQA 2XWBB 5JMCA 1US2A 3LA7A 3ZFFB 3GZTB 4TLFA 3WDXA 3R4DB 3MIHA 5BNNB 1MS1A 5JXHA 3O0VA 4TLGA 4ZU7A 3T08A 2ZABA 3I8TA 2VUJA 2K2SA 2Y38A 3B02A 3DYMA 3OPWA 2WN3A 4A3ZA 1RUJ3 2RDSA 3WF4A 5DABA 1DG6A 3LAGA 4EYUA 5FWJA 5CEHA 3LQCA 3SH3A 2H0VA 4Y5Z0 1PO13 4P08A 3MIBA 2Q8EA 2Z2SB 4Q0VA 1VAVA 1X82A 4Q4V3 4RGKA 4XQWA 4EV0A 3VGIA 3T0DA 1UXZA 1YQ2A 3AZXA 2UYAA 1CX4A 2PAKA 1AL22 3KCYA 3Q8BA 4LUKA 5FQ0B 4S2FA 2WNUB 3DEMA 5ABJA 4GJZA 3WG4A 1S0IA 5F5IA 3VZNA 1W8TA 3R4UA 3TN92 1J3QA 1WMXA 4ZS2A 3OYWA 1IS5A 5FZ0A 5FZKA 1MQTC 1ZZ7A 3F95A 3QD6A 1V70A 4XCBA 1RYYA 1W6OB 2A3WA 3MW4A 4AQ6A 2YV8A 5M0TA 2VZPA 1EV12 4Z2WA 2LS6A 4B4QA 4QX3A 3ZXAC 1SLBA 2PYTA 3AYCA 4COYA 5JDBA 1LOCA 4NMIA 1FPN3 5IYYA 1N3QA 5JCTA 2GNTA 1A8DA 2VC9A 2WO1A 3WNLA 1WKYA 2O1QA 1S2BA 2HJIA 4XJZA 1LHWA 1W3XA 2ZHMA 3CMGA 5JPNB 1D2QA 1OLMA 4XTPA 4AK3A 2TUNA 1NXD1 1UYZA 3T0BA 1EAH3 2BTVC 3L2YA 3EYPA 4HANA 1VMJA 5DDJ2 3BOWA 4AEKA 2VAUA 2X53S 2RS52 1JZ4A 3U37A 1DBNA 2QBXA 2G9FA 3DL3A 4CVUA 2F6BA 3X29B 2EXJA 2H0BA 2E7QA 2XPJA 1UXXX 4RQPC 4ASKA 4P02B 2BW8A 4H3WA 2ZHKA 3AB0A 4LBLA 2WFF2 4FAGA 3TEWA 4QGMA 1NA1A 2A5ZA 3POSA 4QX5A 1TME3 4FPFA 4JC1A 1SACA 1JOJA 4DXZA 3CKHA 3TBDA 3FUQA 2W1SA 2VQ0A 2JE9A 3WOGA 1V6IA 2JXAA 4JTNA 2D6KA 1KDKA 2A3YA 2VXJA 4PT6A 4RS5C 5C8CC 3NV2A 2VM9A 3LGRA 4IGQA 3IBMA 2SLIA 4L99A 4P9XA 4XF0A 1WMDA 3VBHA 1W2TA 3CIHA 3FUOA 3KWVA 3LPFA 1JYXA 1BEV1 1GZCA 3O1MA 1VMFA 1ZRRA 2W95A 3HIFA 1HKDA 2EXKA 4Q4W2 2C26A 1W0NA 2XJTA 1ULCA 3FHIB 2P3IA 3ZDVA 5DAPA 1VB4A 4OMDA 3QBQA 5D21A 1X9TA 1KGYA 1WA6X 2ILMA 3IIIA 4Y1ZA 5FV3A 3TOJA 5FXWA 4CPBA 2X09A 1VRBA 1TMF1 4YW7A 2QQLA 4NIAA 1PK6A 5I0TA 2HWB2 4CCKA 2SBAA 4CXYA 4Z07A 2JG8A 3R05A 4KWKA 1RUI1 3GHMA 4YVWB 5DAWA 2C24A 4IEVA 4TSVA 5FZBA 4HL0A 3A22A 3I49A 1QDOA 4NPMA 5KC6A 3H3ZA 1XJAA 2A73B 3M3OA 1KS5A 4FPYA 3TWIA 1S0FA 3A23A 1V6JA 1O4ZA 3S57A 3JQXA 1OA2A 4B1LA 3ACHA 4LR4A 4P9JA 2GH8A 1R083 2ZZQA 4A42A 4NE9A 3ENRA 4QKBA 3N9NA 4CUGA 4NHMA 2Q5TA 5HXVA 4WM8A 3T4VA 2W91A 3O1TA 4XETA 4W4ZA 4RHV1 4PLNA 2NLRA 1HV1A 1DQ2A 5FY5A 2IVJA 4QX7A 2VMIA 1ENRA 1YIPA 3LEIA 2B45X 4IV3B 1HJGA 2HWC1 4KWJA 4FFHA 5BNNA 1S2EA 2ZPXA 3G7DA 4KBBA 2BZDA 4Q0PA 4XFBA 5IUQA 4HZFA 4D7YA 3VD9A 4LA3A 3O1UA 2XJVA 1GU3A 2RV9A 2TBVA 2VMFA 3CU7A 3P6BA 5D2AA 1K5MC 1I9RA 2B4KA 3GJBA 4L97A 5CAZA 4META 3MF6A 3JBG2 1W3VA 4DXRA 3PU3A 1Q56A 4LA2A 4LKDA 1H1MA 4EZHA 3ZR5A 3VBUA 3ME2A 4JGYB 1VBD3 1Y43B 3MPBA 4MADA 5BUVA 1UKRA 2VNVA 2J42A 5A3MA 3HBKA 2GZWA 3ALQA 1ODMA 2RS12 1H6XA 3I2DA 4AHYA 1DDLA 2WNUA 4AVBA 2P34A 3E6CC 1XNDA 2DCYA 3ZFEB 1STMA 5T5LA 1I1EA 1NZIA 1W9WA 2WZPP 2QCSB 2VCCA 3HNBM 1AZDA 3R4SA 3GALA 4XACA 1W6OA 1TE1B 4XF3A 4DOUA 1W6QA 3BN6A 5B4XA 1YRZA 3N9QA 4NRMA 2R1BA 1VBE3 3B5LB 4NRQA 4BXFA 1HV0A 1HQLA 3KGLA 3NNMA 2VNRA 1CONA 2D3PA 3TN91 4KL1A 5FZ8A 3LD8A 3WG2A 2WNEA 1NLQA 5FO9B 1C57A 2C1FA 2J1TA 2ZGLA 3T1LA 3JXSA 4DFSA 4XW3A 4J25A 1EV11 2RG4A 3HAGA 1RUOA 3A0NA 1GNZA 1LEDA 1E57A 4JHZA 5ABJC 5C9AA 3O1PA 1DIWA 3VHNA 2XHNA 1OPOA 2YB7A 3DPRB 1H30A 3N9MA 1FV3A 3BIWE 4NWVA 4ZS3A 4ES9A 5BPXA 1C8M3 1G7YA 4XUTA 1W2UA 5A1LA 1QF3A 1ZA7A 4HSLA 4B1MA 2OZJA 2RS51 4I0BA 1GYKA 2P5BA 2ZX0A 1AR93 5FY0A 5JSOA 1DZRA 4I2OA 2EXIA 2PTMA 2VBPA 3WDTA 5FY9A 3H8OA 2NM1A 4AG4A 3VBSB 3POWA 1DF0A 1OH3A 1FX5A 1BJQA 1R1A3 3OEBA 4A6SA 4ASMB 5LZ6A 1PNFA 3T30A 2DUQA 1U5ZA 5BNQA 3C7EA 3BI3A 2WFF1 3AP7A 1C3HA 2XOMA 4YW2A 2HH9A 2GAUA 5F3IA 5FAXA 3VZJA 1W39A 3NNJA 2CDPA 4XDQA 3FHAA 2PLV3 4L92A 4WM7A 3S30A 3N9LA 1A6CA 1ONAA 2RM23 4I30A 3RPQA 4E2GA 3NJXA 4PQ9A 1FOD2 5K0UB 4D7TA 1IQAA 1X50A 5B2GB 4B8EA 1O5LA 4N7IA 2CL2A 1DCSA 1E5IA 5G04L 3MHZA 4IUGA 4AI9A 4HKLA 1NA1C 4A7KA 4C91A 2B8MA 5J96B 3BTAA 3QH7A 1QQP2 1WW6A 1CESA 3LFIA 4GH4A 4Q4W1 4YVWA 3WX5A 2AH2A 2H6CA 3GJAA 1PZ7A 3SCGA 2FZ2A 3FWEA 4DUWA 3HD8B 5L9VA 1UY3A 4XJ9A 2ZGQA 3GDBA 2YU1A 4EJRA 2BGPA 2W46A 3MO4A 3ZN6B 1RUJ2 3VBHC 4H55A 4QXCA 3VKLA 4DXTA 3KSCA 3OUJA 1DYKA 3WINE 4WVVA 3RYPA 1PO12 4YM1A 5LBBA 4Q4V2 2LW8A 1UCXA 5I0SA 2BNNA 5C4WB 1UU6A 2NPIA 3VDBA 3H3LA 4CCMA 3AZWA 4COWA 1F31A 1UNBA 4BXSV 2ZGMA 5FLIA 2YDEA 3W5MA 2EF6A 3U11A 3GYDA 4OI4A 1GP4A 1UY2A 1PK6C 2CY6A 3ACLA 5EZWA 3AP5A 2Y64A 4AFBA 2JG8C 4EROA 3H1YA 5A1AA 1RJ8A 4Y1UA 4BQ5A 1D4M3 4D8MA 5FZ6A 3MIGA 1SEFA 5J98B 1E5HA 5C5UA 4NPRA 4LBQA 3WDVA 2WABA 1UPIA 1IPJA 5EIYB 1J83A 1W2AX 1ALYA 1FPN2 1XRUA 1BEV3 2VVFA 3HVDA 4JGYA 3UGGA 3WT3A 1JZ3A 2NZ9A 1AL0G 3PVOA 3MV11 1QHDA 1V9U3 4WM8C 3WUCA 3ZFGB 5IK5A 1EAH2 3SC7X 3FL7A 1AR81 2AEYA 3ZFEA 1SMVA 1DQ6A 3E6DA 2PELA 3JBG1 2JDYA 1YQ6A 4IL7A 1O4TA 1B09A 1OD3A 3AP6A 3ZFFC 3N9OA 3OTFA 4YZ1A 5BNNC 1W8FA 1APNA 1XU2A 5T3NA 1LOBA 4FPKA 2IZWA 4P00B 1WGPA 5BNPB 2EA7A 4YW4A 2OQ6A 3HEIA 1Y4WA 4QQPA 1AYN1 1QXJA 5FWEA 5KWRA 1UO9A 2PHXA 4AGVA 5C71A 1JZ8A 4FTSA 4MVTA 3GBGA 1LGCA 3LE0A 3GZEA 5DAXA 4E8CA 1PVC3 3FC0A 2RS33 4D7SA 1TME2 3CL1A 2ZGSA 1GMMA 3KD4A 2E32A 3VBUC 4CDXB 2K46A 2B7YA 1UZ0A 1S0DA 3R6SA 3WUDA 1JYNA 4A45A 1KITA 1UOJA 4QPGB 2WNUC 1H8TB 1HX6A 2VCMA 2Q4SA 3DPRA 1VBA2 3M7AA 3PUSA 4MGZE 3J26N 4CZSA 1Y7BA 4U2AA 1F35A 1S0CA 2QQMA 2AYHA 4QQOA 1MEC3 2XL9A 3S0MA 4ZY9A 1H4GA 1KQRA 1R1ZA 1JBCA 5JI7A 1H9WA 1OMIA 1ACCA 1FXZA 2DBIA 1Q8QA 2X10A 1JMUB 4COUA 4GXLA 2Z5WA 3RJRA 4LJHA 1JYIA 2WT0A 3ZYRA 4Q4X2 1D0GA 4D6QA 2ZKNA 2ZACA 3D8CA 4QDRA 2WKKA 4Y5TA 2VH9A 3L2HA 4HK9A 4OHXA 3VBSA 1O3SA 3UESA 1YFWA 2WIIB 1X33A 2Z69A 4FI9A 2W5FA 4PDWB 5FMOL 3WHTA 1J58A 1PM7A 5CB7A 1MR5A 2WNVB 5A7QA 3T0AA 5C9AC 2JDPA 5FY8A 3WF1A 4XPVA 5EYYA 3WEZA 1J59A 5LEJA 1JYWA 1VAMA 1XSQA 3OEAA 5K0UA 1OURA 3W20A 1SLLA 1R082 2EAKA 1RL3A 2FZ1A 4XQDA 3H1MA 5GZFA 2R30A 4DINB 4X6RB 1NYWA 1XPWA 2ORXA 2KR2A 3I59B 3FLTA 3I2GA 5E89A 4BQXA 1R091 1ZRIA 3LIGA 4EN6B 5FUNA 4XFGA 4JZRA 5FK8A 4GQ7A 1VMHA 4XJ8A 1RXGA 4XJAA 2BUKA 1IG0A 4QDQA 5FJHA 3EBRA 3AMNA 1OF4A 4Y5SA 4CU8A 1V6NA 4GB31 2JD4A 2XUMA 4FFGA 1I5PA 4YRDA 1BYHA 2V5DA 3SXWA 4LBMA 4Y22B 5KHKA 3E5QA 4N90A 1BLZA 1OA4A 2YZ4A 2GN3A 4URTA 4DEVA 1IG3A 3ZSMA 4ZZ5A 4I3GA 3IZOA 3V64A 1ZBE3 1QQP1 2HYXA 2XONA 2YC4A 4FQZA 1QU0A 3KV5A 4PIXA 5C4WA 4AI1A 4Q2FA 2DCZA 2EIBA 2O8QA 4QD2A 3BU7A 3K75B 3U10A 4IE5A 2R073 1V6MA 1WMEA 1UOBA 2XQXA 2AACA 1YI9A 2F4LA 2D5FA 1SQ4A 1HRV3 2D5HA 1RUJ1 3D0SA 3J9SA 4UFLA 3ZYGA 4DRRA 5A3NA 1F15A 2VNOA 4QQLA 4QQ2A 2DCKA 4GH4C 4Y1VA 4YVWC 1ASJ3 1PO11 3U0ZA 5I8SA 5IFPA 4Q4V1 1JI6A 5FYMA 3OD4A 5K8SA 4AI8A 1AVBA 3OF1A 1SPPB 5E88A 1PGL2 1VBE2 1ZNPA 1UOFA 1YQCA 1ZBA3 2WN2A 1OA3A 1VLNA 1WBLA 3U78A 2PHRA 2XBO2 1PIV3 2X5IB 3T2QA 1UPSA 2Q0AA 2PHDA 3UNPA 5A6XA 5FZLA 4QQHA 1C5HA 4FOQA 4AGGA 2PHLA 2V4VA 2LROA 5LBCA 2J1UA 3I2IA 1BBT3 5A7PA 3GNEA 4IV3C 1FPN1 1G9DA 2E26A 4QHOA 5BNPA 4OYUA 4LE3A 2UY8A 1NKGA 2W0XA 1OLQA 3IDEA 2QUOA 4UBHA 4AVTA 1H2NA 2PHWA 1C8M2 2Y33A 3SNMA 3WNOA 1EAH1 3CF6E 1UOGA 4MXVA 4RN5A 3I3QA 2WO3A 3LEKA 3VBFB 3VD4A 1AR92 1WA4A 1JYTA 1PZ8A 2AUYA 4JGYC 2WLQA 4LHKA 2N7GA 4UW5A 4CCLA 4CDXA 3C8XA 3MBWA 2BERA 3NJVA 3DECA 4HPKB 4K1ZA 2VL4A 3RWKX 4QPGA 4DXSA 5ACA3 1MQTA 1NQDA 4QPIB 1H8TA 5BY5A 3MPPG 1R1A2 1H1IA 1KJRA 1OLRA 4HK8A 4JVAA 3ZFEC 1GLHA 5LCWL 3ZXFA 4MGSA 3PUHA 4YNIA 1TME1 3QCWA 4ORFA 4E4HA 1CIYA 3W9AA 4QU2A 4UF0B 2VTXJ 4EN7B 2RM22 1O8PA 4DIQA 1H6YA 2ZGPA 3D6EA 4LBKA 3AK0A 2JE7A 5IVEA 3TEXA 5I91A 4K3UA 2D6MA 3ASIA 2OW4A 2WL1A 4R9AA 5FKBA 2I45A 5HV0A 3VZLA 1RUH3 5E8AA 3WCRA 1TVGA 3KVAA 2ARBA 2YMZA 3SEEA 4OHVA 3ZYIB 2RE9A 1YUDA 2OYZA 4PDWA 1X9PA 3RMYA 3BTXA 1QJU3 3EXUA 3LDBA 1S2KA 3PUAA 3SH4A 3CDZB 4NRPA 2WNVA 5D8AB 5FYHA 1AF9A 1Q8VA 4OCTA 2RVAA 2CWSA 2W3JA 1AR83 1D4VB 3GF6A 3RMXA 4NHLA 3DPRC 1K3IA 3S5QA 1POV3 3BODA 3D82A 5JVVA 5C6CA 5JWPA 4BB3A 2XJPA 1RVF3 4OUMA 2DWRA 4XXAA 1LULA 4YZ4A 4AWDA 4JCKA 1ST8A 3IM0A 2H6BA 4YG3A 2VOKA 3VHPA 5HCHA 1GWKA 3C7FA 1AX2A 4XF9A 2Y6HA 1YQ8A 4RGAA 1KJLA 2XDVA 4ISQA 4LKEA 1SDWA 1G9FA 5D1IA 5DXDA 3ZLIA 3BUCA 2Y6FA 3VBSC 1R081 1EYBA 2WYFA 1D4M2 4ET7A 4Y4RA 2ZMLA 4CEYB 2PHUA 4AR2A 2YFZA 1JZ5A 3I4IA 3TB0A 1SLAA 2Y0OA 4GWMA 4NN0A 2RMU3 4YSFA 3P5BA 3THDA 4S2DA 1CD3G 1I6XA 4DRVA 1BKZA 1CGPA 4AEDB 4QT6A 1PO21 2VO5A 4S2HA 5K0UC 4FPGA 1UMIA 1BEV2 5JR2A 4XTMA 4XUNA 4A41A 2A71A 1RUF3 4KU8A 1RITA 1BMV2 3N7JA 5DMYA 3WP5A 2D98A 3V0AB 2R0FA 1H4HA 5EJZB 3WP6A 5H9RA 1OH4A 3K48A 2UU8A 3LA2A 1CN1A 2JWPA 4XMIA 1RGSA 1KS4A 3DXUA 4QM9A 5F3EA 4CCDA 4LKSA 2JG9A 3GBFA 1DP0A 5IVFA 1VBD1 2YPJA 2XUEA 1GFF2 2F17A 1AR61 2VQUA 3FJSA 2VOXA 4FCAA 4XZUG 5GZGA 4CCOA 3JB4C 4KG8A 4AF9A 3FFZA 2B9UA 2BFUS 2E63A 5A32B 2WR9A 1PVC2 1DFQA 2RS32 1CAXA 3DXTA 3ILNA 4FO9A 3CEWA 3RWNA 2X5IA 4ZXEA 5C4WC 4LEJA 1H2LA 2NQYA 4HT1T 5H9SA 1EP0A 1WCKA 4TYSA 4V2VA 2JD9A 3FZ3A 2VGDA 3WP4A 5BV6A 1PGL1 2BP6A 1VBE1 1PX3A
chains in the Genus database with same CATH topology
1NCQB 4FBFA 1R093 4BMEA 1S0JA 4HN0A 3H3UA 1MEC2 3DKWA 3SCHA 3CJIA 4K40A 3A0KA 3OJBA 2K9ZA 1AXZA 4JAAA 4DNYA 2DVFA 1H2KA 2GMEA 4KGQA 2OIIA 1TQ5A 3VBFA 3W58A 3ZSLA 5FCCA 3MW3A 2DU1A 1F5JA 4QPIA 3WV6A 1C8M1 2XJRA 4YW1A 3E5UA 5JLVA 2DVGA 4WVWA 4WBBA 5KXDA 2XWJB 1AR91 5F6KA 1LHVA 3ZIXA 3AX4A 4LE4A 3ZXEA 3H8UA 1LCLA 5BNPC 3HR9A 3WG3A 4XBLA 1LGBA 2BPA2 1R1A1 4LNVA 1JTZX 1N1SA 4M3CF 3ZSJA 4ISRA 3EHKA 4CEWB 5BNOA 2A6ZA 4CDXC 2NMOA 2PLV1 4XFAA 2GH2A 4XYXA 3B69A 4F7ZA 2RM21 5JZGB 4QPGC 2V09A 3AXEA 1H8TC 3B94A 3KS7A 3EJKA 3OY8B 1WD4A 2VW0A 2ZX3A 3APBA 1G8WA 3FX3A 4JV4A 1UX6A 2YGLA 1OHFA 2ZHNA 1NY71 1ZBE2 2B5HA 4BMBA 4CP1A 3AKPA 2QQPA 2R072 3AXDA 2A6WA 4XMAA 4C0BA 3PHMA 3ZXLA 2RR13 4OHYA 2E7AA 1FI2A 5AVAA 3BALA 4BIFA 4CEYA 4PIZA 4M3CA 2D6OX 4PDWC 3IT8A 1OSGA 2GNBA 3GZAA 2WNVC 3SH5A 2JX9A 2VMHA 4AEDA 2PFWA 3OCPA 1WLCA 2HEVF 1ZBA2 2QDRA 1DGWA 4ASLA 5GLTA 1FATA 3M3IA 4J6GA 1T6GC 1D4M1 1PIV2 1SCRA 4BLJA 1IS3A 3V0AA 2VXRA 1YI7A 2VQAA 2WJSA 3OGGA 3ILFA 1QXPA 4A7ZA 1U0AA 1BBT2 2WT1A 5DZGA 4BA6A 1ZZ8A 2WZR1 4IEWA 5T5JA 3WQ7A 3AYAA 4C0HA 1GV9A 5FREA 4KQ7A 1BMV1 1O91A 1V9U1 3HT1A 1RHI3 2UWBA 1QMJA 1A8MA 3MLKA 4FOWA 2DTYA 2VW1A 4Y20B 4FOVA 4E2QA 1Z7S3 4AVVA 3W59A 5ACA2 5JOXA 1ZREA 2WWSA 2JECA 1NCQA 5J48A 1DQ1A 4AEMA 2Z79A 4LULA 1RUD3 4M0NA 4YZ2A 1PVC1 2XVKA 2RS31 3ES1A 5AVPA 2JG9C 5JIUA 1QH7A 5F5QA 1G9CA 1VBB3 2GSYA 2BNMA 4OLLA 2ZGRA 2WQ4A 4COVA 2WLPA 3PJYA 2LALA 4RR3B 3JU9A 4JQRA 1NCRA 5JPMB 2CGOA 3WW4A 2D40A 2X5IC 1YJLA 1RUH2 5IT6A 1PO23 4INDA 1MEC1 5JOZA 3ZFFA 1MVEA 3MIEA 2VUAA 1QJU2 4OULA 4F8AA 2IFWA 5GALA 3D0JA 1LHNA 3AJZA 1FV2A 1D0HA 4A2UA 1AR82 4YM3A 2PHTA 3VKFC 1REEA 3URFA 4C1WA 4JGZB 3CJIC 3WW1A 1RVF2 1WLDA 4LO6B 1AJKA 1A78A 1FMD3 1W6NB 2WC2A 4MGKE 1KRIA 1AR63 4CP2A 4CEWA 5FQ0A 2R16A 1AYN2 3VBFC 1GANA 4ES8A 3E97A 3S7IA 5JZGA 4IQPA 2D97A 4PBPA 4XIKA 4QPIC 1O5UA 3RS6A 1Q43A 4FPCA 3OY8A 4HVOA 2WS93 3OBTA 4XFCA 4E2SA 2RMU2 2ET7A 3FLRA 1Y3TA 3B9IA 3NKTA 3RG0A 3FBMA 5JSRA 1OOPB 1GBGA 1RC6A 2B39A 4RL7A 4IEQA 4LTAA 1QXRA 3QH6A 5FO7B 2IWGB 1RUF2 1OFNA 1BCXA 4Y26A 5I0RA 5JIAA 3JZVA 2VU9A 1BXHA 2D6NA 2ZGKA 3M3EA 3N4MA 3ZO0B 5BNOC 4EWDA 3LB9A 3UJQA 1NOVA 4YG6A 5A33B 1DQ0A 4R52A 4IEYA 1POV0 5CIRA 1H2MA 1ZBE1 4R4ZA 3J4UH 1AYM3 2NYYA 4HVRA 3ILRA 1QJY3 1EPZA 5IK7A 2R071 2QKDA 4FOYA 2FQPA 4N9IA 4AXOA 3ZN5A 1HRV1 3RQ0A 5K7PA 4ZU4A 1UN1A 4GKYA 2Q1MA 2VVEA 4AW7A 5KC5A 1ASJ1 4COZA 2E53A 4Z1VA 1IPKA 1H9PA 3H7YA 2UY9A 4BZ4A 1HW5A 1O7FA 2ZX2A 4YARA 5L73A 1UU5A 1ZBA1 4XHXA 1R092 2HWD1 4QHBA 2GC1A 1C4RA 4CEYC 5FLJA 1PIV1 3FE5A 2DUOA 5IK8A 3O5SA 3RDIA 2ZJCA 5JAXA 1FAYA 4GB32 3VDDB 4P9GA 4AEDC 5C33A 5KHJA 1BBT1 1QJX1 4Y20A 3ZXKA 3LA3A 4UW4A 3JQWA 5C8WA 2DVBA 1LU2A 2RHPA 3TYJA 2ZMNA 1B35B 1LENA 2QZ3A 3NV1A 4YFZA 5FDBA 5FLHA 4ZXKA 1ZRCA 1Q3EA 2BYVE 1WW4A 4YLZA 1HRI3 2Q30A 2DTWA 3WDUA 4BQ1A 1LB2A 2GU9A 2B42B 5ACA1 4LUMA 1C5IA 2IXIA 4RR3A 1XNKA 1LEMA 4LT5A 5LRRA 3UK9A 1H8VA 3WW2A 4IV3A 1LHUA 1YJKA 3PVNA 2YY1A 4AVCA 1ND2B 1NCQC 5EXOA 1KXGA 1XYNA 4OVEA 3ECQA 4O9EA 4AFCA 4DY5A 3ZMOA 2WZR3 2K0GA 2YC0A 1RUH1 4R4XA 2R041 2IXLA 2WA4A 1VIWB 4MYEA 2OVUA 2Q8OA 2DYCA 1QJU1 4DZGA 4MSVA 1N3OA 4IXLA 1RIRA 1NCRC 3FFQA 1PNGA 2ZOEB 1ZRFA 1POV1 1Q5OA 2UURA 2EXHA 2XLAA 1V00A 3MDPA 1RVF1 1YFUA 1JW6A 4BLIA 2VVDA 5CFDB 3RYKA 3VZMA 2UWCA 3NAPB 4W65A 3ZDSA 5T54A 2HWF1 1WBFA 2ZX4A 4YGDA 2E9QA 3B3QE 3AYEA 1NQJA 1UIKA 4NR1A 2V73A 3VUOA 1RUG3 2P17A 3VBOB 4X8NA 1LOFA 4B4RA 1ND3B 1AXYA 1DGLA 1LESA 2CWMA 4CEWC 2RMU1 3H9AA 3GHNA 1LOGA 1EPWA 1S55A 3MIFA 5JZGC 4BH9A 1QKQA 4AI0A 1RUF1 3DGTA 2BVBA 4E4DX 4LBNA 1RHI2 2CYFA 1W6MB 5H9PA 3PJQA 5I0UA 1JUHA 3AZYA 5JOWA 1Z7S2 3WP3A 2YYOA 2GC2A 1REDA 4G4FA 4XFHA 4F83A 5LEKA 1OD5A 2A6XA 3AM2A 4HFSA 1JUIA 1RUD2 3NSTA 3PMEA 3R0RA 4CDQB 4CYDA 5AFEA 2QNKA 1IKPA 1RMU3 4B3NA 4FXGB 3ZXDA 1VBB2 3J8F1 1N47A 3P3PA 1ULGA 3USUB 3VDDA 4XBQA 3G6JB 2D3RA 4XFFA 1N1VA 2LM3A 2OPKA 3O12A 3L9JT 1B35A 1PO22 1DZTA 1WW7A 3TNPB 1W0OA 4I0WB 4RQPB 4A7YA 2VNGA 3HWJA 4K9SA 1HXS3 4KWLA 4X8PA 3JUUA 3RZZA 3ZN6A 3THPA 3DV8A 3AP4A 1TNFA 1OFSA 1DGWX 5DZEA 3B9CA 4NWWA 1ZZ6A 1AL23 1CIWA 1C28A 1FMD2 1LKNA 2IXHA 2BBVA 1VBD2 1SLTA 4XF1A 3HN1A 4I01A 4RS5B 4QPYA 1AR62 4AHXA 5GJ6A 1UU4A 3RSJA 4XEZA 1IGOA 1U5XA 2WSUA 4N9HA 3KMHA 4KU7A 1CJPA 2XJQA 2QFEA 4XF4A 1ND2A 1REFA 2GNMA 1XE7A 3SCFA 3MIDA 3MF9A 3O0WA 1SLIA 2MEV3 2WS92 3I54A 3OPZA 4YGCA 1YLLA 2TEPA 3AMPA 1X8EA 2E6VA 3KCCA 3VBRB 2WINB 2HWD3 4Q4Y1 2DF7A 4EN8B 4RR3C 5DDJ3 2XLFA 3ZFGA 4FTBA 4OHWA 3LWCA 4PBOA 2MNGA 4GALA 2JKBA 2ZA9A 3NKGA 2VPVA 3UKVA 1QJX3 1LODA 1VP6A 4X6QB 5CFDA 4G3YC 4HLTA 5HCFA 3NAPA 2ZX1A 5E16A 4MV2A 5JWPA 1W6PB 3MZHA 4CDUB 4IEXA 1U5YA 4JDNA 5EJ3A 5KHHA 4AVSA 1QJY2 4H7MA 1GKBA 1UMZA 1AX0A 2A6YA 4K20A 4LO5B 4B4PA 2RR11 3VBOA 4MH0E 3SLIA 1NG0A 2BFUL 5TSWA 3WZ1A 1ND3A 2VULA 3VL8A 1YO8A 5F6LB 1Y9QA 2OZ6A 1G9BA 1RUE3 1VB2A 1XNBA 1QNYA 1VR3A 1XQNA 4GIQA 3JCIA 2AREA 4IERA 5KXCA 4L9BA 3GZUC 2RJKA 1VBC1 2PLV2 1CAWB 4D94A 3C3VA 3NL1A 2A7AA 3OGJA 1W6MA 2HWB3 2W68A 3GBWA 1JXNA 2W52A 1X36A 5FMOS 1LOFC 1V6OA 4Q1RA 3V0BB 2R043 1NY72 3LOIA 3JD73 2FMDA 3ZVXA 3WQ0A 1YWKA 1RHI1 4EWAA 4S2GA 4CDQA 1C1FA 2PAEA 4XOGA 3VZOA 4IETA 3N3HA 2O8OA 1S1AA 1Z7S1 1KFUL 4DS0A 1AJOA 1NLRA 2VECA 2R0HA 3USUA 3KQRA 4WVMB 4L11A 2HWF3 3I59A 4U36A 2ZMKA 4Z92B 2ZGNA 5ABJB 1MZEA 4B29A 4KGGA 1RUD1 2VW2A 1SFNA 1I3HA 1LTEA 2ENRA 3NVCA 2IXKA 3IMNA 2QE3A 2R6QA 1VBB1 2HEWF 4UW3A 2UWAA 2ARXA 3VV1A 2QJVA 1W0PA 4Y22A 1QOOA 3EQEA 2JICA 3AKTA 5HBAA 5T5PA 2WZR2 4YYOA 4NVPA 4P9IA 1WMFA 2VG9A 4A3XA 2NN8A 2PQQA 2RS13 5L7OB 2ZKLA 1C1LA 5CU1A 3VDDC 1UF2C 1ZA4A 1V9U2 4CDWB 1OQEA 5AC93 3IPVB 2YXSA 5LRSA 4K6BA 4TZDA 1B35C 4GULA 3NWKA 5L36A 4TWTA 1GICA 1RUC1 1FMD1 2WQZC 1ZX5A 2QVSB 3HT2A 4Y1YA 4EWEA 2ZGUA 1DHKB 5EWSA 1NA1B 3DN7A 4L2NA 3ST7A 3VBRA 5HI0A 3FLPA 1C8NA 1ENXA 1MACA 1RUG2 2A3XA 3IDCB 3CJXA 2HEYF 1WLTA 4IV1B 3MEPA 3J8F3 1LRHA 2WS91 3NO8A 1CPMA 3WNXA 1OPMA 3DF0A 3JB8A 1MZ6A 1YXWA 2DURA 1MZFA 1W6PA 4XE9A 3NJZA 2A70A 4CDUA 3MFCA 1ND2C 4FT8A 4K8FA 3WR0A 1MZ5A 3CNAA 4N53B 4BIOA 4MUVA 2DU0A 3FBYA 2X8KA 3ES4A 1WD3A 4Z8BA 1YFXA 4Q0SA 4W6XA 1PK6B 4QGNA 2P2KA 3MYXA 5J36A 4Q0QA 1GQHA 3VHRA 2CGNA 4HPKA 1AYM1 2BEOA 1O3QA 2D3SA 3ZFGC 1QJY1 4JRLA 2GMPA 3MLLA 2TNFA 4OI0A 4YFWA 4AHZA 3ELNA 1FOD3 5CFDC 2KM2A 1SBFA 3NAPC 1G9AA 3FMGA 3WDYA 5FPXA 3SITA 3AMHA 1IHMA 5HCBA 3T2TA 2LUWA 5FO8B 2ZS6B 4F3JA 4DMIA 3VBOC 3VZKA 1ULDA 1OKQA 3WDWA 4AQTA 3V0BA 1ND3C 3VKOA 2UYBA 2LTNA 1PGSA 2ZAHA 4Q4Y3 1OQDA 2A6VA 2CAVA 4GWNA 4LBQD 3U07A 1HXS2 4PIYA 5D8AA 3WQ1A 3UKNA 5CFCB 3POYA 1ENSA 3VBUB 5J37A 4OI1A 2XKPA 2ET1A 4WVMA 3HQXA 1VRH1 2ZAAA 2EVXA 1KFXL 5CVRA 4BHPA 1QNWA 5GLWA 1HRV2 1IS6A 1HRI1 3RI8A 3M3CA 4MLOA 2GC0A 4FP2A 4JDOA 1IKQA 1W6QB 1ASJ2 4HKOA 4WVZA 4E27A 2ZTNA 1GQGA 1FNZA 2MEV2 4XXPA 1IOAA 2E51A 2PA7A 3WW3A 4CDQC 1HDKA 3M70A 3ZPYA 1HLCA 4P9WA 2CTVA 5EYXA 2WFPA 3ROUA 5L7OA 4FQ4A 2HWD2 4XZPA 1S0GA 1VBC3 3VKMA 4CDWA 3ZX7A 3IPVA 2CV6A 1DU3D 5C9AB 1ZVFA 1QY4A 1MS3A 1QJX2 1HIXA 1DQ5A 1JN2P 3AZZA 4LLOA 4R9BA 3VLBB 5I8TA 3PMSA 3RI9A 1ZZCA 3O7OA 3UL2A 3WY6A 2WT2A 2A75A 3INAA 1WLWA 1PHMA 1GZWB 1CQ9A 1VAKA 5A32A 1WUVA 3E6BA 4IV1A 1ZZBA 2MHFA 2EALA 5K9YA 3ZN4A 2V5YA 1RUE2 1CVNA 4I02A 5I93A 1VBA3 1LR5A 5FOJB 4AVAA 4YZ5A 4P9YA 1F9KA 4WM7B 1RUG1 1SBDA 3I7DA 3OD0A 1CJDA 3NV3A 4Q29A 1X7NA 1Z78A 4N53A 4R9DA 3ZIWA 4YW3A 1L3JA 3AFKA 1F8VA 2VOWA 1FYUA 2F4PA 5GZEA 4Q4X3 5CBLA 1MS4A 2C9AA 3VBRC 5T52A 4Q1PA 3ZSKA 2XB6C 4GMP3 1ZRDA 3H50A 4GH4B 1GR3A 1FNYA 2XG3A 3EO6A 2R042 4Q27A 3WLUA 3JD72 2BNOA 1DLLA 1RJ7A 4C90A 2IFRA 1D2SA 5E1RA 1AUYA 2R063 4KH9A 4N43B 2HWE1 1V6LA 1YIFA 4CDUC 1S0BA 1TEIA 1RUC3 2GALA 1HQWA 1UAIA 1LOEA 2CNAA 3ZXJA 1COV3 2HWF2 2WSVA 1U5IA 4ZU5A 1RMU1 4QM8A 4MGYE 4ZKTB 2RJLA 4MX3A 4LBQB 4XBNA 4SBVA 4CTEA 2D7FA 5FPZA 4WZFA 4O9GA 4YGBA 5CFCA 1URXA 3ZYJB 5KBFA 4RFT0 2WA3A 4JRAA 1M4WA 3MFAA 3WHUA 2KA3A 1HXS1 4HMZA 4M00A 5JR7B 4AI2A 2JJ6A 5J7MA 5AC92 4AI3A 3AZVA 3H1WA 5T50A 2JEMA 2O0OA 3PLQA 2XJUA 2OUHA 5J3UA 1RUNA 3WVJA 1AL21 2G9GA 1BK1A 5D8AC 4LLFA 3A4UA 4BOWA 1AR73 2XBO3 2DCJA 5I8YA 4FPLA 1PVXA 2CAUA 2GDFA 4Q8KA 1QWRA 3ATGA 4MZUA 2R32A 4YVSB 3IN9A 4LHLA 4FAHA 3NV4A 5GLZA 3PTYA 2MEV1 3J8F2 3AKSA 4XHBA 1GZ9A 2VMGA 3KT4A 4J1WA 4LHNA 4QXKA 4ATEA 1GSLA 3S6PA 2B46X 1N3PA 4MGIE 1SBEA 1AXKA 2MPFA 1RB8G 2BGCA 1GZWA 2EIGA 5DDJ1 3VKNA 4YG0A 4RGGA 4FPJA 4OUSA 3WD5A 1JH5A 2FHRA 2Z42A 1TNRA 5L7OC 1PZ9A 5CA6A 1N1YA 1BVP1 5JI9A 4CDWC 1VRH3 3PVEA 5IK4A 5DUXA 3LSDA 3WCSA 1LHOA 2ZGOA 1CPNA 2D43A 3MICA 2BWAA 3QOPA 4I0AA 3O0XA 5GLVA 4D69A 3LOBA 4KG0A 1NXMA 2BVVA 4BCUA 1RUE1 4PF5A 3U4XA 1V6KA 1FT9A 1LOAA 2DVAA 2OUJA 2PAMA 5A3LA 4AHWA 2ETEA 1XU1A 1ZYBA 1IZ3A 4DQAA 3USSA 1XYPA 1F2NA 4Q26A 4V1PA 3PNAA 4IV1C 4XIOA 2XKOA 3Q9OA 4Q4Y2 4OHZA 3M2MA 4Q8LA 3RJ2X 3LZZA 4BM8A 4N43A 2HWB1 1S0EA 3BPZA 1IS4A 4Y24A 2AGSA 2Y26A 2DFBA 3N36A 4JGZA 2Y0IA 4N53C 4IEZA 4JTOA 1W6NA 4CP0A 3JD71 2D6PA 4XJWA 2Q1ZB 3RRDA 4BWOA 1Q8SA 3ZSEA 1UL9A 2IXJA 2RR12 2W39A 1MS9A 3NW4A 4IEPA 4R8HA 2ZGTA 4FVVA 5EFUA 4JDMA 1ULEA 1UZYA 2PHFA 4E9KA 4J1XA 1OOPA 5FFOC 3MGUA 4GKXA 1XNCA 1Z0HA 2AENA 4EN0A 4M3CE 4OZXA 3TRSB 4ATFA 1NZCA 1VBC2 1CR7A 3KLSA 1J1TA 5L19A 4RSUA 4HSJA 1TMF3 2IXCA 4NHKA 1BVVA 1YHFA 4B7EA 5A33A 3UJOA 3BCWA 3N7KA 1RUI3 1QOTA 4AEJA 1UD1A 1X8MA 2RS11 5DG2A 3H7JA 3CO2A 5AC91 5CFCC 3K51A 3AKQA 2HWE3 2XL7A 4HVQA 4WZCA 4YVSA 1UKGA 2DCTA 1YFYA 3QLQA 2W08A 1MQTB 4OFGA 1QJZA 2X29A 3ETQA 4Q0UA 3P3NA 4RHV3 4FP3A 4Y4YA 4H7LA 3TNQA 4HKWA 2IC1A 2HWC3 4GA9A 4PCRA 2D93A 5FRAA 3E5XA 3MI8A 4FTEA 1NE4A 1QDCA 4QMAA 4XJUA 4UW6A 2ATFA 4XQ4A 5BXXA 3N35A 5T5OA 1M06G 1F5FA 2AZ5A 1DGRA 2YHJA 5KXEA 1NE6A 4AGRA 4DY3A 2GC3A 3KB5A 4LBOA 2YUEA 4HN1A 5DUVA 4FXKB 3IWZA 1Q8OA 3AYDA 3KGZA 3UV9A 4AQ2A 1LJ7A 2OA2A 2R062 1J3RA 3SMHA 4RD7A 1H1AA 3SISA 3D4KA 4IESA 1A3KA 1SCSA 1RUC2 4AFAA 3RYRA 3SHRA 1COV2 4AQSA 1AHSA 5C8CB 4W6WA 4RA0A 2XGXA 3TN93 4KNCA 4LO8A 1FOD1 2R1DA 5SV5A 4DPNA 3IKWA 3VL9A 5J09A 2ZBJA 4AFMA 3M3QA 4LBJA 1EV13 5JOYA 4YZ3A 1DQ4A 4UXAA 3VHOA 3MW2A 2P3KA 4WM7C 1H0BA 4IEUA 3WXPA 2YROA 4HETA 4FSJA 3AP9A 3O14A 1MS0A 3KCXA 4GMP0 5KHGA 2ZZJA 5GM0A 3WG1A 1UW8A 2R49A 5HCAA 2RS53 2XJSA 3M8LA 2G4IA 3RNSA 1Q8PA 1CAUB 1UZZA 1NLSA 2QDNA 2JG9B 1RINA 3B7MA 3AMMA 4YGEA 1YCIA 5FTTC 1PGW2 5F1RA 4ONUA 3PVBB 2BWCA 5H9QA 1AYM2 2WFF3 4N43C 2XVLA 3V56A 3HMYA 1BZWA 1AR72 1CAXB 4MXWB 4JGZC 2C0ZA 3VN4A 3ZMNA 4AYUA 3V65A 1WW5A 4M01A 4R9CA 5GZCA 1O4YA 5CG9A 1LECA 4BYYA 3THTA 2D6LX 1AX1A 2CGPA 3B00A 4PLOA 3AMQA 1K5MB 3B93A 1O3RA 3QACA 1JHNA 3AFGA 4Q4W3 2NMNA 1GNHA 5LK7B 3CJIB 1OQ1A 2ERFA 5F9TA 2GMMA 1SLCA 3DUIA 3AKRA 1CAVB 2YGMA 2DV9A 2JENA 3KT1A 5FOBB 4I3PA 2I07B 4FPEA 1OOPC 1WCSA 2VY0A 1ULFA 5DUUA 4G9SB 4I09A 1QOSA 2DFCA 4DB5A 2DVDA 2QZ2A 1I5ZA 1YNAA 1VRH2 4K21A 3M4FA 4AFDA 1XYOA 1UIJA 3UKTA 1HRI2 4E4ZA 5CG8A 2NP0A 1SFYA 5DUWA 4PLMA 4PJYA 4YM0A 2FMYA 5LK5A 1VBA1 5BNOB 4Z82A 1N1TA 3MLJA 1J1LA 1MVQA 4BE3A 5JSPA 4YVSC 1OI6A 4Y1XA 3S7EA 3OYWB 4RQPA 1U12A 2I2SA 3OBRA 1ZZ9A 4ITCA 3KZ4C 2GNDA 4Q4X1 5FBZA 3JBG3 4SLIA 4GMP1 3IDBB 4EN9B 2KXLA 4IEOA 4P5HA 5KHIA 3M1HA 3N7MA 5CNAA 1KD7A 4M0HA 4XILA 3CLPA 1AYN3 3BOPA 4RS5A 5C8CA 5KXBA 2PN5A 3LSEA 4UBGA 4W6YA 4QGLA 2R061 2JDZA 5EV7A 1ENQA 3H0OA 5DZFA 3TAYA 2I74A 3LKJA 4M3CB 1HQNA 2BQPA 5GZDA 2C5DA 4HBNA 1QGLA 4D3WA 4C1XA 2ES3A 3C2UA 2HYKA 4LO4B 1COV1 4P14A 3KM5A 2AR6A 2HKXA 4WV8A 1LGNA 1G6NA 2VOVA 1JYCA 1J3PA 4NOTA 1QH6A 4B7KA 2ZCWA 3B01A 1CAUA 1RTVA 1TMF2 1YYNA 2E7TA 4E4SA 2D44A 5T55A 3VBHB 5BNQA 3E6CC 3AJYA 5DG1A 5CADA 1BQPA 1VALA 2GN7A 1RUI2 2FBEA 4K7JA 1KDMA 3LCPA 1DZQA 1ZM1A 5SV8A 4LO7A 3T1MA 1WCDJ 2XLGA 1DYPA 4BPZA 5AFBA 3HBZA 2XHKA 3N7LA 4MXWA 1G86A 1MS8A 2XH6A 2HWE2 1MS5A 3D5OA 4K1YA 5GLUA 2JG8B 4NO4A 4XFIA 1PGW1 1VJ2A 1XXNA 1O3TA 1XE8A 4OI2A 4YM2A 4P9LA 5GKAC 2EAAA 4RHV2 3IIAA 1K5MA 1AR71 1DGRN 2P3JA 4N7UA 4H14A 2XBO1 3KT7A 2XVGA 2HWC2 2ZHLA 1RMU2 2P37A 1CAWA 4AE2A 4GB33 4CRQA 1CAVA 1LU1A 4FPOB 4WM8B 4FPHA 1EY2A 3BB6A 1PMIA 1NCRB 2DUPA 5BYNA 1QQP3 4L8QA 4YW5A 2XWBB 5JMCA 3LA7A 3ZFFB 3GZTB 4TLFA 3WDXA 3R4DB 3MIHA 5BNNB 1MS1A 3O0VA 4ZU7A 2ZABA 3I8TA 2VUJA 2K2SA 2Y38A 3B02A 1RUJ3 1DG6A 3LAGA 3SH3A 2H0VA 4Y5Z0 1PO13 3MIBA 2Z2SB 4Q0VA 1VAVA 1X82A 4Q4V3 4XQWA 4EV0A 3VGIA 3AZXA 2UYAA 1CX4A 2PAKA 1AL22 3KCYA 4LUKA 5FQ0B 4S2FA 2WNUB 5ABJA 3WG4A 1S0IA 3VZNA 3R4UA 3TN92 1J3QA 3OYWA 1IS5A 1MQTC 1ZZ7A 3QD6A 1V70A 1W6OB 2A3WA 3MW4A 4AQ6A 2YV8A 1EV12 4Z2WA 4B4QA 3ZXAC 1SLBA 2PYTA 3AYCA 4COYA 1LOCA 5JCTA 1FPN3 1N3QA 2GNTA 1A8DA 2O1QA 1S2BA 2HJIA 4XJZA 1LHWA 2ZHMA 5JPNB 1D2QA 4XTPA 4AK3A 2TUNA 1NXD1 1EAH3 2BTVC 3L2YA 4HANA 5DDJ2 3BOWA 4AEKA 2X53S 2RS52 1DBNA 2G9FA 3DL3A 2F6BA 3X29B 2EXJA 2H0BA 2E7QA 2XPJA 4RQPC 2BW8A 4H3WA 2ZHKA 3AB0A 4LBLA 2WFF2 4FAGA 4QGMA 1NA1A 2A5ZA 3POSA 4QX5A 1TME3 4FPFA 4JC1A 1SACA 1JOJA 4DXZA 3TBDA 3FUQA 2VQ0A 2JE9A 3WOGA 1V6IA 2JXAA 4JTNA 2D6KA 1KDKA 2A3YA 4RS5C 5C8CC 3NV2A 3LGRA 3IBMA 2SLIA 4L99A 4P9XA 4XF0A 1WMDA 3VBHA 3FUOA 1BEV1 1GZCA 1ZRRA 3HIFA 1HKDA 2EXKA 4Q4W2