1BX0A

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
296
Chain Sequence
HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVLVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
total genus 96
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1bx0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1bx0A02
2BVNA 3QFCA 4LBYA 3VO1A 1CQXA 1FNCA 3ZZTA 2QTZA 3JQPA 1E64A 1TLLA 1J9ZA 3WYAA 3CCMB 3WBKA 1W34A 2B7BA 1U2RA 3AGPA 3OZUA 1OB5A 4TN1A 4RD0A 3W2IA 1ELOA 5JBQA 4M1KA 4TMTA 1K9MD 3OZWA 1BX0A 3W2EA 2NPFA 2DEUA 1W35A 2CNDA 1EP3B 1ZM9A 2J7KA 3CCQB 1VQPB 2B7CA 3I1FA 4B44A 1Q86D 3FJOA 3ZC3A 4C0SA 1VQ5B 1F20A 2C78A 4PC1A 4ZGNB 1G7SA 5HXBA 2XNJA 4ACAA 1GJRA 4YHBA 1A8PA 1GR1A 1QX4A 1W2BB 1K8AD 1JJ2B 4N3NA 5AN9A 1VQKB 1H42A 4TMVA 3A1FA 2BGIA 5TY0A 4ZCMA 3VNUA 3G71B 4PC7A 3LVBA 3SJZA 3CPWB 4BPRA 3W5UA 4B47A 1TVCA 3W2GA 4HE6A 1FRQA 3OZVA 1E62A 3U2QA 2OK7A 1JA1A 4R71A 2GQFA 3MCAA 1BX1A 2DERA 2B5OA 4ZCLA 4AF7A 3FPKA 1XB2A 3E1YE 1M1KD 2DCUA 4YALA 3MMPA 3I56B 1YJWB 3CCEB 3QFSA 1AMOA 1NDHA 1AIPA 4WQMA 3CCRB 4ZV4A 3CCVB 3CW2A 3JQQA 3G4SB 1Q81D 1OB2A 1EXMA 4RD3A 1JNYA 1QH0A 4FWTA 3LRXA 3WBJA 2VYQA 4YAOA 4P6VF 1EWYA 1EP2B 1KTVA 2BM1A 3P26A 1QFYA 4LBZA 1QGYA 4G1VA 1VQ7B 4IW3B 3VNVA 4NBSA 2QEXB 5EMNA 1G7TA 2VNKA 4RD6A 1SM4A 2QDXA 1YJNB 3CMEB 1Q7YD 1ZM4A 3G6EB 1VQ4B 1YHQB 1OGJA 4HE5A 1R5NA 5KSWB 1IJEA 3ES9A 1EFCA 2FX3A 1S0UA 4QHYA 4PC3A 2OTLB 2QTLA 4YAFA 3AVVA 2R6HA 2VZLA 2E1RA 3CRZA 3CB4A 4RD2A 2EIXA 3CC4B 4U9UA 4NCNA 1KQSB 2BPOA 1GVHA 1R5OA 1KK3A 1VQOB 2CRVA 1QFZA 1G7RA 4P3YA 2OTJB 1QGZA 2QN6A 3CCJB 2VNHA 1N0VC 1EFTA 2BN4A 3QFRA 3OJXA 4RD4A 2HDNB 4MYTA 4PC6A 1TUIA 1YI2B 4UAJA 3P27A 4EH1A 1IB0A 1QUEA 1Q82D 1FDRA 1WDTA 2PIAA 5TR9A 3CXCB 4B43A 3WNBA 1EFUA 1HA3A 2HMAA 1GO2A 2X3UA 3CMAB 2BGJA 2OK8A 1QVFB 1CNEA 3W5VA 2BF4A 1W87A 2EFGA 3ZBTA 4Y7CA 2BMWA 2YWHA 4YAUA 4J0QA 4RJLA 4Q7JB 4H9GA 4LC0A 1NJID 1D1NA 1QGAA 4DQLA 4MYUA 1N8RD 4N3GA 3MHPA 1M90D 2XEXA 4AC9A 4YAWA 4B4DA 1TTTA 1FRNA 1VQNB 4M0LA 2YWFA 1ZM2A 1FNMA 1YJ9B 4M4SA 3B82A 4F7DA 3CD6B 4RCYA 1BQEA 4TMZA 1XE1A 1GAQA 1KC8D 3PENA 2QMUA 2VNJA 5GV8A 3W2HA 3W5HA 3VMFA 4LBWA 3J81k 2RC5A 4G5GA 1DDIA 3WNDA 2BV3A 4G1BA 2PLFA 2D74A 3V76A 3B8HA 1K73D 1D8TA 1H85A 1B2RA 4LBVA 4PGOA 2GPJA 3LO8A 4FN5A 4M2LA 5DSZA 3LYUA 3U6KA 1VQLB 3AVYA 1KD1D 2C77A 5H59A 1E63A 3ZBUA 1FNDA 4RCZA 3CCLB 2BM0A 4B48A 3AVTA 3QSYA 5TV2A 4TMWA 3U6BA 1FNBA 1N0UA 1S72B 4Y9UA 2ZITA 1IJFA 1KK0A 4ZCIA 2BSAA 1VQMB 4TMXA 1CNFA 1BJKA 3ZZ0A 4ACBA 1YIJB 3CC2B 3WXMA 1KK2A 2DY1A 5THXA 1I7PA 4M53A 1KJZA 3E20A 1VQ6B 1GAWA 3QFTA 1KRHA 1QG0A 1DARA 1DDGA 3CCUB 3AVUA 1EP1B 1D2EA 1JA0A 4K1XA 4Y9RA 2HCJB 2VNIA 3JQRA 3OW2B 3AVXA 3ZZUA 1ZUNB 2RC6A 4ZGQB 1YITB 4RD1A 4QFMA 3QE2A 4B3XA 1QUFA 4AF6A 5GV7A 2AHOA 3AGQA 2XNCA 4FK8A 3CC7B 2DETA 3VO2A 1F60A 1SKQA 2PMDA 2YWGA 1DG1G 1UMKA 3CCSB 1ZM3A 3W2FA 1G7CA 2YWEA 1VQ9B 1R5BA 4C43A 1VQ8B 3B78A 1B23P 1KK1A 4PC2A 3I55B 3WNCA 2QA4B 1OGIA 1QFJA 3OJWA 3WY9A 1QVGB 5H5JA 4DQKA 1JB9A 3AVWA 5FA6A
chains in the Genus database with same CATH superfamily
3JQ8B 4R84A 4UKDA 2DYIA 4H1TA 4F21A 1L8QA 1MQ8B 6ABPA 1AMNA 1G21B 2X8AA 4RVSA 2VQEB 2XOEA 1IVYA 2N0SA 2H0QA 2R2GA 3JWHA 3SM3A 3CY6A 1QQBA 4OSPA 3W4KA 1MAWA 1B6GA 5KKNB 1P4HA 4HDAA 3A6FA 3UO8B 2FZCA 4D8TA 4Y8VA 5CA1B 3W3AH 3O74A 1XJCA 4EG6A 3GLSA 1UMCA 2DMRA 1F6DA 3TNJA 1CJUC 3LIIA 2CT8A 5KQMA 1TK9A 5ESDA 3T3GA 3GJ0A 4QOIA 2B3DA 1JHQA 1M0EA 3NIGB 4YC7A 4H17A 4MQ5A 1J7JA 3QUAA 4RC9A 2WT9A 4W9NC 4Q3KA 2P8JA 4DIDA 2HBRA 1RM5A 3Q2OA 2GEKA 5C9ZA 5JBQA 3LNCA 2EWMA 3GELA 4PF1A 1YBFA 3RWOA 3CGGA 3HU1A 1UWVA 2ZZGA 5DJ5A 4LHZA 1WP9A 2WG2A 3O3MB 5CVUA 1GGMA 4Z4QA 1DTWB 4XD7A 2NO6A 3PHJA 2PGNA 3TBHA 5EE0A 4BO7A 5K8IA 4GLOA 1LC3A 1ZVKA 2JCYA 2XZLA 2W43A 4JC8A 4XB2A 3N0RA 3SEJA 4PRKA 2E4YA 3V8NA 1I4WA 5A9RA 2UYHA 4BNGA 1XIVA 3KEOA 2GXSA 3IEMA 1T8TA 2NUPA 3M3DA 2I4LA 1UJMA 2H4HA 4L73A 1WZEA 1WBJB 3AUFA 2RKBA 2ZJ4A 3KZCA 1HQKA 1NT4A 3NHWA 1Y3AA 3OZTA 3HC7A 3QZUA 1U3VA 4X1IA 1EWKA 1A9SA 3FPEA 5HSGA 5EJ5A 4CLEA 4Q4AB 5KZMB 3R7NA 3ICOA 2PRYA 4FDVA 3MT9A 1K0UA 4U2BA 3KIPA 4ZEVA 2IBTA 2ZSUA 3D6FA 1A8HA 1GTZA 3GL9A 3GWGA 5HK9A 1LPOA 1PQYA 1E2DA 4KDRA 3N0TA 4IJWA 5EY5B 3V3TA 5JAUA 1NVXQ 4IJ6A 1NF3A 4UUQA 1ZC4A 3NGLA 4C20A 1XELA 1F6BA 1QFSA 1IWPB 2YWDA 3B1KA 3EIFA 5DX0A 4CMHA 3TW8B 2DHRA 1HG0A 3KFVA 2F17A 3WVNA 5KSZA 2QX6A 3DT8A 1GRCA 4TV8F 3DZBA 3FHOA 4U9IS 1YAJA 3PB3A 5TDHA 2I9KA 4KPYA 1TJ4A 1PUXA 5BUZA 1LJLA 1XTKA 1NPTO 3EHEA 4WY5A 3UMVA 4TYYA 1C7JA 1CHDA 1FDIA 1Y48E 1NXXA 2JVIA 4GP7A 4IG9A 3A1CA 3CLHA 5FFFA 4Z7QB 1T5BA 5BYKA 3L40A 2JLZA 2VP5A 3W5UA 1MXHA 1U99A 4MWTA 2J48A 1YRWA 4ZQHA 1L5SA 3QOXA 4DNPA 2QD3A 5ADHA 1GZ5A 1JYFA 1E5XA 4EY7A 1KVTA 5BVHA 2G9RA 1ZU5A 2JFPA 2PL5A 1QHGA 2R751 1HDOA 1OWPA 3D6NB 3I9JA 2QMHA 3W4JA 1IN5A 1YB6A 3A8IA 2L69A 4MPRA 4ZU3A 4HF7A 4TV9F 5BV8A 4RF3A 3RBVA 4GPZA 2W2KA 1GU7A 5AOBA 3TFWA 5ITWA 5FCDA 2CXTA 2R1VA 2BMDA 3BD8A 3MNFA 2ZU0C 4PRZA 5H02A 1ID8A 3DWGA 2Z8XA 4GE3A 2W9XA 1XDGA 4LY6A 4ZI7F 2H8KA 3W6ZA 5J4HA 3BMNB 3FOBA 4EPRA 3I45A 1C9KA 3ER6A 3CT4A 4CRWB 1SUFA 1YJWB 2JJ8A 4L50A 1PF7E 1M1NA 3SM9A 3JATA 3LF2A 2QE7D 2WVJA 4LV5B 5K3FB 3TNDA 3PFGA 4MKRA 3K4PA 4RM3A 1C4KA 3S70A 1RZRD 4JJ6A 4D3YA 5TRDA 2AMLA 3LA6A 2CEKA 1PL0A 2AS0A 2XCLA 3FOCA 4XLZA 4E5PA 2BZ0A 4F6CA 1Q81D 4XLFA 3HPRA 4IWYA 2ONJA 2B4QA 3ZW9A 2AXEA 4YA6A 2GD0A 5LZ5A 2OZPA 3KJEA 2C92A 1YL6A 2FE4A 2JCVA 4LYHA 5BW8A 2AXNA 1X80B 2GVZC 1E7MA 5GGXA 4EAAA 4Z4YA 4FWTA 1VI5A 1PTJA 4CQMA 4RLFA 5F5LA 4LFCB 2VYQA 4X7BA 5AHOA 4C4YA 1K8QA 1JS1X 3A14A 3K6RA 1IL0A 2QEQA 3DXXA 3Q0IA 1NKVA 1QS0A 1E2UA 2C29D 4OJNA 4RXUA 1KI1A 1SQSA 4TX1A 4BNHA 5FULA 2B1JA 4GWGA 1PR0A 4U4AA 5J5CA 3N86A 4FE3A 4E5UA 1P9NA 2W2LD 3PXAA 1SVOA 1TIKA 3RASA 5HJEA 1OZFA 4CNQA 4OOEA 1ZGZA 2RK4A 1DKUA 1WW2A 2YCBA 1HOXA 4DJJA 1L4KA 2PD6A 3BF7A 3ZWNA 5BSVA 2E5FA 2CJWB 4HG2A 3GJ8A 1UWCA 2QX8A 4HFRA 4KXXA 1TD9A 3LNNA 1ND5A 2C99A 4QXRA 4WI1A 5AVJA 3PHHA 3C15C 3TLMA 1XGKA 1Q7YD 3KWMA 4F5YA 1J99A 5MFPA 3G6EB 2R3SA 1Z3IX 4JJZA 1T10A 3DOIA 3GEDA 3L49A 2YIDA 5IFLA 2ZFUA 3LVFO 5GVSA 2VRCD 4L16A 1Q3TA 1U8YA 3CF0A 1V0EA 3G9TA 5CBKA 5ICMA 1V71A 2BF7A 3RS5A 5AI6A 2IGTA 1MC4A 3CVVA 2FWBA 2B92A 2QTLA 4AJ9A 1HRDA 3GVCA 2VQ3A 3TWOA 3ZU3A 5CDGA 5FOTA 2GJPA 5B57C 1IK4A 4Q3BA 4RY2A 2P3OA 2DOKA 4A15A 2CLDX 3ROGA 3TDMA 3DBLA 2B4RO 3CB4A 4AO7A 4QUZA 2ZUSA 4G09A 5I9BA 1XVLA 3ASSA 1HYHA 4NWIA 4RD2A 4LDRA 1V3QE 3EZLA 4OUDA 2YVLA 1G5TA 3T35A 4ZYWA 4M8SA 2GCGA 2J9FA 3VH1A 4HDMA 4RQTA 4JGGA 1FS5A 4RS3A 3WWPA 3R8CA 3VA7A 1V9SA 4K6CA 3WKCA 4UNPA 1FUEA 2WJJA 3AIMA 1AGYA 5G4KB 1BIFA 3FTCA 1XTUA 4QQFA 4GF5A 1I9CA 1NUAA 3FDIA 5AVRA 3LDHA 4FFVA 1CUJA 1W5FA 3CF4A 1P4GA 3C8DA 5CB4B 5CFLA 4EJMA 1GUZA 2JI4A 2BGMA 2Q5EA 1T9GS 2B2CA 3QEMA 3HA3A 4RM0A 5DWDA 2IU6A 2PANA 2JZOA 3CLUC 1PE0A 4J7UA 2ZIAA 3ZYZA 3OQBA 1NQOA 4UDOA 1WPQA 1LGYA 1X1CA 3KUKA 3NOVA 3QPWA 3DCNA 2AOUB 5E1OA 2IDMA 1HQDA 3FAKA 4RD4A 2JFWA 3L07A 2D00A 4AM8A 1XWFA 1PG0A 3AM1A 4BQFA 4G8BA 1K89A 2ZPTX 4ZVMA 1MU0A 2GTIA 3LDAA 2DWOA 3NBFA 3PVSA 4ZO8A 3R7WA 4ZMSA 4EH1A 3FDJA 3L92A 2K7ZA 2ZBGA 1U8XX 4DCOA 1S2NA 1FDRA 1WDTA 3TLBA 3ROPA 5ALXA 1DQPA 4LJ9A 5HKBA 3L9WA 2Q3LA 1D2MA 2Y68A 4X44A 1KDVA 3E35A 3SJUA 1X38A 4PIMA 3GLGA 4MQBA 5D7BA 3AVPA 2OHOA 1N75A 3EBOA 2J07A 1CIVA 4ZZ1A 2E4UA 3DGEC 2J59A 4A82A 1E2QA 2B94A 2W6ID 1MNQA 1VLOA 1X74A 2XMCA 3P0IA 4NCHA 4WIAA 5ALTA 2O2JA 3TIVA 1GCIA 5ADWA 2AOTB 4OGGA 3BGOS 4MEBA 1U7DA 2BMAA 2OK8A 2C9OA 3DNMA 2NGRA 5IDVA 4BVHA 4DHWA 5HIJA 3IQWA 3ZZ1A 3HNPA 4RABA 1K68A 1PQWA 3S27A 2XKBA 3SSMA 5I7WA 2VCYA 4YAUA 2E49A 3FCOA 3R40A 4DM7A 2XXAA 3OCYA 4XM0A 1W44A 4LRWA 3TNLA 3UT5B 5TEVA 3K9FC 1F7UA 5CH3A 4MPTA 2ZOSA 5HCUA 3DKPA 2DR0A 1XZCA 4BC1A 1EKXA 3C43A 2BT4A 5BUSA 4HLDA 4YEDA 4MWGA 5CGQB 5F1PA 3A1UA 4RIGA 5KAPA 1RAEA 2DJIA 1MAVA 3OQNA 5ALOA 1IQPA 3G2PA 4H7DA 1O4VA 3DE6X 3G8BA 3PR1A 2BFDA 4OMFG 5CUQA 1VLZA 4G36A 2GHIA 3EDQA 3OZDA 2O8NA 5BYAA 5JAMA 2X8LA 2AWNA 2UXCB 5JSYA 1I5RA 3RVKA 1VMIA 3HCOA 3JZMA 4OU4A 4OPMA 2BDUA 3B82A 1E7QA 1PEYA 2YVUA 1RQLA 3M82A 3QGMA 3H9JA 4TXMA 5GJVC 1T2EA 2OOSA 4MUAA 3SNKA 3UXMA 2QN2A 3OX1A 3IBGA 3IODA 1LUAA 2OB2A 4QXQA 5LQUA 4BVKA 1QZXA 3WTBA 4L9RA 4UCXA 3IP5A 1O9HA 1OQAA 1FFDA 2Y66A 3VMFA 3FNIA 3TLGA 1JBEA 1X9HA 3QG1A 2Q6LA 3J81k 3QE3A 1B6TA 2BAGA 3KJHA 3ODGA 4IG4A 2IIBA 1D2HA 4O2AA 3SWWA 4D97A 2EZ8A 4TUYA 1TMOA 2ZZFA 3V76A 2R4UA 3JRWA 3ZN2A 3PJGA 4UPEA 3CYFA 4Y2PA 5LD2C 2CLOB 4A92A 2FDXA 4NJMA 4BDSA 4MVJG 3K72B 4E12A 3GUUA 1PEDA 3EODA 4QRHA 1T5IA 3LO8A 1XP8A 3JU3A 2MSEB 5AW3A 5JMOA 4MGZR 2VH5R 1X7ZB 2ZM6B 3GYBA 3O6VA 1SCJA 2IXTA 3KPYA 4Z9BA 4ZYVA 2ZDQA 5HM6A 1PDVA 2L0XA 4X7MA 1EI9A 1VL2A 1NUUA 1NB9A 1WXGA 2GZMA 2TMGA 3CURA 3DAYA 2AEEA 2I3GA 4B34A 3WWOA 4F85A 4XWKA 1IIBA 1YDHA 1E63A 2JLBA 2JKYA 1AHPA 2F1IA 3HDVA 3U7FB 3Q88A 1TU4A 3WGQA 2IYQA 2VYND 1NBMA 2D8MA 3RWMB 3ZD9A 1VSUA 4UEKA 4KMRA 1OWNA 3T3EA 1UZNA 1WCIA 3FR8A 2QTMA 3QSYA 1L7PA 3M70A 4P3IA 1XE3A 4QV2A 2ZB4A 3GA7A 3RBAA 5JSQA 3ZWKA 3CEMA 4I5GA 3ET4A 3JR7A 3C85A 5F5XA 5ARCA 3C5WP 4ZI3A 2H1RA 1L5WA 3NBXX 3NWBA 4JYBA 3ZHYA 1IAQA 3O4RA 4PQFA 2FPSA 3PC2A 5K0SA 1LWNA 4JJIA 4QGHA 1L5GB 3RU2A 1RAHA 4NFHA 1GL3A 4PX2A 5DLQC 1KPGA 2DKNA 2FOLA 4AJKA 3BH6A 1C5KA 1HK7A 3RGGA 3MTEA 3HXKA 2UXDB 1I6LA 1K0FA 1HTTA 4IS2A 5JDIA 3FSEA 3IE1A 2WQZA 1ZIXA 4B6JA 3BEOA 2OGSA 2ZJOA 4PQYA 3E7PA 3DUWA 4G2TA 3VH2A 5C81A 1VLJA 1ORHA 3NWPA 4KCGA 4LJYA 1EE1A 4YONB 5THKA 5EP1A 1EFVA 1NWHA 3Q6RA 4XDHA 1M2OA 1VLVA 3QVVA 5DP2A 5EXTA 3SQXA 2O8FA 3LCCA 4GPAA 5L3VA 1REQA 2AHRA 3SQLA 2VPWA 4IVRA 7ABPA 3FDZB 3EH2A 5HA5A 4D6XA 2F8SA 3AI3A 5IAKA 1B74A 2ACKA 2X2EA 3ZGYA 4FMCF 3L1UA 1GL7A 3MWKA 4DBVO 2IZZA 5LXTA 1G1AA 2P9QA 2GXQA 1X7XA 2PYZA 5FQOA 5D87A 3OIUA 2C3PA 5K3OA 2UYYA 3BB3A 4GX1A 1JEQB 4ZGQB 1YITB 4Y0AA 1NJ8A 5L4NA 5FNZA 4MH0R 2QV7A 1Q0TA 2PX2A 4CMBA 2ZYTX 2A5YB 3FPGA 4H7JA 2REQA 3VJLA 2Y0CA 5LVAA 2FA9A 3D43A 1VIDA 4FS8A 4DQVA 4TLBA 5KYGA 1LPNA 1XJ0A 2G0TA 2XT0A 4CF3A 5KI6A 1CDDA 1SXJA 1D3AA 1NLZA 4IY1A 4K81B 4LGCA 4QVKA 3TFQA 4Z1MD 3L4BA 4DNTB 2G08A 2X22A 4TRJA 1JRLA 4NE9A 5TQVA 2O0LA 3V48A 5J2TA 2P4EA 3DL0A 4G97A 3NHUA 4Z8YA 4GR9A 5IEJA 2YVQA 5SY9A 1YC5A 2R1UA 1X70A 3HCNA 4J6FA 4YVFA 3RSFA 3E22A 1S7GA 2CW5A 1DC7A 1KYTA 2PU5A 1DG1G 2QLJA 2IXEA 3BMOB 4PQEA 3V97A 3EA4A 3VO9A 1EWTA 1GEGA 1MA0A 1MW9X 3GW8A 3I4LA 1HMYA 1A88A 1ZMXA 3DEYX 2NZJA 3Q0EA 4KN5A 3U7QA 1GZHB 2YWEA 2YHSA 3BY1A 2PX5A 1S7CA 3AFMA 2AW3A 3LCJA 3LHIA 3TSOA 4CM8B 1I30A 1I51A 1JWBB 3PR2B 3VAAA 3P9QA 1NIJA 1T9CA 2O1WA 1CQPA 1ZD2P 4R2XA 1EBFA 1FP6A 1DIGA 3K15A 4N5IX 3S55A 2CV2A 1DOHA 2FW6A 2I65A 5M2QA 1SC1A 4LDZA 1P73A 1VE6A 1W5EA 2OO7A 1VKJA 1TPZA 1UFOA 3GZ4A 3KQYA 2Q3JA 1EEHA 2OZLB 3IUYA 3TD6A 4AI6A 1XX6A 3ORRA 3KAPA 3EJWA 1E2LA 2J45A 5JAIA 1HT0A 4QBFA 4KR2A 4IJKA 1SBIA 3N2ZB 1MV8A 2ISSD 4Q39A 3JASA 1KDRA 2YHIA 3AFOA 2DP4E 1QB7A 1X8XA 1LCIA 5U9CA 3LGXA 1UFVA 1A95A 1QYCA 3KQSA 1JHUA 1KS9A 3EIEA 4FDTA 2V3VA 4Y2JA 1J2UA 2GZSA 5FI5A 4F3RA 1KSFX 3BWXA 2CCKA 2NW6A 1M1YE 2P79A 1UMDA 4J6EA 3GVPA 4UVIA 5JUWA 1OLUA 5K0CA 3RV4A 3UN1A 4G5QA 4K0RA 3U9TA 3SHQA 3UAYA 1LU9A 3PICA 5HIMA 3P45A 4M1SA 3I2FA 1TRKA 3Q8LA 5LD2B 4X00A 1JXMA 3A9TA 4LJAA 2PKYX 3TIXB 2B83A 1BWPA 1GZUA 2FLKA 5AUQA 5LLTA 2OBRA 1P2DA 1KY5A 2Y27A 5HHTA 1JPNA 4HDQB 2XA9A 5SYAA 1ELOA 1SQ5A 2EV9A 2I0FA 3N87A 2X6RA 4C06A 4WT7A 4IF4A 3D4LA 1YDGA 3NVDA 4BZQA 5KJ1A 1TW2A 2JJMA 1XZ8A 3AILA 4WJKB 2HCBA 3PXXA 2JLXA 4XW2A 5JDCC 4LYGA 4CTKA 4EI8A 3BMQA 4MPJA 2X23A 3JQFA 4RY9A 1Q12A 1N8SA 2RGDA 3DMTA 4N3BA 2YJ3A 5NLLA 1XAIA 4CKYA 2HA3A 5JCJD 3HB7A 2E4VA 5B4VA 5IJ9A 1XD8A 2ZRAA 1SBNE 3GJ4A 3R3UA 4DZZA 5KTTA 3FGOA 3RS9A 1C8VB 1EM8B 1LSUA 2C9CA 1D2NA 1UT5A 4GEGA 1I4DD 3N8KA 5CD1A 2VATA 1NL3A 3DVAB 4YV1A 5K8CA 4HDCA 1XCJA 4ZGNB 3KWLA 4UNQA 2QJFA 2GAAA 1OREA 5LZ7A 1H22A 3E61A 3K1AB 3R44A 1COZA 5A0FA 3TUZC 1NN1A 2OO3A 3LDFA 5BWLA 4BX9A 3ANYB 4V38A 3ZJVA 3RJ5A 1PV2A 4AN4A 2OHIA 3TIIA 3OM9A 3OF3A 3CQ9A 2B61A 1Y7HA 5JQGB 1QH8B 2AZXA 3IOMA 3AUXA 2WM3A 4G9GA 1YNOA 2ZRMA 1JJ2B 1XMXA 1B0AA 2HO5A 4OI4A 1CUCA 4TLDA 4KLZA 5AN9A 4X66B 4TMVA 2AG0A 3E7FA 5L3SB 5IBRA 4E2XA 1SZCA 1GKYA 5K8TA 1NJ5A 1UDWA 2JHCA 2ZIUB 1CNMA 3ANTA 1NG9A 1R74A 1S4QA 2D0OB 2JGFA 5HDQA 4W8GA 1PFVA 3B89A 1YB4A 4OLFA 1SIOA 4LTNA 2OILA 2XUPA 4K86A 4ZVRA 1Y9DA 5JCOC 3E70C 2ZIFA 2CUKA 3EQ2A 3QNWA 4LWZA 1SUEA 4BPRA 4U0KA 5HGXA 3H5RA 3P52A 3PQFA 1ZUD1 3ZQ4A 2W2VA 5KNBA 2J7PD 4DJFC 1HLGA 5C5DA 2I3ZA 1E3WB 5EWJB 5SZJA 3T5BA 4YT2A 1YBAA 3DP7A 2EHJA 1R6BX 2OFWA 3FSJX 5BNZA 1FTGA 3TKYA 4LWQA 3MEQA 3DL7A 2R68A 1L4BA 3KYBA 4P84A 3HKEA 4UBNA 4PO8A 4EVIA 3UKOA 4BEWA 3A05A 4R71A 1LDMA 2GQFA 2SKCA 3IA7A 4OIMA 3NTXA 3D26A 5MN6A 3OD5A 5KHOC 2G36A 1X7DA 3WMFA 3CR8A 2YJZA 4ZCRA 4ZCLA 3A2MA 5G1NA 621PA 4FFRA 4H0FA 1OX5A 4GX2A 1PVDA 1ID1A 2XVZA 3U1VA 4BMCA 3RHSA 1OH8A 1U28C 1XQ6A 4EMUA 5EQTA 4C1NA 1W0KD 2VCHA 3VUEA 2BJHA 1WKBA 1L5NA 3COPA 3IT1A 4IF6A 5FL7D 3QFSA 3DDYA 5H9VA 4KYVA 4MUBA 4HRAA 3CCRB 4GUAA 3OI7A 1I3OA 3UQZA 3PC3A 1OZ0A 1T5EA 4JKOA 4ZMBA 3SD7A 1K98A 1LLUA 3CRW1 2HRQA 3DXYA 1S6YA 2GPTA 1JPVA 2QJTA 1SWVA 4KE8A 3WHLA 2GZAA 1J2EA 2MMGA 1CQIA 1E2FA 4UM9B 5CT6A 2RD2A 4MQFA 3ZU2A 1A9XB 3ZJYA 3LSTA 3QU7A 1O57A 4UDYX 1HPLA 3TM4A 1LH0A 4GD3Q 5C1PA 1PJRA 1VYUA 1GPWB 1NB0A 4HUJA 3FYUA 2XUZA 2MCFA 1OASA 3ER8A 5DM4A 1EP2B 4DMLA 3IFSA 3P26A 3AHFA 4LBZA 2C03A 4L8FA 4FCVA 4NBTA 4S1NA 2Q0XA 1JQ3A 3DWEX 3USZA 3C3JA 3CCFA 1NW7A 4AG3A 2XA2A 2D6FA 3G85A 1XLVA 4KE9A 4RYDA 1Q11A 4YLEA 5JNTA 2HW8A 5JJKA 4QXMA 5TGZA 3TDKA 1BXRB 5LZ2A 3MM4A 2RI0A 4AROA 3QFHA 5FO0A 2CBGA 4RU1A 2VNKA 2XWQA 4GS5A 4R5MA 4TSFD 5M5BA 1C3LA 1GPAA 2QAGC 5L3QA 3V42A 2VJIA 2DBQA 4LSMA 4QVAA 1M6YA 3NHRA 4G9BA 1P2FA 2JHFA 2D5IA 1XDDA 5ALNA 3TBFA 3EQZA 1JN0A 1TVKA 4L5AA 4ZMRA 2ZTLA 3T3HA 1Z0UA 5J40A 2RGEA 2QX4A 3N8GA 3AVOA 2Q7XA 2GMWA 2Q4TA 4C89A 1P4RA 4D9NA 4CYMA 4Q9HA 1EFCA 2J3KA 4L28A 2QP3A 2OT3B 4BWGA 4PC3A 1ILWA 1Z36A 1H8ED 2AG6A 3CUUA 1RE0A 2JA2A 4QASA 4ZIRA 3H65A 2QK4A 1JJBA 4O59O 3T5CA 3ZPXA 4C0LA 1RC0A 3Q11A 3QQPA 4KMMA 4LK3A 4BVFA 4KDFA 2R84A 1FTYA 3AKYA 1XRNA 1RCTE 5JSKA 4LRSB 4AJOA 2ZE6A 2JLVA 2P0YA 4F9FA 1JG6A 4WZZA 1QC5B 5A9SB 2JGMA 4B7ZA 4ARCA 1NXVA 3Q9SA 1FSFA 3QVGA 4X91A 3U7JA 4Q34A 5JXIA 2CXQA 1QCZA 1JJVA 1KZYC 4H6PA 5JT1A 3K0BA 3DLAA 4FSXA 2IY7A 2BGKA 1YCHA 3G6WA 1I7DA 3BX1A 1ZMTA 3F5MA 4IHJB 1R6VA 5EHGA 1IJBA 4TM8A 3V8QA 5I4IA 4OHPA 1P0QA 3ZD7A 1GWNA 2P9GA 1A5AB 3WK6A 4I5EA 5E6UB 2YX1A 4MVYA 2ZROA 3VTAA 3LT2A 2Y2UA 1SCBA 4WN9B 2HHHB 4GRDA 1G7RA 1EFKA 3LJKA 2GAFA 5CDSA 1US8B 2FMKA 1HDRA 2OTJB 1G19A 4DCSA 5ICGA 4WK0B 1JWAB 2QN6A 4OXRA 1RYHA 1R0LA 2WZBA 3VU1A 1KJ9A 2IWHA 4BECA 3WTCA 1V6CA 3HRKA 3W5CA 2UUBB 1V1MB 1JHOA 1NZDA 2ZBEA 3TQIA 1KFEB 3RWBA 4MRMA 5FV4A 1TI7A 4DK1A 1FFCA 3QELB 4JBNA 4L75A 3UMGA 4KNYA 2V45A 1BKDR 1HYEA 1Q1GA 2E7ZA 3UG6A 1JU3A 4V03A 1QPBA 3CIFA 3P94A 2P4HX 1F1BA 3PITA 4RHTA 4XX0A 4U2EA 2ZTSA 1NOJA 2VDVE 3R6TA 1IUNA 4M21A 5ALRA 2ZQ5A 1BLIA 4X95A 3HSSA 4RDLA 1W47A 4LK2A 4JJFA 2PH1A 3OZBA 3LKZA 4FMDF 5SY6A 3ZHVA 1A27A 4O8CA 3ZY5A 2JF0A 2HBQA 2EEPA 2P35A 2QXYA 3KB2A 4L9SA 3NBQA 2HMAA 1ZLXA 3D3KA 2ZCJA 2PEYA 1XV5A 3ETEA 4MVWA 4HL6A 3U4GA 4WBSA 4YJ3B 2FPIA 4UREA 3DE4X 1H93A 4KZPA 3TOSA 1V47A 5FD8A 1E5VA 4PGAA 1N1GA 5HP4A 5M3BA 4P5EA 3D1VA 4UTXA 1WSDA 5AVOA 5F4MA 3B36A 4BLPA 5BV0A 1ICIA 1LLCA 4XNFA 1RAIA 3C6MA 4GZ5A 2FP3A 4L5IA 5FF9A 4C08A 5LUAA 1FS6A 4HXEB 1DKOA 4U8GA 4J0QA 4GMXA 1OXMA 2OFXA 1LSJA 2CYAA 1XBTA 4QG7A 5KWEA 1RCFA 2WIBA 1IY8A 2WSBA 3JVEA 4I4CA 2AYXA 4A2WA 4JH0A 3ZGNA 3FNRA 3EULA 2M1ZA 1FPMA 4PHGA 1W5BA 2WLTA 5DM1A 1HY3A 5HWSA 3JAKA 3GLIA 2AI3A 3KE8A 4XKWA 4IL5A 1MOZA 2WU8A 3BIOA 4NPHA 2HF8A 2W6ZA 4BIMA 4NJEA 4ZRDA 2RHGB 4NPCA 1TECE 1GZ7A 3P4XA 4RX1A 4MUMA 3CX7A 3D2CA 2WUGA 5F4ZA 4JC0A 1NP3A 2VSYA 3GRZA 4QECA 2YN4A 3LX8A 4JQYA 1E9VA 4UEQA 5KNDA 2XUKA 2OPHA 5GONB 3DM5A 2CF5A 2IHVA 4D41A 3NX4A 5I47A 3A6PC 4F7DA 3PFKA 5JXGA 5HEKA 2FR8A 3FW1A 3NUGA 3RF7A 1YQTA 4RCYA 1DKNA 1USUA 4YACA 2XB9A 4Z53A 4D96A 4DNRB 1UBHS 4KI7A 3PENA 1KAMA 3QIAA 4N49A 4R9UC 1JFSA 5GJBA 3DT6A 3TTSA 1OJLA 4FSHA 4OQLA 1NA5A 2KM1A 3WLSA 4AZVA 1Y1RA 3HXOA 2WU1A 1J24A 3DL4A 2PLNA 2RK6A 5C0OE 4ZODA 1YE8A 1JECA 2FJ0A 5JTTA 2D2XA 4N01A 3U19A 2YTZA 3D8BA 3W7VA 2F00A 3A6GA 1MVNA 1C3VA 1C7IA 4RPDA 3G5UA 1D8TA 4KEAA 1KYVA 1SKBA 3DE1X 1L9XA 1N2GA 3IEIA 3QOFA 5TF0A 3UAXA 1IZ9A 1W0JD 3OESA 2XVMA 1NMQA 2QAGB 4DLRA 2C9DA 2QWXA 1VP3A 2BR3A 2DSNA 1JEYB 1P3Y1 2P30A 3ZCTA 4DJTA 4CNBA 3GGJA 3N9IA 5BMVF 5P8WA 4QJ3A 1EQ2A 3KXKA 2C77A 4XLEA 3GPDG 4JD5A 1KSHA 3H7AA 5HE8A 3CUVA 3TE6A 1T4CA 2WFLA 1G63A 3IUPA 2BFPA 2ZRIA 3D0QA 3GCDA 3IPLA 3DWFA 1FTNA 3KPWA 4TVKA 3UT6A 3BDVA 1ULZA 3CCLB 2UVDA 2X85A 4FFBA 4JENA 4HBZA 1XN4A 4WUVA 2W93A 5DK6A 1M8JA 3AUUA 5JU6A 1CS0A 2RMKA 3QXHA 3OHPA 1NZFA 4OBBA 1FRZA 3VYVA 3ZLBA 1EVQA 2B0CA 4BGDA 3OTGA 4LKOA 2QN9A 1U4OA 1C8LA 1TMYA 4U00A 1TIBA 2FQYA 1P7WA 3EXFA 4EGCB 3C41J 1G20B 2ZLBA 1NN3A 2E4XA 2H3HA 3CTPA 3EXEA 3DOUA 4TKLA 1MIOA 1Y5MA 1TZJA 5AKJA 5AK0A 3R5XA 2CXSA 2IT1A 3FRHA 5CH5A 1ZCJA 4CN9A 1XMOB 3D7KA 3GB9A 3CC2B 1OZAA 2H5LA 2XZTA 4UXHA 3D5TA 2JDIA 1RIFA 2EKZA 4FZJA 4RETA 1DTSA 3KJXA 3KJFA 1Z63A 4J07A 5CU7A 4HAUA 5BSKA 3NAGA 4JI0B 5ECWA 1O6BA 1ZW6A 2QTRA 3RARA 4BGEA 2E37A 2Q0SA 5KHLB 1V8OA 2OFFA 1B6RA 3T51B 1DIBA 3B2NA 2VZ9A 4BX3A 1ZZGA 1VQ6B 4D0RA 2EL7A 3BZUA 4C7OB 4NCXA 1SC6A 1NE7A 2I54A 2VF4X 2XCUA 3HM9A 1YQQA 4L4YA 1DDGA 1E18A 5ALUA 4N6NA 4DSZA 1NUPA 3WDSA 1MZPA 2OAP1 1JG1A 4LV8B 1Z8HA 2M9MA 3L8YA 1A2QA 3KYCB 4M1EA 1MJGA 2J0UA 2E1BA 5A9TA 5IHPA 3E9YA 3MMSA 5GGYA 2CF6A 2OCKA 4ZCPA 1P2UA 2WKSA 3SC6A 3TZHA 1V0FA 4DIMA 1IWOA 4HX9A 1JI0A 1Y0YA 2BFBA 1Q7EA 4KU4A 3ZGZA 1JH8A 4CG1A 3B1WA 3WGHA 5E9WA 4X1YA 5K0LA 3FR7A 3SHVA 3RFVA 1ATIA 1GUYA 1ZHFA 4MTLA 4YRTA 3M2PA 3EEIA 1GSOA 5EQFA 4NXNB 3LC1O 1E2JA 3VPHA 3KE9A 5HZMA 4MARA 1O6FA 5DBIA 1GNSA 2ZVDA 2YCLA 3TMKA 3AWDA 4UBIA 1K6EA 4NG5A 5J63A 4MA4A 5GZ6A 3OSUA 3NWEA 2ECQA 4DCNA 4D81A 1RDFA 4B87A 2KYRA 3BTUA 3Q6MA 2WQ6A 1PP4A 2GF2A 1LZLA 3UHJA 5KTSA 1T1IA 2H9IA 4QNRA 4M83A 4C3VA 1C8BA 3ABQB 3BGIA 4RBNA 2HWUA 2RGBA 3FFWA 4I3HA 5J23A 2VUHB 4K03A 2HK6A 4M9ZA 1DKQA 4OP7A 2EFJA 3IO3A 3G5MA 1T4DA 3HA5A 5L3RA 2D1YA 4LRQA 4LTDA 3CLTC 4LVOA 4H4DA 1TRHA 1LTQA 4F3NA 3B78A 3CTAA 1Y1KE 2YOGA 1V41E 3PFHA 5LN1A 4QNMA 1BHSA 2A9JA 4CM7A 5L3ZA 3RC1A 1QZZA 4WZAB 2QA4B 1ECFA 3BAFA 3GROA 1JSXA 5A1TA 4PN7A 1NNI1 4ZAWA 1N57A 2EDAA 4E1AA 1E3XA 3HJBA 3PPWA 4MUKA 3DHWC 5AVXA 1EZ1A 1ICEA 4OXKA 5KOIA 4RSMA 5IBPA 3ZE2B 4X45A 3VR5A 5IKMA 1QANA 3G88A 5FA6A 2ABWA 2C4MA 4IH4A 2VSNA 3O4VA 5DI3B 2QRPA 4AYWA 4EG7A 4GXQA 10MHA 1E79A 1U2GC 2ON6A 3ZQJA 3UH0A 1ONPA 3AUKA 2HA4A 1XTSA 4R01A 3FBTA 4FILA 3WV5A 5HZHA 1P7YA 1GAEO 1Z6ZA 1E64A 3IBSA 2A4MA 2CVQA 3Q41A 4LS3A 1WABA 5LNK6 3SSOA 2CFOA 3E48A 4TN5A 2F4NA 4M0PA 3AOEA 3DXFA 3BCDA 3WBKA 4YK7A 5CMLA 2YWBA 2YNMD 5BP7A 3UJHA 3AP1A 1GTVA 4MB6A 4AMYA 1J2RA 4BO4A 2QLTA 2XTJA 3CJTA 3M6MD 4KQFA 3I3OA 2HV8A 3BMCA 3D0OA 1XTVA 3IALA 3TO5A 1BCRA 2OBXA 1WW3A 3ORQA 3WLQA 3ZHZA 3SQWA 3EF3A 3PQCA 1Y3CE 4JU9A 4R1PA 4N65A 4P5DA 1DQYA 1GD1O 1VGQA 3WFZA 2HAEA 4KR0A 1V26A 2NPFA 2CY0A 4D98A 1OLXB 4V39A 4BBZA 3HRIA 3DZDA 3GJRA 4ATNA 3HR8A 3HWX1 3FUTA 2AUMA 3EXIA 5K3DA 1T25A 5HZBA 4O4LB 5D3MA 4AO8A 5F9MA 4MWCA 1N2BA 1KOJA 1PV4A 2ZAOA 4DXHA 3W9SA 1L5YA 4DDTA 5A4FS 4CXMA 5DM60 2IYRA 2ZWAA 4C0SA 2ZE7A 5FLXA 3FSRA 4O2RA 4EUKA 5LIPA 1M2KA 1HE3A 2ECFA 1FU7A 2JEYA 2WDZA 3PJEA 1H6AA 1HYQA 2WZCA 4N7MA 4PG4A 3ZE1B 3VKUA 4BQOA 4DAEA 4ACAA 3PGA1 4MO9A 5T3YA 4XM1A 1N34B 1S02A 2BTQB 1E6EA 1WF3A 1LC0A 2UVPA 2YASA 4GPD1 2QUHA 2G07A 1Z0IA 2IVFA 3OHSX 2O7RA 1TYZA 2NZUG 4A0SA 1D7OA 3A9RA 3GLRA 4NOMA 3HCCA 4TQGA 1R9JA 2IOHA 1CP3A 1XU7A 4JLOA 2IVZA 4O0LA 5EMKA 1VQKB 2Z1MA 1RMQA 2P68A 2F8LA 3O92A 3EGXB 1VQ1A 3M6UA 4X1OA 1ZCAA 4HB4A 4BNDB 2R5WA 4JI3B 2WOJA 5FPSA 1GFSA 3R7BA 3G71B 4FYYA 1X7GA 3FUXA 4PGFA 5JS8A 1O0BA 3L1JA 2PZLA 3PVCA 2ODTX 4B3JA 3C24A 3VI3B 4XWGA 4CUJA 3LVBA 1YBMA 3SJZA 3B3FA 3S3TA 4W1QA 3K7EA 4WJZA 2E6KA 3OE7D 5CVEA 3OW7A 1TM2A 4DIFA 4AZTA 2O7VA 2J9XB 2BFAA 3HDJA 2Y0PA 3I83A 1UWLA 2BGUA 4DMMA 5KYKA 3LU1A 5T7BA 1RWWA 1DJPA 2FEAA 2FPRA 1W49A 1KFJB 1IM5A 2CKDA 2I7XA 3EMDA 3IDOA 1R3DA 1K7FB 3FTDA 2BHRA 3G2LA 2HU8A 3T5MA 1YZ3A 3OQIA 5FWYB 1KWKA 1GPLA 3OURA 3AL2A 4YCCA 3R9KA 1Z47A 3FNGA 4PVCA 2FCAA 4PNEA 2WSIA 3ZQ6A 2CFTA 2Z2JA 1A4UA 5BSEA 3VDMA 1T35A 4HAIA 5JOQA 4I2VA 1F8FA 3H2ZA 1ACJA 4NZZA 1R0BA 3AEQB 4OHWA 4RL4A 4XJVA 5J2UB 4BFVA 2ZRBA 3HEBA 4QDXA 4BO8A 3HMQA 1XYVA 4MWZA 5EP4A 3WIVA 1FFSA 3OKAA 4CPDA 2Q1WA 1Q2XA 5JSFA 1NDHA 1UZUA 4Q01A 1C8KA 2AF4C 2PZMA 4UVGA 4NF2A 2WINI 13PKA 4YV0A 3OZXA 5TPWB 4PLCA 5C8YA 3WYBA 1PQPA 5BURA 1IXYA 3RS3A 1MB4A 1LD3A 1S01A 3BVPA 1LPPA 3KQWA 3L0DA 4ICIA 3GIWA 1EQUA 4ZPJA 1WETA 4RO0A 1XQXA 4RE5A 3SJ7A 4PZYA 3G13A 2OD2A 3IGFA 3OSZA 3K2IA 5LIRA 1DP4A 1S3FA 3HU5A 1CY0A 1WMDA 3A4MA 5KS2A 4QOGA 1JVNA 2J1LA 4F71A 4FYXA 1XQBA 3L1IA 1FYWA 1U1EA 3WBJA 2BUBA 4Z0NA 1I7SB 4U5XA 3RVNA 2AFHA 1JDJA 3TSWA 3SQMA 4PPYA 1LX7A 3X1JA 4YMVA 3HWWA 1FLVA 4JT2A 2QRMA 4NZ9A 3F5FA 5EXXA 5LJLA 5IT9A 3ZBPA 3R77A 2PM8A 3QKUA 3VX3A 5I01A 4DR3B 4E51A 4UNSA 2HJ9A 2IPOA 2VK8A 1ABBA 2DKOA 5EMNA 1IRIA 1I10A 1QORA 1Z5OA 2VPTA 4ILKA 3RCBA 3BFXA 2Q50A 4A2PA 4C6SA 4RD6A 2Y1LA 5EQDA 2CFCA 3ISVA 4AS1A 3LBYA 4UZUA 1WXIA 3Q9NA 3MCZA 2WM9B 3AVQA 4JOBA 4YCLA 3PFWO 4S3MA 4DZRA 3LIPA 3RQSA 4DB2A 3GFFA 1LSOA 4U2GA 4YAKA 4X7EA 4TYMA 3WB9A 1XMJA 3DTTA 3B3GA 1UXJA 2F6RA 1V3UA 1ODLA 3D2BA 3OLWA 3AR9A 3CUEF 3E58A 2D7CA 1WD5A 3IA2A 1IJEA 5TMDA 5CB8A 4CQNA 2FX3A 3PQ7A 2I67A 3PUZA 3DNPA 5KCMA 4PCAA 4O6VA 4XPIB 3QX3A 3AF0A 1U0GA 1O6ZA 4I5IA 4F56A 1VCHA 5CJPA 3DNFA 5BNTA 1GCGA 2D59A 5IAOA 3GRVA 1JLSA 1Q22A 5JPIA 1NMEA 2Z83A 1OTXA 4F6RB 2DWCA 5DNAA 1BHQ1 2VJBA 3MRXA 4KFUA 3SBOA 5A05A 2BC9A 2YR0A 1PL7A 3ESDA 3F3KA 4LEIA 5IARA 5A3VA 4NFSA 3HEMA 2V5VA 1F12A 1N3IA 3BE6A 1YS2X 3PIDA 5LYYA 3ZWOA 4ER3A 2VDRB 3U4QB 1XOIA 3OZGA 4GXNA 2WAOA 4MGYR 3DOCA 4IGIA 4ZV9A 1J09A 1T6XA 1AZWA 3UICA 4D0GA 1GVHA 1KDPA 1COWA 1CW2B 1X1AA 2P2GA 5K0JA 4DW8A 3AG5A 3UFBA 5EQJB 421PA 3HXLA 1E9RA 5DYGA 1BXGA 2B8EA 4IDFA 2HQ1A 2IW3A 2PFKA 2ZL6A 4PAWA 1Z7GA 3A31A 3E3LA 2C04A 4EYEA 5KTNA 1MORA 3QIVA 1RXUA 4MEAA 3V2GA 1KVUA 3RKSA 3WLLA 3HH8A 1XRJA 3LUFA 3L0IB 1LJUA 3P9KA 2F2TA 4X05A 1NURA 3KVVA 3VX4A 1KJQA 1XHLA 4HDSB 5DSXA 5LBTA 3ABIA 1W5TA 5JCXA 3DDWA 4RZQA 1EFTA 1AKNA 1PR2A 2BN4A 5HCIA 1YQGA 3JWIA 1JDTA 1AF4A 1Z22A 2J87A 4I9HA 2RH9B 3TVTA 2OECA 1R10A 3I6MA 4Q3NA 2QW0X 4ZKDA 5JBIA 3CZ4A 1W88A 5AKYA 1IY1A 2HT6A 3DEZA 2JAQA 1H2ZA 3VNRA 3ZWVA 5DS0A 1CZNA 3ESAA 1IB0A 4DE5A 3FOEC 4M1QA 3P0HA 4Z8XA 1SBQA 4LDJA 5IYNA 4LVCA 3MB5A 4YAGA 4JSTA 1E0JA 2OHFA 4IRUB 3S4YA 4BXOB 5BPFA 5AP9A 3N74A 3RSZA 3WDMA 5HE9A 3SC2A 1ZNWA 4ZVQA 1KO1A 3A7EA 3ZS8A 2C96A 4DA6A 3PDIA 3PUVA 4FPXA 1I14A 2K87A 3WA7A 2ZYVX 3QYPA 4JP5A 4Z4CA 1R00A 1UR5A 4OOXA 2QL7A 4INZA 4ARUA 4C76A 3OIVA 2WRZA 4Q16A 4I1RA 3U4HA 2PD4A 3FMFA 2ZCUA 1OKKA 1KYWA 2BELA 1QG4A 3GJXC 4UFNA 4P3NA 4TKUB 4F5EA 2XB4A 5AYVA 2CLEB 1TVEA 1Z4JA 3HFJA 2G25A 3EVGA 3FWPA 3RRJA 5JRZA 2ZXFA 5KDLA 4FFPA 5JTUA 4J91A 2CCGA 5ERXA 2PCLA 5BQXA 4XJXA 4JDPA 1KKMA 2NSDA 1D1NA 3SR3A 4XM3A 3PNKA 2G88A 4LXUA 4ZQIA 4MW5A 2Q5CA 4I50B 3HJTA 3LBIA 4M98A 5EFOA 5E7IA 4AKIA 3UOWA 3L8HA 2C2GA 1S3SA 1KR2A 2SHKA 4GMFA 2ESRA 4KBFA 3A04A 1U4SA 1U1DA 4YAWA 1P45A 2ZJBA 4B40A 1PKXA 1WNTA 3OZ7A 3I1IA 5ALMA 2F64A 4WAUA 5FOWA 1WCYA 5DT2A 1U9IA 2M2IA 4X7DA 4TV8A 5KYXB 3FD8A 1ZM2A 4N0PA 1YRAA 5FHRA 4ZDKA 2C61A 3WHPA 2FR1A 4N82A 1N07A 4M4SA 3S5JA 2XCOA 1JKXA 5B2EA 3MGCA 3AU9A 1EHYA 4PYKA 4TWJA 4L5YA 3Q7TA 3ZDBA 2GT1A 3GU3A 3ONEA 2YC4C 3WNQA 4ZV7A 2OXEA 3T8YA 4KIFA 2PVSA 2QQGA 2QY9A 3EUAA 3TJRA 3DZCA 2NQ2C 1YI0A 2ZL5A 2NO7A 4RVFA 4WLEA 5H68A 1HRKA 1GQSA 4CCYB 4IJUA 3VOTA 3NCTA 4AYTA 3B5JA 3VVCA 2Y1KA 1NAHA 3SP1A 3ANMA 2I33A 3OBBA 5HTKA 4MMYB 3IMCA 1T9ZA 1UFRA 4MV9A 3JD0A 2Z98A 1QAOA 2VJCA 3FKJA 1AD2A 2XT6A 3K16A 2GAJA 1K66A 2ATCA 2IX9A 3CV3A 3ZX4A 5A7FA 4L76A 3FA2A 1Y3IA 4UC0A 5D3KA 3H2YA 1P33A 4IP0A 4EYOA 1QFMA 4ZI7A 3L0BA 1N6HA 1MT3A 2V1UA 2B69A 2GJ4A 2XQFA 3FVRA 1ZY2A 2ACWA 5I8ZA 1THZA 4B7AA 1RKVA 3BGSA 4FN4A 1A8QA 4B6RA 3A36A 2A0WA 4OP1A 4G0MA 2X9VA 3CG0A 4MA5A 1YRQA 2QLLA 3CG4A 4MWDA 5AM0A 2XMGA 5A4KA 4RCZA 3K3PA 3RSHA 1AZTA 2W70A 4TPKA 4ER7A 1UAAA 3BCRA 2HLHA 1C1XA 3MRSA 4INOA 4LJSA 4R51A 1GFZA 4P3PA 1PO7A 2BEUA 2NTJA 1FIUA 5CEJA 2TYSB 4CG0A 4M89A 4PX3A 4MIOA 3HKBB 1S72B 4Y6QA 2LVBA 3I6BA 1NUQA 4FE4A 3Q2IA 1WY7A 4PFKA 2I2FA 2CMGA 5TQ2A 1Z45A 2PSHA 4AMVA 4KK4A 5CX1A 1WLSA 4O8ZA 1E20A 3VR6H 4HEA6 5K0TA 1W94A 4Q0MA 4JVSB 3UIEA 2YV1A 2XZPA 2J3IA 3AY0A 6LDHA 2BBSA 4EYQA 5LQNA 3IAUA 4FXPA 1ZCBA 4LWOA 1DEXA 4NBUA 1BQ3A 1WHSA 4ZT6A 4EUFA 4LV6A 2CMFA 3C3PA 4R8VA 1IXSB 1ZIDA 1B8OA 2YDYA 2OBSA 3A9UA 2BFMA 3IVXA 3EPPA 2OGWA 4LYDA 3PL1A 3N39C 4WKNA 1I7PA 3VJKA 5I7VA 1RQ2A 1PWHA 2ZYRA 3K8ZA 2CVPA 2H51A 4PW0A 2PUDA 1EDEA 3C1AA 1E8NA 3B3AA 1F8XA 3D3EA 3LL4A 1DARA 1GHTA 4QQ8A 3QKIA 3UB3A 4HNGA 3BXPA 1CEQA 3G9ZA 3E5RA 4PLTA 5HUJA 1UPFA 1U1GA 5EIEA 3ODPA 4O3MA 2EWWA 1ZRSA 4RDCA 3S2IA 4F46A 4TKVB 1E3DA 4X61A 4ALJA 3RYCB 5EIFA 2V59A 4A0HA 6CHYA 4LHVA 1TC1A 3G49A 1I01A 3C0KA 3VI4B 3CEJA 3N2KA 1FMCA 3RAJA 1ODKA 2B99A 3N2IA 3RNOA 3FCSB 3OZIA 4IYJA 4F2WA 1P7CA 3DC7A 4IVQA 3FLAA 3DO8A 3LWDA 3VU9B 1KYZA 2AN9A 4E0FA 2G5PA 5J4LA 1OI2A 2NVBA 3G5AA 2XNDD 1M2JA 3P2YA 4HDKB 1EE2A 1A9RA 2ZBFA 3WRVA 2Q2NA 4OHZA 4PXSA 4FK8A 2JFFA 1YRLA 1KY4A 1KZ6A 4ZFNA 4UFOA 4G4GA 4TZ6A 3GA0A 4AS2A 3NI2A 4JJ7A 5J4KA 3ZE8A 1LJ8A 3U3OA 2PE3A 2A92A 2DH5A 2NAFA 3BORA 3FG9A 4LX8A 4MW7A 1JAXA 1XXHB 5FI0B 2ZIXB 3UFXA 3VV2A 3ZIUA 1NXWA 2YBEA 2PRZA 3JYLA 1ZM3A 1DC8A 2HLDA 4JU8A 3IQGX 1I1NA 1ZUNA 3KUDA 2K2WA 3GN1A 3L6RA 4Y2YA 4F1JA 1FNSA 3KL2A 4PTLA 5HTOA 1JQLB 4I55A 1PJ2A 5J47A 4DADA 4UAGA 3ROXA 4OLBA 2ZZKA 4HYTA 2WC1A 3H1GA 3T5AA 4INPA 1TXGA 1KJIA 4KGDA 2W2OA 4J3FA 4CM4A 1T5HX 5IJ0A 1H2HA 2WMNB 1OSNA 4UE3S 4WLUA 1MXFA 5KYYB 3KXDA 1A8IA 2GM3A 4B8WA 2OXCA 5LA6B 6REQA 2IY8A 1L4GA 2HMWA 4CQMD 4HVTA 3ZWXA 2B4KA 4DNQA 1HE1C 3RVMA 2BH9A 3O03A 5DOZA 5J5AA 1KP3A 2AZTA 5LLDA 4L07A 2WYUA 1NFFA 1WBDA 1NVWQ 1Z33A 4EPTA 2FN3A 3DCYA 2ZSHA 3IVMA 1GRRA 4ZQFA 5DT9A 2CYBA 1L5QA 1O96B 1Y33E 3CKLA 4LWPA 3PA6A 3UWOA 3RNLA 3UT0A 4DCTA 4KBGA 4MJ3A 4EVQA 3TLCA 3WLJA 5B5SA 4LOIA 3FTFA 3WRYA 1Y7PA 3ENZA 1JDVA 4ITRC 5IYZF 1F0KA 4BO6A 4B8YA 3O4FA 5BUCA 3AINA 2LDXA 2VRNA 2H08A 1C41A 1G6Q1 1NKSA 4EFMA 2Z2KA 3B3JA 3UUGA 1J9ZA 4JBIA 3Q3GE 1KMMA 1XLWA 2FW9A 4JLNA 2DLDA 3D2LA 1XRPA 4TROA 5KC8A 1G38A 2VSOA 5BYBA 5C52B 3W0LB 1NDUA 4NX2A 3FNFA 4EHHA 1U2RA 3GUCA 4PXAA 1XDSA 4CU5A 3L6CA 2KJQA 5AKLA 1CWUA 4XQ9A 4EIWA 1C0KA 2PT6A 3O2NA 4B0PA 4ENSA 3AJ9A 2VBFA 4MQ4A 3BD6A 2NU9A 5JD4A 3OUUA 4ND2A 3F5DA 4JX8A 2I6SA 1OMOA 2XYQA 3R09A 4B2LA 4D44A 5I8PA 3L7OA 4Q4DA 1FX0B 2ZWMA 2FY8A 4JI2B 1PW5A 2FSGA 3ISJA 1DS6A 3QYJA 3RC2A 4C2UA 3FTNA 1FQKA 2VK4A 2HSDA 3H18A 2DEUA 1JG2A 5DH9A 1TOAA 2O8CB 4FEAA 1O6CA 2Z6QA 3AESA 3Q6QA 2I03A 2GR9A 3KOOA 3T4PA 3CCQB 1VHLA 4UE6A 1LNQA 2GZRA 2W98A 1HV8A 2XB6A 3GAFA 2HM7A 2PKQO 1NTOA 2X1LA 1E6MA 2IE0A 3KBOA 4GOXA 4DA7A 2RJ3A 2DQSA 4HLCA 4N3AA 4DLNA 5IU6A 3FJOA 2YQ5A 1UBKS 2MINB 1CVLA 2WMYA 2GASA 3JQ7B 3PWSA 4CTJA 4QGSA 7AT1A 1RJGA 2IK8A 3ETNA 4BP1A 1KI8A 4R1QA 2P3MA 3ICQB 3A4YA 2C3MA 3MZ0A 2XNJA 1YHYA 3H4MA 4W5HA 2B8NA 2YYSA 1MKYA 1Z0FA 4MS1A 3LMKA 1C3OB 1XZNA 3JD3A 4NIMA 1FMTA 1QO7A 3MK31 4CE6A 1C3XA 3EXG1 3PLRA 4UUMA 3NANA 1TM1E 2WAXA 2H4XA 3RVPA 9LDTA 3OY7A 3BSSA 3WMGA 2YY6A 3HY3A 3NONA 4HDNA 4Z9FA 4TZKA 4JXXA 2IUTA 3RF6A 1X7YA 3NLLA 4M38A 1KYXA 4FNGA 5IT4A 3W6OA 3LY7A 3IKVA 1RQPA 2PX3A 3LLVA 4A26A 4EY8A 4CIYA 1FYEA 1IRXA 2IPMA 2H5JA 2IZOA 2V7QD 5ER6A 3RVDA 4ZYZA 3KG2A 2A5LA 2LIPA 3HBFA 5ALYA 1ZR2A 221PA 3V9AA 3KWFA 2BEVA 4LNAA 5LP6A 4DK0A 4X64B 1GA6A 4KO8A 5HQ3B 3WLPA 1BKYA 2EGHA 1TVCA 1G9XA 2QA5A 5AVKA 3WQHA 1YGPA 4B74A 1AQYA 2X1HA 1R2QA 2Z4SA 1UJ2A 1V4BA 1VBFA 2C4HA 4CFSA 3CBGA 3O8QB 4FI3F 3ITDA 1PEKE 4Y2SA 4JEHA 3K6KA 4ZAYA 2HH9A 1KOGA 1NXTA 3GEHA 4KXVA 2C42A 3ZOZA 1E6KA 1XTTA 4YO7A 3ND7A 1HEYA 1IBSA 2GQ0A 3GJYA 4YRIA 2IU4A 5A2QA 2IBMA 2VXYA 5TPZA 2BGNA 1PN3A 3C5CA 3F71A 1VG0B 4LHXA 2COKA 2Q46A 1Y1SA 4BNZA 5I4BA 1PW7A 5FYDA 3S7ZA 3CEPB 5I45A 1MCZA 3AEUB 3BJRA 3OOJA 1K08A 1UPUA 1Z5UA 1AB6A 1LNZA 2HFKA 2GKOA 3CCEB 3QBJA 1DAGA 2IZ7A 3C97A 1Z4MA 2XT9A 3GLVA 5KHAA 3TTYA 5EZQA 5LFAA 4N5LA 2HT1A 1EXNA 3PE6A 4FE7A 4RCVA 2I87A 2O23A 1DJOA 4MP8A 5B3JA 5BN1A 4D3DA 4E7OA 2BMJA 3UBMA 5JZOA 4Z9AA 4CKEA 3FMOB 1V0JA 1EDBA 3CX6A 4EHNA 3SKYA 5BW4A 5IJWA 3V7AA 3GFRA 3DAFA 3GC6A 3Q5EA 3FJ1A 4Q1CA 4XIIA 3VZPA 1L7XA 4JKYA 2GB4A 1JNYA 2XIJA 3EK2A 3A3BA 1IZ0A 3GPBA 3FPFA 2R8XA 4ZO4A 1NWCA 2DQZA 2G76A 3L4SO 4I7EA 3X1YA 4AJHA 2BTEA 4CG3A 4YAOA 1C1DB 1WZCA 2FTKE 4Z9XA 2CNWA 2XUQA 4DYDA 1QRAA 1XKXA 3JVVA 4XYEA 2DFKB 3QOWA 2GN8A 4IFTA 4RY8A 1QVZA 2TRSB 3TRIA 1M54A 1C4OA 2O05A 1DLJA 3EZ6A 5JWOA 4MCHA 4QVJA 3IUBA 2YZ2A 5CT5A 4MVCA 1E9DA 3VR4A 1GZVA 2J09A 4G5SA 3CNHA 2EARA 4DBLE 1K75A 2VDUE 1AK2A 1GT91 3H86A 5KNDH 1A9OA 5T4EA 4NENA 3KFLA 3WC4A 4B6SA 2VDWA 2QB5A 5IZ4A 1W4LA 2R8BA 3MWFA 3K71B 3EVDA 4RK1A 1ZK0A 1S2GA 4WNYA 2OZEA 1QWOA 4Q1VA 1VSVA 4MQEA 4HQ0A 4YJGA 5BV2P 4UDNA 4TMKA 3F8WA 3A28A 4TTIA 1ZESA 3GRUA 4JJGA 1K6XA 1UOEA 2E5WA 5DN9A 5CB4F 1S0UA 3GOQA 3RSOA 1TX4B 4OQMA 1VE1A 4R1SA 4S05A 3BH7A 4MGIR 1C1YA 4Y30A 1MJ5A 4NU8X 4E4YA 8AT1A 1NBMD 4XR4A 1TTHA 3D3WA 4XQFA 4F04A 3U9SA 1HZZC 1G8PA 2Q1XA 2QVBA 1QBKC 4WNCA 2IWRA 4O4HF 3HEAA 3MPOA 4B3RB 1Z3CA 1ZW1A 3U0BA 5CBPB 4DLTA 3ILYA 3R4VA 3S68A 4OLJA 2ZKLA 1SRRA 5KKCA 4Z49A 2GRUA 3CNQS 1SY7A 4JB2A 5KOJA 1B8UA 2XHZA 1RU3A 3TR6A 1U0NA 4G56A 1Y42X 1NSTA 3MINA 3ONUA 4OL0A 2VHJA 4ME6A 4BNWA 2W37A 3PG5A 3IKLA 2QR5A 2C0PA 1N2CA 2V5AA 1P2VA 4M1MA 3OG9A 3HXPA 1HDCA 1S2OA 4K2AA 2QYTA 2DTXA 4Y1RA 4ER6A 4KHPB 1MIHA 2LXNA 2H5EA 2I55A 2QR3A 3KAQA 1UKBA 1ZK4A 3G2HA 1B3BA 2G0AA 2YWRA 1F06A 1YCDA 2ZKIA 3UGQA 2FK7A 2D1TA 3D8TA 4X63A 5KOHA 4UHCA 4B4VA 1ODFA 4HYYA 4JQCA 3K5HA 3KKPA 5G4LA 1TCAA 4X71A 2Z0MA 4ZOCA 1C0IA 2PX0A 3ENQA 3HJRA 2NVUA 3TSAA 3G2MA 3T3IA 4E13A 3SHWA 4YRRA 1K6IA 1BOOA 5G0WA 4PG7A 1MTZA 4QPDA 4D6PA 3RB8A 2XMRA 2QGNA 3X1MA 4V02A 1S1CA 1OY1A 1IN8A 1DXYA 3L43A 5TEWA 3W05A 2VDKB 1PZNA 2A57A 4LRUA 4UBMA 4A8JA 3TFOA 1P0CA 2KMLA 3D6MA 4NBVA 1P1HA 5ALJA 3KO8A 4XSVA 5ILGA 1VFNA 1S2IA 5TGDA 4FDAA 2BGWA 5KVSA 1D07A 2PYDA 4FSDA 2ZW9A 2GFHA 3QPAA 4P0TA 3VDXA 4F8YA 4R1UA 4QM7A 4WXPA 1P9WA 3CT6A 2XQKA 3ZWCA 2FMTA 3EJ6A 4DCVA 4YUAA 4WH0A 4MAAA 2Q4RA 4RMNA 1DOAA 2ATEA 1MENA 2QVLA 3VR2A 2J67A 1SXJD 3BK1A 3EUFA 1CU1A 2B6NA 3P2KA 4ZVSA 1KYQA 5T4FA 2PUWA 2BLNA 2ZI9A 5AVYA 3NU1A 5HS6A 2SNIE 2HMUA 3HVIA 5C18A 3DUFA 3HKDB 3UF0A 1WDKA 3CEHA 5K3EA 3JD4A 4H1HA 3PTAA 3A3OA 2OHVA 4M8NE 4BE4A 3NR2A 3OZFA 1P72A 1SPBS 3KZNA 3QBTA 5BVGA 3OOHA 3ED5A 1A82A 1C30B 1CPYA 2OENG 2PGOA 1UM8A 1PJ4A 1MAAA 4HXFB 4Q3DA 4EG8A 4IINA 2ZTGA 4IUYA 4QEKA 4X6UA 4DR1B 2I2XB 5F21A 2Q28A 2IYZA 4DTIA 5A4DA 2I4TA 3IDSA 2CNBA 2NO5A 4MUEA 2W00A 1JPJA 1XFOA 4KYUA 1BVRA 1DO2A 5D1HA 2W5UA 3V1NA 1MH1A 2M5SA 3ZY3A 1X8KA 1U2DA 2C5AA 4S2EA 4UTVA 2CXUA 1FCJA 3QITA 1SKYB 4QTTB 4Y6SA 5FBKA 4MJLA 4A91A 4DA9A 1YIDA 4HAYA 1HNXB 1EVIA 3FBWA 3OTHA 4LSZA 2ECPA 5E6RA 3ID6C 3VPCA 2P9FA 2G8NA 3DE7X 3O9VA 2LCFA 3P5BA 3THWA 2XMPA 4U2KA 2X9GA 5REQB 3KSUA 3L0ZA 3F2IA 3MYYA 3JD2A 4MEJA 5I7UA 4RL6A 2QZPA 2R5FA 3DR5A 2SCUA 3BB1A 3ICEA 3K9LA 3QKTA 5THQA 1C9EA 1M2FA 1SUIA 3H04A 4QU5A 1TE2A 3JWEA 4RKFA 3WB0A 5JC1A 1DIRA 2EIHA 2FSFA 1A2KC 4NOKA 3NRJA 4ZQCB 3ZHQA 4JR0A 4CM1A 2ECKA 4LSGA 3EISA 1AT1A 4PZDA 2ZWIA 4Z4SA 4MOWA 3VSBA 3PF9A 4AMGA 4B3MB 2X6YA 4NOLA 4PZUA 1FTQA 3KLNA 2JJYA 1UD3A 4D45A 5FUMA 1AM4D 1XRLA 2HA6A 4WUTA 3QOYA 1Y7IA 3RY8A 4N7RA 4F5DA 4R2LA 2FWNA 4QUEA 1K4YA 4WESB 3IEXA 4IQ4A 4P7JA 4LBVA 4YBZA 1G9TA 3ZX5A 1Q0SA 2FPGB 2PMCA 4GUDA 1U80A 2ZG6A 4IRMA 4F0JA 3GLGE 5E0KB 2XSZD 3LYUA 1OA0A 2OM6A 3SZUA 4BQQA 3EPJA 1W36D 1V7CA 1PZMA 3H6HA 3Q98A 1UFQA 4FZ3A 3VHQA 4DABA 3KFXA 3PDHA 1KVQA 5JEEA 4O0MA 4GKKB 1XZEA 4CDRA 4TTSA 3ASTA 2C2XA 2PUTA 3QJYA 5F78A 3KZOA 4HWSA 4RYLA 4D8XA 1RHKA 1TO6A 4EVSA 3OLYA 2DFLA 5CNIA 3UB2A 1GGHA 4MR8B 5GP1A 4AYXA 4KSBA 2VP2A 1FMJA 4RKYA 3L8CA 1W581 4BMVA 4OHOA 1KI4A 4C01A 3OPMA 1JKMA 2NADA 1MW8X 1P2BA 2GFIA 3NAZA 4AECA 3DC2A 3D81A 4FC6A 3KQKA 1RPAA 1MVOA 1QLJA 1QF7A 3N2NA 3DLTA 2L82A 2VKTA 1CZHA 2GDZA 4ENVA 2DR2A 1DC6A 4Q00A 5AO9A 1IJFA 2IPAB 4KRFA 2I3AA 5DU2A 2Q9AA 3MBKA 3T34A 3VYTB 1EIWA 1W7AA 3DPSA 1KOLA 1XVVA 4W5NA 4OKNA 1U5BB 1HLDA 1A72A 3KKOA 3TZEA 5FBVB 4FHFA 4QDZA 2IHYA 4H2DA 4DRYA 3WBFA 4LOHA 2DKFA 2D3WA 2GZ3A 1GAXA 5L6MB 4RLSA 4CF5A 4AUMA 1T2AA 5K0ZA 4E1BA 1SOMA 2A9PA 5HS4A 1XNGA 1KYIA 2BFWA 3SKVA 1V3TA 4N03A 1I3KA 5KYUA 2YYYA 2C7OA 5THXA 2IS4A 2XMQA 2PWAA 1Q1BA 5FR1A 1RWOA 3LH5A 5JAZA 4ABTA 2D1FA 5K6TA 1SCUA 5EJAA 1EK2A 2R6CA 2ZUVA 1Z68A 1DC3A 2WU3A 1Q0HA 3CRQA 5CHYA 3R7FA 2B2NA 3PZRA 5JAQA 3RM3A 3RRNA 4EEZA 3N7TA 3I6ZA 1YDMA 2AFIE 1A71A 2EC5A 2FB9A 2I2AA 1JHDA 4K1XA 1VLMA 3OX4A 4RESA 4BJ5A 3ZDDA 4OYYA 4Y2TA 3HU2A 1I3NA 3MJTA 4Y6OA 5TGTA 4CM5A 2WR8A 1X7WB 5BR8B 2EW2A 1HFWA 2MYNA 4HB3A 3ON5A 1QDUA 4LDNA 2VQFB 2HJSA 1E2MA 3V1MA 4RF5A 2DQKA 4R31A 3ANNA 4O2LA 5EJIA 3ZDZB 1L4LA 4FOOA 4D4HA 3D4IA 3TB6A 1N9ZA 2DT5A 1ZSYA 2H16A 1FFXA 2XWSA 3AHJA 1RMTA 3HDQA 5CLJA 3W34A 2BW0A 1Y89A 1W85A 3WWDA 4A6XA 1Q50A 3OQJA 1NV9A 3BILA 4CEJA 3F4LA 2FEKA 2H9AA 3EH1A 4QGGA 5DX1A 5C32A 2KBFA 4AF6A 1JFTA 1UEJA 1YZLA 2BKEA 4HUQA 1ZGBA 2ISQA 1KERA 2J3JA 4Q4JB 3EEOA 4R2JA 3M4ZA 1J97A 2DPYA 2LW7A 3M0EA 1PTJC 2LGJA 2VHZA 1LQ2A 1UDAA 3OWHA 2OXTA 5A02A 3VO2A 2BOVA 4OK3A 1QZUA 4ISBA 3KQOA 3PCXA 2I7DA 4P7BA 3TCKA 1YUMA 1Z6XA 1IUPA 4CMIA 4EBFA 3I52A 1AKWA 4PWYA 3SFZA 3VPSA 1SELA 3X43A 3GLFB 1XTPA 5AM5A 1M1ZA 3MS7A 2DC1A 1UBTS 1SJ9A 6NULA 2Z43A 3KM0A 3IHLA 5A3SA 2WILA 4HTFA 2YMMA 3EXHA 1MFPA 1VQ8B 2WJIA 2VHYA 4M9XA 1GV0A 1B8NA 2BI7A 3A1VA 3QKSA 4EGQA 3F5SA 4W7HA 3DFIA 1KDZA 1OPXA 5J35A 2IYLD 2WB4A 2VQDA 1AKYA 1N33B 3IUJA 1UADA 5DBEX 2BWJA 2Z9BA 4XUDA 3ZE7A 2FWRA 2R1TA 2WMDA 1WV0A 1UMCB 4FIDA 1U0LA 3QV2A 4ZVTA 4YFYA 1L4FA 3H99A 1QH1B 3ASRA 3O95A 3BD7A 2XKJE 3E8MA 5G3YA 3ZQKA 3LZCA 2AQKA 3BE8A 4IXTA 1Z5WA 5H5JA 2RCYA 3GARA 3IJRA 3PVZA 3CC8A 1KAQA 2CLIB 4EAQA 2DFNA 4MV4A 4K0KB 4DJEC 2QM0A 2WFAA 3NASA 3BIWA 1YL5A 4B7XA 1A8SA 2V98A 4KXLA 1KNQA 1TYCA 2O3SA 2WJ3A 2QL6A 1M8GA 4BASA 4BKMA 3RC9A 4BJHB 1D1PA 2XCIA 4NBRA 4XMYA 1HMPA 4GLLA 2CBXA 1YASA 2R6GA 4EG5A 1R9GA 1T9GR 3LW7A 4FX5A 2YZGA 3IQIX 1H2EA 4QJBA 4QOJA 2ZJ2A 3RODA 4MR7B 1DDOA 1JYSA 4YHHB 2Y6VA 4O2BF 5BSRA 2Y71A 4R3UC 1YA6A 2AOWA 4OQZA 2NUPB 3R0XA 1OLSA 5IFKA 2B36A 1ZHOA 3ROKA 4CIAA 1TKRA 1OBFO 3ZWYA 1XA0A 2LZ0A 4X1IB 2HI0A 2GWRA 3AKEA 4IIJF 5C4MA 1X0XA 3T7IA 2ZAYA 3TQRA 1M2NA 2G06A 3TQSA 1AVTA 4DWVA 1NBEA 1JDUA 1OX6A 2CSXA 1C80A 1U3TA 4IUDS 3ANLA 4JBLA 3RG8A 1GA4A 3H11B 2GDJA 4ESVA 1ZM9A 4P9SA 2B4AA 4H7KA 2OBNA 5JE8A 1M7GA 3ROZA 3SMQA 2OC4A 3K5IA 2GN6A 2B7CA 3HUUA 4RM2A 4MV7A 4TVOA 4CUKA 1HBJA 1K86A 2HA2A 4DDUA 3I8SA 4CL8A 2WJWA 1DTEA 1PJBA 1RWKA 3E8SA 1DOZA 1XRMA 2C31A 2PX4A 2X1VA 5A4AA 2GN4A 4UQOA 2AJCA 3T4EA 4DLWA 4CKXA 2J0VA 2XMDA 4E22A 3R9XA 1R0XA 3I8XA 1NP6A 1EDDA 2PKWA 1GA1A 3AFHA 3B13B 3JZFA 3NDIA 3CMMA 4GNRA 4M1ZA 2Q5IA 5LMZA 3BIFA 5HXBA 1U0OC 1VGVA 2GTHA 4JP8A 1KSGA 3VKVA 5IS2A 2GN0A 4LNHA 1QHIA 2A0YA 2H5IA 1DE0A 2HMSA 2ZI6A 2JGLA 3IUEA 3PXGA 3Q15C 4BRZA 2PZEA 1KQ3A 3ECCA 3ZCXA 5BVHB 4N0EA 4LI3X 1L4MA 3HBMA 4D5GA 1DCMA 2YVAA 4N8DA 4OF4A 5SZKB 3U7IA 5LJIA 3HYLA 3NIWA 4Q4HA 2H0AA 2ZSFA 2O20A 4IKOA 3VHXA 1H42A 1RLJA 2C4TA 1KF0A 1GPBA 2CJFA 2R6R1 2W2KB 2CWDA 4KMSA 2HCRA 5B58C 2RE8A 1R8JA 2VK1A 4H0NA 3M33A 4Q1DA 3MJFA 3RK1A 2R1VB 3VNUA 5LP6F 4IJ5A 5B37A 5TMBA 4HEJA 3HNRA 5CRIA 2I76A 3FWNA 2Q5JA 2YIJA 2VP3A 1WMEA 3PKIA 2GM5A 5BMVA 5C8DA 2F55A 3PJFA 1ZICA 2IU3A 5DDIP 3RHFA 2HQBA 3P0FA 3FDXA 3U4DA 3BRSA 1M1NB 4P98A 1E94E 3JATB 4UU8A 3F6RA 1TA4A 1YMUA 2NTVA 3L7LA 1CR6A 5JASA 2WSSA 1AXEA 3COYA 5D01A 5ENDA 1WUJS 4Z3OA 3DYVA 4C5AA 2VAMA 4ODIA 3R0ZA 4NU0A 1ZQ1A 2IXDA 4MI6A 4S1PA 5AM3A 3KUCA 4EYGA 3VOSA 1D4AA 4IZHA 6AT1A 2B25A 3W8EA 1UDXA 2IEBA 2RKWA 3GA5A 4TKOB 4FS3A 1BX1A 4GP9A 2LCQA 4RQUA 2L2QA 4F72A 1TA0A 4DQUA 1KI9A 1YIOA 3Q7SA 4CTMA 3NFRA 3BYZA 3DE2X 4CQMB 4TMFA 4P93A 3C8ZA 4Y6RA 3B85A 3KV1A 4YALA 1RRPA 5IVKA 1JKFA 2J5RA 3A4VA 3D31A 1YOVA 1RIIA 5F3WB 3GJQA 1QS0B 5C8VA 2VJMA 3OQ6A 1ZSVA 4ER0A 1NF8A 1N2HA 1MAHA 3F9CA 4YUVA 5DNYB 4YAIA 3LQRA 2WJGA 5ERYA 3LUPA 1A50B 3HM2A 1OLOA 5DBGA 1W93A 4Z99A 3ZWPA 3CBQA 2GILA 4M7PA 4MDYA 4EZIA 4P0PB 3ZHTA 1NNEA 2ZRHA 3QX8A 4H31A 5ULLA 5F98A 4PNHA 1VKOA 3WL8A 1Z2PX 2IP2A 4WNAA 1FXWF 2JIPA 2E4WA 1FFBA 3SX4A 3JVIA 3R3XA 3EWSA 2Q6KA 2D13A 1FDUA 4QXPA 2PKXA 4TWAA 2OTCA 4QAQA 3EPHA 1RI4A 1XFAA 4QPNA 3E82A 5BQ5A 4MI9A 1II0A 3VM6A 2WFZA 2P2SA 2P9ZA 5HW0A 1MEOA 3WRWA 4I1UA 3WGLA 4JB0A 3EFOB 4N0MA 1CY7A 4IKEA 2ZDGA 4FCCA 4TZTA 1YNSA 2Q8QA 3A2KA 1PUIA 2ZRLA 4QU0A 3STHA 3KL9A 2CKMA 1BYIA 2X2FA 5ENZA 1Q19A 4J0EA 5IP5A 4ZYXA 4IJVA 1VQ7B 5EZYF 3JAWA 4RF2A 1E69A 2M6KA 4L9WA 2HOQA 3PDUA 4AUEA 1HNWB 2IE8A 5J1TB 3VU0A 3PSHA 3W78A 4KRGA 3T5GA 4F4UA 5FAKA 2EKDA 3DBLB 5BN4A 3VKFA 4HDRA 4CLHA 4YFVA 3RUIA 4B3SB 1SM4A 3SOPA 4OUDB 2PS3A 4RPGA 2ZE8A 4H15A 4WA7A 1Z5ZA 3RFTA 5HZKA 2J9FB 2X13A 2ZYHA 1SKUA 4L5BA 4EHDA 2CNNA 3MXTA 4C04A 2BDEA 5IX8A 4ZTZB 4NONA 2QHXA 4XB6B 3WBBA 1JAHA 1U9YA 2ID4A 3CLSD 5JDIC 1SBTA 3QE4A 4G07A 4I8XA 1VMDA 2BFEA 3BJIC 2G9NA 5HQJA 2O3QA 1RXVA 4YAFA 4CL2A 2LDBA 2O8DA 3WLRA 1PYDA 3NEYA 2YJTD 3BJZA 3I05A 1K6JA 1M5TA 2GAIA 2ZBQA 3QEMB 3N58A 1XWWA 3SF8A 4RSGA 4Q05A 2ZSDA 5A5VA 4M1OA 3OIGA 1PD1A 1L9KA 2V7GA 4TKZA 3TZQA 3QU9A 3IEKA 3TTUA 1GDTA 1LDGA 4DEXA 4RQAA 1VGRA 1DFGA 4KFSA 4BQIA 2FYTA 5AI9A 3PGLA 3UHOA 1CZLA 1EK5A 3R7WB 1CVRA 2G72A 2JD1A 2FH5B 3D1JA 4ZGBA 1E9FA 3R3SA 1L7BA 1KETA 1ONNA 3PFIA 1O5OA 2O2YA 1GNQA 1KWGA 1TYDE 1CBUA 3CX4A 2ODWA 1ZAKA 3VAZA 2FQ1A 1P2SA 4J76A 4LZNA 2JDID 1CY4A 4CKCA 1AH2A 3EYWA 2C5LA 2ZE5A 3A6DA 2HIMA 3WGUA 2RI1A 5DMHA 5FUXA 3RR2A 3I0NA 2WSLA 3RK0A 3VYWA 3SVLA 2G1PA 1ULTA 2GF9A 4YJ3F 4MGHA 1DBWA 2V74B 1SXJC 2YICA 1BWSA 3L4BC 1F4LA 1M2VA 5KSPA 2D5AA 1H0KA 4P12A 3FWZA 1L3IA 3I61A 1QONA 1ZNXA 2DWPA 1G0OA 1WR8A 3GD5A 4R0VA 4Z2YA 2X0FA 5BSWA 3Q7IA 3DLCA 4Z4EA 1JFRA 3RQIA 2PGJA 2VO1A 3GY0A 2G04A 2JGRA 3QKWA 3EAFA 4X20A 5D5QA 5LYJF 1AUPA 5A7GA 5C7IO 2XXAB 3MSXA 4NMHA 4TLLB 5DKFA 3QRWA 1T29A 2ZK7A 1QUEA 4JOSA 4KK3A 5EKDA 5C34B 5K0NA 2X0KA 5IK2A 2YJNA 3DFFA 2O2CA 2XNHA 3KETA 1UAYA 1N6IA 3C39A 1LQTA 1F8UA 1K8RA 2HA0A 3FYCA 3V34A 4A2CA 4ENWA 4DR2B 2O57A 3SX0A 2NV0A 4I4LA 4YP9A 2XODA 3NP9A 4GWKA 2Q9CA 1E6WA 2QRVA 1HA3A 1OHHA 1G55A 2RG1A 2VYVD 1PVVA 2YXDA 1PFQA 2AF3C 4Y2XA 2EX4A 3IT3A 2X3UA 2WHPA 3EIQA 1T5DX 2YOFA 3K8OE 3OCVA 4ZARA 3R6WA 1QFXA 4OXNA 4NEHB 5GONF 3SZRA 2AE1A 2BFDB 3MCUA 4R2HA 1YD7A 3VR3D 3WQBA 3WIEA 3W5VA 2I6FA 3H2HA 3JQAD 3SHTA 2X0DA 2Y2VA 4L9AA 2EFGA 3DMFA 1M1UA 1XPRA 3CPXA 2BMWA 3KB1A 3CRRA 2P9JA 4LN1A 2WF9A 4RMIA 4UULA 4QSMA 1KEKA 4JJEA 4RJLA 2Q8NA 3K2BA 5LM3A 3NTQA 1YKFA 5FPHA 1RXSA 4MWBA 1QGAA 4NESA 5E9QA 4MYUA 4EUNA 4HLUA 2GHTA 1M6VA 1KI6A 4NYIR 3R6LA 3AHEA 3TLGB 2GARA 3O7WA 1NFRA 3QPVA 4C21A 4O2AB 3U17A 2XEXA 2X9QA 5LQRA 3I42A 4EGSA 3GCGA 3FRIA 3MWDA 1QG6A 1GXSA 4TUYB 2AN4A 4B3IA 2YFKA 1ZK1A 4LMBA 4KDCA 4PU0A 3MT0A 4JUFA 4CL0A 5CVDA 4EA9A 4RDJA 4LXYA 4OQNA 1CIJA 5FIUA 1TKBA 2X2PA 3D4PA 1YACA 4Z0PA 1XAJA 2CFIA 2WP0A 5B1DA 1YTUA 4WDRA 4ZU6X 3SYNA 1YS4A 2WF7A 2PA3A 3LUJA 1K27A 1PD0A 3HR7A 3HXMA 7MHTA 3PGJA 1W36C 4LF5B 3QUBA 3F6CA 5JANA 1YCGA 1KC8D 1E79D 4LJ5A 2FFBA 5K5EA 3RYIA 1WXFA 1VA4A 1ZIYA 3FPCA 4OJTA 4MCAA 1QPGA 2AUNA 1ZMRA 3W5HA 3PDJA 1VHWA 3OP4A 2Y92A 2EBUA 2H18A 3SEZA 3KP1A 4G5GA 1WQ1R 2EGUA 1W1UA 1G17A 3JQFC 3DMTC 4EG3A 4BVLA 2EFHB 5CT8A 5T4BA 2ZUEA 5ECYA 3AF4A 1X1TA 2QMEA 3SYMA 3I9MA 1MBZA 5JR3A 3O4JA 3NVKI 3KTFA 4UARA 1DAOA 1L7NA 1P80A 2IY9A 3TE7A 1VPWA 2F1LA 4ZCTA 1CRZA 1GRQA 4YDQA 1J9GA 4H1UA 1PLJA 4BLVA 4I14A 1LY1A 5AXAA 5KNCH 3OZCA 2Y1OA 4O25A 1V48A 4XKJA 3W7BA 3VC7A 3ADBA 4QPZA 3UTCA 4GGOA 7YASA 1N36B 3WL3A 2NT4A 3K20A 4MK4A 4KYIB 1R0ZA 2R7LA 3GIDA 4D99A 2W2XA 3OTWA 5AVWA 1P61B 1TZCA 2JIRA 1TM3E 1DV1A 3AP3A 4RORA 4EHBA 5KDDA 4DIUA 3SZ3A 4ZYUA 3RI3A 1YCFA 2YN2A 3EC1A 5J59A 1QF6A 1VXOA 1EFVB 4ZVNA 3AVTA 1P1BA 1XNHA 1M2OB 2FPUA 5EJ9A 2O8FB 2FWIA 4Q9DA 4FC7A 1QIMA 4PICA 1REQB 1SOVA 1CR4A 1J90A 2X3FA 3U48A 5CITA 5M34A 3GT0A 1GFIA 4Y9UA 1KZ4A 1XI2A 2GCEA 2QXTA 3V4VB 4XWOA 4EVRA 2UU9B 1KC1A 1L8AA 3GCWA 2QVZX 2BBTA 1KZ1A 1U0SY 3OU6A 4ZOLF 2YH2A 4MRNA 1KHHA 1TM7E 4D9CA 5DHTA 1N06A 2DPHA 4YRJA 3WDLA 3ZBQA 3C3DA 1EBUA 2RG7A 2OG2A 3B12