1BX0A

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
296
Chain Sequence
b'HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVLVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
total genus 96
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1bx0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1bx0A02
1R5OA 2PMDA 1A8PA 2B7CA 1IB0A 1KK0A 4R71A 1VQKB 2EIXA 3JQQA 1YHQB 4B4DA 3WNBA 3QFRA 3W5UA 3LYUA 2AHOA 1OGJA 2B7BA 3MHPA 3W2FA 4P6VF 4LBZA 3AVYA 3CB4A 4ZCLA 2PIAA 1EXMA 1BQEA 1Q86D 3OJWA 1M1KD 1QVGB 4FWTA 3QFTA 1G7RA 2BN4A 3QSYA 4U9UA 3CCEB 3AGPA 1F20A 2NPFA 2YWHA 3J81k 1E63A 2CRVA 4RCYA 4G1BA 4PC2A 4N3GA 1XB2A 1KRHA 3QFCA 5THXA 4G5GA 1GO2A 2XNCA 5FA6A 3SJZA 4AC9A 1QFJA 4AF7A 2QA4B 3FJOA 2BVNA 3CPWB 2OTLB 2YWEA 3W5HA 2VNKA 3VO2A 4ZCIA 4NCNA 3G6EB 1BX1A 4LC0A 1YJNB 2DCUA 4Q7JB 4B44A 3G71B 3JQRA 1IJEA 1JA1A 1S0UA 4YHBA 1DG1G 3V76A 3B82A 2RC5A 5HXBA 4K1XA 1NDHA 1VQ4B 1W34A 4ZGNB 3G4SB 3VMFA 1QUFA 1BJKA 4Y9UA 2QDXA 1JJ2B 1KTVA 3CMAB 1KD1D 4PC1A 4TMZA 3CCJB 4UAJA 3LO8A 4QHYA 4DQKA 3W2IA 4ACAA 3W2GA 1FNCA 4RD3A 1VQ8B 1E64A 1GAQA 1YJWB 3PENA 4BPRA 2YWFA 4F7DA 2HDNB 2BGJA 1CQXA 3AVUA 1KJZA 3MCAA 1WDTA 1ZM3A 1G7CA 1U2RA 4PC3A 4M53A 2C77A 1TVCA 2QEXB 2BGIA 4B3XA 2X3UA 1K73D 3W2EA 1VQ7B 3VNUA 1Q81D 2BF4A 1W2BB 3CC7B 3WY9A 1FDRA 1TUIA 2J7KA 2GQFA 4HE5A 4NBSA 1QG0A 4P3YA 2BPOA 1H42A 1N0UA 3B78A 4PC6A 1DDIA 4FK8A 4HE6A 1QH0A 4C43A 2BMWA 4YAOA 5AN9A 4TN1A 1N8RD 4H9GA 1OB5A 1ELOA 4RD1A 1QVFB 3OJXA 3MMPA 1FNDA 2QN6A 1JNYA 1R5BA 4FN5A 3CMEB 2QMUA 1VQLB 3CW2A 1F60A 1J9ZA 1SKQA 4Y9RA 2BM1A 1QGZA 2B5OA 1JB9A 1B23P 1GAWA 2GPJA 1QFYA 3AVXA 1CNFA 1AMOA 3B8HA 1AIPA 2R6HA 1ZUNB 1I7PA 4AF6A 1VQNB 1XE1A 3ZBUA 2VNIA 1CNEA 2BV3A 4LBYA 3AVTA 4ZV4A 5TY0A 2C78A 3AVWA 1KK2A 5EMNA 1D1NA 2VNHA 4LBWA 1N0VC 3ZC3A 3CCVB 4M2LA 4C0SA 1KC8D 1FNMA 2DERA 4LBVA 3E1YE 3AGQA 3WYAA 1QX4A 3OZVA 1KQSB 1EFCA 4B48A 4PC7A 3CC2B 1D8TA 2OK7A 5JBQA 3W5VA 2BSAA 3OW2B 1Q7YD 3VNVA 3CCQB 4M4SA 4YAFA 3JQPA 4IW3B 2RC6A 3CCRB 1VQOB 3WBJA 1E62A 1QGAA 2OK8A 1GVHA 4WQMA 4EH1A 1NJID 1QFZA 1VQMB 1DDGA 1EFTA 3ZZUA 4B43A 1Q82D 3VO1A 5KSWB 3WXMA 1SM4A 5DSZA 1OGIA 4TMXA 4QFMA 2D74A 2HCJB 4DQLA 4RD6A 1D2EA 1TLLA 4N3NA 3U6BA 1IJFA 3U2QA 2DEUA 1BX0A 1S72B 1QGYA 2BM0A 4TMWA 2EFGA 1EWYA 2VNJA 4Y7CA 1KK3A 4PGOA 4ACBA 4TMVA 4B47A 3ZZ0A 3CC4B 2PLFA 4YAWA 1K8AD 5TR9A 3U6KA 3OZUA 1JA0A 1G7TA 2VYQA 2YWGA 3ES9A 3WNCA 2XNJA 3QE2A 2XEXA 4MYUA 1EP1B 1YIJB 2QTZA 4J0QA 1VQPB 1KK1A 3CCUB 4RD4A 3I55B 1FRQA 1ZM9A 1OB2A 1EP3B 1QUEA 1UMKA 4RD0A 4RCZA 1DARA 3CD6B 1TTTA 2OTJB 1ZM2A 1VQ9B 1GR1A 5GV7A 3CCMB 2ZITA 1K9MD 3P27A 1GJRA 3LRXA 3AVVA 3CXCB 2HMAA 3ZZTA 2FX3A 4MYTA 3CCSB 3A1FA 5H5JA 1W35A 5H59A 4RJLA 4ZGQB 4G1VA 4RD2A 1YJ9B 4YAUA 4YALA 1YI2B 4ZCMA 2CNDA 1FNBA 1VQ6B 4TMTA 2DY1A 3WBKA 4M1KA 1YITB 4M0LA 3QFSA 1M90D 3P26A 1FRNA 2QTLA 3FPKA 3I1FA 3WNDA 1R5NA 1G7SA 1EP2B 3W2HA 1W87A 1VQ5B 1H85A 2VZLA 1B2RA 3CRZA 3I56B 1ZM4A 3LVBA 5GV8A 3OZWA 1EFUA 3ZBTA 1HA3A 2DETA 2E1RA 3CCLB 5TV2A 3E20A
chains in the Genus database with same CATH superfamily
4I8IA 3ERCA 2QORA 1TLTA 5CHYA 1B15A 1ZWLA 2VQ3A 1U6JA 2VR1A 3W3ZB 4D81A 5AK3A 2OMEA 2Y1EA 5D5QA 3JWPA 2BCEA 3BILA 3NUZA 3K70D 1ZU4A 1Z5ZA 1XK6A 1UBTS 5GM2A 5JZSA 1JHQA 1GRQA 2GO1A 1SK9A 1NSFA 3IMKA 4PN3A 4B31A 3OQVA 3EG5A 2BKLA 4OBBA 3EHEA 4MKHA 3W5UA 1Z6AA 3SSNA 2ENUA 2PS1A 4JLMA 4CQLA 2I80A 1II8A 1SG0A 3IIMA 3AVYA 5B7PA 4L02A 1GGKA 3AB7A 2BUAA 3GUUA 2BAGA 3IPLA 1U1GA 4S1TA 1O97D 5EEHA 3UYKA 4QUBA 1ZITA 2WSLA 3ETLA 4R8SA 5K0LA 1Q86D 3RJMA 3GOQA 2JLRA 4P1ZA 3RT1A 2NO5A 2W70A 2NUTA 4JSYA 4ZQBA 1SFRA 1X7WB 2NU7A 1DUIA 1PV2A 2JJQA 5ALMA 5TQJA 4DSNA 3GD5A 3TGPA 4D9MA 3ZCXA 4AK9A 3HXLA 3T7SA 5ICCA 2V59A 3R7WA 1AO3A 1XPRA 5ED0A 1VMDA 2L17A 4LYFA 1PR1A 2Q8NA 3EAQA 2FE4A 5C8YB 3JX9A 4HH1A 2P9YA 1O03A 4LCEA 3AGPA 1JZTA 1NKTA 2I3AA 2QRGA 4MUGA 1Z36A 4NMMA 3TFWA 4G9GA 3B3JA 5T8KA 1E63A 4JLVA 3SS9X 3F8SA 3HUUA 4PINA 3LP6A 3R0VA 2JL1A 1QNLA 2EATA 1CG6A 2WZBA 3ILHA 4QGFA 2F1KA 5JWRA 1E6WA 2IE0A 2J48A 3A4TA 1XEFA 3ADBA 3QEAZ 2HTFA 4GOKA 1ZOIA 3VR2D 2AN5A 3JTEA 3VR1A 4FYWA 1U0SY 3OCXA 4HN9A 4YMTA 2CL0X 3NJRA 3EN0A 3DOCA 3AFOA 1KRHA 4XLZA 4DNOA 2F55A 4QZVA 4ETWA 1QYVA 3KETA 1JFFB 3RODA 1KKMA 1LW7A 1BE0A 1JJ7A 4AC9A 1SQ5A 1NX9A 3VDQA 2YIMA 4UHEA 1H9AA 4ZOLF 5BVHB 1XAIA 1Q12A 3DLPX 2BEWB 4J75A 4CT4B 3Q12A 4WY8A 2XE4A 2DQ4A 4KPGA 2IVZA 4NYJQ 3H05A 1DXYA 2WYOA 4KYIB 1AVTA 2NOAA 2WPDA 1L5HB 4X1IB 3R7BA 1NY6A 2SECE 2QF7A 2VXBA 2COKA 2C83A 5NULA 5HK9A 5H83A 2ERYA 4D02A 3L7KA 5B58T 2PT5A 4RWZA 3WMWA 3TFOA 4MAFA 3G6EB 4NF2A 3IJPA 1QRTA 1SEPA 1USIA 4PG8A 4BLTA 4TUYA 5DB4A 1GLGA 3M3HA 2I65A 1V5WA 4ZC8A 1R9JA 3K2QA 5I9IA 2CEKA 4L8GA 4KDRA 4MUKA 4KHPB 3B82A 2F2TA 2WINI 2QRVB 1JNXX 2C03A 5ADVA 4BMPB 4TZTA 1CS0A 4F3NA 5ITSA 5LOVF 3G4SB 2UU9B 1DWPA 1LLUA 3LL4A 4DNFA 1FW8A 1M6WA 3G9UA 2X7JA 2OD2A 1H5NA 2EJVA 4Y2YA 5AJYA 3C3KA 3DVAA 4MARA 5BVGA 2GD1O 3S44A 2ZCJA 3NJ4A 3RPEA 2C61A 3FTFA 3RU7A 1G3MA 1UJCA 2XNDA 1OGYA 3P96A 4DT1A 4QODA 4UUPA 3H6GA 4Q4AB 4MS1B 1M34E 4ILEA 1FP7A 5AKZA 3I9OA 3DM9B 3FG9A 4KRYA 2EKQA 1GUFA 2VPIA 4MR9A 1DBWA 2XGGA 2HK6A 1QYDA 2J3KA 4F8YA 1W88B 1IBKB 3A1SA 3D4LA 2Z1MA 4H7FA 2WTMA 4UD2A 3NORA 1LBEA 2J5KA 2WNIA 4X92A 3BIXA 5BQPA 3PENA 4H1TA 5CB8A 4AJEA 4LXQA 7REQA 1XAHA 2GEVA 1Y7PA 4HATA 2PA3A 4TKUA 4WCDA 5J4LA 1XTBA 4QARA 3UXMA 2FRDA 5JAOA 5IUJC 5BWLA 2QYHA 3ZWWA 4WRRA 3TKYA 3D6AA 2OXCA 2ZL7A 2LV8A 1IC6A 1T5TA 4PG4A 1CQIB 2HHJA 1OY1A 1AK9A 2F1OA 1SUCA 3DL4A 3NZEA 3AR9A 3VV3A 1GZ3A 1NVUQ 3R3ZA 2VCEA 3DMDA 4F6CA 1G7CA 4EUNA 2HNBA 4F93B 1XZGA 1RHUA 3I9V6 1W36B 1AV7A 1H8EA 5CFNA 2F43B 3X1WA 3HYTA 2V4UA 2O8FA 1P7VA 5ANRB 1XTJA 4B6JA 4BS9A 1VOTA 4EG8A 2ZXUA 1JHXA 5JS6A 1D5CA 3OZEA 3T99A 3QVMA 1CUJA 5AI8A 4F6RA 5JEEA 1Z6ZA 1TRHA 1ZKDA 4RSRA 5IM4A 3HP7A 3KAJA 1NRKA 4FGSA 5CDGA 2ZJ5A 4TWZA 2N1BA 2JFGA 3WICA 3CPEA 3V7UA 5G0UA 1MTOA 4JXZA 2P62A 4JROA 4NU5A 1E3QA 4RK4A 5EMKA 3MD9A 3NGMA 3VUFA 4HS9A 1WHSB 1SCUA 3VC3A 2QDKA 4MRRA 1XQBA 1EFPB 1NBMD 2ZSUA 1OXSC 1SA0B 3KQYA 5FTMA 3B36A 4QUZA 4P3YA 2AOUB 2AR0A 3N0WA 1CWUA 1XAGA 3WLRA 2FLKA 3V32A 3WMEA 3F6CA 4HB0A 2J32A 1EVLA 5AM3A 1YAHA 4R7TA 4RF5A 1TW2A 2FEAA 4IRXA 1MW8X 3D7RA 3ZJUA 4MO9A 4R4JA 1EYZA 1P5ZB 4A6DA 3WAGA 1K89A 3UJAA 1RRMA 5BN3B 4D4LA 4HWSA 4GMDA 4JNKA 4CLOB 3C0KA 1SUPA 2XOKD 3ROZA 2BJVA 1EJ2A 4EW2A 3KVYA 3EVAA 1C14A 2OV1A 4ZPXA 2HXYA 3B6EA 4X93A 1IN8A 4FN5A 2I4NA 1C1YA 4QGAA 4US1R 1NLZA 1GXSA 3CF0A 2WWFA 1BEEA 4K40A 3TX6A 1AZTA 1VLOA 1F8XA 5A9TA 2FNAA 3OE1A 2XJ9A 4RDIA 2P6PA 5HNKA 3KXPA 5F4JA 2QX9A 5ALKA 5KSOA 1APBA 4KVGA 1QH1A 2QVXX 2X42A 4NOKA 1OLUB 1TXGA 2WF5A 1A3CA 2VSXA 1JR2A 3GV0A 4LYGA 5AM5A 1Y42X 3HABA 3H1PA 2C4NA 4EA7A 2HB6A 2ACKA 3TIGA 5HDBB 1IZZA 1UWKA 3SYNA 2CVPA 1F48A 2IE8A 2OHOA 1G8MA 3DAYA 1TCBA 1VXOA 4UXHA 2OCPA 1XTZA 2QMZA 3IP9A 1KRXA 2AJDA 4NYIQ 1U65A 1Q0PA 4DLUA 3E8XA 1LLQA 1PDWA 2P6MA 4K6KA 3ELWA 3H5WA 3TTVA 4IIHA 1U2DA 2FVYA 2VF5X 3ADOA 1GGNA 4HP8A 1E2NA 2OCBA 1W8IA 2A9PA 1CJBA 2DQSA 4U6SA 1QLHA 4AF6A 1Q7EA 1U2TA 1U6IA 3F6RA 3H2SA 1V9SA 3I9KA 3Q7PA 1I36A 4L57A 1SZJG 1JYEA 1KO7A 4RFSB 5IH3A 3ZBUA 3USCS 1PUJA 2WJ3A 2FZKA 3STXA 3VDXA 3CTPA 3TDKA 3I5UA 4TVKA 2PAAA 3LLCA 3MJCA 3PQ5A 2YWDA 1FU7A 4X91A 2WOOA 5TMBA 4JAVC 4X1OA 4F5YA 1FS4A 1RRFA 1GZUA 4WDQA 3TM5A 2BHNA 1M6HA 2I54A 2OQIA 1C1DA 1FYEA 4LMRA 4LOJA 5KX5F 4DLAA 2O54A 2WD7A 4MSUA 2E4UA 2Z30A 5ICMA 8MHTA 4RANA 1JR6A 1KL7A 5JCOC 2AZ4A 4JLSA 3QKWA 5BSKA 1DFGA 1XTSA 1C7JA 4R1SA 4JIGA 4IO0A 3Q6IA 3B85A 4UEWA 5FWDA 3DKVA 5HCNA 2V0NA 1NVFA 1KQGA 4ES6A 1CRLA 3A4VA 4HMPA 3E18A 5D1NA 3FWZA 2H4XA 5I7EA 5JH7B 1EIZA 4IKPA 2QGNA 4YCLA 3RS2A 2BLNA 3ZKWB 4CVNA 1PDOA 3R2JA 2KQUA 4DV6B 4XGIA 2WT9A 3EGIA 1BIFA 2H2IA 1HYQA 1K5PA 3ZQ4A 3TAHA 1KVTA 1M2HA 3BMOA 1JKIA 2YICA 1NU8A 5EIOA 2Z5LA 1Y1QA 4R9NA 4WN3A 4UU0A 2YIJA 3CH4B 2ZRHA 1XTVA 4AZ0A 3KQHA 3B7GA 4YJHB 2YHSA 3UW3A 3QI2A 2W6MA 5ALVA 2QTVB 2IQIA 1SRRA 1QVZA 1VL8A 2C00A 2XX3A 1VQOB 3FPSA 3M6WA 3FPPA 1UF9A 1N5DA 3D31A 4D6PA 1NN5A 4M89A 4XCXA 2VHVA 1QS0A 1N2CA 4JI1B 2A30A 4M1EA 4QRIA 5DYNA 3KZKA 5KSWB 2O7SA 3NWBA 1J2UA 2FSVA 4YH1A 1HYBA 1CUBA 2QM8A 3EIXA 3H1BA 4JR0A 3RRZA 3FM9A 4OB6A 4WKOA 3ELYA 3UXHA 1Z13A 3K05A 2XMBA 3NHLA 4GP7A 2FWJA 2VJKA 3O5AA 4WXEA 4WNAA 4X8HA 1A8HA 3SBDA 3ZE1B 4LHEA 4N3NA 3AUKA 3GLIE 3C3JA 5IKEA 4OLAA 1S72B 1E1QD 2VT3A 1BMQA 4G5YA 5LOVA 1TJPB 4TMWA 3AFGA 3P0IA 3NBAA 3BH4A 3OP1A 1BCRB 1RC0A 3E48A 3GXBA 2O50A 3KLMX 3F7TA 3MM4A 4O4HF 3MJFA 3RVRA 2QTNA 3GUYA 3R7FA 1V8BA 3WYEA 1DFIA 1M73E 2XW6A 2ZSFA 1NI4B 1EAYA 4IOKA 1IUOA 2VYVA 3F1LA 2ZUVA 4YP5A 3WLAA 4YY3B 4DWVA 3BBPA 4EPWA 2HO5A 1SQ6A 3QHAA 4IMJB 4QGBA 5C80A 5I01A 2QYSA 3VZRA 3HB1A 4MMYB 1NFRA 3IKLA 1P1BA 4JH0A 4FC7A 4MXDA 4BFSA 4YAWA 1I4DD 3IUSA 1P2TA 4W9MC 1BDIA 2W0MA 4KNWA 1B73A 1D04A 1OT5A 3ZXYA 2ODAA 1OI2A 3JZMA 1MLDA 4NOMA 2Z5VA 1K5HA 3ICWA 3OU7A 3PBKA 3BL5A 4LV8B 4O4JF 2PR2A 1GRCA 1Z0UA 4LOAA 4Q3EA 1NZFA 2OV2A 4A5SA 4JUAA 5HW0A 2WF6A 4KLZA 4PTYA 2Z04A 5FLKA 5AW4A 3KJXA 3DMPA 3PGMA 3VU3A 4FOSA 3ACCA 5AUNB 2XB2A 1R6AA 4YJ3F 4YAKA 3ORRA 4PLFA 2AS0A 1YOVA 3QY9A 2C2ZA 3KHKA 4PHCA 4TYQA 1Y1PA 3HM2A 4JFAA 1MJGM 2AUTA 4ONEA 5IUKC 1UD3A 5L53A 3QX3A 4B84A 3T1NA 1QUEA 4XW2A 1V95A 1DEAA 4FYPA 4J0EA 1YB1A 3SEFA 3OCCA 3TN7A 4KFRA 3UUGA 4RD0A 1NPTO 2WV9A 4RORA 2G88A 4RZQA 4TWBA 4DN6A 1E43A 3K8OE 1WAMA 3KELA 4GLJA 3DD5A 4ZCQA 4MWZA 4BTLA 3CSDA 1HT1E 1NF9A 4EATA 2I29A 5DPMA 4V2UA 1NQOA 1N7JA 1Z75A 4WK4B 3EVZA 1EVZA 2IZ1A 4G5RA 2ZE7A 4HXGA 3EVGA 2MJLA 5KQRA 3OFKA 4ZJZA 1VIVA 3S40A 1DCFA 1UMDB 2ET6A 2NYVA 1Q0LA 1GNSA 3P2KA 4LV6A 1WEHA 4RKRA 4EL0A 3I72A 2YHBA 3DBHA 1W36C 2NMVA 2JJ1D 1X9GA 2VHJA 3V8VA 4J0DA 2HLNA 3A6PC 1NNSA 2DFPA 2H48A 4Z7NB 4N41A 2XZOA 1TT5B 1XUOA 2QVBA 2QBYA 2YUTA 3KQNA 4NRDA 3G9QA 3GRFA 1W35A 3WGZA 5LB2A 4DSZA 4U7GA 1DCTA 2AFHE 2JHFA 2Z4TA 3MQ2A 2Y0DA 4RJLA 3NHUA 4IH9A 4ZGQB 4ZDWA 1HO3A 1PS0A 2OAP1 4GNRA 5E95A 1FX1A 3RY8A 1YI2B 1EDBA 1AHPA 2FWNA 2OBSA 2Z09A 3DAGA 1SBIA 4X63A 4CEHB 4I66A 1QE0A 1KI8A 4KL8S 5FPSA 1H2WA 3UGJA 4AL4A 3FCAA 3R09A 4B85A 3C3AA 4S2EA 4BATA 4BRZA 3KLPX 3K6KA 1M0WA 1FSFA 1WO8A 3T7RA 1Z68A 3ETDA 4Q9KA 4OKNA 4ZK2A 4WBNF 2X14A 1NVVR 1VECA 4OO3A 1YXMA 4XUDA 1GIAA 2QR2A 5FOSA 5K4HA 5IC4A 1JEYB 4OXIA 1LA2A 3DE3X 3R9KA 5BWCA 2O8DA 3GJXC 5T4HA 1YIOA 1ZGZA 1AN0A 2H1LA 1P0IA 2QNIA 1JHAA 3DOIA 3PYMA 3PHJA 4QBTA 2D1SA 3G5AA 1Z18A 3EIUA 5CX1A 3RYFB 3O9MA 4NHEA 1RXCA 1V4BA 1QYRA 1A72A 1XMIA 4FYYA 2Q1SA 4XCVA 3A9SA 4IIXA 1ADJA 1VIDA 3SICE 4LQ4A 3R40A 2IZ7A 1ECBA 3Q0IA 4FYKA 1KSHA 2X0FA 4EQ6B 1DAGA 4P81A 3ZS8A 2QUAA 4D25A 5KYWA 4JP1A 4EPRA 3B7PA 1PNOA 2CUKA 4TSFA 2H2GA 1XI2A 5EIHA 5CITA 5TGTA 3BWMA 2EQBA 3JAMA 3RFVA 1Y5NA 2OOKA 1GGJA 4AKHA 1NVAA 2ZBQA 1V35A 3LA6A 1B7GO 2O4CA 1WNTA 1QO0D 5KEIA 1DCMA 1QIHA 3JPWA 3U9TA 1Y8AA 2B7CA 3EDOA 4UMVA 1W75A 4WFKA 1T4CA 3AHEA 5TIIA 1PJSA 1CTQA 1HDCA 3PJEA 4HDOB 3RS7A 3P32A 4B8WA 1RADA 4MRPA 3WRYA 3WTCA 3S1LA 2FR0A 3UV7A 1UBHS 3AEKA 2PX0A 1E1YA 4WK6A 1PL8A 5KX5A 3BJIC 2YNMC 1OZAA 4FNAA 3HWSA 1T2NA 4OHCA 4KKVA 5C4IA 2OAQ1 3FOWA 4CKWB 1KPGA 1RQGA 3KDPA 4PAQA 3ZGOA 1SXQA 1T3GA 2Q28A 1UK9A 4I1YA 4UCFA 1RTTA 1T0HB 4Q7MB 2HPHA 4BX9A 3H3FA 4YFVA 2CBZA 1X80B 3JVDA 3H99A 4IHJF 4IBOA 4MQ5A 3RUPA 2GJAA 3NFRA 1E5QA 1TF7A 2P4EA 3LIPA 4DLKA 3JV7A 2XUPA 3PD1A 1TJNA 1S5PA 1PNTA 4OM8A 4G26A 2GHRA 2TMDA 1G7RA 4RDKA 3N0VA 2JLUA 5JYCA 2JIZD 2PMFA 2C7BA 2VAVA 3EUEA 1BCSB 3SIWA 4J3NA 3NWOA 5FOWA 2FP3A 4BGUA 4UTVA 4OJMX 1P1IA 1VKZA 2E49A 4LXHA 3HPRA 2QRUA 4MUMA 5B53A 3IEVA 2GWHA 4LYHA 3TSOA 4DCVA 4JJEA 1ZK4A 4Z54A 4CUJA 1P29A 2QNBA 3PKZA 3PDIA 4TV8A 5TT0A 2GPAA 2JRLA 1LNSA 1XD8A 4XYEA 2A5YB 1RW4A 1EE9A 3LX8A 4IL5A 3ZJ4A 2PSEA 2HV9A 3OPYB 2FN7A 2YZMA 3D7KA 1XB2A 5HGXA 3OD5A 1PG5A 1H22A 1VE3A 2PX4A 3VPFA 2ODTX 1KQPA 1OPRA 2DT5A 3DE2X 4LOHA 1MC5A 3QKRB 3K5PA 3ODPA 2IXFA 4LSWA 3WLNA 4JB8A 3UOWA 5B4UA 1N1MA 2OFFA 1NC3A 2ECKA 4P83A 4URXR 3O2JA 2JLXA 3CPWB 5AK6A 5DTQA 3R0JA 3R6WA 4EG4A 4QIHA 2WPNA 2FW8A 4D7AA 1NSTA 4FOTA 4QXRA 4URZR 3VR3A 5KTYA 4WZTA 3I61A 5CA0B 1TUEA 3HRKA 1L7OA 2DOKA 4EYGA 1RAHA 4GUDA 1KETA 5JUWA 1DOZA 3HU1A 4NCNA 2B4YA 2EWMA 3QNMA 5BUZA 2D5IA 2R44A 2XZLA 3UATA 3N2KA 1UINA 2HDWA 3SHWA 2FR8A 1WB9A 3DFUA 4L4SA 3TDNA 3LMKA 3LX4A 5JSZA 3GGGA 4EVQA 2GBGA 3A2LA 1X7XB 4OQYA 1T5BA 1OB0A 5TF0A 3D3EA 1OVGA 3BB1A 3PNVA 4NAUA 5BT8A 4LF9B 1W6RA 4K1XA 4X65B 1CFZA 2JFHA 4J43A 1WM1A 3ESZA 3EXG1 1JG3A 4IVNA 4YI5A 1IBRA 3OD1A 4O8CA 5FYDA 3ZE0B 3VMFA 1RYHA 4OFBA 4O4JA 4TWIA 5CGQB 1QDUA 3B6JA 1TQ2A 2B4AA 3K1ZA 3A4MA 2CKMA 1V45E 1KD1D 4CIXA 4PYLA 3LK7A 4RUKA 1HQKA 3DFMA 4B6RA 1K3TA 3FCYA 3CCJB 1JG4A 1ZDMA 1AQLA 5AOCA 1J1ZA 3HKBB 4NBTA 1NFQA 3FZQA 1ZGCA 4UVDA 2Y1OA 3FB1A 4Q6WA 2IUTA 5D7NA 2WMYA 4DK0A 5K1ZA 3C4QA 1RWWA 1Z6TA 2NG1A 1ILWA 2XR1A 3GVPA 4YJ3A 3WGTA 5FAKA 4ZEVA 4MUNA 3Q39A 5EFZA 1KHTA 4ZP1A 1SXPA 3I34X 4ROSA 2PWBA 1ZGJA 3NUQA 5FI0B 2PS0A 2ZRQA 1BKSB 5K20A 5F1OA 1IXYA 3NHRA 4YRDA 3FDIA 3GJ0A 3ZWPA 3OKXA 2JD0A 4TLMB 2D8MA 3IVGA 1SUAA 2NPIA 1J8VA 3KL4A 3OP4A 4WHMA 5KQMA 3RGGA 4YCMA 1OHHA 1U1FA 3GGCA 4G2TA 4K9DA 2J9FB 3PTLA 2I62A 3AP2A 3Q40A 4WESA 1E1NA 1HNXB 4WACA 2MSDB 4O2BA 3CWZA 4R68A 2E18A 4UUBA 3GYBA 4O4LF 1PP4A 3JXEA 4Y6SA 3ZW7A 1KY3A 5LQCA 2C0CA 4JVSB 2Q27A 3KPYA 3IPXA 2J0EA 2Q4BA 3PDJA 4BEVA 4WGFA 3RSOA 1JH9A 3JSAA 2AC4A 1HMPA 3FA2A 2PL1A 3ICPA 4AY5A 2FDRA 2O0JA 3OCWA 4JKYA 5ED4A 1JHYA 5K3FA 5B58C 3U19A 1Y8ZA 3U7RA 4ABTA 5A4MS 1S7GA 1RAGA 1DZIA 1FVXA 2WWVD 3DO5A 1Q50A 3R6DA 2XBMA 1W2BB 1SN7A 3K9BA 3W5SA 1OTHA 1YACA 3JQFC 2OWEA 3PQ3A 3KNZA 4NKRA 1WOOA 4TXHA 4E08A 2FW0A 1CUIA 1K6XA 2YHAA 4RVCA 4CTKA 4DFDA 4K9PA 1JHZA 3C74A 3BTOA 1P4AA 3CNQS 2XQJA 5JCZA 1R18A 1H1LA 3A1PA 2HRBA 4MV1A 4KDEA 3D8TA 2QPLA 3UNXA 3QFFA 3V8EA 1J6UA 4NNPA 2GF2A 1CJSA 1A82A 5EP3A 4GZMA 4HZUB 3PICA 1FFSA 4I1OA 4JI2B 3IOYA 1NYRA 1PQPA 3JQGA 3TLJA 1CJMA 2LKDA 3F67A 4WBNA 2VQSA 4ZZ0A 1J7JA 2YXEA 1CVIA 2NUAB 2H5JA 1T8UA 3H4TA 4BO9A 1ZN7A 2VJYA 3IV9A 1LI4A 1Y5IA 1FU8A 4BDTA 5A05A 1QO9A 1ADBA 1R1DA 1XVAA 3S7TA 4N0MA 2FUEA 3AWDA 1GZ6A 1JVSA 4QREA 2GEUA 1WLYA 2XDWA 2F3TA 4GDFA 2MSWA 2OR3A 2FDCA 1LDMA 1WZ2A 3KJHA 2V7XA 2C5FA 1RFLA 1L5FA 4RGYA 1RWQA 1XCOA 3H6KA 3IIEA 3HHEA 3TLYA 1DOHA 3AHFA 1XTIA 4BZQA 5EWMA 4S1OA 2YOGA 1W4ZA 3QIAA 4HRYA 5JCJD 3I1IA 1E6LA 2IH5A 1EESA 3MERA 3DQPA 1E2UA 1UZAA 3H3XA 1XCPA 2J3DA 4GX0A 1D2AA 4DA9A 1Y3IA 3RTBA 1E2FA 3O75A 4A6EA 4MQEA 3RFUA 2C1XA 4RQTA 2BYTA 4MJ3A 3OAAA 3DB2A 2CUZA 5HOEA 1HUQA 1RZRA 1GAWA 1NJ6A 1K7CA 2EL9A 1SPBS 2GILA 4ARBA 2EGGA 2RGBA 2FCRA 4ZO8A 1P45A 5E0KB 4PZ0A 2PCJA 2QSUA 2R25B 1WIWA 3KS9A 3EXFB 1HNNA 2FKNA 1MO3A 3AW8A 2RKOA 3DCIA 3S2FA 5JAMA 2Q5FA 1FXUA 2AH5A 1L4KA 1HF3A 4P3OA 1CNEA 4HDSB 3PJRA 2Z9BA 3EQ2A 3ND9A 2O3RA 2JCSA 1MOZA 1ZXBA 1Z2PX 2W2LA 3NBFA 4YBRA 3GLQA 2KPOA 3VRHA 3FKSA 1CQPA 3AVWA 1VQ1A 5F33A 3EOBI 2IX9A 3LJKA 1CUYA 1ARZA 1JSZA 4PTLA 4ZOCA 3OC0A 1RP1A 3KRTA 4ZEOA 3NAQA 3OLWA 4KWCA 1G64A 2JIRA 2BOVA 2OORC 2F8TA 1ZUD1 2Y92A 5LZ7A 1ADFA 2AKEA 4RV5A 3RF7A 4KV7A 1XFDA 2ZUDA 4FBLA 4LBVA 1HGXA 1KI1A 2QUBA 4QDKA 3GEIA 1FSGA 1ZSVA 1E0SA 3AG6A 4OAQA 4OHXA 4MVJE 2O6HA 2BHRA 4CPDA 4DR6B 2B8WA 2PMEA 3AUUA 1FVFA 1TPYA 4RPKA 3UJBA 3UUEA 3O2QB 5HUQA 3S8YA 3W5DA 3LZDA 5D51S 4ROTA 5KYNA 1MKYA 1Q1NA 3T4XA 1QVRA 3WK5A 1P4HA 2OK7A 3GG2A 4KWTA 2VUTA 3ST7A 1G291 1XZNA 2C42A 3MILA 3OPMA 3OFNA 2ZKIA 3JW8A 3MMSA 4GKAA 4L76A 4XLLA 3WXBA 3NCHA 2FRXA 1U9YA 1YASA 3ETCA 5LD2C 2BDUA 1RJ9B 2B35A 1DAFA 2FPRA 2G8LA 1UDCA 2I6TA 3A9UA 2H29A 3PF9A 3NYRA 3T9DA 3GRZA 1JTVA 2COEA 5A03A 3N59A 1K0UA 1QRAA 2Q2WA 4OSEA 1N4AA 3FJYA 2FQYA 2HADA 3KQQA 5K51A 4EWLA 1XCJA 2Y93A 1HL3A 5EZYF 3ZIAA 1QFZA 5G40A 1J70A 2QA5A 2WQ7A 1M67A 4GICA 4N12A 3ZZUA 3KEMA 3CEJA 1EDEA 1CIJA 2UVDA 3WXMA 3ABSB 2M1XA 4OFZA 2W2KB 5DYWA 3VTKA 4E09A 3ETNA 2XZDA 3F6BX 2PANA 4NPHA 3L0DA 1M0SA 1M1YB 2IPAB 2PZMA 1YJCA 3AERA 3I8OA 3LV8A 4G25A 3VSAA 4G4IA 4BLWA 4LGVA 4AZTA 1C7IA 3THYA 4GP6A 2VDQB 1I5OA 1TLLA 3U6BA 3DLCA 2Q4DA 3HHPA 4LE1A 3GSIA 3U2QA 1UBOS 8OHMA 5K8VA 5K6TA 3B51X 3DW3X 3O7WA 5F4OA 1YFZA 2FZVA 5CFLA 5ICGA 2YZNA 1NLFA 4OBEA 4Y2HA 5DI3B 3VNRA 3LLVA 1KY5A 2CE2X 2W9XA 5CT5A 5F51A 4EFDA 5HRUA 3SR4A 3ZD7A 3KXLA 3FVRA 5IH7A 1GOTA 3WLKX 5DLYA 2XUKA 5LA6B 4N76A 2VK1A 4YRMA 2G9RA 1Q1AA 2PQ0A 3KVNA 1ZVQA 2GEDA 4MAAA 1P1JA 4I1SA 2BRUC 3NHMA 4FX5A 1VFNA 3PEEA 4M21A 5G53C 5EHQA 4QTUB 5F9MA 1QXSA 5ARCA 2FPPA 4CM9A 4KCGA 1F14A 2V6MA 2XNSA 1Z0JA 2G08A 3F0TA 3UFXA 4C0LA 5D3MB 4YUYA 3AU8A 4GFDA 4GIBA 4AQ7A 5EA2A 2INGX 2WJZB 3HGTA 4L07A 3ILYA 4BZPA 2P3SA 2WYVA 1ODKA 4QAQA 1KEZA 1UJNA 4BOYA 5C7OO 4BVGA 4ALKA 3I45A 2Q2QA 1TMKA 2R47A 5B12A 3LW8A 1L5MA 5B3KA 2X6TA 4N03A 1VMAA 3ENWA 3GLTA 5KNDA 1VQPB 3OU2A 3VDMA 5A4JA 3RU9A 1B4DA 4CF4A 3DZCA 4PV7A 2QD1A 3T3DA 4ZHQF 5F12A 4CI9A 4ZTUB 3E5NA 1QDLB 2WFMA 2OLKA 3PA1A 1QV9A 3DOHA 3M5WA 5C8XA 2BL4A 3BGIA 1VE5A 4ND8A 1Z22A 4WMLA 3C48A 1T5OA 1V5EA 1YDGA 3ORYA 4I6EA 4Z9BA 4E46A 1N8KA 2H5LA 1ZX1A 1YIDA 2XYVA 3TW8B 4BB9A 3GY0A 3IGFA 4Z53A 3JAKA 4WZBA 3H4VA 4TLDA 2IPMA 4DKXA 3CA8A 1IHXA 1GR1A 5AVKA 4RIFA 2BFEA 2Y4NA 4R5MA 5K8UA 3BAZA 1G8SA 1MQ9A 2ZVQX 3GZNB 4PFQA 3U3MA 1UR5A 1V4NA 4OXQA 2IT1A 1DG3A 4FTWA 1BH6A 2QLLA 1LTHR 3MHTA 4BBZA 1P18A 1ZU5A 3HBLA 1ZMBA 4GBJA 5GONF 3VNBA 2XKKA 1LDNA 2C4WA 2A7XA 3K9HA 3Q3CA 5C52B 2H9YA 3LVQE 2ZB4A 4FBGA 5EKTA 4C76A 2FR1A 3C7DB 4JL5A 2W22A 4MV0A 3A14A 3ADDA 4L50A 2PX8A 1KJIA 2A14A 1E96A 1YJ9B 2JGNA 1JDZA 4G85A 3PXGA 3TOZA 2O5EA 1FQKA 5BNWA 1QBGA 3LFUA 1FIUA 3QPCA 3LT2A 1UBJS 4PYMA 2P91A 1JS1X 1WKBA 4P98A 1UCFA 3FHTA 1UDWA 2XY4A 1Z07A 3CE6A 4Z0NA 3ROQA 1KJJA 2JFPA 1B93A 3I64A 5DBHX 3WGQA 3IAXA 3CUEF 4AZWA 3CLTC 4CMIA 4XL9A 3FPFA 5BP7A 3B12A 2HL6A 1S9HA 4KQ6A 5DHSA 4RZUA 1I94B 5E4TA 1LF5A 4Y1RA 4EKEA 3NBZC 2WIJA 1P5RA 3GLHA 2MOKA 2FOXA 3LIIA 4CUZA 3QEBZ 1U81A 4RHEA 4I5EA 5EJIA 2VJJA 4GI2A 4EECA 4F91B 4TMKA 2H5IA 5LQKA 2W43A 4KSCA 1CXZA 1N2SA 1Q21A 5C81A 3MPOA 4XJTA 2PSJA 3X1DA 2XWBF 3ZX5A 5I9BA 3WFJA 3K9LA 4IDGA 1MVNA 1SOUA 3C15C 3T7JA 3L4EA 4JXJA 2FZEA 2HREA 2AHRA 2W6IA 2FN8A 2JGIA 1U8EA 4FD2A 1HA3A 4NJEB 5JSFA 1TKRA 2DAPA 3JYQA 3UJ3X 3GT7A 4C4YA 1KEWA 4RZHA 2IS4A 4NCHA 1NRJB 4ZXPA 5IW8A 4LFCB 2KLHA 4OV6B 5KKAA 2Z6UA 1RWPA 4MKZA 3SXJA 2I1LA 2Q0SA 3ZXUB 3C5EA 2AMYA 2FLVA 4JUDX 3F5FA 1X3LA 5CG1A 1OZ0A 1CY1A 5F3WB 4KXXA 1GZHB 4L73A 3COJA 3C41J 3OFVA 2EP8A 3WRXA 4DMGA 3OPOA 3C6ZA 2CLHB 5I7WA 3ZW8A 3NI2A 1I0LA 2WSSD 5LLSA 1UC8A 3PKIA 1YIAA 2R6ZA 4ZCPA 2EX0A 3JARA 3HZRA 2O7RA 3CVVA 1P75A 1V0EA 3DLIA 4PRZA 5IJWA 5A3VA 4DJDC 3UT5A 3O8RA 5DZSA 3HZZA 1JXOA 1G5TA 1OW3B 3EPPA 3N75A 2LZ0A 4PQRA 1P9NA 3H2YA 2EF0A 3OJWA 4UU1A 4DHWA 1NXOA 3QYPA 3FHCB 3PEFA 1IN5A 1WD5A 2ZI6A 5EIFA 4DNQA 4FWTA 5IULC 3PGJA 5JJLA 3WIBA 1ZVVA 2NAPA 4UZEA 2Y9MB 3LGSA 1X9IA 1SC1A 4MTCA 1LLFA 2OKGA 1MUUA 1EBBA 2WJIA 2A67A 2C8LA 2EJBA 3BK1A 1MDBA 4XSVA 2C4MA 4ETIA 4ZU6X 1KSFX 2JI4A 5E0OA 1LBTA 2HHCA 3DHEA 4ZQIA 3IP5A 4ZI5A 3R74A 1MNAA 3VKUA 4ZGWA 4O29A 5E3IA 3AF5A 4LE2A 3NOXA 2NUPA 3TZKA 4ZJUA 4OGWA 5TVKA 3HCRA 3EPHA 1SHJA 2A0WA 1DS6A 1T1GA 4IAOA 4W5HA 3IP1A 4XIJA 5AHRA 3S1AA 1H8HD 1QTIA 3HCBA 3JQ9C 2QRMA 3ZK7A 4X8IA 4YV7A 3G68A 4B71A 2G4LA 4FMDF 5CFRA 1QVAA 1V26A 2FA9A 2PH7A 4O4HB 2IJGX 2PJDA 3GO4A 4L74A 4B17A 4G5GA 2I6GA 4EHNA 2PWPA 3DCYA 2MSCB 2C5AA 1ZJ4A 1V11B 1HLGA 3RVJA 1NLYA 3ISTA 3UWPA 1QFJA 4FGLA 1TM1E 3JAWA 1ZOLA 4Q03A 5IJ9A 5JI2E 2BVNA 3LCJA 3ZU5A 3GUZA 1RYFA 1X8JA 2ZUBA 1NXXA 1NVTA 2PZ8A 3L7OA 3IAEA 1GUYA 3NU1A 4IWNA 5DP2A 3THOA 2AJLI 3VVMA 2IV7A 5CDFE 2I34A 4OIMA 1DC6A 1UDXA 2WJ4A 4MVJM 3IO5A 3P97A 5GOTA 3UQZA 5A7GA 4H7DA 2RBGA 1P9RA 2A33A 1JDNA 2XSZA 2FW7A 4GQNA 2FFHA 1XVLA 4H16A 1U9ZA 3AC0A 4B4UA 4QFCA 3CCFA 1DNPA 5KB3A 1PJCA 2TMKA 4HCJA 4KUGA 3BWCA 4TPKA 4R7GA 3C98A 5BNIA 2IBSA 1NI3A 3G9ZA 3IVAA 4FU0A 2VHTA 4LJLA 2JJMA 1Z7GA 3IESA 4UDXX 1EDZA 9LDTA 2V1UA 1Z4PX 3LU1A 1YB2A 3HCOA 2Q46A 2YYSA 4C7XA 4RVOA 2JDIA 3CUUA 1ZCFA 3PA8A 4GOXA 3H87A 3BVPA 4ZGNB 3S2ZA 3OT1B 3DDOA 4QFBA 3ZIUA 3I8SA 1DO8A 4EZIA 1BEZA 2Y6VA 1U7ZA 4V1CI 2VJPA 3L0SA 2D5CA 4UC0A 3P0JA 1I2CA 2AVNA 3CMAB 3ECCA 2O52A 1BGXT 4HGOA 4UM9D 3BERA 3D0RA 1TA9A 4LN1A 2HRRA 4C3ZA 4FHEA 5GOZA 1FDVA 1AXEA 2B34A 1ZMOA 1RM0A 3CHYA 3QUQA 4K8RB 2V7BA 2CNLA 4UUAA 2SBTA 1I7QB 4C2AA 4RM3A 4QPCA 2GO7A 1T9GR 1GSHA 3HFSA 3JR3A 4ACAA 1JKXA 3B5JA 1XCMA 3N6VA 5EXDA 3U1VA 4MP6A 1DG9A 2A0FA 3MWKA 1VPVA 4C7VA 1JQDA 4CV0A 2F9FA 4CV3A 3A6ZA 4Q7LA 4ZHQA 1CDZA 1OZHA 2BBWA 1L2TA 4EFMA 4EL5A 4RENA 2HGSA 3ICEA 5EQFA 3K9FC 3G5MA 4L16A 3OJEA 3BCDA 2G0AA 3STWA 4A27A 5KNCD 3U7HB 1AD2A 3QUAA 2EBFX 1HEUA 3PIDA 1RRKA 1XF1A 4V0OA 3SM3A 1J9EA 3SBXA 2GZDA 3U49A 1XZJA 1YCDA 3TTWA 2ZKLA 2IYYA 4JZYA 2QS9A 3SC3A 1CIVA 1MX3A 1ADCA 3SC2A 3L4SO 3QKSB 4H17A 3FWNA 4FMCF 4C4XA 2RH9B 4E88A 3CR3C 1UMCA 4PLGA 3IAHA 1Y33E 3I9FA 1HZEA 3IDAA 1U2RA 4HEA6 5JY1A 5KOJA 1NF8A 4J3JA 2VBCA 4DLLA 2C77A 1WNFA 2WSBA 2QEXB 5FBWB 3AX6A 3JALB 4KTTE 1LRJA 2JFVA 5CB4F 1ZC4A 2EXXA 2OSBA 3O84A 4V39A 2X3UA 4YX9A 1P2BA 5DH9A 2JW5A 2JI6A 1W0JA 5SZJA 1EVIA 1AQIA 1R8JA 4J0GA 3P2MA 2HRQA 4MGKR 3HEBA 3NRJA 4C6TB 1Q57A 5JSHA 4N7JA 2QXUA 1QGUA 4GXNA 3CUKA 1XXHA 4MRMB 3CVXA 2GQFA 3ZLVA 3LKDA 5DI9A 1VRVA 4TQAA 3M2PA 4B34A 4PSKA 3EG9A 1Q7RA 5D1HA 2H1OA 1M1UA 5BSXA 2RGDA 1QG0A 4P3PA 4Z8XA 3UPDA 1UMBB 5F7OA 2IX3A 4MVJD 4CLDA 1M10A 3BIFA 3DOEA 2UUBB 3WO0A 4GLLA 3TAUA 3PHIA 4PAAA 1XVUA 3HYLA 3PWKA 1P6UA 1P80A 5JCPA 1OFUX 1PCXA 2NZWA 3ONNA 4XDGA 1KI9A 1V5IA 4MW5A 4D96A 1YZKA 4EJFA 4HDRB 3WB2A 2QMQA 2OC9A 1K2VN 2HCBA 3ENQA 4HPJB 3L3BA 4MW4A 2OXRA 1EI9A 4MHSA 5A71A 2HXGA 2G04A 4WJZA 1I3LA 3HI6A 4C5CA 1PJ4A 1BN7A 1TC1A 2XEDA 3I2IA 1VKRA 5HMMA 1E1RA 3BPSA 5J4KA 2PH1A 2UZ1A 3R0IA 4FNGA 5TT1A 3F47A 1BA2A 4JI6B 2Y67A 3FTDA 1XLTA 3K73O 3PQ8A 3RBZA 1MN6A 2QKYA 3MWLA 3E27A 3WWEA 2Q2NA 4PZYA 4UMEA 2Q1TA 5E7MA 2V7TA 2P27A 1P4GA 2HJHA 4ZICA 2O23A 3U7IA 4JP8A 1GPMA 1M1YE 4DGQA 4RK1A 4CIYA 1AGRA 3K0HA 4ILKA 4R1LA 2RK6A 4C6HA 2VDWA 1XFAA 2F17A 2H4YA 2O05A 3H16A 1B8NA 4KBFA 1PSWA 5AJXA 5AWFC 3FOEC 1N8NA 1W4LA 4LCJA 4XD2A 2JJ8A 4GRIA 3OOYA 2CYBA 4KMSA 1KGDA 2D2IA 4H1UA 5AVVA 4B3RB 2P1DA 2PEZA 1ZK1A 4BNWA 1TGYA 1QH8B 2CMKA 4X7MA 2OO7A 1WHTA 2R9VA 1E66A 1Q84A 1SBTA 1UDRA 3MELA 1DEKA 4A6XA 3TVDA 4L8VA 4TKOB 1ULSA 1Z37A 3G0CA 4YBZA 3BZUA 4D2IA 1G2PA 4ESVA 1JIQA 5HF8A 3SZGA 1JJFA 5TY0A 2QPTA 2CVZA 3CNEA 4AJNA 4C87A 4UW9A 1JIKA 4UPVA 1W8DA 1R0CA 2QE6A 2HF7A 4UAGA 1ABEA 4W1RA 3E81A 3AB8A 1B00A 2NIPA 1C9DB 4LJYA 1TCCA 2HH9A 3QTLA 5HCIA 3BJEA 1D1NA 3LW7A 4RPLA 3TVTA 4N7RA 3S28A 1Z4JA 4R83A 4DM4A 3GJ3A 1X1SA 2PS9A 5FPPA 1UK7A 4MICA 4W7IA 5SY6A 3TQQA 3ZDFA 3IR7A 4DA8A 5CK5A 3EFOB 3LC0A 4XI9A 4BAZA 1PQWA 1UBRS 3A3PA 3H9EO 3RV4A 4CUKA 4E22A 2WT4A 1AGXA 1IXZA 1UBGA 1Z0DA 4IFBA 4KBYA 1HYEA 2MTBA 2KBEA 1SMKA 2XQIA 5JAPA 4P93A 2HK8A 3TJRA 4DLYA 2WQ6A 3WYAA 2I4OA 3T56B 3DNMA 1ZNWA 4UHCA 1RTKA 1C8KA 4QU5A 4ZDIA 4DS3A 1T2VA 3FCXA 3BXFA 4HYEA 5BUCA 4TXJA 5B55A 2H92A 4BMCA 4JMQA 3UKJA 2YDYA 3U4QB 4G4SP 3SSAA 2G9UA 5J2UB 1DRVA 4CLEA 1CE8A 3TCKA 1M66A 3MBOA 3MJTA 5C18A 1PLJA 1PR2A 2ZYDA 5E2IA 4HAXA 4NJMB 2R1UA 4CLHA 3OW2B 2IY9A 3EDQA 4RL6A 2VDNB 2UVQA 4Q15A 3ANMA 1I1NA 3EGWA 4GQBA 5DNDA 4BNZA 4Z7OB 1UIMA 2WFLA 4HQFA 3K09A 4M7WA 3TOSA 4A91A 4EABA 2ZTHA 2I6UA 1AUQA 3D02A 3UK7A 4Q4LA 2EYQA 1CIPA 5E6SB 1DIBA 1QGAA 4IR7A 3ZCTA 2G09A 1P73A 1X1EA 1QSGA 3D3WB 2ORWA 3O21A 3SXPA 6PFKA 5CLGA 3IUYA 3U3RA 1VQMB 5DRTA 1U63A 4WZAB 3X44A 1XSEA 2NXJA 1N75A 3D8BA 1SKAA 3RARA 2GBIA 4E1AA 3RK1A 1JILA 4CU5A 2X4LA 1D3AA 1G8PA 3HYCA 4C78A 2M6KA 1WULS 2IEAA 1GKKA 1TTQB 5ADHA 2FWRA 4FE7A 5C4MA 2GD2A 2X8LA 4HO1X 4RD6A 1D2EA 3IIIA 2EJUA 3FR8A 2RE8A 4Y2UA 1MGOA 4NECA 4CRWB 4IUCS 4K3VA 2M2IA 2NXCA 3EDRA 4EZEA 2DX7A 1N36B 1WSDA 4L2IA 2WV7A 1RC8A 2IHVA 2VP6A 3R7AA 2WRZA 1IZ9A 3H5OA 2FPOA 3TR5A 4MPRA 4RHXA 2WPDD 3CWQA 3QGMA 3TNDA 4MIYA 3A04A 3TOXA 3LTEA 4CQNA 1SBHA 2VJMA 1JKJA 4OGGA 4HLUA 4A0SA 2D3NA 3UJPA 3FNHA 3UG6A 1YC2A 1OBFO 2JH3A 5CT4A 1HBJA 3VBCA 1HDZA 5BUQA 2KI5A 3K5HA 3NANA 1QRUA 4K9SA 5ES3A 5IYZB 1POWA 3DV9A 1B26A 5ECYA 3RRMA 4AQDA 2EZTA 3DKIA 4LRYA 1OA0A 4BNTA 3PA2A 5FLXA 3AEUB 3DD1A 2G80A 4K26A 4IDCA 2RHHA 2FFAA 1PUIA 1MXHA 2OCIA 2ZB7A 4UZUA 4RESA 2QZZA 1U0BB 4YDQA 3USZA 4M0MA 3X1MA 2P2SA 1U0LA 3DF9A 3AG5A 2NPOA 3PX3A 3WNCA 3EMBA 3L6RA 1ZL0A 2Z2IA 1O0SA 4QT4A 3VR6A 1DKPA 1YZGA 2C8JA 3QYFA 1IL0A 1Y1RA 1G16A 1PI3A 4JQSA 4OUKX 4QWMA 4KQ9A 1J2RA 5B57C 4UE2A 2B4RO 3IE1A 1WXGA 1B16A 1YB7A 1H1TA 2VT2A 4LWQA 4A7PA 2BEVB 4JUFA 4JLOA 1BG6A 4R9UC 2GM3A 2ZTVA 5GZ3A 1QG2A 3LGAA 1MVOA 2SCUB 4U0JA 3A1CA 5EMHA 1KE1A 1UMKA 1K06A 1X74A 1O96B 2GBFA 3OCVA 3IAM1 4HNHA 4L0MA 5FWYB 4GYWA 3CD6B 1RAAA 2EKLA 1J2EA 2QE7A 1NF3A 2I78A 2ZLBA 5FPTA 4TTJA 4IEEA 2PRKA 3FUTA 1WUJS 4GPEA 4CYMA 2BELA 3OX4A 3FXAA 4DYHA 1YRAA 1GUBA 3AZPA 4RO0A 3BIJA 2ERXA 4B87A 1EIWA 1Q0RA 4B4VA 3UA3A 4W5TA 5BWNA 3SE7A 3CJQA 4JT8A 1OC2A 5COAA 1L7NA 3GUCA 5A3RA 3COZA 1NBWB 4IVQA 1I7NA 3T7IA 3GARA 3EARA 1GJRA 2AZDA 1YRWA 3AXTA 2G5PA 1Z6GA 1XRPA 4IJ6A 4XWTA 2PD3A 4P4GA 1Z5WA 4ZZ3A 3JASA 5JXWA 3URKA 5J3JA 3ZZTA 1O77A 1CR2A 2H51A 2YV4A 3H2BA 3QBDA 2C2XA 2GZMA 2ONJA 3ZWMA 1Q1GA 4KIUA 1K27A 4DV4B 2PKQP 4TZ0A 1H8ED 3F5QA 4BRWA 1ZCAA 1IB6A 3H8SA 4G0MA 4IDEA 5AICA 4C6SA 4OX9Y 1I8TA 2PKEA 1VL1A 1E3WB 1PFWA 3BULA 3O4FA 1TQ4A 3KHTA 3QQ5A 4IY1A 4KQIA 2PXXA 2VWHA 2Z6AA 1PEDA 1QB8A 2JGDA 3H5TA 1FNBA 1S8AA 2E4VA 4E5SA 3HCWA 1AX9A 5HX7A 1RM5A 2CHEA 4XVQA 1MQSA 3TSZA 2GAOA 3IOEA 2CFSA 2HA3A 1BXGB 1YR7A 2QY9A 4WCFA 4EG0A 2DPLA 2V8BA 3LUHA 4U5XA 4XR4A 4A23A 4LJ7A 3ZXXA 2IYQA 4M0LA 1EUDB 2ZPAA 3R3VA 4Q1DA 4NZOA 2DE0X 4OBWA 5FHRA 1C9KA 1HOXA 1NDQA 1RQNA 4GMHA 1GTL1 1MT0A 2X86A 4O6VA 2VKTA 2FZ5A 3WNDA 3BMCA 2DWUA 5EUMA 2HMYB 2WK1A 2YHIB 2F3RA 1S2OA 3I09A 3QF4B 1N5RA 2Q5CA 4UHJA 1SKBA 1G6OA 1NW9B 3G7SA 2ATIA 2WUWE 3FOBA 4JLAA 1YGYA 5LC1A 4YV0A 2VUSA 5LP6B 1CF2O 4G9BA 3DDWA 1PTJA 2AI3A 2AFIE 4AF8A 4H1VA 3MTBA 4KAXA 2X9VA 5EE9A 3E5RA 821PA 2H7XA 3AI3A 3M5DA 4K6MA 1HMYA 1KMMA 2FWMX 2XGSA 2G06A 3NTVA 1TTPB 4EDFA 2PLNA 4Z1MA 2J0UB 1UXIA 4YCBA 4P2NA 1IUPA 1M8KA 2X76A 3H5AA 4DUGA 3QPUA 3QEOA 2Q5EA 3ICQB 4BLQA 2E82A 4LJSA 2CNOA 3EODA 4RTJA 2BW0A 3F2IA 3FHJA 1UBCA 1G3QA 3FHLA 3QV2A 3II6X 1TF5A 3CMCO 2L19A 4FM9A 1Y89A 2F1JA 1ID8A 2ZE6A 4WA8A 1OJLA 1E4EA 4IIGA 4ZU3A 1Z4IA 3T51B 4YAIA 5CAEA 1VQKB 3H1EA 1ZIOA 4X1KB 3JQQA 1XN4A 2P67A 1A88A 3Q8XB 4IOJA 4AJJA 4BNDB 4D1YA 1UFVA 1WKVA 2QYTA 2BGGA 2CN1A 4PS0A 4PLTA 1OAOA 1S7CA 3D3JA 4QYSA 3I9NA 3QFRA 2CSUA 4I1RA 4DVGA 1V4VA 3W5AA 5AI0A 4WY5A 3CF6R 2Q9UA 2WI8A 2VJDA 3NAGA 5I8ZA 4MRNA 4XASA 1QFSA 1E1LA 1OV6A 3FRHA 721PA 5EXPA 2H52A 2B1GA 4Q3BA 1DIGA 1UPFA 4ZYTA 5KNBA 3ZV5A 4JT9A 4AECA 2KBFA 3EWSA 3H8WA 3JVVA 1Z5GA 1EUZA 3Q3JB 4L08A 4R3UC 2VDLB 4E0FA 1EG7A 4JXKA 3DLHA 3K2EA 1QRRA 4G3XA 5E38A 1F3OA 1R8YA 5KMGA 2XH8A 2P0EA 5EZYB 3U60B 2LR0A 3V4RA 4EBFA 3PXXA 1LJLA 4YQEA 4Z6KA 3D9QX 4FGUA 1Y8RB 3QUBA 5AVOA 3KQKA 2UYOA 4QJBA 1E7SA 3JVIA 1U7XA 1QZTA 5DX8A 3ZZMA 2CZGA 2NSDA 5K0EA 1XQXA 3C2QA 1CQJA 4H0CA 4MI1A 3AHJA 3FNGA 3OY2A 4OYRA 1BU8A 2R68A 5AM4A 3R3HA 4KLRA 1IOWA 4RCYA 3HR7A 3PFKA 4S1WA 5C3MA 1E4OA 1TVKA 4BBAA 4KIGA 2KM1A 3NKLA 1E1DA 3NDJA 1FC0A 1M2VB 2B6NA 1WY7A 2QRJA 4YRIA 4RULA 2V3VA 2RGCA 1ES9A 4GSYA 5DKFA 2WJ6A 1JFVA 2AXQA 3I01A 4G6IA 3DUWA 1FS6A 3SJZA 4KNVA 4REMA 5KC8A 1RJWA 4MPJA 5L95A 3IHWA 4H3KB 5EKSA 3WSWA 3ROPA 4N49A 3RYTC 3LDGA 5I4IA 1VG8A 1GTG1 3HXQA 4G41A 1J07A 1ZVMA 4UDYX 3IP3A 1PUXA 1KI6A 3CGWA 4MW1A 2WYWA 2CBGA 2Q3CA 3K9QO 3DO6A 4RAOA 4NESA 5IARA 3MJ4A 1OU0A 3CZQA 1G1AA 3PFGA 2V3CC 1MTZA 4BZZA 2GB4A 4MWCA 3PNKA 1H6BA 5AK4A 1HR0B 3BTSA 3I37X 2ZRDA 4ZEWA 3VZQA 1NB9A 2VJOA 2ZJBA 4N0EA 5AMXA 5GY7A 4Q4CA 5IDXA 3ZY4A 1JPVA 3GF4A 2AOTB 3WFIA 2HBQA 4EEKA 3PL5A 3BH7A 5BNTA 5CDUA 3S8EA 2X0KA 3G71B 3EVTA 4FDAA 3TZ6A 1G21A 3QEKA 4OOVA 1GA6A 1HV8A 5IZ4A 1OH8A 1ORWA 1SZCA 4C3VA 1OWPA 3CURA 4JL6A 3SC6A 2PL5A 4CMHA 1YQQA 3DKPA 1VQ4B 1K3FA 2FOIA 5B6PA 3TI7A 3RFTA 3CF4A 3Q0TA 3KJIA 2KLBA 2YWRA 1DX9A 3DT8A 2OYNA 1P9OA 2GEFA 2W6CX 2WHPA 4I5GA 3VX4A 1YGPA 2QNRA 4O1IA 2EFHB 2L69A 1I4TD 2XVXA 5EP1A 3U7QA 2RFLA 4C22A 2MR6A 4JZKA 1SUFA 4Q0MA 2B8JA 2V1XA 3Q2IA 4EJ0A 3ZHUA 1XZQA 5HE8A 4DYVA 1LSUA 3V6LA 1L4FA 4E31A 1NNUA 5EJ7A 2GESA 2VYVD 2ZTUA 1B0UA 2FP4A 2FH5B 3ZHSA 5BRJA 1SVOA 2CHGA 2VHXA 3AFMA 3EDMA 3EULA 3R0ZA 3AZOA 2CDBA 4YS6A 4XRGA 2VAMA 3M81A 1GQSA 4UVGA 2YUIA 3PXUA 3T34A 4NDZA 4EJSA 4UM9B 2R00C 3JYPA 4MQ4A 4O1MA 4X8LA 1BHO1 1DAKA 4PWYA 1YJWB 1ADGA 4BRSA 2FDXA 1CFJA 2ZJ8A 4BUJA 4F60A 1RE0A 2X53S 2Y1XA 4HXFB 1JFSA 3A4NA 4AG3A 2WDPA 4H6PA 5HVNA 4XQFA 2NADA 4F92B 4OCZA 3P2JA 2YBEA 2JGJA 4FHGA 2G70A 4ZAWA 4N01A 3GHHA 1SXJA 3DOOA 2O7NA 2WYUA 1XU9A 3EIHA 1VDZA 1CRQA 4YJDA 3X1ZA 3DT6A 5FOXA 3ZIDA 3ZY2A 4NQZA 3ZEIA 3UAWA 1RKUA 4C7MA 1U3DA 3LBIA 1BMDA 1KEVA 1EQUA 3IHTA 5LLTA 1JJBA 2HT6A 2P79A 3GK3A 3IQEA 1BXRA 4INPA 2LCQA 3SLKA 1SG6A 4RL4A 1RIFA 1Y3HA 2GXQA 1EWVA 1QCYA 4P9NA 3PDUA 2BE9A 2Q5LA 4NV1A 4PBSA 4NS4A 3WRWA 3BD7A 1IBSA 3KQUA 2O2HA 5JNVA 3C8MA 1VE1A 3L4JA 3GOHA 2W2TA 4UM7A 4BMXA 2Z0MA 5LM3A 3TPCA 3FJ1A 2OM6A 5AUPB 4HAOA 2GZ3A 4URYR 4DCGA 1JFTA 1QK4A 4QUKA 1QIKA 1FXWA 4XUCA 5CURA 5L6LB 3AY6A 3CGGA 3EZYA 3HZOA 2ID7A 3RC2A 4EFNA 2O0LA 3UK2A 2BEUB 1XEXA 1KC1A 1EK0A 1PR6A 1JJIA 4JELA 1GAEO 3N7UA 1EDDA 2C2YA 2G72A 2FEPA 4W1SA 1AQNA 2P3OA 1IZ8A 2UYYA 3PSHA 5EIBD 3THSA 3ASQA 1BOFA 1PK8A 3GVLA 1QZ3A 1L7XA 3WRYC 5BSHA 1UP4A 5FLEX 2CFCA 2H1FA 4XYGA 1FW6A 3OMWA 2BMWA 4K0KB 5EHIA 3QM1A 4AI6A 1W46A 2C97A 4CMAA 1DP4A 4FZRA 3LPCA 1OB5A 4JKOA 4RD1A 2O2IA 1R4MA 3E2IA 1XWFA 3QZUA 4Z99A 3J7TA 3GFVA 3PRHA 3CRVA 1UOPA 4ER7A 1TM5E 4ZIRB 4KKUA 1H5QA 1SHLA 3NC0C 5JT1A 1TECE 1RFGE 2BTQB 2J5XA 4DCMA 1I3OA 1EFVA 4G24A 4IJMA 4P31A 1VCMA 1C1XB 2WAAA 1WVMA 3H1AA 2XD4A 3M6XA 4A4DA 2BMJA 5HUHA 1QTQA 2AJTA 4EKNB 3EX7C 3LLUA 1GRVA 1ML4A 4WZAE 4RTNA 3F3KA 3CW2A 3UGQA 3HBAA 4DDWA 2PSDA 1Y9DA 3G3EA 2VKQA 4Y9RA 3RROA 3DBRB 1QVVA 1RXEA 2J4CA 4KXWA 1QGZA 2WSIA 1TADA 2QM7A 4J0FA 3G49A 4LMAA 5HBRA 4C4TA 2D62A 2AOWA 2GDJA 5AHOA 5C5EA 4XIFA 3VBEA 1LK7A 2J8ZA 1GDHA 3R23A 5LP6C 4B74A 4ZAGA 2YV3A 1VI5A 4HI0E 1QKIA 3WWDA 5L7TA 4LOKA 3OOSA 2AG8A 4ENRA 2L82A 1KPIA 2X6YA 2FPIA 3C5CA 4WINA 4LOIA 5DHUA 1NVDA 1AMOA 1P60A 2A0YA 1AIPA 2PR7A 2QM0A 4QDJA 5CXSA 5A4AA 2NSYA 4OMUA 1XZ8A 2GN9A 1W9XA 4ZQEA 4ZO6A 4CNQA 4TSFD 3AHHA 4Q9AA 1DX4A 1MOQA 1C0KA 3WJ2A 3UHAA 4LBYA 5FBRB 3SK0A 4M1ZA 2B36A 2ZJ0A 1WZUA 3D8NA 3FWHA 4EG5A 3I9V1 3DO8A 4RMIA 4AD8A 1M7HA 1ESZA 3ONFA 7MDHA 3D4NA 2CCGA 3T3HA 1GT91 3JZAA 5CK4A 4DA4A 3B2NA 4KB5A 4OH7A 1DFHA 4W8OA 4LBWA 2VS1A 1WXEA 3MZ0A 3CCVB 2J9RA 5HXAA 2G5CA 1HXHA 1JQKA 1PQUA 1NQTA 5KO2A 1N6RA 3KKKA 3IKJA 4WZBE 3G8AA 4M22A 3BIWA 4MB2A 5FNZA 2RSLA 4L85A 3V7NA 3VISA 4BX0A 4TS3A 2V3WA 3HG7A 1QONA 1USWA 2I91A 2DC1A 4CF5A 4XCQA 4L0DA 4OK6A 4R54A 2C0PA 4EYKA 4A26A 1AB5A 2QN8A 4I4TF 1KS9A 2ZSKA 5DM70 1A9YA 2IP1A 4C0JA 1ZZGA 1KQ3A 3DKRA 3ABQB 3OUTA 2IZZA 1SCKA 1AS0A 2C2OA 4XX0A 1MO2A 5AW6A 2AMJA 1D6JA 2VQ6A 4ZTZB 3CC2B 2YVAA 2ZYUX 4DREA 4CQLB 2CHQA 4H18A 3KCNA 2XQGA 3E15A 4ZT6A 4XOIA 1II8B 3FGNA 5G3YA 3M34A 5DISB 1ZJZA 3ABOB 5A5GA 3EF1A 3EGDA 1F1JA 3K9GA 1NMXA 1QF9A 3QW2A 1DC8A 4Q01A 4AYXA 4D0NA 3KSAC 2Z5FA 5I4CA 2Z1DA 3K1AA 2RBKA 3BF7A 1JJVA 2NU7B 2YWJA 3A6LA 4TLBA 1YR1A 3T9EA 3WLFA 4A2PA 4BWGA 3LUBA 3G5TA 5H4HA 1GVHA 3LQ4A 1Q2UA 4JR1A 3EDYA 3DV2A 1P4MA 1IN7A 3R7WB 4IIJA 1M76A 2ZSJA 4QGGA 1SUDA 4QFDA 1QPZA 4LX0A 4MWOA 1Q82D 2QHXA 4R2HA 1R6TA 3ZE7A 3TOCA 4DCPA 2XGMA 1XL1A 2IU4A 3OIGA 1HE2A 2AIRA 3EYWA 3SZRA 4CL2A 4PAOA 3NRCA 2J6HA 4ZT3A 5AUQA 3I3SR 5BPFA 1XHEA 3RVSA 2ZULA 4KR3A 2F59A 4HMQA 1RCUA 2EIHA 4RWEA 2I6FA 2P4UA 3KXKA 2HIHA 4BCDA 5KSYA 1E9CA 2D7CA 4Y0AA 2Z08A 3WGYA 1QG4A 3WAJA 3UA4A 1M1NB 1VIAA 4TTQA 3LSTA 2P3QA 3SAJA 1ML3A 5A1JA 1RYDA 4MEAA 5FDFA 4GE0A 4ETNA 1F17A 1ZD1A 4AKIA 4PGOA 4DCTA 3CT6A 1SKYB 3DMNA 7ABPA 1P6QA 1QYIA 3PUNA 1JECA 1XHFA 3GJ7A 3AKEA 4W1QA 1W5EA 5FEUA 3Q3HA 1L7PA 3GLFB 3JQ7B 1FFDA 1GG9A 1XHLA 1XMSA 4KUEA 2QVYX 1O94D 1U2SA 4IHQA 4L75A 3V34A 4UPEA 4DCJA 5F4BA 2AMFA 3WLLA 3M1LA 4BNVA 1FZTA 3Q0EA 4P2BA 3QX9A 3KFLA 5L46A 5JXJA 3OIDA 1EVYA 3V55A 4DIKA 3KEGA 4JOCA 1SUEA 2HBYA 3ES9A 3LXUX 1BDJA 1HKUA 1W59A 4FOOA 1B3RA 3FSJX 2QX6A 4NQRA 1JWAB 2FUKA 1EGAA 1XP8A 4H6WA 4HNVA 1R4ZA 2BGTA 2XKBA 4R8KA 3DA8A 5CA1F 3W5BA 2FGKA 4D44A 4FYIA 5EKUA 2AFRA 3U0VA 1U1CA 1EM6A 1U0OC 2A9FA 4M0UA 2XF2A 3Q6MA 4WA7A 1EP1B 4D97A 1JHOA 1DOAA 1RI1A 4LDPA 3P94A 4N5DA 421PA 2CJWB 3DZKA 4MGHA 5AK5A 4CCWA 3M4JA 6YASA 1CS0B 3A8IA 1HORA 2FMKA 9MHTA 1FXSA 5AP9A 3RSZA 4F86A 2YN4A 1ZOPA 2JS7A 1S2MA 4FX2A 4KWEA 4QG3A 3DVAB 4IDDA 2NN3C 1MCZA 3SKVA 3TYXA 1N7HA 4PLVA 3A3GA 1QYCA 3I4FA 1ZJ5A 2A5LA 3LPLA 3SQDA 3PPYA 1G2OA 3A11A 3T5GA 3A1UA 3EZGA 3IDZA 3OCYA 2I33A 3UJ6A 4GOMD 4Z4QA 4HMOA 2FI1A 4E3ZA 2FSHA 4RHCA 4UNNA 3ZQKA 4ZI7A 4HJRA 3FTEA 2LCFA 1I6WA 1LI7A 3WL6A 3SSOA 5AESA 1X7YA 2FEMA 2G1KA 2JBWA 2JKZA 5CEJA 4ND5A 1FS5A 1J00A 1MRSA 4CTNA 3IVXA 3ZXIA 1J5EB 2NYUA 2ZEJA 1N3YA 4K9QA 5DBFA 2N75A 1V1MA 1GL6A 1UKCA 1ZINA 1IWOA 3BFKA 1DO0A 5CP8A 3GEBA 1QGOA 3FMIA 4I7EA 4IJWA 3REQB 3KT6A 3CCSB 3WDMA 2YINC 4TV9F 4Y6LA 3AL2A 5H59A 5L3ZA 4C7KA 1UD8A 4CL3A 1K6IA 1UJ5A 2Q5IA 2SKDA 3QMMA 3BE6A 4K5QA 4PHTA 5BR7A 3STVA 1N05A 3O38A 1YUBA 1QR6A 1RPTA 2GERA 2B30A 4WECA 3T1TA 2O19A 1SCBA 2TS1A 3C39A 2OHHA 3CKKA 4OREX 3Q98A 4RDCA 4U9IS 4W7SA 5EGNA 4PX9A 2FU5C 2YVUA 1FE8A 5FBQB 3R76A 1M2NA 2ZE5A 4UHDA 5ICFA 3W0LB 2P9QA 4U6QA 4EARA 3QOYA 5H0IA 4LYJA 2IGTA 4YO7A 1DPGA 1FRNA 1CUDA 2XXBA 1CV2A 5BRNA 5JALA 1FYVA 4NBKA 2WJYA 1XTUA 1XJ0A 2BFCA 4II3A 3Q3EA 4M86A 4A0HA 3D3QA 2PUVA 5JBIA 4R81A 2EC5A 2JA1A 3TRKA 1NUPA 2Q50A 4HFNA 1MZPA 4B3JA 3GDWA 4YRNA 1TK2A 3TQIA 3W8NA 2WTBA 2Z1NA 3DMYA 1U8AA 4J4HA 4J7AA 3FDJA 4XORA 1GUZA 3P5SA 4OU5A 2PEYA 5E7JA 5IDVA 3K32A 4I9NA 3DEYX 3QXJA 3HB4X 3ACDA 3ZD9A 4N0DA 4JLWA 2F67A 1MX1A 1WXHA 5JO9A 1DUSA 4D0RA 1NZJA 5JATA 3I42A 3GHYA 4GOOD 3A9TA 3DFKA 4XE5A 4U3JB 5EOVA 3V8QA 1OC4A 4FT2A 1X14A 4B83A 2RGNC 3B1JA 1NRWA 2DKNA 4IVRA 4NCJA 1E2IA 5C7LO 5B2ZA 2WUDA 1IB0A 1AG9A 3JYOA 3OESA 3MJHA 1Q91A 1ZIPA 3DXYA 2EIXA 1RRGA 5BVGB 4NE2A 1GXSB 1CR1A 2H2DA 2V6FA 3ANTA 1WF3A 1POXA 3OAAD 4NYJR 3V42A 1RZRD 1KAGA 3I04A 3WBFA 1JMKC 4ARUA 1QQAA 2LE0A 1QH1B 3LYUA 5IZCC 1GTVA 3RK4A 1N5JA 2RJOA 3CM0A 3EQ9A 4URUR 4D9NA 3NVDA 2FZCA 1IJKA 3K8YA 3L9WA 4HPWA 3SNKA 1KEEA 1M6VB 3LKZA 1E3DA 2AW5A 2JLSA 1JH8A 4FGJA 4LK2A 3R5KA 4YNBA 3GIDA 1X15A 2BZGA 5FADA 2HDHA 2X4DA 1SBQA 2AK2A 3E8MA 3BY1A 1SXGA 3FH0A 3TF5A 4I4TA 3AWIA 2ZVJA 4S0XA 3PGA1 4R8RA 4CKCB 5ERXA 2ZUWA 3UT0A 2W2LD 3ZQ6A 4C4RA 1C9YA 3DHVA 2VYFA 4RVSA 4JBGA 5AHXA 3FKSD 4RY8A 4B4WA 4MPDA 4EUKA 3OZXA 5BW4A 3THWB 3W05A 3FOAA 4MYSA 2YWHA 2O14A 4RE6A 1T36B 2V7GA 4UFPA 5ALGA 4X6YA 1EZZA 2Q6IA 2QL6A 4OP3A 3G2QA 4AP6A 2C7VA 3IUQA 3W90A 2ZSHA 2W6JA 3UBTA 1A71A 3V4LA 2V0GA 5GJVC 2V4DA 2I4LA 4MDHA 1QIDA 3UJDA 2WMOB 1HDIA 3PFNA 3ZGVA 3LPAA 3QEMA 1IHYA 1IOLA 3U3OA 3BS4A 1C1DB 1DMSA 4OI0A 3ROGA 1G6KA 4U8HA 4DR5B 3GRUA 3VPDA 1QV7A 2WD7B 4IIFA 5F1PA 4B3BA 1Y63A 3IXMA 2JVIA 5EPEA 4Q3KA 2IYRA 2GA8A 1EXWA 1AC5A 2BKEA 2JFFA 4LHSA 4AF7A 4M1SA 4QUDA 3FPLA 4BWYA 2FK7A 4CM6A 5HJEA 5KZMB 5EE1A 1LXCA 1XDDA 4BGIA 3KKOA 3WV4A 4BO4A 2B3TA 3JRXA 2ODQA 1CZHA 3I83A 4G5SA 2D3TA 3OFND 2JAPA 3LQFA 1PVOA 2Z57A 4YRPA 1MFPA 3ZCSA 3UYLA 1GTRA 2FMHA 2E4AA 2IYNA 3Q38A 3G2OA 3GRCA 3A6KA 1UM9A 4LE0A 2XUOA 2ENWA 4AMZA 2ZYWX 4XM0A 5T64A 4M8LA 3LC2O 1DIRA 4F04A 2JN9A 3BMOB 3ESAA 4PR0A 3B60A 3DVSX 3MFQA 1T5DX 1FP2A 3ZIAD 1UWLA 3SNHA 5E9AA 4E4TA 4RKEA 4AZ0B 2YXPX 1DG1G 3DP9A 3P9XA 1LV7A 2AUMA 3NT5A 3QBTA 4JJ7A 4XPIA 5K8JB 1WMFA 5EJGA 2RC5A 5EAIA 1USUA 2BFBA 4WIAA 4U7HA 3T6KA 3EY4A 1Z4MA 2UUPA 3LNTA 2ZZQA 1ZSNA 3NIWA 3DEZA 2IEIA 4NPCA 5DULA 5EE0A 1E5XA 2CXSA 2BFDA 4F21A 5C5CA 1QS0B 1N2CB 4NU6A 4TXMA 1XK7A 3IELA 5IXSA 1E2DA 1YZQA 3G8DA 3D8UA 3KJFA 1Y5RA 4UUNA 4P36A 3L7BA 4ZQCB 3F4KA 2NQTA 3PD7A 3T3GA 1KMCA 3LECA 1P1KA 5TQ0A 4X07A 4RDJA 4OU4A 3ETHA 4NZZA 4GEKA 2OE2A 3OQBA 3J80A 4RTMA 4CQJA 3PZRA 4GR5A 3EGEA 3L8ZA 4YT8A 4IUYA 1M6YA 5JJKA 3WISA 1OI3A 2G36A 1U0FA 3S8MA 4BTVA 1T26A 2YV5A 1GAQA 1K9VF 1X1QA 3BFXA 3CW8X 1FMCA 4WKGA 3PTZA 1SOAA 3AILA 3JQBA 3TMAA 3VSDA 4UQPA 2YWFA 1YDHA 5A1TA 2H17A 1W29A 3B89A 3CVWA 1ABBA 3SVZA 3CZ9A 1CQXA 3MSCA 3OLXA 3VQTA 3PLNA 1K63A 4RV9A 2B1JA 3ELDA 4BKPA 4EFLA 4RIGA 2X13A 2P2LA 1G17A 2NVWA 2F48A 2FG6C 2GJPA 2YXDA 2FK8A 2B2CA 2FEOA 3DMTC 1SIWA 4PCLA 3F90A 4ZYVA 4FXPA 3IMCA 5KQPA 5CGZA 1U7TA 5HDQA 4JC5A 3VR6H 2BHTA 1WDTA 1V6CA 1U0GA 1W73A 4JEMA 1M8PA 2IDKA 2VH2A 4YIHA 4PC3A 5HIJA 3RO7A 3T38A 2RHCA 1IAVA 3FPJA 4LXYA 4OH1A 4E4YA 4BKQA 4ZMBA 5BSEA 3OT5A 2I2CA 4HVCA 3TH5A 2Z43A 4Q16A 2DLCX 3BE5A 4WERA 1YO6A 1Y82A 5CB0A 4B3XA 2XTJA 4ISBA 5IT9A 2NO9A 3K5IA 4NYIR 3VDNB 5FPHA 2Z4SA 2GJKA 4AJ9A 3VTAA 2NZ2A 3JATA 1TA4A 2R6FA 1N5KA 1L7DA 2GAIA 4JX8A 1JXQA 3GAMA 3T0FA 1U8TA 1YOVB 3MWJA 2WYIA 3VNQA 1XMQB 3LY9A 4XOUA 3WGHA 2HHLA 5FJIA 2R11A 4W7HA 4XYBA 1ZGGA 3WAKA 5MGNA 4YACA 1CDDA 1D6NA 2VPWA 3FYSA 1OXBB 3KKPA 3Q87B 4XDHA 1H42A 5EJ9A 1U90A 3EUWA 1KDOA 3BFPA 3C16C 3QJ5A 1T8PA 1NOIA 5JO0A 5MN5A 4ZYYA 3R0XA 4NK5A 5C1DA 2O5VA 4OMDA 1I2DA 3RUAA 1Z15A 1R8XA 4QOSA 4RIIA 4CEJA 2ORVA 4OHKA 1T91A 4F4HA 4IINA 221PA 2GSDA 1P0FA 5REQB 1L6RA 3DC2A 3TB6A 1QR2A 2IIBA 3ESRA 2NVUB 4WK2B 1T9KA 3T1VA 3TPZA 5BWMA 4NZYA 1JQAA 2CZQA 1V7PC 3OJOA 4FHCA 4X54A 3WK9A 4CLRA 2DFTA 4KRFA 4B45A 1OCEA 1A1SA 3AOGA 3EZFA 3NWEA 3Q7RA 5C31A 5IXJA 2CVOA 1SOMA 2PDAA 2H4ZA 4YRFA 5A6VA 1SVSA 5JC8A 3OEHA 1GNTA 3H3JA 4Z7QB 3IDSA 1F38A 3G8CA 3ICCA 3QOWA 4W4TA 5JVDF 1BWPA 3AUXA 1AKVA 3D7LA 4TRJA 2VK2A 3ZNQA 2JVJA 5KTOA 1SC6A 4IKOA 4OQLA 1WQ3A 5LXTF 1W52X 4D4IA 3MJRA 3RVOA 2B83A 4JP3A 1H94A 2EKDA 2LNDA 2HUPA 3VSBA 4HD8A 4JP5A 5TPZA 3WGLA 1IDN1 5DK4A 2A4MA 1FMTA 4AN4A 1QFYA 3KJEA 3GVCA 3EQ8A 4HAYA 3O95A 4HDNA 2GN1A 3GG9A 3VZSA 3ND5A 4P7FA 4TM8A 1D0SA 4YEDA 4E51A 8LDHA 2DBVO 2P11A 1MO6A 2QX8A 1IQUA 3QUSA 1SKYE 2EW2A 2XTZA 3B3GA 1VQNB 4C04A 1GQQA 3SEQA 4FYJA 1NJ8A 1NN3A 4OXNA 4NCXA 4OQMA 4Q1EA 1YDFA 3GLFE 3DV0A 2HT1A 3QVUA 2W6ID 2O0HA 2EX1A 3JVEA 3WLTA 1TVMA 1N8SA 2IOHA 1A95A 2XECA 3HKCB 1K7YA 4BQIA 3A31A 4KR9A 5DNCA 5IJZA 2WWYA 2XDQB 2XB6A 3VR4D 1YVPA 4XZ3A 4HRXA 2OA0A 1KTIA 2DFLA 2HX1A 2GLUA 2OAEA 1L5OA 1R6XA 2ZWOA 2QJWA 3RCBA 4YCSA 1I4WA 3K0KA 5H7XA 2QZ4A 3GMTA 1YS4A 4J2OA 3PFBA 5CH8A 4FMPA 4PLWA 3URMA 4BFXA 1AGNA 5JSUA 2QMYA 4YELA 2NZJA 5DF1A 1FNMA 4YRCA 1OH5A 1DQSA 1CUHA 4NP6A 3KVVA 5HZBA 2FSGA 1NPDA 4RS3A 3IUBA 1OWOA 1O4VA 5DM1A 4TROA 3NHPA 1N9ZA 2BZSA 2CL5A 1T4CB 2ZYVX 1PJLA 3NT4A 5KUTA 1J7KA 3N70A 5CCDA 5GJCA 4OYLA 2IYFA 1JI3A 1X7DA 2Q4OA 3B5EA 3L8DA 3V1NA 4GBMA 2W98A 2HYIC 2PWZA 3AEKB 1NONA 5KNBH 5JANA 2XRMA 4J4BA 4NU8X 3UK6A 1E94E 4NI5A 3AY3A 2ODPA 4QYXA 2XYHA 1JDJA 3CBQA 2Z8XA 2ZR9A 1EX1A 3LPMA 5K4AA 1UWVA 3WOVA 1G4AE 2VDOB 2X8KA 3SF8A 1FLDA 1JUDA 4Z4VA 1DWOA 2XWSA 1VA4A 2IUEA 2BSQA 1CK4A 1K7SN 4US2R 5L40A 4D0GA 3R5SA 5BORA 2G9QA 4OYHA 2UZ4A 1E62A 2EEZA 1WMBA 2GUGA 1DBSA 2PLRA 2FXVA 4X61A 4GD3Q 1R0BA 2WKRA 4G84A 1E98A 3BDIA 4FP9A 3T0IA 5SYNA 2ATXA 2Q3BA 4EYEA 3WGNA 3S2IA 1SM4A 1VXRA 2GNOA 1AHIA 4PZAA 4D3SA 3LVRE 3FX2A 1N2JA 3OETA 1ZH8A 4LJAA 4ND2A 2NTVA 2O2CA 5B7QA 2IHZA 3KPVA 4NZ9A 5J47A 1IMJA 2DMRA 1U5CA 5BSGA 4DQLA 2FLWA 3RASA 4C30A 1D9ZA 1VBFA 1PJ6A 3PVDA 2AF3C 2P3LA 2Q9AA 3KE9A 3PDIB 4TV8B 4R8MA 5AH0A 2VQEB 2QX7A 3L8GA 4B81A 5EZQA 3R6JA 1L5LA 1XJ5A 1OX6A 2CB9A 5I7HA 3LUDA 5ITWA 4FIDA 3ZLTA 1X87A 4CI0B 4Q9JA 1VE9A 1XZMA 3DWFA 3EW7A 1M6EX 3GWZA 4NBLA 3WSVA 2LUOA 4NS1A 5DYIA 3N07A 5K45A 1OIVA 4RLQA 3JYNA 1GU0A 3MJSA 4YRZA 1UODA 4B33A 4MLDA 1SCQA 2WAMA 2XSZD 1RJEA 4CMJA 3LVFO 5EJ2A 1OYOA 3MRVA 4DCOA 1UPAA 2JCBA 5FBZA 4BLPA 2VBSA 4V02A 3UTCA 3NEJA 1KU0A 5DLPA 4GMGA 1YRYE 1ACJA 1BTOA 1DKLA 4WXPA 1XGKA 1E5TA 3MGKA 1MNQA 2VF4X 5DNVA 2OXTA 3LUJA 4J2HA 4BP3A 1T6XA 2VI5A 2C99A 5JARA 3OI7A 4J1NA 4XIIA 1DB3A 3HA2A 1W6UA 4NFYA 5L4NA 3AF6A 1Z6YA 3DAFA 2FZ4A 3K72B 2GKOA 2FSVC 3KZMA 4QYWA 1XQ1A 2ZZGA 3K4HA 4FCCA 4RH3A 4UATA 3N2KB 4P3NA 3I23A 3QE2A 2B78A 5K8IA 3L6UA 1N1EA 3JD0A 2BFFB 2QTZA 4WPGA 3HSKA 2OKCA 1DAOA 4XM1A 1I9GA 3L1IA 1XDGA 3BXEA 4B8ZA 1E4YA 3DAPA 3F46A 1DELA 4O2AA 3CE9A 3GLGA 3ZVMA 4KE6A 1XZBA 1UEXC 4C21A 1TZKA 4GOND 1YLOA 4LYDA 5J58A 1A4UA 2BZ1A 1U3CA 3KB1A 1K5DA 3PUJA 2NTYC 3ZX4A 2W7TA 1E0JA 4MW2A 5IJ0A 3HCDA 1WG8A 3ZVLA 4I1PA 3G1UA 1ZD9A 4UCWA 1S2LA 2D3WA 3DG9A 4UE6A 1P2DA 3FDZA 1E1QA 1XX6A 2V7VA 2IK8A 1QHXA 3JQEA 1ZO8A 2PMBA 3RIYA 2A35A 4F8EA 5EC8A 2QMHA 2IYUA 4K1LA 1KZ1A 2MIIA 2CLKB 3QLVA 4P7GA 4BVBA 1CUGA 3BRWA 5KYXA 2DZDA 1FUYB 3GA5A 1OXUA 2M98A 2XADA 5E6UB 4Q21A 1VGVA 3N39C 2TECE 1X70A 3MA0A 1YF3A 2DYIA 1XNJA 3F8TA