1BX0A

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
296
Chain Sequence
HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVLVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
total genus 96
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1bx0A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1bx0A02
3ZZUA 4YHBA 1VQKB 3B78A 2AHOA 1W35A 1ZM4A 2XEXA 4AC9A 3JQQA 4ZGQB 5AN9A 3CB4A 1QFJA 3CCQB 2J7KA 4J0QA 3CD6B 4LC0A 1DDGA 1DDIA 4M53A 3PENA 3CCEB 2PMDA 3CPWB 2FX3A 3VO1A 2YWGA 4FN5A 4PC6A 1FNCA 5FA6A 4TMTA 1KK2A 4YALA 4YAFA 3AVXA 4TMVA 1EP1B 4Q7JB 1YHQB 3MHPA 1EFTA 1N0VC 2VNKA 1VQ5B 1IJFA 1W34A 1Q81D 4RD0A 3WNCA 1GO2A 2D74A 2QEXB 4B47A 1VQ4B 4H9GA 4QHYA 4B4DA 1GJRA 2QN6A 3P27A 3U6KA 1DARA 4RCZA 3CCMB 1TTTA 1EFCA 4B3XA 4NBSA 2VNIA 4FK8A 1E63A 4DQLA 3U6BA 2VNHA 3AVTA 1XE1A 3W2GA 1D8TA 2OK7A 4B44A 1FNMA 3WY9A 1OB5A 4G1VA 4C0SA 3AVYA 3JQPA 4TMZA 1QUFA 4WQMA 4LBYA 1ELOA 1U2RA 1XB2A 4ZGNB 1JA0A 1W2BB 4HE5A 4RCYA 3AVUA 4U9UA 1UMKA 1YI2B 3MCAA 2DY1A 3CC2B 1Q86D 1FDRA 2QA4B 3W2FA 4Y7CA 3CCUB 1K9MD 2B7CA 1CNFA 4IW3B 1G7TA 3MMPA 4F7DA 1NJID 1TUIA 1DG1G 3A1FA 3LO8A 1K73D 1J9ZA 2BGJA 3QFCA 1VQPB 3LRXA 4N3GA 1D1NA 3B82A 4UAJA 1EFUA 1CQXA 1QFYA 1K8AD 3LYUA 1VQOB 1FRQA 4ZCLA 1E62A 3W5UA 4K1XA 4P3YA 3W2EA 2QMUA 1WDTA 2YWEA 5THXA 2CRVA 3W5HA 3WBKA 4LBZA 5TV2A 4EH1A 1KTVA 3AVVA 1ZUNB 2EFGA 4YAUA 1BQEA 2X3UA 2ZITA 1SM4A 2C78A 1A8PA 3VMFA 3E20A 5DSZA 1EP3B 1FNBA 3WYAA 1ZM9A 1KK0A 4RD4A 4M0LA 1QUEA 4DQKA 4YAWA 2VYQA 2YWHA 1QG0A 4QFMA 5KSWB 3CCJB 2BPOA 1D2EA 1IJEA 3AVWA 1KK3A 1JA1A 1EWYA 3ZBUA 1S0UA 3JQRA 1W87A 3QFTA 1YJNB 3VNUA 1QGYA 1JJ2B 3I1FA 2XNJA 1F60A 2R6HA 5GV7A 1HA3A 4B43A 3CW2A 1S72B 2QTZA 1OGIA 1FNDA 1E64A 3OZWA 1N0UA 4Y9UA 2DETA 2E1RA 2VNJA 4RJLA 1QVFB 2NPFA 1SKQA 1ZM3A 2B5OA 3LVBA 2CNDA 1KJZA 1AMOA 2DEUA 3WXMA 2B7BA 1G7RA 1M90D 3W2HA 3FJOA 2BV3A 2QTLA 5GV8A 3ES9A 1GAWA 3QFSA 1ZM2A 3CCSB 3WBJA 2QDXA 4P6VF 5EMNA 3I56B 1VQMB 2RC5A 1N8RD 1JB9A 4ACBA 4PC1A 1NDHA 2GPJA 4G1BA 2HCJB 1JNYA 2EIXA 1R5BA 1G7CA 3B8HA 3U2QA 4ACAA 1QVGB 4C43A 2OTLB 4ZCMA 2VZLA 3VNVA 4FWTA 3ZBTA 4B48A 1KD1D 1AIPA 4BPRA 1YIJB 4M1KA 3OJWA 4N3NA 5H5JA 1YITB 2OTJB 1H85A 4LBWA 4RD1A 4ZCIA 3G6EB 1BJKA 3SJZA 2BM0A 4YAOA 1KQSB 1H42A 3VO2A 4AF6A 3AGQA 4ZV4A 2BM1A 4TMWA 4PC2A 1B2RA 1F20A 4Y9RA 3CC4B 4M2LA 3CCVB 2DCUA 3CXCB 1VQ9B 3CCLB 4RD3A 2HMAA 3FPKA 4RD6A 1GR1A 1TLLA 3ZZTA 4M4SA 2BGIA 3OW2B 3QSYA 1VQ7B 3CMAB 2OK8A 2PIAA 4TN1A 3AGPA 1IB0A 4PGOA 1VQ6B 5TR9A 1EP2B 2BN4A 1EXMA 1QGAA 1GAQA 1B23P 1BX0A 1KRHA 1I7PA 2BF4A 1QX4A 4PC3A 3G71B 1GVHA 3G4SB 2RC6A 3I55B 2BSAA 4G5GA 4MYUA 4TMXA 4NCNA 1VQLB 1R5OA 1QFZA 2BMWA 2HDNB 3V76A 3QE2A 3WNDA 3OZUA 1R5NA 4MYTA 1YJWB 5H59A 2XNCA 3OZVA 1OGJA 1BX1A 3J81k 1KC8D 1M1KD 3CC7B 3ZZ0A 2PLFA 4LBVA 3W5VA 1VQNB 1QH0A 1Q82D 4HE6A 4PC7A 5TY0A 3E1YE 3WNBA 4RD2A 5JBQA 2GQFA 4AF7A 3OJXA 3CMEB 1FRNA 1YJ9B 1CNEA 3CCRB 1KK1A 2DERA 2YWFA 5HXBA 1QGZA 2BVNA 3W2IA 1VQ8B 3QFRA 3CRZA 1Q7YD 3P26A 3ZC3A 1OB2A 2C77A 1TVCA 4R71A 1G7SA
chains in the Genus database with same CATH superfamily
4YUZA 3E18A 4XH9B 1GZVA 1YR3A 3MCVA 3I6MA 5KO2A 2D5AA 4HL6A 4YUWA 2CFTA 3M1IA 2HO5A 3GSIA 4AUMA 4RPDA 4DLRA 3GXOA 1IOVA 2PM8A 2FUG6 5T3YA 4PX2A 5LDDC 3UHJA 1J7KA 5J63A 3H11B 4LHWA 1YU9A 3BF7A 5FRDA 1ZEJA 1KMMA 2OAQ1 2P6UA 3S2YA 1HDYA 4PAGA 2AW5A 1RPZA 4ENPA 3BGSA 5E7MA 5F5LA 2AX3A 4H7FA 5AHKA 1W30A 1GLNA 2MT9A 3AUXA 4KL8S 3AR7A 2BCJQ 2YHIB 1P0CA 4KDRA 2IHVA 2KMLA 3X3HA 2I66A 1FFYA 1Y4SA 4GF5A 1N3LA 4WDQA 5I9NA 1RP1A 3G6WA 2OWDA 3BRQA 1VLLA 2IW1A 5KHOC 2KBEA 4CL0A 4ESEA 3C97A 1C81A 2JBAB 5KNCH 3IAHA 4FN4A 1IK4A 3FPJA 4H7HA 3SIRA 2QNBA 3DCYA 3UXMA 1EP1B 1OQAA 2VBCA 3GCZA 1Z08A 3ISVA 3WDKA 2HGZA 4F4DA 2SHKA 4OUDB 1N0VC 4G8JA 4L4RA 1VHEA 1GPNA 3I37X 2YYYA 3Q6IA 4MIOA 4I66A 3DEKA 4CLDA 5JRDS 4C21A 5LWQA 4XQ9A 3WMXA 4WLNA 4WD3A 4MLCA 2W2PA 1E9DA 1KC1A 1ZHHA 2D2FA 4BLTA 5EUCA 3OPYA 1WZCA 1F3OA 4E31A 3PNMA 2XTZA 2HBQA 3D6TB 3TO5A 5AW7A 2B9EA 1RQGA 4RF2A 4MYHA 3B60A 4GPTA 4IH4A 1MXHA 5CGQB 3G2HA 4ZT3A 4W99A 2P9EA 5MN4A 4CCSA 4DNTB 3ZJUA 5CA0F 5ED4A 4WUVA 4HS4A 3COYA 5KB3A 3T95A 3DF9A 3DD5A 2PUVA 3IDZA 3U4AA 1BMQA 3F5DA 3EEFA 4O2AB 3Q2IA 3STWA 1U28A 4Q1FA 4G5QA 4LQCA 4E88A 1EFKA 3DULA 2EVWX 3P7MA 3OZCA 5AUQA 3AZOA 2FR8A 1ZJ4A 3CH5A 2JCGA 3D3WA 3PGXA 1OJLA 4NMWA 2WZDA 1W1WA 2AT1A 1OREA 2QV0A 3MMSA 2FMIA 5IBRA 3GR6A 3DE4X 1GZ5A 1OE0A 4C20A 4UDYX 5E4YA 1HL7A 1QJ4A 4N7RA 2Z4RA 4W82A 3T4XA 3WLOA 2C94A 1JL3A 4KAXA 1MR3F 4G5FA 4UUQA 3T5AA 3V6MA 1NVMB 4JASB 3ELDA 3U3ZA 5JISA 5LMNB 3H2GA 4WZAB 1CZOA 3SE0A 4LRQA 4CN8A 1P5FA 2NU9A 1PI3A 2Q8NA 3R6GA 2YWDA 4JNKA 1VG9B 1JKMA 5DOZA 1LEHA 2IYNA 5ENVA 2OV1A 2H1OA 1U90A 2C2OA 2VDRB 2XDAA 2XZTA 3AHIA 2R85A 3HN7A 4IVRA 4UM9D 4HE5A 1WCV1 2ACKA 2HSDA 2R6DA 3A6FA 5HMMA 3UMFA 4M0MA 1VRCA 5A04A 3MCAA 2C98A 4D42A 3LLSA 1FMLA 1ND5A 3HUFA 3R3HA 3MS2A 1P4HA 1SKYE 4NAHA 4ENTA 1L1QA 1V3UA 3IAEA 1BD3A 1YONA 4GECA 3W06A 3JAWB 1TEXA 5BN4A 4G6ZA 4YRGA 2NU7A 1DEXA 3PDJA 2WUWE 4AUKA 1N1MA 4HV4A 4R0VA 5I7FA 4ARZB 1E92A 4NDNE 3VZPA 5LQKA 1QMPA 1VPWA 2FQ1A 1LRLA 3U3XA 4IX9A 1BFUA 1U0OC 1L5SA 2REOA 1T3TA 4M1ZA 4QXOA 3E7PA 3GJTA 5JI2E 2GILA 4KKTA 1ZXXA 2XB4A 2AKYA 5DYYA 4C4SA 2YFYA 4F21A 1A1SA 2NAFA 2AI1A 3D3JA 3U31A 1OA0A 3WHPA 2QJRA 4Z5XA 3BIJA 1RPTA 1EFUA 1CQXA 2ZJ6A 3UO8B 1PWXA 4ZP1A 5DLDA 5HCIA 4F5EA 3ETDA 1MBZA 3NIGB 4P3KA 3DMHA 4DLXA 1Z56C 4F12A 4AK9A 3EDYA 3HU2A 2JDIA 4L76A 1Z0DA 1W85B 3GRRA 4N9WA 4K1XA 1H22A 1X77A 2Q4RA 2LKDA 2OV3A 3CSUA 3FRIA 4F6RB 1AS3A 3LT2A 3MXTA 4M8NE 3ZY5A 2ZIXA 3W5HA 2D5IA 4LBZA 1RHMA 1T9GS 1RWPA 2AFHA 2HL6A 2QMYA 3LUFA 4QJBA 5A1JA 3A1SA 1CR2A 1BGWA 3LK7A 3PU6A 4L57A 3ZW8A 2IYQA 4HQ0A 1RLTA 2I4LA 2P2NA 3FA2A 4BL5A 1GNSA 3IQWA 3LIIA 5ICSA 2JJYA 3GGCA 3OCJA 1GTMA 3S1AB 3I4CA 1KEZA 4GXQA 4RKFA 3OICA 4WHMA 4JC8A 4GPIB 2X15A 2ZOSA 2QL5A 3IBTA 3SKVA 2J32A 3AQIA 4IKEA 1ETHA 2GBIA 1UJ5A 2CMKA 2DH6A 3QE9Y 5CJJA 2DU8A 5JNRA 1NB9A 1FP1D 4MRMB 2BIFA 4R1OA 2J3LA 1XTSA 2VJLA 2X9LA 3Q7IA 4CL8A 3L1KA 5AT1A 3UK0A 4NU0A 1EXDA 2G17A 2HWUA 2I4NA 3BSFA 3K05A 1H6CA 3UB2A 2ODPA 4CU2A 1THGA 3I8OA 2QJOA 1R66A 2V55B 3LK6A 3PNYA 2KB0A 4LQ4A 5FHQA 2PU5A 1QRDA 2QTGA 4EATA 4IMRA 3ODPA 5A9RA 2P6NA 4NZYA 1A7AA 2HLDA 4MUAA 3CLRC 1OLXA 3UJDA 3FYTA 2XX3A 4MRAA 3CCJB 1CJSA 1NL3A 1ZVQA 4HQ6A 1WVGA 4WZLA 1K6XA 1GUDA 2XKBA 3HA5A 4ZYVA 5AVOA 3WO1A 1XQBA 4PZYA 4E2YA 4HX2A 4CMAA 1Z7BA 1CF4A 1FXUA 4XLLA 1XO1A 1DEKA 4NYJQ 1WD5A 1LV8A 1Z2AA 3ROPA 4URUR 3G5LA 4MMYB 1LCIA 4PICA 4TVOA 1E3JA 1YJNB 3DDUA 3V8MA 1L4LA 1Q0TA 1DO8A 4IEEA 1KFEB 2OD2A 2Q49A 3F90A 3T0FA 1A4UA 1F60A 1WHSA 3AJRA 1L5YA 1F5SA 4BKPA 1NPYA 4BVEA 5AVZA 3TLGA 3LCVB 5HCUA 3BJIC 4RS4A 1EDOA 3RUDA 3NBQA 5FWNA 4ZJZA 3ZDEA 1KVSA 1YASA 3PPWA 1YQEA 5TQ2B 5KW9A 3WGVA 1SKMA 1X1AA 4R5HA 1BXGA 4EI8A 3CX6A 2PIDA 1JSXA 3TKLA 4S1OA 1ULHA 4U02A 3OE7D 5FT9A 1JILA 3P1JA 3TZEA 1GCAA 2ZULA 5EQFA 2XGGA 3I01M 4PO9A 4F46A 3G2KA 2HDWA 3PEUA 1YBFA 2XLBA 1M1YA 4FZJA 1YFKA 4KSCA 1FW6A 3B7PA 1LH0A 3ILVA 1MH1A 4R1NA 4R1UA 2DVMA 3GY0A 4V0QA 3HJHA 4M0UA 5AVVA 4CKCB 2VAWA 3TPFA 1GDTA 1KYXA 3NM4A 4DSTA 1Z5PA 1B74A 4MHTA 4FZ5A 4OK3A 1N78A 2QW8A 1P7CA 1WABA 3AUAA 3TSWA 1DKNA 1M90D 1E6EA 3FJOA 1AZTA 3MMXA 3QI2A 3DAGA 2EIHA 4KQCA 4ID9A 1U3TA 2QD4A 3G8DA 3PI6A 3RNLA 3UA3A 1IQ0A 4IILA 3U39A 4B46A 4CTOA 1XQ9A 3ZCRA 5AW1A 1M6NA 3QG1A 3ES9A 2NIPA 3EGDB 5K6AC 1N06A 1KEUA 2CBXA 1LBTA 1UF9A 2ZBQA 4HQLA 4QPDA 1T6YA 1UMBB 1Y42X 3T52A 5CFOA 1T8SA 5KNDH 2Z2YA 4RVNA 4BEBA 1GFWA 1XK7A 1PJQA 3COJA 1N8RD 2XB9A 2CCJA 4YUXA 4E5DA 3AR5A 1EQ2A 2QRJA 4D97A 9ATCA 1WU7A 2W93A 5C1PA 2WIJA 3QITA 1VMEA 5F4OA 1H4TA 1OLSA 1QIIA 4LHVA 4D9NA 5MF6A 4PGAA 5F73A 4BO5A 3JQFA 1FDWA 4RTMA 4X7CA 3LM8A 3U4CA 1OD6A 2PKEA 3B9BA 1W0CA 1Q3KA 3VBCA 5M2QA 4L0MA 3U2QA 2AVDA 3ZK9A 3ZNPA 1XWFA 5ADUS 2AMLA 2ZRAA 1RRCA 2J0QA 3CG4A 5CR9A 2IYFA 2QX6A 4IUCS 2HK9A 3I5YA 4MB6A 1XA4A 5KYYA 3H97A 3KYCB 4GYJA 2GZAA 1LV7A 1N2SA 3SVTA 1SVNA 2AZ4A 4DZZA 1DU4A 2QQ0A 4F4IA 5JXGA 2Y1WA 3UPTA 4XQEA 3NJRA 2BGGA 3IBCA 2JIOA 1FSFA 3MJVA 3W1EA 3ZCUA 8GPBA 2IZ1A 4MVJD 4WLEA 3TL3A 2Y1LA 3C24A 5CLJA 3M9WA 5JFGA 3H9EO 3H9QA 2XMCA 4L28A 1PR9A 4DMGA 5DLEA 4QOJA 2FSFA 2XAUA 3H5LA 2G9VA 3U7QB 4OMFG 3TW8B 4WXHA 3K8OE 1XDBA 4UPDA 1MKYA 1JFLA 3DFIA 1X7ZA 2R8BA 2Q3BA 2XNKA 2X8AA 4RJJA 4S04A 2GXAA 3LF1A 3QWBA 5JS8A 3QTBA 3M3DA 1IHOA 2WF9A 1C3VA 4UHJA 1TVMA 3IJEB 4JLKA 3LAWA 1AD2A 3AOGA 5JHHB 3ZGYA 1FFXA 1ZL0A 3OM0A 1IM5A 4RGVA 1PS9A 4J07A 4U2DA 4Q02A 3RTDA 3VO2A 3E70C 2FDCA 2O52A 3DP7A 2NVUA 2IYAA 3PE3A 2D62A 1EK0A 4BRZA 3NETA 4G7XA 1XZEA 3EXAA 2VAPA 2DG2A 2RB5A 2VHUA 2WIKA 3IAM6 4UE3S 4NEHB 2NSYA 4PY2A 1QS0B 1H1DA 1LJLA 4I36A 4RQUA 2P41A 4U7FA 3W6ZA 3HA2A 3T7TA 3A1PA 3O9ZA 2DHDA 5EJIA 1EHYA 3D1JA 5D86A 3RRMA 2GNPA 3U3MA 3DE6X 1A9TA 1IMOA 3EA5A 1WCIA 3I9V6 2YN2A 3OP4A 4B6FA 5F4JA 3TF5A 2QUKA 2RHRA 1RJEA 1IPEA 2IHTA 4RTJA 3IBGA 5FBZA 1BSVA 4EG0A 4L1KA 3LBFA 1RQRA 2XYPA 3MB8A 1GUAA 2NT4A 4EPXA 3N2LA 3NXKA 5HJ5A 5DHUA 1Z33A 3AUTA 1GU7A 4MSUA 5HFAA 3BHIA 3DVAA 1MPTA 2RB4A 4A26A 8ATCA 3LI2A 3Q3AA 1G20B 3O26A 1QHNA 4LV8B 3X2EA 1N2EA 3AEUB 3JQAD 2MSNA 1Z25A 1UK6A 2I6SA 1MDFA 1W0JD 4MPJA 4MW1A 1Z17A 1UWKA 1YBHA 3U81A 3ZEAA 2VQFB 3Q7SA 2WABA 2D7DA 5TR9A 3SS9X 4OOXA 1A5SB 2PGIA 1F0YA 1RRMA 4TLBA 3OW7A 3QELA 2Q8PA 4M7OA 2QX4A 4EYGA 2GQ0A 2M6RA 3RIGA 1EAYA 1SPXA 2IOFK 3JQ8B 1HRDA 2AYYA 4B81A 1NI5A 2V7WA 3CEHA 1U7HA 2NVOA 2OCYC 3CR8A 3DWIA 3FI0A 3OIFA 5AIAA 1G21E 1POXA 2QTTA 2F43B 4O08A 4WAUA 3TTSA 2RGDA 4XWTA 1IXKA 1MGOA 4BFCA 2DQYA 2KHZA 3V2IA 3I2GA 4BNDA 3VNRA 1RRKA 2EFEB 3HJTA 4BMOB 3FNEA 4C6TA 4LZLA 5J1TB 4DLAA 3JY6A 3TG8A 2VYVD 5FUXA 2YVAA 3S8MA 3HVRA 4IPTA 1U5BA 4QFDA 4EHNA 3FGNA 3BX1A 1KPGA 1HE4A 4DYDA 1H2FA 1VJSA 4K9NA 1BDHA 1R5OA 3P0HA 2BMWA 2JATA 5CLLA 4H1WA 3OQMA 1CPYA 3K6KA 1X86B 2F48A 4NZNA 4G65A 1ADYA 3ASSA 2XD9A 3WO0A 2UUBB 1U6KA 1R5NA 2P3SA 4GLLA 4HRYA 3ZE9A 1ZIYA 4LJAA 1ECJA 1Y8QA 3ABQB 5BSVA 5HGXA 1SVOA 1AURA 2VJQA 4L5BA 1U0TA 4ER7A 2PGAA 4FIDA 3H6GA 1GTSA 3KOYA 3RU2A 2JLUA 1XEFA 3QKWA 4MW0A 3G9XA 3NYIA 4A03A 4ZVQA 4EHBA 1BIFA 3EMVA 3FHTA 1W8DA 3A2KA 1M75A 4HPWA 4HAYA 5DMXA 5I7VA 2X3YA 4C7XA 3TIXB 1UODA 4GDFA 4C2UA 2UVDA 5BNZA 3CC7B 5E7IA 1UT8A 1E89A 1RHQA 3OLVA 3QGMA 5K3FA 1ZGGA 3VX4A 4AU1A 1HE2A 4ETIA 4MARA 1RXEA 5AKGA 2Q5CA 3IIJA 2QQ5A 1JYFA 1FFGA 1LA2A 4BBJA 2FK7A 3AFHA 2QY9A 2HC9A 2II6A 2VXCA 3ED5A 1P61B 13PKA 2QU8A 3EBOA 3BT7A 3LDAA 2VJKA 3HVHA 4CMIB 2F1OA 4DLLA 2HFKA 2VPQA 2SKDA 4DLUA 4JGGA 3ZBPA 2PUEA 1JLLB 1PUJA 2ZEJA 1RE1A 3MK31 4MQMA 5JO9A 2G5PA 3INGA 1SVKA 2PKYX 1P81A 3PL5A 2VSXA 4MK4A 5BW5A 2DB3A 1F9AA 2HXSA 2BBSA 1D2HA 3PA6A 5AK4A 2OBXA 1Z7EA 2JANA 2PYZA 3HHEA 4GOLD 3CVWA 1CNEA 2X7JA 3TECE 4M0EA 3RNOA 4A0SA 4PIPA 4NOJA 1YL5A 3UH0A 1OTYA 1YS9A 2XRMA 1M1YB 2BY4A 3AB7A 1E1MA 3ZKWA 1PZNA 5KOJB 2EBUA 4Q9NA 4BLOA 2PKQO 1RVV1 2CVOA 2J07A 3RYTC 5EJ9A 4WLFA 4EY8A 5I7OA 2J6BA 3VVBA 4OHYA 2GEVA 2RHJA 2VJNA 4MJXA 3ZC3A 3O6VA 2CE2X 1EU1A 4B6SA 2JGIA 3Q40A 4KPYA 5JYBA 3AESB 3AUYA 1GXSA 2EHJA 3WMRA 1Y81A 2MIIA 1OX4B 2QLMA 3L4BC 3AZPA 4Y3UA 1TA9A 4DB4A 3O7MA 4ZAWA 4G5RA 3TNJA 1M6WA 2BEUA 3JQQA 1SJ9A 4WZAA 3ENQA 4YECA 3OBBA 2QZ4A 4HDNB 2CVHA 2RH4A 3RT7A 4EOGA 2ODEA 3IMFA 4G09A 2JH3A 1GSOA 3OFJA 1VL5A 2BM8A 5F3RA 1J2TA 1TQDA 2AQIA 3OAAA 2IFTA 5IYQA 3HLYA 2WIGA 4MQBA 4R41A 3PQCA 3CPWB 1R6XA 2H1FA 3DP9A 3SJCA 4JGBA 1F06A 4K40A 1HLPA 2OO3A 3AIMA 4D82A 5AD1A 3OKAA 4Q4LA 5CLHA 1QWOA 4V3BA 1Y7LA 3PNQA 4J6FA 1V5FA 4AT1A 2ECOA 2JHPA 2XADA 2H7XA 1IWBB 2CLOB 2IE0A 2ZTNA 3BQNB 1SXJD 3L77A 4K26A 4KB5A 5LL6P 3BHMA 1XDSA 2GVZC 1MO6A 1TYEB 1Z4JA 2NO9A 1Q0UA 3REFA 2BOVA 2Q2QA 3MINA 3RYFA 3WL6A 3GT7A 5EKUA 1B6TA 1R64A 2D0DA 3GGJA 4KQIA 4OHFA 3F5SA 4GQNA 4PHHA 1XFAA 4W5RA 1CUWA 2XLCA 4EF6A 5CHEA 5L7YA 1OH8A 3ZLBA 2JBWA 4QHYA 2IDZA 1M2OB 2PWZA 2Q5QA 4P5EA 1T3LA 2X4IA 3BL6A 5AUNB 4WN9A 5EFOA 5DNDA 1Q0PA 3EDRA 3P27A 2W4IA 1SXGA 1DARA 2PX0A 3W4JA 2EP8A 1ZY2A 1R5JA 1QVWA 5EHQA 2EU8A 3G0OA 3ZWDA 4NBSA 3PCXA 2OT3B 4GMXA 4X9XA 1GDDA 4XSGA 2Y1FA 1D4ZA 4FM9A 3CGGA 3AKCA 3FDZA 2WPDA 3QHAA 4BGIA 3B1VA 3B8EA 1H2WA 3EGXB 1ADJA 1C1DB 2AHRA 1MDBA 2FUKA 2OGWA 2YDXA 2H5IA 2GM4A 1SIOA 2NW6A 3M5PA 4ZTUB 3AVTA 1XE1A 3W2GA 3C7CB 2OK7A 1JHZA 3PA8A 4DRXA 1EUQA 1GU1A 1OA1A 3V1YA 1V9CA 2ZCUA 5BQ5A 1SKAA 2WUGA 2ZB4A 4HDQB 2JIRA 1BX3A 2GCOB 1GTG1 4HDMB 4G1VA 4KVZA 4MGYR 4LJ7A 3W90A 4C0SA 1KAHA 2JBHA 2QXUA 3DMDA 5FBQB 4RNCA 5IT5A 2O0JA 4GOOD 1IIBA 5KVVA 4X65B 3I23A 5A4MS 3I64A 1IN4A 1DTEA 3BICA 3DMTA 5AJTA 5JBIA 3TOCA 5J3JA 3FPBA 2ZQZA 4WQMA 4O33A 1PT8A 4B7AA 4MWBA 3GG9A 1QU2A 1Q19A 3DOEA 1CVLA 1ELOA 1TADA 2IU3A 1LW6E 3AIIA 3HC7A 5B2FA 5EXDA 1GYRA 5J2UF 4HK4A 4D8TA 1F2UA 2GHIA 3Q98A 3RFVA 2DUMA 4QFCA 1RXVA 3OFVA 5TMEA 1VGVA 1GRRA 4U6SA 3BGOS 4EKEA 1QDUA 3CY6A 2MMCA 2G25A 1G5RA 3C1UA 3Q7EA 4QQKA 2UYGA 3K30A 4O2BB 1V5GA 1A0OA 1KPHA 4OAPA 4Q39A 3IUPA 3DMYA 2QY6A 4MGEA 2P79A 3HFRA 4IJQA 4X91A 4Y9DA 3WK5A 4DNQA 1WDLA 5F1KA 2VUUA 2TRSB 4IXMA 4DXDA 2G40A 4PRLA 3QWHA 1UQUA 4Y7CA 1DCKA 1K7CA 1H8HD 2UYOA 3FRJA 2BTOA 3HKEB 2Z3WA 3UIEA 4X7EA 5KWEA 1APBA 3A9TA 3CUTA 2I71A 2I9KA 1G42A 2Y67A 2V97A 5CIWA 3FR7A 3UHFA 3NIDB 5EIHA 2B7CA 1F9EA 1WHSB 3CX7A 3DVSX 3WXBA 4BP8A 2F3QA 3B1WA 1ZA1A 3FTFA 3ANMA 1TUIA 4K9DA 4FU0A 1XN1A 1W1UA 2HMSA 1J9ZA 4PHFA 3AKEA 1VQPB 1AUQA 3KOMA 4M3NA 4N3GA 1WZUA 3Q0EA 1E3LA 4EFLA 4UAJA 1UBRS 3ID6C 3RK1A 1O8CA 2ISQA 1ZSVA 3I4LA 4EYOA 5BMVB 1ZJYA 3IXQA 3RYHB 5KOHA 3VBEA 4FGLA 2NN3C 2XVYA 1X7XB 3CYFA 4JJ7A 5BV8A 4P3YA 5CX1B 1WW8A 1E1QA 2DULA 2ONKA 5THXA 2XPCA 4B83A 3PITA 4C3VA 2ZBVA 4FCVA 2Y8EA 3ER6A 2C1XA 2J3DA 2QVXX 1EVIA 3SEAA 2RHGB 3BAFA 2O05A 1DAPA 2XDWA 4QO8A 1OFHA 2ZYUX 4B3GA 2N3ZA 1RAEA 3UNXA 2EW8A 4BFWA 3T9AA 3NPMA 3VNBA 4MX8A 4IICA 5HX7A 1PWHA 2FPMA 4RDHA 1A8PA 4H08A 1UOQA 1WXIA 3D2CA 4WI1A 1EUDB 4HCJA 5IKOA 3WKEA 1V1RA 1KO8A 1WXWA 4JHXA 1J1IA 1TM4E 2J4CA 3HCWA 3FB4A 4JS0A 4YJHB 5BT8A 4U9HS 1MHTA 1LXCA 1R0WA 4LYYA 2HR1A 3ZCVA 2DWPA 3ONFA 1SUWA 3HYRA 2JLXA 1AF4A 2WG1A 3EWAA 1S6YA 2I67A 4HFMA 4XGRA 4ZI5A 3RBXA 2OGUA 1PHRA 3S70A 1DG9A 2BFAA 3KKKA 2OLEA 1G3RA 2P8SA 3PPXA 1ZSYA 5DM0A 4AJ4A 3DNFA 3C6XA 4A92A 1AHIA 2W6NA 3PJEA 3PT5A 3DE2X 5JFOA 2QW0X 3GROA 5G1PA 3GX1A 4UHCA 1A9XB 2O50A 2QUZA 4EY3A 1GQOA 3AR6A 2GTIA 4YTEA 5K0LA 2QROA 2V0GA 5KSWB 1H2AS 3DFKA 3VR1A 4NBNA 4QELA 2R5WA 3BMOA 3LA6A 5KVAA 1DZ3A 1JT2A 1P1CA 1D2EA 1WVMA 2G1KA 2XB6A 3FFAA 3G17A 1OY1A 2JLQA 3I9MA 3OBIA 5DEOA 1ESCA 2HT1A 3RVOA 1C7EA 2RD2A 1DTWB 2E55A 1KDYA 2HQBA 4I9HA 1MIOA 2CLMB 4MO9A 4MROA 2H1CA 4AY4A 1JIKA 4XOUA 2YMLA 3A05A 4IO0A 3LQRA 2XNJA 4J7XA 1ZIOA 3S0JA 2E6UX 1NVKA 1UWLA 5FDFA 2XQFA 2Z2KA 3DUFA 3KM0A 3QMPA 1WZEA 3EYWA 4O5OA 3G89A 3AM3A 3GRVA 3AETA 2FE1A 2C88A 2I03A 2ZIUB 3KUDA 3SX2A 3ETJA 1JKXA 2C2BA 3BZUA 2Z2ZA 4TZTA 2QTZA 4BGDA 5FTLA 5M7EA 2JKZA 4Q15A 2HPAA 4E5YA 1OU4A 3INTA 5KU1A 1W73A 4D9IA 1QZXA 2J0UA 2ZSDA 1J6UA 2R44A 3NWEA 4YFVA 1OVMA 3R4CA 1E61A 3BGDA 1ODIA 3ND5A 3O7WA 3OCXA 4EB0A 3KD2A 3E7FA 4MQEA 1Q7EA 1XMVA 2DOKA 3RC1A 2AD1A 5K9ZA 4KR3A 4OXQA 4TTPA 3RUPA 3PFHA 4FT2A 1VIMA 3H5TA 1J97A 3IR5A 4JQCA 1T3SA 1UM9A 3B3AA 2DAPA 4KG7A 1D6MA 3USZA 2Q3HA 2AI2A 3K09A 4JBWA 3ZEIA 4ZHQF 1Y3AA 4E21A 2FSVC 4XPZA 1M2NA 1ZRNA 5C7LO 3R7NA 4UTPA 2PX5A 3EZLA 4JSYA 3NBFA 3ELBA 3SXJA 4GP6A 3GIRA 3G5MA 4ETMA 1YS1X 1OX4A 3DLCA 5A4KA 3AUFA 4QU8A 3OT1B 1WR8A 1SUPA 3PQFA 4WXEA 5JZVA 4K0KB 1R9MA 1TJ4A 2MU1A 1LQUA 2N1BA 5LP6C 1NWHA 3CVVA 1ZM2A 4F8YA 1B42A 1SPBS 2GAIA 1F2DA 1XMSA 2H1VA 3WJAA 4E5KA 1V2GA 5M29A 5EMNA 3I56B 2OQVA 2PJDA 3DTVA 3RHSA 2ZXUA 4P98A 5CNIA 2FFJA 1KZHA 3PDCA 1Y80A 3T5TA 4JQSA 3AFMA 1A9SA 4XEUA 5GONB 3SOPA 4RHEA 3UOGA 4RMJA 3NWPA 2XWJI 4V03A 3AK4A 5KX5B 2HCJB 5D01A 2JL1A 2R4QA 3P9RA 3NUQA 4QDUA 5KQGA 3U19A 4DC9A 5FPKA 1P29A 4I9UA 1RHRA 3ZXXA 1QPGA 4CMBA 5EUQB 4DKJA 2H0QA 1MORA 1P4RA 3ZY3A 1EGHA 4S1TA 5EUBA 2Z30A 2JFBA 4G8DA 3RRFA 5EIXA 2CHFA 1T9DA 3EBPA 3VNVA 4PZPA 1DEOA 4D4HA 4ZZ0A 1BCSB 3QI7A 4LVOA 1CF9A 4QAQA 3ZDRA 3AB3A 3IVXA 2QD1A 4BO7A 1N2HA 2ZYGA 1ZW1A 2CFSA 4ITUA 4LV5B 1XF1A 4ZJPA 1MD9A 1F7UA 1J90A 2Z8YM 3LV8A 2VF8A 1UT5A 5K3FB 5JH7B 5K3EA 4DJTA 2X2EA 3QFHA 2IKSA 4S1PA 1SUCA 5ICFA 2IVZA 2D0OB 2X42A 2XV1A 3B6IA 1MO5A 3Q15C 4QT0A 2B5WA 3HYLA 4QDTA 2LD4A 3HWWA 3CR7A 1I7QB 4LYGA 1ZVVA 1CEXA 4NBTA 4QVIA 1N33B 1TCVA 1U28C 3CKLA 3A3BA 1NN3A 3HSKA 3L8MA 3UCFA 3QPVA 4DV3B 3O9VA 2PXCA 4JT9A 1BJKA 5EIAA 3PIDA 1JIQA 1ZYUA 221PA 3U4MA 2E4XA 4DV1B 1LPAB 3SJZA 1VYHA 3ZHZA 2Z8YA 3CCFA 1SBTA 1VKZA 3JZIA 3Q1KA 1Z45A 4X60A 5U9CA 1VE7A 1X39A 1E79D 1Z8HA 4FFSA 4IWXA 2ZDQA 4MKZA 4C4XA 4C6RA 2HF7A 1LC3A 1NM5A 2PL1A 3MQ2A 4ZV4A 3DQPA 4MV3A 1A98A 1RP7A 1YS6A 2FP4B 3CZ5A 4TX1A 4UTXA 4V0ME 3T0IA 2ATEA 2AOTA 5CVEA 1NVBA 3E3AA 3O3OB 2FY8A 3KKOA 4HNUA 2QB5A 4IHJF 2H9IA 1ORRA 1V5WA 4LE1A 5KOIA 5L53A 1QQ7A 2BFOA 1IEXA 1RXWA 2UZ0A 1PR5A 1WSWA 3M2TA 5ES3A 421PA 4RMNA 4B8WA 5KOHB 3FPKA 3GJYA 3K0FB 3SBEA 3LVQE 3RQSA 1FFSA 4CMHA 2BCGY 5D2CA 1L4EA 2QRVA 3NWOA 1UBTS 1KO7A 2W0SA 2H3HA 5REQB 4CIVA 3U1BA 4GO1A 2NXEA 1O87A 3EIUA 3PX7A 4DA6A 5JJBA 1LI7A 3GI1A 4ZVPA 1FUYB 1S9HA 2ZSFA 3OUTA 3PHLA 4BX2A 3B5JA 5B7QA 3CMAB 3STXA 4EJ2A 2ONYA 4TN1A 4Z4VA 2NP6A 4QBGB 4W63A 4KPFC 3T3EA 4DVJA 4R1PA 3UENA 2BFWA 3MJTA 3TXAA 5KTPA 3QNMA 2C2KA 3TTUA 5L3ZA 3E3OA 2QGFA 4WCFC 1MH9A 3CT4A 1YMUA 5BSEA 2Z5VA 1LU9A 1KR5A 1V45E 1I18A 4ZRDA 3MVEA 2RHLA 2AXNA 4CM3A 2VHWA 2OCXA 3AEQA 5FJIA 4CN9A 1EB8A 2WRZA 1JAHA 1V43A 4KKVA 4TQ9A 3WHIA 5B1YA 5J4LA 1J33A 3M1YA 4FYYA 3R24A 1N6NA 1SHLA 2JIZA 4I1SA 5DSXA 2ID9A 1HFJA 1Q17A 2AX4A 4M8SA 4CW7A 1CY6A 3TLCA 4CLRA 1U94A 2X7HA 5TJHA 1CUVA 2IYPA 3EEYA 4MGIR 3TZCA 3NIWA 3JQGA 3K20A 5EEHA 3I55B 3PXCX 1U3VA 1T2VA 2PGXA 3AY3A 4MYUA 3Q38A 1N0HA 4MDYA 4NCNA 1CJMA 3H42B 4N49A 4ZCRA 3IAS1 5LP6F 1GNRA 2O7VA 1NIJA 2JCVA 4HH0A 1D4OA 1TVKA 3NKFA 3FNGA 4KN8A 4TV8A 3T3PB 3OKCA 4NZOA 4J91A 2XTMA 4IIEA 3SIPA 3EISA 1QO0D 4XDGA 1PQUA 5B3JA 3RIYA 5KQRA 4RVSA 4CM9D 1NLYA 2IYRA 2AK3A 2PKQP 3HPRA 4KBGA 3JD2A 4BMVA 5ULLA 4F85A 3VDXA 3TCNA 1XWIA 3I62A 2VDOB 1JALA 3OIWA 4HD8A 4Y9TA 5D1NA 5BQOA 2CT8A 2G1AA 3NHBA 2BFNA 3H87A 1OGJA 2K2WA 1Q91A 3CO5A 1FFBA 2HCFA 2OHIA 1RACA 3SICE 1GDHA 4CM1A 2JZCA 1R8JA 4MZXA 2I7TA 2OQRA 3H86A 4XLZA 3S28A 4PYIA 3F47A 1CR0A 3FWZA 2LWIA 4HG2A 3T7KA 3VI4B 1B00A 4YXFA 4K9SA 2EBHX 4O4JF 4AS3A 5LZ7A 4L3VA 2Z2IA 4IRMA 5CA1A 3I32A 3ITKA 5FTNA 5T5QA 4DANA 1H3EA 2DHEA 1B93A 4RV9A 3G79A 1JRLA 1KH3A 1UK8A 1RKVA 2F2TA 2XYGA 3QX8A 4IH1A 4ER3A 4YPVA 3RQIA 2XB2A 1Y8CA 5BUSA 1QHFA 2DYKA 1U7WA 2OHFA 4NOKA 4PFQA 1COZA 1G2QA 1FX1A 2R6JA 4OLAA 4OXXA 2V6IA 3AHCA 4DJAA 3MS7A 3QJYA 2H4ZA 4FMCB 1MT3A 4D4LA 5LZ9A 1QGUB 3AW8A 5HDBB 1YZUA 5COQA 2NM0A 3LDHA 1DUIA 1D5CA 3JXEA 1U8UA 4ZI7B 2B21A 2OGZA 1KBZA 4QBTA 4GMKA 5JALA 4TS3A 1ZNYA 4KE9A 3UB4A 4HAXA 4LYDA 3STTA 5JD6A 1E2IA 4CGYA 4GLJA 6REQB 1J2EA 3O8OB 2E4AA 4GS5A 4JH0A 4Q4JB 3MWEA 2Z58A 4DLZA 1O0SA 4ECEA 4L7QA 5AW4A 3FTQA 3I45A 4FMDB 1Y6FA 1M2JA 1JF8A 2VFAA 3L0CA 4QUHA 3GLHB 2OECA 2L19A 4EHAA 1Y1RA 4FYHA 2GASA 1KI8A 2JEOA 3DPSA 4OHCA 3AMVA 3VKGA 4NCIA 4POAA 1T0JB 2NUAA 2RKOA 4CWAA 1XOIA 3E9NA 4TLMB 1UKVY 1ZM4A 1Q0QA 1QCDA 1XQYA 2FZLA 1NBWB 4HDSA 4OFZA 4D98A 5JCJA 5JSHA 5JAMA 5KWSA 1Z75A 1NGSA 1UM9B 1P8AA 3A9CA 5IC6A 4NCAA 8AT1A 5IVKA 3QVGA 3DBHA 4ITRC 3TBFA 4II3A 1DBIA 2VJPA 4KOAA 2Q9CA 1JXMA 1DDGA 1J70A 4NJEB 4Y2GA 5EP2A 5INTA 5TIIA 3GPLA 1RRPA 5I5GA 3AY6A 1NATA 1JLKA 1MEEA 5IXSA 2PFSA 2QN2A 3KR1A 4QICA 2Q3EA 4TTVA 3EVAA 4Y2XA 4BX8A 2IS4A 2QT1A 3GMSA 4MCIA 3MWYW 1YFZA 1HE1C 3TM4A 2G9ZA 2ZIZA 3GRCA 3SF8B 4TUYB 3OF2A 2FCRA 1PUIA 1L1EA 5KYXA 5LXTA 4NEQA 2A35A 4RPBA 1DT3A 4TMVA 2P30A 3ELWA 5FI5A 5TEVA 4ZHQA 1DZIA 2F7SA 3PT9A 4WJLA 1WNTA 1SXJA 2O2CA 4X1KB 3U7IA 4S2EA 3KPJA 4YJ3F 5A9TA 3BM5A 4DA7A 3OMWA 4DOMA 4I55F 4YT2A 3SQWA 4DIFA 4P9SA 3JAKA 4WESA 5KKCA 4D9EA 2V7QA 1WMEA 3HWSA 3PP8A 1C9YA 2FWAA 3K8QA 3KEQA 3O4HA 4UAUA 1PEKE 3M6WA 2JW5A 2GRJA 5ETJA 3DB1A 4LQDA 2J5BA 4C08A 4ND6A 4I1RA 3DOUA 4LE2A 4E5SA 3EG5A 2I1LA 4RK5A 1TTPB 1IZZA 1S4QA 4QEDA 4RSRA 3PJRA 4KDCA 1L5LA 3EF0A 3QLVA 5J4KA 2A4MA 2HLPA 2I2XB 1LDEA 2GERA 3LP8A 1Z62A 2WTBA 2QN6A 1CP3A 4HX5A 4PRKA 1T24A 3LW7A 3QIVA 5BUZA 1Z0AA 4NBUA 5TARA 3FNFA 3LPMA 5E4FA 3MIZA 1P60A 5BT9A 1YTUA 1FNSA 1NB0A 1M83A 1FOEB 3DEAA 1AF7A 2B25A 1C80A 2OCKA 4GOND 5J40A 2R97A 1H6AA 2IEAA 1QIDA 2OB2A 2GCIA 2FSVA 1E3EA 2JA2A 2NZUG 2IYZA 3DL7A 4DCGA 4TKOB 3UJNA 4X20B 2PL5A 1AB6A 4OQ4A 2IRWA 1UZNA 4MYCA 1A2KC 4EECA 3GZ4A 1FK8A 2CUNA 4X6XA 4YBRA 2JIBA 4JR0A 4JUFA 4WOBA 4YAJA 3DWEX 1WHTB 2FVYA 4UMFA 4FE4A 3BN3A 4KQEA 1BJTA 2DP4E 2P8JA 4M88A 3USCS 4DMUB 1M2KA 2DSNA 3UT5B 4C5AA 1ZO8A 2HA4A 2PWAA 1N25A 2Q5EA 4QT4A 4XFDA 2ADOA 1Z15A 4DMLA 4OJTA 3D4LA 4TMZA 3IAFA 5DYNA 1JZTA 1UT6A 2DTEA 1RBQA 4NDAA 3LZCA 3PUJA 1LX6A 3CCBA 1C7JA 1CY2A 1F2TA 3Q87B 4WK2B 3RODA 4IINA 2APJA 2EDCA 4PZDA 4IV5A 4EL0A 1A9XA 3ROMA 1I4LD 1VJDA 1DX6A 1L8AA 3CIOA 3EASA 5HMLA 1NBMA 4HBGA 1YXMA 4YCCA 3WLJA 1K2WA 2C31A 2WU8A 3ISJA 4B75A 1O8BA 3NDRA 4DHEA 5LU9A 5E1DA 3TVTA 4AQDA 3U16A 5KTSA 1TFRA 1YB4A 1B8OA 1PWYE 1R6DA 1PL0A 2DKFA 1TT7A 2DPMA 3I5MA 4EW2A 1GZ3A 2QA4B 1RIIA 4LJ6A 4XD7D 1B0AA 3NBXX 4HVTA 2HJWA 4ZZ1A 2EW2A 4G5HA 2Z6UA 2VO1A 2C3PA 1NOKA 1UBSB 4FFRA 2V58A 3UC5A 3ICOA 4JMQA 1NDQA 3UBMA 4QAJA 3ECAA 4ISBA 5DTQA 5EMKA 3M6IA 4QVJA 5EQJB 2Y9MB 1NJID 1OROA 5LOVF 2QE7D 5I9BA 5EFZA 4LRWA 4KX3A 2BEWB 2RAVA 1LPBB 2R00C 1NI3A 5CMLA 1W36D 3GLGE 1QHXA 4QRDA 1FYWA 2WQ7A 4HGRA 2VA9A 2Y6VA 1V95A 4R68A 4X7DA 2GBPA 5J5AA 1ZI6A 2ALJA 1ODLA 1QLJA 3CSSA 3CUUA 4X1OA 4DFDA 5JS1A 3SXUA 1SCUA 4OFWA 3NBKA 3FGOA 3LGSA 4GPBA 2PGJA 1M1ZA 4EJ6A 3T3NA 1QIJA 5IP5A 3WZLA 2I1WA 1FUEA 1CR1A 3Q5DA 4LRUA 2NPIA 4UNSA 1E0SA 3KXKA 3ANLA 2Y27A 3NNNA 1WEHA 3EFOB 2IBSA 2YY6A 3JQBC 1HT1E 1ZXBA 1DUSA 4YREA 1IEVA 3C8HA 1JSCA 3WGZA 3WLQA 2FN3A 1Z0UA 1EM8B 1LVGA 3W4KA 4BLQA 4P7KA 3BMXA 5IARA 4KNWA 3OCZA 4KYVA 1NRWA 4UULA 2A9RA 3MAJA 3ROKA 3CZQA 2W7TA 2G1PA 4HAWA 1FYXA 4ADSG 4RFSB 4XLHA 1D5WA 2ANBA 3OQVA 8ADHA 2H7YA 4OSPA 1C9DB 3O3NB 4N8SA 2YCBA 5DBHX 2EFJA 5FBLB 3STUA 3TZLA 4HGNA 1FNBA 4RULA 5CNMA 1PQWA 1ZM9A 1VKHA 1CQWA 2YZ7A 2QYTA 4BFSA 3ADKA 2IUUA 5AESA 1K8RA 3A3YA 3QLJA 4WDRA 2GD2A 2HBRA 3U26A 4JGIA 4F7WA 1NIPA 4EB8A 2WJJA 3F49S 4OBWA 2HZ7A 4BO9A 4EUFA 4GOMD 1TLTA 5ALVA 4O6VA 5FA8A 2IPAB 3HUEA 4DWVA 1ZS9A 3KWJA 3JCZA 3FOBA 4YRTA 1MC1A 3IV6A 4MPRA 3K9HA 1ZH8A 3GBPA 5E0KB 1TIKA 4ARVA 5KTTA 1T25A 1XMXA 5KNCA 4BDTA 1T1JA 3E48A 3KK0A 1SU6A 2GPBA 3WSWA 2GX6A 4IXDA 3V7YA 2GNOA 3LCUA 4PTLA 5A89A 4BWYA 1JJ2B 1XZKA 1NV9A 2FMFA 2YFHA 3D8HA 4AN1A 1DRWA 1SQ0A 4PQRA 3GNTA 4BNNA 4BNHA 1ZWKA 2LNDA 4HN9A 4PGMA 3NANA 4Q03A 3ZYCA 1GRNA 3DBRB 2JG3A 3KT6A 2HWXA 3PEWA 5FWYA 3DKRA 1S3SA 4DLPA 5JDIC 4CEIB 4NCKA 3O03A 1N0UA 3BPSA 2O2EA 4C06A 2XTJA 1USWA 3BS4A 2P2GA 1WTHD 3ONUA 2IPXA 4LTNA 3IE0A 4LX0A 1GEEA 5TX7A 4WKNA 3ZGOA 4BFYA 3QMWA 5EE0A 4MDEA 1SAYA 1YUNA 2H4XA 4CXMA 3KPWA 3DEJA 1XELA 1CIVA 2DLNA 3NBUA 2CNDA 2JIPA 4D43A 2DPGA 1DIGA 4WZ6A 1W4AA 1HM5A 3PUZA 3NBZC 5JJKA 2DEUA 4DV5B 4GYYA 3FOCA 1Q15A 4KNVA 2LR0A 4GPEA 2P6OA 1CK4A 1N5IA 1O6ZA 2W37A 4L6IA 5ALZA 5KI6A 5LQUA 2VKTA 4GR5A 2PLRA 4A0FA 1RQPA 2ZYWX 5C46F 1WV1A 1WE2A 2BV3A 1SCBA 1K06A 2BLLA 3HM2A 1VQ1A 3UMMA 2EJUA 3IPAA 4J0DA 5IG2A 1OHHA 3H2ZA 5IJ0A 5KAMA 2P91A 1MFZA 1G4AE 3WYDA 1R0SA 3ONVA 4ZKDA 4CJXA 2JFGA 1KVQA 3LD9A 2AXPA 2H07A 5K3DA 3VSBA 5DNCA 2IZ5A 3N0WA 3UICA 1L5OA 2OZKA 3OWOA 4CQMB 3UJPA 4EY5A 4HQRA 5KCMA 3WADA 4TTRA 3R1IA 5TMDA 2J3EA 4KQWA 3SOZA 5B4TA 4IIYA 4YRRA 2IXGA 5DN6D 5DK4A 1XDWA 3EAFA 1D3AA 1UOPA 4Z7JA 2GK7A 2POQX 3BXHA 1QCCA 3KAPA 1UWCA 2ZK7A 1YBVA 4UM7A 3TR0A 4A0HA 4BQIA 5DNVA 4C0KA 3G2JA 2IKQA 3CEMA 3TLYA 1E4EB 3FUVA 4BB5A 2GKSA 1CUBA 2HK6A 1DIHA 2R1VB 3WKBA 4CNBA 1KSFX 1Z7WA 5KNCD 5LB4A 1PLLA 1QVGB 4C43A 2HSZA 3K0HA 4ZXFA 2FI1A 2H8GA 2WZCA 5C8YB 3E22A 1ZOPA 3KL9A 2JRCA 4Q19A 5SZHB 5LM3A 1XRRA 1ENOA 1SHKA 1NQOA 1QP0A 3AESA 5H3CA 5KJ1A 3BFJA 4E1VA 3T12A 4CUKA 2CNKA 4ZO4A 3A1VA 4AECA 1A50B 1BHSA 2PZEA 4R01A 1ORHA 3EFEA 4U0KA 5JAIA 2R79A 4B73A 4EB3A 1YVDA 2GI4A 5KMGB 1KDVA 1G64A 1Q3TA 1SQ5A 2J67A 4KVFA 3NVKI 4ZO9A 2QG4A 5EXEA 2H65A 4I1UA 2X8BA 2Z95A 1VZ3A 2VWQA 4FOLA 3AL3A 4DAOA 2ZAMA 1TKBA 2IXAA 3TD6A 3ZWOA 5EWJB 4UFPA 3VSEA 5GZ3A 1MW8X 5ICCA 1YJ5A 1GPYA 1UEIA 5DRTA 5TB5A 5ELXA 4ZALA 1IMJA 2WK1A 5E38A 1P5JA 4YRPA 1S4MA 5FTKA 4QOSA 4F06A 1GL7A 1OX6A 1DMSA 1QE3A 1HFWA 4PG5A 4ZI7F 2QSYA 3T1TA 1NY6A 3HH8A 1TQ8A 3KYBA 2CNWA 2CJFA 4HPJB 2PTGA 4G4IA 4LGCA 1L5HB 4BZPA 1U5BB 2EZ4A 2ZU6A 3UBTA 4L8GA 1BU5A 3KP1A 4TMWA 1MOSA 4CQNA 1B2RA 4MV9A 1XL0A 4QVKA 4M1EA 3CGWA 2OXRA 4W7HA 4M76B 2IC5A 5EJ5A 3ZWQA 2OSVA 3QH4A 1YZQA 2A67A 2QDKA 3ZV7A 4Q66C 3HI4A 1WAMA 3EGVA 3IEKA 1D2CA 1XKQA 3GPBA 3JX9A 1HLFA 2IITA 5TQJA 5ALWA 2L82A 2HJSA 3E22B 4O0LA 2LW7A 5K3BA 1XCOA 4XTCS 1JYEA 3KQKA 3E5MA 2JHFA 2R9VA 1Y48E 4IXTA 4QUIA 1E1DA 1IULA 2Z08A 5CH5A 1P39A 4XIFA 4FFLA 4YCAA 3SI7A 4RK1A 1BFKA 4KRGA 5JARA 1TZCA 3DFUA 3OIGA 4HNAA 2G63A 4BZWA 2I4MA 1SUIA 5DX1A 1VQ7B 3GUHA 1HNWB 2ZI9A 3TNDA 4GLFA 1G8HA 4WW0A 3OZFA 5FOQA 2O57A 4NTZA 4MQ4A 3HJNA 4OGKA 3ZGLA 4TRNA 1M0TA 4J4TA 4Y1FA 3U7RA 2VXBA 3LNTA 3WLEA 4K3UA 1EA5A 2NTEA 2EP5A 3WMFA 4B7ZA 5C5CA 1OI3A 3OF5A 5G4KB 2PMCA 3CN7A 1TYDE 1TZ2A 3K9CA 3THWA 2FK8A 4FUQA 1M1NB 3HKDB 3KDAA 1R6BX 1RM3A 1G6OA 3WAGA 1YGYA 1MAHA 4EA7A 2CUZA 3ZD8A 1YI1A 3A3GA 5JNWA 1XZ8A 2Z4TA 2ZRCA 1PR4A 5BOSA 3C4VA 4AS2A 2N9UA 3D8NA 2BH2A 1G8KA 2UVQA 1C0PA 3UHOA 1MO4A 1X7WB 3R0VA 3MQ4A 4LJSA 3HCRA 4YCMA 5CM2Z 3A9RA 3QRWA 4WLUA 4M21A 3R23A 2VP2A 1I3MA 2A1IA 3A7EA 3WMGA 4UFNA 2WHEA 2ORWA 2XE6A 4IWYA 4YCSA 5KX5F 1Z2OX 4OGWA 5IK2A 1GEGA 3BG5A 4XEHA 1ZDMA 3AWIA 4N5HX 4YACA 2JCSA 1GXSB 4CR6A 1V9SA 2BP7B 5AXDA 4KK4A 3EOBI 3OZVA 1L5VA 2VCYA 1L1RA 3RVBA 5JNVA 4UTOA 2I3BA 4PO1A 1F4LA 2XVAA 4HUQA 3FPPA 2DIEA 3EA0A 5JSYA 2XT9A 3DBOB 3CSDA 3KSRA 4PYMA 2XD4A 4PS0A 1E99A 2W6IA 1BHQ1 4L4XA 4RTQA 3EIWA 4MUXA 3QY9A 4F3TA 1XEWX 2C4MA 3K53A 4QGAA 4A15A 2A5LA 2A1TR 1TU0A 5FWXA 3SZUA 4UBMA 3L49A 1MZVA 3DE0X 3OUZA 3QX9A 5JWHA 1JEDA 4LIPD 3VR2A 5CDSA 4PZAA 1H8ED 2MYNA 4FX5A 4LWQA 4V0SA 4AY3A 1H66A 2O07A 3V9PA 4BNJA 5L45A 2GM5A 4RD2A 3WR5A 4EYKA 1MUUA 4FD2A 3AZQA 4ZK2A 7ADHA 3KQTA 5G1OA 1GZDA 3GB9A 4V0NA 2X0EA 5JOQA 1UJMA 3NYQA 2ES4A 3TG2A 5EMJA 5ILOA 3ZWCA 4IOJA 3I8XA 3I8SA 1PAUA 4KOEC 4C7BA 3FPEA 4M7RA 3VA7A 2VQ3A 1WUJS 4NBVA 2OQ2A 2P0EA 3AH8A 4UDNA 4D2IA 1F4PA 1SOWA 4P2BA 3A3PA 5WRFA 4PN3A 3IVCA 1STOA 4P22A 1XFOA 3AYZB 5GOZA 4B2IA 3A27A 1CB7A 1DWPA 2Q62A 3PDIB 3CPJB 1PDOA 4P1ZA 4YMGA 5C8XA 3DBLB 1OJ7A 1CBUA 3BUSA 2WD7B 3C39A 3C1AA 2IP2A 3H6KA 3N0RA 1M2OA 3EFHA 2IYWA 5AXCA 2AJLI 3BDIA 2VBSA 1B0PA 3C15C 4G0VA 2R4TA 2JGFA 3EGCA 3MA0A 2UZ4A 3DC7A 3MRTA 3LYLA 2QVYX 3G1WA 3AUKA 3LQYA 3O95A 4MI3A 3FVRA 1K8QA 3SYRA 2XUOA 2L42A 1XMJA 3TOZA 1C0KA 4J1QA 3ITDA 4K6FA 2FSPA 3TLXA 1MEOA 2PSFA 2P1ZA 1T5IA 1T6BY 2LGJA 1JIIA 2ZSHA 4TQAA 3B3FA 1FL9A 3ZE2B 4NFHA 5EG5A 1X9HA 2NO7A 4KYUA 3WL5A 4C5BA 4EG3A 3ILYA 4IDOA 4B3RB 1QKIA 1XXLA 2L69A 1VE1A 4FBMA 2WIFA 1ZGZA 1VI5A 2XWPA 4JUCA 3SFVA 5IZCA 3SKYA 3ZGZA 8MHTA 1FRFS 1DO0A 4RORA 3H05A 4TS9A 5TF0A 1DC3A 3FXAA 4FC6A 3SG0A 1JSLA 4GI1A 4EJFA 1FA9A 4U1RA 4FI3F 1NFFA 1Y6ZA 4XX0A 3D4OA 3NTXA 4ZMSA 4KE8A 3UATA 3WJ7A 1Y4ZA 5BWNA 4YALA 3M49A 1O95D 3DFFA 3KYDB 5E6SA 3RT9A 3ZNOA 2VTEA 5H4GA 3LH5A 3F9RA 4NOMA 1UBGA 5J2UB 4Q7JB 4ZCSA 4AIIA 4Y2VA 4AZWA 2V0NA 4IWNA 4XD2A 2OSBA 4HDSB 3KV1A 2AC4A 3I2YX 1IXRC 1X2EA 3HACA 3PBKA 1TCCA 5C53B 1JDUA 1U7XA 3RLIA 1NVWQ 2ZAOA 4KPEC 3PTAA 3GJRA 2JLVA 2HIMA 3LX4A 3N53A 1MT0A 4S0XA 3LL4A 3G1TA 2P27A 2PL9A 4Q0MA 2C5LA 2ZUEA 2QYOA 5BUQA 4DTCA 3K0FA 4ND4A 3AR2A 3IEXA 4GGOA 5CB0A 1UKAA 4U2BA 3FVQA 3GLRA 2FVXA 4LRSB 4IVNA 3KAKA 2QJWA 4KQHA 2GYUA 1KMHA 1G1MA 4QPCA 1GPDG 2B1IA 5A5GA 1RR6A 1R0XA 5HIJA 5HQ3B 4RTNA 3ZU6A 2OZLB 5DM1A 1IN1A 4FC7A 4RA9B 4B3XA 1DAHA 5IC5A 1YJ8A 5AKXA 4I14A 3LNNA 5EIBC 1SU8A 5F21A 2WUFA 1QIEA 3CESA 1YO6A 3N2YA 1XHFA 3FPHA 10MHA 4NBWA 3LPNA 1JDNA 2PZGA 2FX5A 3V4FA 4I6EA 4TKMA 3OZRA 2BZSA 4D1YA 4MUBA 3OPMA 2Q1WA 3OLXA 2OA0A 2C7RA 1GVNB 2B61A 3ZVKA 4YRKA 4OX9Y 3HE3A 1U8CB 2NVUB 5AFSA 4NU5A 4NABA 5DTMA 3TSZA 2ZRPA 5DNEA 3V8RA 1RYFA 3PUWA 1W9HA 5EKSA 4I4LA 1L8QA 3CX4A 3C6ZA 2HV8A 4F86A 1IPFA 3PSAA 5DHAA 4CEJA 1WXQA 5KEIA 2GBGA 4Z1OA 1YKSA 1E2PA 2WEKA 1QO7A 5BR1A 1NURA 4NICA 3EUEA 4I99A 4TRMA 4F45A 1IEQA 3H18A 1DXHA 5J4HA 1Y5NA 2D1QA 2AEJA 3I2JA 1LW7A 1XSEA 3OY2A 5CW2A 4A73A 1IXSB 3IQZA 4Z0HO 4LMPA 3OOCA 1A9ZA 4TM8A 4W4TA 2XMBA 5CHYA 3KBOA 1YJXA 1IUPA 3A2MA 3OOSA 3HY3A 1BCSA 4URYR 3QLTA 1AS2A 2HHLA 1FFDA 4FS8A 3CC2B 2R6GA 3DFZA 1I8DA 3LT5A 3QHQA 1RWMA 1TTHA 2ODBA 2PJZA 3AP2A 3L7NA 5EE1A 4HZIA 1GD1O 1YQWA 3D7LA 5DDIP 2VQSA 4R31A 1R4MB 1FVXA 3OZDA 4JNCA 1HNNA 4LWPA 3EXFA 1EBUA 2BFBB 1JLRA 1UDRA 2HLDD 3BFVA 4F7DA 1U4OA 4OQPA 3B2QA 2ZB3A 5BNWA 1TM7E 4S35A 4DR7B 2I62A 3ED1A 2GEUA 3IR7A 4QBFA 1OWOA 1G8YA 2IW3A 2P2DA 2YJZA 2BHRA 3OMXA 4CDRA 1YE5A 3LYUA 2NSHA 4OYHA 3PD0A 2XYHA 1DJQA 4HNSA 2W6CX 1BWRA 3DM5A 5CDFE 3N59A 2AG0A 2FR0A 3FNQA 3MJRA 2CZQA 2FW9A 3U5TA 1CJUC 1QR6A 2GFQA 3MLAA 3SIWA 3ZWNA 3W2EA 4IIHA 5BSGA 1T9AA 3L82B 2BDUA 1YB2A 4ZT5A 3TQOA 4R2HA 5IJZA 4MKHA 3EK2A 1UMCB 1FZQA 1LNZA 3ADOA 1JG6A 4XKVA 2JGJA 4K7JA 3F2IA 4ILEA 5H81A 2BFPA 1GIAA 3CZAA 3N8IA 2ZYVX 3OC6A 3NGXA 4G24A 1BQEA 1IOLA 5I4CA 4XFKA 2WINI 2XUJA 2ZJ0A 3EXHC 1WZ2A 2H2IA 3QA9A 4A6PA 4RZXA 1AQIA 1NR5A 5CB8A 1KARA 1Q57A 4Q4JA 2YMMA 4XX1A 4O4IF 4XAQA 4AG5A 5ECGC 3STYA 3TZBA 3WNVA 5JSZB 1P91A 1E3ZA 4TLCA 1WMDA 2IHBA 1RRVA 2IY8A 1FB5A 3KZXA 4H1HA 3IAS6 1X15A 1PIWA 1OYOA 3KKNA 3T0GA 4I55B 2HRBA 3PUYA 4D41A 1KU6A 2PRSA 4B2PA 1WEKA 2X8LA 1TKRA 3IVAA 3L0OA 3DAFA 3OQBA 1WP4A 5A4DA 1E8DA 3KEOA 4KXYA 5J2TF 5KNDD 3T5BA 1EDEA 4NFYA 2EF0A 2BFCB 2X86A 4BO3A 4UTRA 4YEJA 1S01A 4ML3A 2G0AA 5C5EA 2Z6QA 1B16A 2RGUA 3QSGA 1CJTC 4MI1A 1U2TA 2EGHA 4KU4A 5BW4A 3I6BA 3EIOA 2V3WA 2Q0XA 1SXIA 2WF7A 4OATA 4V0MA 3V7UA 6ABPA 3A9WA 4QWWA 3D31A 4M98A 1A27A 5FBHA 5BSTA 3VJLA 3RU3A 4K6GA 1V8FA 4CNQA 4E46A 1QMGA 2E21A 3B5EA 4NENB 5AKLA 2ZFUA 3TLMA 3PQDA 5CA1B 5DF1A 1MP0A 3OJFA 3N8HA 5HA5A 4JWTA 3RD5A 2ZR7A 3E3LA 3VNUA 2X5JO 1K5PA 1KEWA 4P32A 1A1VA 1ZVMA 4HWGA 3B1ZA 1QRUA 4GQAA 2IEDA 2IXTA 3PICA 3TRKA 3WOHA 2VHCA 2I4OA 2OFXA 2O8FA 1E1QD 3LQKA 1KKUA 1Z8NA 1TK9A 2J08A 3RI3A 4GPZA 1OGIA 1CLUA 3M2PA 5EC8A 3BDVA 5LD2B 1E64A 3ADPA 2G9UA 5HKOA 3AKYA 1HX7A 4JI7B 2GRUA 1QJCA 3GFBA 1EVKA 3UANA 2M9MA 2YXLA 4ZEMA 2O7RA 4KQXA 3SYTA 3P5BA 1W5BA 3A8KA 4JI4B 3H9JA 1SKQA 4E3ZA 1O95A 4BX0A 4UUBA 5JZBA 2W2KA 3I28A 1BS1A 2YASA 4PSKA 1KBQA 3LDUA 4ZMRA 4GD3Q 1C9JA 1ZRSA 1FUKA 3IP3A 2X0JA 3I6IA 4X6YA 3RTGA 1W44A 3WE7A 2QLTA 2ZRFA 3BH7A 5GONF 1G7RA 1U5AA 2RIPA 1WPXA 3W2HA 4ALKA 1UD3A 4Y0AA 5J59A 3WDMA 4RC9A 2BFCA 1AGXA 3P0FA 4IR7A 4H17A 3TJRA 2EKBA 1QK5A 3F96A 3QPBA 2XCLA 3QVXA 4OHVA 5GV8A 3QVJA 1QC5A 1W88B 2D2XA 1JEYB 2WNIA 1PNQA 4QQRA 2PZFA 4ME6A 1N5MA 3I39X 1L4GA 1QTIA 3A3OA 1W5AA 1NVFA 5E3JA 3J81A 3A1WA 5IAOA 2Z3ZA 1WQ4A 3QV2A 4FE7A 2G6TA 2VBTA 1E2DA 3HDGA 4I5EA 4YGXB 3TZKA 4QU5A 1PK9A 1VQMB 3JQ6A 1S1CA 1TZKA 2Q2WA 4MWTA 4XONA 2WJ3A 1RKUA 3F3KA 1YDFA 1T5SA 4OKSA 3P5SA 3DMTC 3NC4A 3QOFA 3H5WA 2G8NA 4UZSA 3M83A 1ATZA 2VZ8A 3HXQA 2DXIA 1C1XA 1KVUA 2VPZA 5ESRA 3RSLA 2OCLA 3M6LA 5D7NA 3ZWXA 5B7GA 3HK2A 4Y98A 2AFIB 3PKZA 4REQA 5TXGA 1YS7A 1HNXB 2OLKA 1YC5A 4KCGA 2OO7A 2ZRNA 4NV1A 5ISMA 1R9GA 3B8HA 2UZ3A 1REQA 3NFYA 1XDZA 3QM1A 4PQYA 3IRUA 1GAXA 1ZUNA 4AO6A 2IODA 4MUEA 1SXJB 4X1KA 2E5WA 5IRCD 2O8DA 3D6UA 5CXSA 5EGSA 1A69A 4B48A 4WRRA 2JDID 2VDNB 4W5HA 4UHHA 5JTTA 1G4UR 5GM2A 1LVUA 1RLOA 2EX1A 3LY5A 5AVKA 4QPZA 2ORED 4GR9A 4J0KA 3EULA 1GOTA 4NRDA 4FB4A 3WGIA 1W6UA 3TJMA 2WNSA 4ASUA 2IIPA 2VPTA 3I5UA 4JJ6A 5FYQA 4BNTA 1C2YA 3FFWA 2C4KA 5AK0A 3VH2A 3D54D 4BOYA 2ZXFA 5KKAA 1SHJA 3L41A 1J2UA 5C7YA 1NNLA 2O5VA 1PJ6A 5IYWA 4LI3X 4O1MA 4C2AA 3EX7C 3GNLA 3ABOB 3VV2A 1R4NB 2GA8A 2UYYA 5ITZB 4JLPA 2ZS7A 3SC2B 1C8KA 3DM9B 2XQJA 3FF1A 2VBUA 4U7TB 4AWAA 5CBPB 4HWTA 4BQOA 5IX8A 2C8JA 5A7GA 3IEIA 4QTXA 4UNIA 1J0XO 4KR9A 5I4KA 4JI2B 1ZUWA 1E1LA 1GFZA 3RVNA 4EHLA 1AHPA 2F3SA 1ITZA 2IEIA 4EG6A 2IZOA 4JKOA 1KYYA 3L6DA 2ZXIA 3D2LA 2JLZA 3TMYA 5CD1A 4HZUA 1PK7A 5L46A 1F8GA 4Q4AA 2HMWA 1DV2A 1M9NA 1ZLXA 3GLHE 2V7XA 2NVBA 3ET5A 5BSWA 3WGKA 4DG5A 2QMEA 5T4HA 3JSXA 1US8B 1YRLA 4M2LA 3T54A 2PANA 5U4QA 3KT0A 4XB2A 3NC0C 4R3UC 2ZB2A 4C0WA 2CV0A 1JQAA 1E9BA 4M0KA 2BE7A 1YZKA 1Q84A 2P62A 1FSSA 3AOEA 2ZG6A 3QQ5A 2MR5A 4FFBA 1RLMA 1ABBA 1QGED 2H18A 4HYTA 4US1R 4FLMA 1QTQA 1Y89A 4K6MA 5EUMA 5JS7A 1P6UA 3QVTA 3AVPA 2ZUUA 2K87A 4YQZA 3KHKA 3VHXA 2OHOA 1R16A 1L3IA 5HRCA 5JSUA 3ZQUA 5JEDA 3QEMB 1NG1A 2Q3MA 4MKXA 1QVAA 3S2FA 1J0DA 2OGSA 2F1LA 2YICA 1SVWA 2C1ZA 3C48A 4H31A 4HLCA 3SK0A 4GGPA 2GA9A 3B9QA 3V1LA 4LMBA 4BMXA 1U65A 3R6WA 4GSLA 4KMRA 5LYJA 2ORIA 1S8OA 3HU1A 1VA5A 1PYGA 2ZIXB 3DDWA 1EFVB 3IT1A 2NXWA 5HF5A 4YUYA 4C78A 4LGMA 3ZQ4A 1SUAA 1Z0ZA 2GEJA 2BKVA 4IGEA 2H29A 2RHBA 3RKUA 3KR0A 2BF4A 1AK1A 4IL5A 3MFQA 5ADHA 4JU8A 4GX1A 3MXOA 4IJ6A 1V25A 3FUWA 3Q3IA 3HTXA 1JG4A 2I54A 3KR9A 2AR7A 4S1WA 2HOQA 3PYMA 3BE5A 3PX3A 3MUOA 5CFRA 1ISMA 1C1YA 4Q7KA 4YB8A 3TZ6A 1EJ6A 1N2OA 4R83A 3IA2A 5K8JB 3OZGA 3GP8A 3ASTA 3ROXA 2GFHA 1KYQA 2VBGA 4D96A 1ESEA 1IVYA 3E9QA 4KIUA 1N2BA 1SUEA 5ALKA 5E6SB 2CEKA 1JE0A 2LE0A 1LNQA 3DTVD 3MS4A 4HTFB 1BQ3A 1O94C 2FPRA 3OKXA 3EFOA 2Q4DA 4MXDA 2C5EA 3WDLA 4F56A 3R7AA 1KGSA 1Y7HA 1JQBA 3BAZA 4KXWA 4YRZA 4GAEA 3RR2A 1BA3A 1XTUA 5JD5A 1KJNA 3AU8A 3RUFA 4CQMA 4C87A 3NV7A 1NLZA 3O8NA 4TVSA 5F51A 4AMVA 3NI2A 2OYNA 2ZB7A 2EKDA 3MJHA 3GLIA 1K97A 1P5RA 4RDJA 1U4NA 3BULA 4I5FA 4D45A 2K5UA 4GW3A 4R1LA 5KTNA 1NOIA 1XNJA 2X41A 2OCAA 3NHAA 4Q1BA 1CUCA 1ZWLA 2O59A 4Q00A 3Q39A 3K9GA 3JVUA 1UBOS 1U3DA 1A8UA 1I7LA 2BFDB 4YY3B 3B7GA 2PLFA 4IRXA 2Q7OE 1RCUA 3DNPA 3AONB 4MKRA 4L4SA 3S29A 4QVAA 4R51A 4KLZA 4RTLA 1GA1A 3H2JA 5L3QB 4ASUD 3FFXA 1RWKA 1KDZA 1Q1ZA 2PXHA 1XZDA 5ALUA 1AK2A 2MSWA 4WLVA 1EJ0A 4F4JA 2QJTA 2LIVA 3N58A 4XUCA 2Z8ZA 2CUTA 1W47A 3A4LA 4NV3A 4JOCA 1LRKA 2DTDA 4PO3X 3PD7A 1FRNA 1WF3A 3DCJA 1GZHB 1W75A 2WT8A 1E0DA 3HXTA 3A04A 3UUFA 2JIZD 3F2VA 3UXHA 3NHFA 5G0TA 5E7QA 1N34B 1VCMA 2UVPA 1CLEA 2I80A 4JUIA 3JD1A 3QE0A 3JQ9C 2HD4A 2PT9A 1YF3A 1L8XA 3WVNA 1E79A 2J31A 2NQTA 1S3IA 3UK2A 4QDKA 4O4JA 2WYHA 3AINA 1TM2A 5E3HA 1YA4A 5IU6A 1BCRB 2RBGA 2YHBA 1SUFA 3A31A 4WACA 3ZOZA 5C32A 2XWBF 2HEGA 3WGNA 1IDOA 5KTOA 3MRVA 3LT0A 2PSDA 1M8GA 1O97C 5K0FA 2VHQA 1SCJA 1U9IC 3DGFC 4D56A 3P9NA 3D7NA 1SK9A 5LMCA 3EVGA 1AHHA 1LY1A 2E4YA 3LHFA 5DWDA 3RTBA 2CC2A 3VC2A 2HUNA 3ZNQA 3BKXA 4MB0A 1Q6ZA 2NO1A 2P2SA 1R7RA 3HJUA 1V2HE 2XIJA 2D1TA 1EDZA 4OQFA 3AR9A 4GX2A 4BNDB 5B36A 4LPKA 4B0PA 2WG0A 4HWPA 1JGTA 4GFDA 1B14A 1ZU5A 2YJGA 2O2JA 4J8PA 4L74A 2AFIE 2PH1A 4DN6A 1WQ1R 5T6BA 3QPDA 3GFTA 1E5XA 4UQOA 2Z1MA 5FAXA 5I4BA 1M2EA 2G3YA 1FMJA 1XCMA 4RXTA 4Z9FA 3P9YA 2C9YA 1KK2A 1CE8A 3A1UA 2H54A 3N0TA 3UK6A 1TDJA 2CHGA 3OA0A 1URPA 3O73A 4B3HA 4C0QC 1T8YA 4CCAA 1YQTA 1KI2A 3R3WA 1XEWY 1YHQB 1Q74A 2BFDA 1ZESA 3K8ZA 1FEZA 1MMFB 2J9GA 3A6KA 1DHTA 3NTLA 5ED0A 1E3MA 3F5QA 4KTVE 4F3YA 3AV0B 3JD0A 4MS4A 1P7WA 1OUMA 4RYLA 1Z2PX 5F77A 3H1EA 2QTCA 3MWDB 3IT0A 3CLUD 3GEGA 1THMA 2D8AA 1JG7A 3H9CA 2H9YA 2NZYA 3AM5A 4NU8X 4WMLA 4GPD1 1KQ3A 5FCDA 1P0QA 4H7EA 5G4KA 2AMYA 2J5RA 3A2LA 2I76A 1XU9A 4JX9A 3OA2A 4ZQCB 5AR1A 3ZDQA 2RGAA 3R7BA 1OHHD 1XAIA 1SRQA 3TQHA 5JAOA 1XLTC 4OG2A 1RZVA 2AXEA 4M9UA 3ZTTA 3JWPA 2J45A 4OBXA 2YYAA 4XLTA 3K70B 4G4GA 1JH8A 1YMQA 2G4VA 1XCJA 4I5GA 2BONA 5CA1F 1NY5A 1QAQA 2XZDA 4BO6A 1ZN8A 4HGQA 4QREA 2Q28A 4W5QA 1JQ5A 2QS9A 3V2GA 2A5DA 3EQ7A 4RABA 5I9IA 2UV8A 1HE8B 3G13A 2OFFA 3HRHA 4MUJA 4RVHA 3VR5A 3IILA 3SZMA 3JU4A 2RHOA 2OAGA 1X38A 4ZPJA 2J9RA 4NDZA 2PUTA 3NVMB 3TTWA 2PD6A 2QZPA 3ESAA 2E48A 2TSYB 1HPLA 1AUOA 3IGFA 3GLGB 1WB6A 3BH4A 1AO3A 1M74A 2C3YA 4M49A 4IZOA 2X6XA 1EVEA 2UZIR 3AC0A 1CUDA 3Q8WA 3D0OA 4Q5IA 4Z7QB 4W8OA 1KGDA 4COKA 1VGRA 4JLBA 1QUFA 3F9IA 4LBYA 4UOEA 2OXTA 3EPHA 4GI7A 3WL3A 3L1VA 5FOWA 4QASA 1SXHA 2OYRA 3RSCA 3HYTA 2H1HA 4FBGA 1A5TA 2CF6A 4H7KA 4ND2A 1HG1A 2QORA 4EMTA 5ELLA 4BTVA 2GLUA 4D5EA 2BTQB 3JASA 3SVZA 1ZK4A 1NN0A 1NYQA 1MFPA 2VDJA 5LP1A 1I4TD 2DQZA 4W5JA 1XTJA 3NDIA 4P9NA 3FVVA 2O4UX 5FWXB 2DY1A 2ZKIA 1UZAA 4DF3A 1ZBQA 2OTCA 3KCNA 3HCDA 2CSXA 1M73E 3C8DA 3BSWA 4KVGA 1C3XA 2O8EB 1X0VA 1YR1A 4GZ6A 5BRAA 2JAUA 4AKHA 2A84A 5F52A 5CVTA 2QJFA 3MGCA 4MIKA 3WIEA 4HH3C 1LWNA 3HDJA 2VT3A 1L7NA 3ASVA 3BSYA 3MMPA 2PX6A 4B17A 1DG1G 1LVHA 2XR1A 2R60A 1V71A 2QLBA 2VZ0A 3PNLA 4X62B 3ZD7A 2QKYA 2QTRA 2Q46A 3JWJA 1NQXA 5EINA 4P3IA 2N75A 4HDRA 4AJIA 3M82A 2WOOA 2G6BA 4M54A 2R1UA 5FUBA 1NNSA 3LP6A 5A4IS 3PG5A 1XR3A 4ZCLA 3BD8A 2ZI3A 4OF4A 1QH8B 2O2YA 2YS6A 4YX9A 1L7RA 1M8FA 2VF4X 2JJQA 5JC8A 5IK2D 3JWHA 4XOTA 3MWKA 1H1LB 1NMYA 2CRVA 1FNNA 1N5OX 2QWXA 3CF6R 3OEYA 1GQSA 3G0DA 4JBLA 4M9ZA 4YLEA 3W77A 1FQJA 2XUQA 3R3YA 4ZO6A 4YIKA 4JMPA 2EFGA 5IYPA 5DOVA 2Q0HA 3K6JA 4RESA 3ZV5A 1GA4A 5D85A 2OAEA 3D43A 1KO4A 3MEQA 1B3RA 3W9UA 3I0NA 3R3JA 4ITVA 2OQIA 3VH4A 2PBRA 5AP9A 3PCRB 4P81A 5KX5A 5JXJA 4G5SA 2EG5A 2C2YA 4KIFA 4CZ2A 1N6RA 2TECE 3N05A 2RFLA 3C3JA 1W19A 3U4DA 1DBRA 4BKOA 5CDTA 2REXB 3OQNA 3ZPNA 3A0UA 3KHUA 1EP3B 2AN9A 3UG7A 1K88A 3T3OA 3AJ8A 3ZLUA 1HT3A 3BK1A 1JHVA 5A6SA 1WSVA 3H99A 1AOXA 2CLSA 3TKYA 4XE5A 4B34A 1SVIA 4PS1A 4RTKA 1ZJ6A 1AXEA 2PA0A 2QAGC 4ZYTA 5TE9A 1VSUA 2WY2D 5FV4A 3NONA 4X1IB 4KR6A 1IUKA 3LUKA 3FM9A 3PKJA 1Y98A 3R5HA 3NWJA 4GQBA 4QG3A 3FIUA 1W5TA 1Q22A 2EZ8A 2IF0A 4AKSA 3UY4A 1LGYA 4GI2A 3RE1A 1AUPA 2HN9A 4AJJA 3KS9A 1YBMA 2B0CA 3Q9LA 4RM3A 2X14A 4EG5A 1K6EA 1YQXA 4JK3A 5ALNA 1SWWA 1TPZA 4RH0A 2CHEA 1PJTA 3HLTA 3FG9A 1ZVKA 5IN4A 5BSXA 2QQGA 4Z4IA 2WWRA 4PW0A 2H11A 2CXXA 4EJSA 5JQGB 2GN6A 4G3XA 4L8VA 4NR0A 5DGDA 3PQ7A 3T15A 2AG5A 2YW9A 4YIHA 3BBLA 3I05A 3TTXA 4AP5A 4INPA 5B30A 4L4ZA 4U5XA 4PTZA 1KYIA 5GOTA 5TJ9A 6LDHA 5GV7A 1HA3A 5F4ZA 1VPDA 3AR8A 3OFSA 3CEJA 3PS9A 3WIUA 1L7BA 1XVTA 3I0ZA 1G38A 3I0MA 3HBJA 1Q1AA 3IUNA 1G8FA 3GJ0A 4AMGA 5BY2A 5C37A 4P0PB 2FRXA 4LAFA 2GHQA 2X77A 1ENYA 3ESBA 2AZMA 4OI1A 2R7KA 5C8YF 1QF7A 2CB9A 3N86A 5AVQA 3LXXA 1L7XA 1ZI8A 3BIXA 3QOWA 4Y18A 5AOCA 4B3JA 5JZSA 3GFVA 2PT5A 5J2TB 1XPUA 3C8UA 3L4KA 5EHIA 4XYBA 2NQ2C 3UEOA 1ZM3A 1N6OA 1FLDA 3FE2A 4LOIA 2JD1A 3FROA 1GP2A 3UZUA 1W29A 2ZIEA 1ZN9A 5LLDA 5T4BA 1LRJA 1YIDA 2QQFA 1JHRA 1DPFA 2FPIB 2CL7X 1WY5A 4M37A 4BO8A 3Q0TA 4UUMA 5SYMA 4Y2RA 2A33A 2EGUA 3VX3A 4A2QA 4CT0A 1JAXA 3I6ZA 5CBKA 3FCAA 4XRGA 3FPFA 1Z4LA 4JDUA 1QKJA 4CUZA 4AN4A 1L7AA 4URHA 5K0TA 1C1DA 1CUHA 4KKSA 3ZU3A 4BBPA 4LXQA 3VTZA 1AGNA 2CLIB 1E4YA 5I9TA 4V2UA 1GN9A 1I24A 4E4YA 1JIXA 1NYTA 1Z4NA 3PQ4A 3RYCA 1M2HA 1PFKA 2IOQA 2ZYTX 1SXQA 4WKGA 4MNTA 1ZISA 3MERA 4I5DA 3A28A 3NHPA 3B3QA 3UJ6A 3WBJA 3NUGA 4YN3A 1CETA 3C4JA 2AUTA 2BI4A 2QDXA 2JLSA 3DSRA 1UFQA 3PC4A 5LYYA 4GE3A 2IIQA 3RUHA 1O4VA 2FNAA 5BSKA 1T13A 2B0JA 5J3OA 3B1JA 4OKNA 5FFMA 3FKQA 4GVPA 4LJLA 3E7XA 4FIZA 3OCWA 1JXQA 2QTVB 5EJAA 4EP1A 2KPOA 2A9PA 2C0PA 1CU1A 3DVAB 5AI8A 4NK5A 4DSAA 5D84A 3LOQA 1C4WA 3IA7A 3PHIA 1NONA 1UDBA 2C59A 3BH0A 2QAIA 2JJMA 2HPVA 2DMRA 1Y0YA 2J3JA 1EQAA 4MI6A 4DDUA 3UTCA 5CDHA 4XLAA 4YT8A 3THOA 3A9SA 1LNSA 2E4VA 2SCUA 5A5EA 4YV2A 4WTOA 4DADA 2XZLA 1NF2A 4HWSA 3RS4A 1FX0B 2WT9A 3N2ZB 1X8XA 3PFGA 2EX4A 1KXJA 3QEKA 3HADA 5CD9A 2HU8A 4KP7A 3H5AA 4WOKA 1CUZA 3KKLA 4D74A 3QBEA 4PBSA 1Q6YA 1ZAYA 2OBSA 3Q9NA 3BL8A 3NJ4A 3QLVC 2CL6X 3D6NB 3FHLA 2N42A 1CNMA 1JPJA 5LYJF 5F23A 2DX7A 1XMIA 3DXFA 4NI5A 2EQAA 2IUTA 2B78A 3DR3A 1PSWA 5F1PA 4P80A 2R8PA 3TSAA 3EWNA 3JAMA 1P74A 2AFIA 4QQFA 4HDMA 5HW0A 4QIHA 1FFXB 3HNOA 3IJPA 4N0QA 1LFDB 4HHEA 1UBLS 4QXQA 2I2FA 3C14C 2I6UA 1SA0A 2CV2A 1X3SA 3UUGA 2QL7A 2HIHA 4E03A 2O8NA 2BBOA 1OTHA 3E8MA 1USKA 3MPOA 3NE5B 4W5OA 3FDZB 2D59A 3ZHRA 5KAPA 4YAOA 5I3ZA 2RIRA 2I8AA 4OOSA 1R3DA 3K2EA 2F59A 2GN1A 1AZSC 4IDBA 4IYRA 4K9RA 1H42A 4WCFB 4YP9A 1XQ1A 4AIRA 4DM4A 1ZNZA 2PO7A 1OCEA 3DV9A 3IMKA 1I7NA 4MKGA 2XB8A 4NX2A 2JZNA 2Q7XA 4W7SA 2QU7A 5I7AA 3MIIA 3WZMA 3F8WA 1F20A 4ES6A 3K70C 3MTAA 2Q6TA 1E4OA 2VYFA 4OJNA 4UM5A 2P2YA 5LQSA 3PC8C 2XVZA 4L75A 5EESA 1B0ZA 2DFVA 3W5AA 2EZ9A 4CETA 3HS3A 4BV8A 4D4KA 2WHYA 2HA0A 1KU0A 1M8KA 4ZOAA 1JN0A 3HNRA 1M1YE 4HDKA 4NCHA 3JWIA 4JODA 4Q7LA 4X8HA 2KVOA 3HGMA 4KXMA 3C7DB 3ZY2A 2QV7A 4C2BA 3DQZA 1EGVB 3C41J 1DGQA 4ZARA 1P1IA 4TKVB 3O1HB 2OBTA 3U0BA 4BC0A 1LX7A 1DO2A 3KOUA 5JO0A 4UU1A 1QTNA 4B3BA 5K09A 1J5EB 5IM4F 4V24A 2Q6LA 1EI9A 3QSYA 1U2ZA 5T67A 3UCXA 1KFJB 3L0BA 1N7HA 1SO8A 4TKZA 4DEXA 4EW6A 1GUBA 3NYRA 1OLOA 3HDQA 4GLOA 1TB4A 4DK1A 1VHLA 2PS3A 1P80A 1Y1SA 2QXYA 3D5EA 4FONA 4JMLA 2BN4A 5A5DA 3MT8A 3WX0A 2ZBEA 3UWKA 1VCIA 1K4MA 1C30B 1YLOA 2JGAA </