1BXAA

Amicyanin reduced, ph 4.4, 1.3 angstroms
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for interprotein complex-dependent effects on the redox properties of amicyanin.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords PROTEIN (AMICYANIN)
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1998-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bxaA00
2H5UA 1NPNA 1QLEB 3FSAA 2N0MA 5AZUA 2H3XC 3EH5B 3QPKA 1SFDA 1EZLA 3T9WA 3FU7B 1KCBA 4M3HA 2FT8A 1SHWA 2VN3A 2VM4A 4E9WA 4G7SB 4KO6A 4K9JA 4G72B 3S8FB 7PCYA 2Y69B 1OCCB 3UACA 3ZDWA 1JXFA 4F2EA 1PZAA 2BW4A 2FQDA 3QJSB 3OMAB 2GSMB 4HALA 1A4AA 3H4FA 2YAPA 3AG3B 3QQXA 4YSCA 5I6PA 4DP1X 1KYAA 2YAQA 3EH4B 3AY2A 2IWEA 1GS8A 1AOZA 3UGEA 4YSTA 1EHKB 3S3CB 1JERA 4AZUA 2DYRB 2LLNA 3ZX1A 1AQ8A 3L45A 4YSOA 3DKHA 6PCYA 1M9WA 1V55B 1SDDA 1FA4A 1NIAA 4FA7B 5AKRA 2B3IA 2OCCB 1X9RA 1NTDA 1L9OA 2VMJA 4UANA 3ABLB 1JZGA 4GYBA 2XV3A 1AZCA 1ILUA 3FSWA 2WSDA 3TBBA 4RH4A 4YSPA 4MFHA 4DPBX 1OCOB 2BP8A 1IBYA 1W6WA 1HAUA 2FWLB 1HAWA 3N2JA 1QNIA 3PCYA 2VSMB 3NJFA 5F7BA 5PAZA 1SF3A 2UXGA 1JZJA 1VLXA 4A2HA 1E67A 2YAFA 2HRHA 4AKPA 5B1JC 1RZPA 1UATA 5D4JA 2ZXWB 1BXVA 1JZHA 3ABGA 3FU7A 1FFTB 3FSZA 4P5SA 5E9NA 2DWSA 1GW0A 4BWUA 1R1CA 4BXSV 4AKQA 3UAEA 4NB7A 1E5YA 2QT6A 4NERA 4E9VA 1BQRA 2E86A 3X1EA 2BW5A 2P80D 2QDWA 4YVNA 4YSSA 1OCRB 3DTUB 1SFHA 3QJQB 1E30A 2WO2B 2CALA 3NJKA 4M4RB 5B7FA 1L9RA 2XXFA 1WA1X 5FC9A 5EHFA 2FJSA 2X88A 4DP7X 1J9SA 1KDIA 3S3DB 3CZUB 3FU9A 2B08A 5PCYA 4HIPA 4DPAX 1AS6A 8PAZA 4KOCA 4A66A 4GP5B 5I6OA 1SHXA 1V10A 4DP0X 2TSBA 1ET8A 1NWOA 3PAVA 5B1JA 4HCGA 2BZCA 2BWIA 1L9QA 1NDTA 4BWTA 4E9TA 3NSDA 2AZUA 3WI9A 1NIBA 3G5WA 1GYCA 1GSKA 2PPEA 1N70A 3U25A 1J9TA 2BWDA 3CDZB 2PPAA 3T71A 2CUAA 1PZCA 3AG4B 2GI0A 1AIZA 3FQYA 3WKPA 4AX3A 1AZRA 1GY1A 2IH8A 2EIKB 3ZBMA 1PMYA 3GXUB 1XB3A 4WKXA 2PP7A 2VSKB 1ZPUA 3NYKA 4DP2X 2UXVA 1DYZA 4YSUA 2AVFA 1SJMA 1ET7A 3IEAA 1JZFA 1WA0X 2EINB 2BP0A 1OCZB 1GS6X 4L0PB 1NWPA 1ZIBA 5B7EA 5I5JA 1AS8A 4G7QB 2A3TA 3OD3A 1L9SA 1N68A 4F7KA 1ZDSA 1CYXA 3FPYA 2YQBA 1MG2C 1AG0A 5B1BB 1QHQA 4QKTA 4YVUA 3OM3B 1AAJA 4TXVB 3EHBB 2XVBA 3PAZA 1A8ZA 4JKNA 1AACA 4P5RA 4YSEA 2IDQA 1XMEB 5B1KA 1DZ0A 2P80A 2J55A 4DP8X 1A4CA 5I6KA 4KO5A 2HLEB 2TSAA 2BZ7A 1BXUA 3FQ1A 3JT2A 1AG6A 3QJUB 2OJ1A 3NJLA 2J57A 4Q89A 2PCFA 1CUOA 4HAKA 3QJRB 4JHVA 1BXAA 3X1GA 3N55A 2FNWA 3MX0B 3IBOA 2FQGA 2FQFA 3WIAA 3KW7A 4KOBA 1FWXA 4YSQA 2GC4C 1KV7A 2XLLA 3HEIB 2FQEA 1KGYE 1NIEA 3EF4A 2YARA 1T5KA 3WNIA 1NIDA 1GY2A 5B1AB 1ADWA 4A2FA 2XX0A 2EIJB 3NJHA 4DP9X 3FPXA 1AS7A 4DP4X 2DYSB 2I7OA 4BDVA 2XX1A 1ETJA 1SNRA 1JVLA 2PP8A 4YSAA 2ZOOA 2BHFA 2IDUA 1PLAA 4E9XA 2FT6A 3BVDB 2XWZA 3BQVA 1AZBA 1I53A 2BO0A 2YXWA 3X1BA 2XXGA 3PAUA 2QPDB 2YAOA 4HCFA 4KNSA 1CURA 4PAZA 2IWKA 4Q8BA 1JVOA 3EH3B 1V54B 2PCYA 1AZNA 3FS9A 4DP5X 4GP8B 1X9UA 3NJMA 1OOWA 3H56A 2VM3A 1E65A 2HRGA 2AFNA 5I5MA 3GYRA 1JZEA 4E9YA 2AANA 5LDUA 1OE3A 1ET5A 2XUWA 4ENZA 4PCYA 1PF3A 2JXMA 4DPCX 3ASOB 1BEXA 3QJVB 3UADA 3ASNB 3X2QB 4UAHA 2WO3B 2ZONA 9PCYA 3JTBA 2YXVA 4AI7A 3ABMB 1A3ZA 1W6LA 5F7AA 1IBZA 3AZUA 1BYPA 1IC0A 2CBPA 2HX7A 3H4HA 1KBWA 2MTAA 2RACA 1NIFA 5D4HA 1M56B 2DY2A 3FSVA 4HHGA 4KO9A 2MRYA 4YSRA 4NAJA 4KNUA 3KW8A 1WAEA 3CVCA 4X4KA 2HXAA 2Y1AA 2YAMA 2BP0B 1NPJA 2YAEA 1XB8A 4W1TA 2I7SA 3NSCA 3S8GB 4BK5C 4F2FA 1OE1A 1A65A 1AR1B 1RKRA 3GDCA 1OF0A 3T6WA 1ZDQA 1F56A 1TEFA 3WKQA 3ABKB 2R7EA 5B7MA 5TK4A 1L9PA 1JOIA 1ZIAA 2PPFA 4UF7C 2VW4A 1MZYA 2Q9OA 1OV8A 4EF3A 1A4BA 2IDTA 1AZUA 5I5IA 3X1NA 2X87A 3FQ2A 2DV6A 4AKOA 4A2DA 2NRDA 3OMNB 4A67A 3TASA 4E9RA 3CVDA 1L9TA 3DIVA 4N4YB 1WS7A 3IN0A 1KDJA 1OE2A 4GP4B 3QJTB 2IAAC 2ZWNA 2VW7A 3IE9A 3NP3A 2GB2A 4G71B 4KNTA 3C75A 3SBRA 1WA2X 5A7EA 1MZZA 1PAZA 1ZV2A 2HX9A 1PNCA 3T6XA 3WNJA 1TU2A 5AFAA 4A2EA 4W9ZA 3CDZA 2XV2A 4HZ1A 1IKOP 3AG1B 3NP4A 1AANA 2BP8B 1B3IA 2IDFA 2CJ3A 1J9QA 4FAAB 3RYMA 3T6ZA 1ASPA 2UX7A 2Q5BA 2HZHA 2JKWA 2JFCA 1PNDA 2GIMA 3NSYA 2R7EB 2W8CA 2IDSA 2FT7A 3T6VA 1SDDB 3FU8A 3NJNA 2UXTA 2YAHA 1J5DA 4E9SA 1RZQA 5I6NA 1TEGA 2VW6A 3S3BB 3CG8A 1W8EA 1BAWA 1NICA 3FYEB 1ID2A 1KCWA 2XYBA 2QDVA 4BDVB 1ASQA 2DWTA 3V9EA 4BWWA 3PLYA 5ANHA 4ZK8A 1BYOA 3NT0A 4QLWA 1NINA 4DP6X 1HFUA 3D12B 2PP9A 5I28A 2UX6A 1KBVA 1ILSA 1J9RA 4G70B 4CSZA 1BQ5A 3OMIB 4G7RB 1URIA 4CSPA 5IY5B 5I6LA 4JHUA 2GHZA 1JZIA 2CAKA 2IWFA 4BXVA 4YSDA 3V9CA 4A68A 4N8UA 1J5CA 1ASOA 1JXGA 3SBQA 1E5ZA 1PY0A 2H47C 2AZAA 2XU9A 3SBPA 1MDAA 2FTAA 3PPSA 3X1FA 3FYIB 4GY4A 5B3SB 4WTQA 2CCWA 3UABA 3IN2A 2GC7C 4A2GA 3PXLA 1YLBB 1WS8A 3TBCA 3WG7B 3TU6A 5I26A 2QPEB 2J5WA 1MG3C 1M57B 3ERXA 1XB6A 1NZRA 1TKWA 1PLCA 3CVBA 3SQRA 2HX8A 1BQKA 2J56A 4HCIA 4KO7A 3AG2B 2W88A 3UAAA 3NJJA 3MBWB 2I85A 5D4IA 4YL4A 3HB3B 1SF5A 4GXFA 2XV0A 2PPDA 3OQRA 4E9QA 1PLBA 1GR7A 1CC3A 2EIMB 2OV0A 3NJGA 3TA4D 3NSFA 3AW5A 1PCSA 6PAZA 1CYWA 2EILB 2PLTA 5TK2A 2PPCA 3ZIYA 4HHWA 1RCYA 3NJIA 1IUZA 5I6MA 1PZBA 7PAZA 2IH9A 1JXDA 1GS7A 2UXFA 3FT0A 2GBAA
chains in the Genus database with same CATH superfamily
5AZUA 4D0DA 3PHAA 3QPKA 4YHZL 4E2OA 1RQ5A 2OSLB 3DSFH 2J1YA 3PHSA 4M3HA 1V8HA 2FT8A 1KEGL 2NY2C 3LS4L 4N68A 4HWBA 4H8VA 3TFBA 5JYMA 3SJVD 1UM5L 2Z35A 4BSWB 3VWJD 5I1LA 2G4EA 5IVZA 2BW4A 4M4RA 5D8JH 5I73B 5DJYA 1P7KB 3ARFD 3F8UB 3OMAB 4H8PA 1ZSHA 4PY7A 4CVZA 5L0QC 3CVHH 2EC9U 3ATAA 3TJHC 1UA7A 5AVTB 1FO0B 3EH4B 3MNVA 2RTTA 2CWRA 1KGCD 2LTQB 5J12B 2WB7A 2G0LA 4KXBA 2Q0ZX 5F72S 1BMZA 2B1HH 5F7HA 1EDYA 3LIUA 1AQ8A 5CLWA 1NGXA 3DKHA 4NQSB 3G04A 4J3OG 4XMKH 5SWSB 1RIVH 1LLAA 4W4NA 1XO8A 5EPMA 2COVD 4Y4KB 4UM8A 1SRDA 3WO3B 4JGNA 2FZ3B 3VYNA 5EO1B 2Z91B 3AQXA 4KV5E 4XODA 1QSEE 2VXUL 2CO7A 4HOZA 2EUZA 1ILUA 1P4IH 3V4VH 4Z0XB 1RD6A 1TZHA 1HU8A 1IBYA 2DIBA 2EAEA 2WN2A 4PJIF 4L1LA 4Z7VF 2VDOB 2NX5B 1AE6H 1I7RA 4MXVE 2FWLB 2W59A 1WPCA 2CNZA 3ROLB 1FZKB 4O4YL 3TVMD 4H7VA 2RAMA 2VSMB 2QQQA 1LJMA 5IHWA 1JZ6A 2NY2B 1MCOH 2DW5A 5EEVA 1MCJA 3QJZA 2CDEB 3QQNA 4U3SA 1OP4A 1IQDB 1JZHA 4P9ML 5IHZA 3QIWD 1T1WB 5LG1A 4XOCA 1ZVNA 4P99A 4FXGB 2WQXA 2PW2B 3EH1A 3UAEA 4UQ3A 1BM7A 5CMAA 2XKNB 3LZFL 3BGMB 3V7AG 4ZMQA 1HOCA 4XXDA 1OTTD 4O5LH 4TL5A 5JDSB 4E68A 1E30A 3RFZA 2IQ9L 1ZD6A 1L9RA 3IJSB 2MNUA 5IBUB 5IKCB 1E43A 1KFAL 2XY2A 4FQIL 2AJZA 1S7UA 2VQUA 4AYDC 4EDWL 1J0JA 4R7NB 1KCSH 1ITBB 1XGRA 4CN1A 2QQLL 4M8QA 1IAMA 3CHRA 4GW5B 4M8VA 3WBDA 1CL7H 2CGYA 4U3SB 3KG5A 2R0LL 1DVSA 2YHGA 4XR8C 4JQVC 5C0BD 3RL1A 4MAYC 5B1JA 1CVRA 1TTBA 1L9QA 3WI9A 3ATFA 1U42A 4NKDA 3W0WE 2YSTA 4PJEE 2NY4B 3QC5X 2XQBL 1JNHA 1R3KB 4JM4L 3LN4A 1O9WA 2O61B 3CFEA 4QXVA 5EDXA 3T71A 1U8CB 1SM3H 4MA1B 5KEZA 5IESL 5IGXL 3IM1A 2X1PA 4PWEA 2IAMB 4NFCA 3SEPA 3LTVA 2CRYA 3AUVA 4ZD3L 1MJ8H 4KPHL 4QRSB 3RWIA 5BJTB 3E1ZA 3FK3A 4MJ5A 2FATL 3VXPA 2QVIA 1L9NA 4KQ3L 5BO0D 5I1EH 1NEUA 2F7PA 4L3ED 4PU2A 1ZIBA 4WKZA 1AR1C 3Q5YA 1DLFH 4GJTB 4R26L 1L9SA 1RUPL 4JQVA 3SKNA 1CYXA 2QSCL 3IVKB 4K2UL 5HYJA 2L7JA 4U1SB 1E4WH 3VFNA 3JWNC 4FKEA 2CG9X 3EHBB 4WJG3 4OD2A 1BVNT 3ZL2A 2AEWA 1U41A 3GSNA 3LRSA 4XNZB 4UBDD 4U1NA 1RUML 4GQRA 4Z3GA 5BZZA 1FVCA 4R90L 3CN1A 4K3GA 3APCA 3NZUA 3O41A 3ALPA 3GMRA 5AALA 5F0LB 2ZXAA 2WOBA 3RVUD 2VLJA 5I8KL 1NBQA 3CZJA 2XN9A 5CSGA 4UU9A 1FYTE 2K0RA 5D5ME 5B4MC 2ZOWA 1AG6A 2JIXD 1TPXB 3FC8A 1J1XH 3L81A 2LV4A 1G4MA 1EDHA 1QATA 4OD3H 5IW3A 2VISB 2WINA 3NA9L 4PP2A 5FCUL 1HYSD 1AGFA 4HC1L 3WFDL 3WIFA 4A7GA 1MSPA 1N26A 5J6HA 4ZMPA 1CK0H 5HYJB 2CLVA 3GKZA 1NLDL 4YE4H 1T1YA 2FGWH 2Q8AH 2GC4C 2ZG3A 1AGDA 3HEIB 3EF4A 3BAEL 1VB9A 4CJ1A 3BDYH 3HIZA 3WMSA 3CXHK 2EABA 3IE4A 2XBTA 1U3JA 5EZLB 4N8PA 1HSBB 3MOBH 1YEEH 2D2CC 4WTZA 3VXOA 1WTLA 3BGFC 3DBXA 4EJ1C 1PLAA 2FUQA 5DUMH 2XTJD 4U6YA 4NRXA 3B37A 4MHHG 1S7XB 1XF3B 2NUPB 4GMTH 1FV1B 2XWJB 2J88L 4JRXA 2O5NA 4Y1AA 3TN0C 1FO0H 1A6PA 2QPDB 2CBMA 1UXLA 4LLWA 2WMPB 3ATDA 5E1HB 3BH9A 1D5XB 3PHOA 5CD5D 1MY5A 5F8RC 3IJSA 5FF6A 5J6HB 1KEML 4LE8A 5BOPA 4J39A 1S78C 2W9EH 3PGFL 3QEQB 3ZE0E 4IRSC 1I9JH 1A6AB 5D1XA 3F62A 2CRMA 3ZTCC 3KS0H 1ERNA 3SKOA 4M6OL 4PJ7B 5INDB 2WGXA 1JXJA 4PS8A 1QOKA 2PF6A 4BZ2L 5AOMA 5DHXB 2J3SA 1E8XA 2EE3A 2YN3A 4Y4HB 5FUCC 3UJJH 3CDGA 1U8IA 5L2JB 1R5IA 2F61A 5LJYH 3MGAA 5DFWH 5JHDB 5FECB 1AGEB 2VT0A 4KY1L 2O5ZL 1MEXH 1QPPA 2ZAHA 5E7FA 2M26A 4APQC 1JGVL 1BEYL 5CGMA 5FF6B 4X6EA 3IJYA 4GMSL 4PTTB 5EBLA 4J28A 3ZE1F 1NPUA 3RVVC 3ULUL 4L1TA 2YMXL 4Q6IA 4HMDA 1EHLL 4GKSB 3DGCR 3FSVA 5F6HJ 2G2RA 5CS7A 5J89A 3S4SA 3JUYA 3UC0L 2G3XA 1X7QB 1MIMH 2VZOA 5E2VH 1VHPA 2B14A 2P5WE 1WUNT 3BAXA 5F0MB 4RA0C 1E2WA 2I7SA 4BFBD 2UZXA 5FYKL 1NGWB 5HI5C 2PYEE 2JJSA 4TRPL 1UUSA 2VXQA 5DZ9A 4CMMB 2A1WH 1IEAB 1PQZA 3QDGD 3BKCL 2HMIC 4WFGD 5T3ZD 3MRLA 4YDMA 2VR3A 4DO4A 1BFOB 1CQYA 1JNLH 2GK2A 3CZEA 3IFNH 2NY3B 3KPSE 4YHOL 3UEZA 2PPFA 3PIQB 3PNWA 3VFNB 1A22B 1PJ9A 3VTAA 1U58B 3T3PE 5CBAA 3IJYB 1A4BA 1SJXA 3O4OC 1EK3A 4XRCB 3ETTA 2XWRA 3GJFK 4UQEA 1N6UA 3W9EB 2OP4H 3TIDA 1XSOA 4HQQL 4PI0A 1IL1A 3QORC 1LO0L 1Z5LA 1WYJA 2OMBA 4P0DA 1N2RB 3LN9A 4FQXA 1IQWH 3WNNA 4A67A 1S5HA 3UERA 4XXCC 1G6VK 2A74C 4OZIA 2DQMA 3VRIA 3MV8A 1F3JA 1UWYA 3D0LA 3VXRA 4I9XA 3AXHA 5J0BA 1THCA 2FO4B 4HIIA 3JBG7 2J88H 3RTQD 3QORA 4ZUTA 4WSGA 1T6WA 1TO4A 3P4LA 4LL4A 3VXTB 2R0WH 2HKHH 4CDHA 3T2NH 5J12C 1ZV2A 4P23C 4K07A 4A6YL 1NLBH 1CIUA 2WKOF 4Y5YB 3UJIL 5FM5O 4PFEA 3MUUA 2OW6A 2WXOA 4WO4C 1ASPA 3IDXH 3C6EA 1TYJA 3W38A 2VRAA 3DOIA 3L4CA 1DO6A 4H40A 4OTXL 1B4LA 4EN3B 4WUUB 1N8ZA 5HHME 2FT7A 4P59L 5T3XL 4C47A 1KPVB 3DX4A 4WEUD 4F5CA 4IW4C 2BY1A 3HPJB 2HPTA 4DT2A 2JXMB 1HT6A 4NWTH 1CTNA 2K4AA 5CR1A 3NIGB 3QULA 4XPTL 5DEGA 4MNGA 4HF5H 3OWEA 5C0GA 5E94B 3FRUA 3TZVC 1S5IL 3INUL 1NDGA 1JSYA 1N10A 4UT9A 3BVVA 4P5KA 4MD0B 2QELA 4Q58C 4Y4FD 3MRRA 2WUCH 3EFDH 1KXTB 4UMSA 1BQHB 1RHHA 4AYID 5E8DL 3FO0H 1INQB 1INDH 1FVDA 3RU8H 3WXVL 1T4WA 2UZYB 1OAYL 4H13C 1NKGA 3V9CA 4C54A 2G3MA 3ZSTA 2QSTA 4N8UA 5AOZA 4GAFB 4K5LA 5JLZA 4EI0A 3MXVH 2OZ4A 4HK3N 3SE6A 4R0LB 3TO4A 2IGTA 3C2AH 4Z7WF 5A2IH 3L3JB 2VQTA 3LX9A 4ACTA 5BUPA 4L3EA 1FNSH 3HR5A 3PWUB 3OXRB 1I1CA 3QI9C 2CU9A 5F89B 5C9JB 5ADOH 4TULL 4J3OF 5SWZA 4F7EB 4ICXA 3V0IA 4QT5B 2OI9C 1XB6A 4B6ZA 2LU3A 4OZFH 1NCHA 4QIRA 4JFFA 1KLFB 1XF4B 3QYNA 1V27A 4KO7A 4RWYH 1RUMH 1QLFB 4UM9A 2IQAA 2W07B 4JFVA 3T3MF 4FLOA 5JYLA 4IOFD 5D96C 2AEPL 3KCPB 3QNXA 5EZIL 3CVHL 2JTDA 2ZCHL 3N1QC 4N3TA 4RMSA 3V4UH 4X83A 4KQ4H 5HHOB 2CJUL 3DX9A 3QJFA 2WO4A 4TV3A 5CSZA 5C0BA 2EIBA 1D6VL 1VGKB 4DO6A 1CF8L 3ILPB 4MAYD 4Y16B 3FFDA 3MV11 4PJDE 4G5ZL 4N26A 5C3LD 3O4LB 5I6MA 1Z7JA 3K2UH 4B9PA 3QIWC 2UXFA 3T9WA 3ES6A 2DRUA 2IANB 1I8UA 1HXMB 1CFQB 4G8GB 4NAQA 3RZCD 5KW9L 5DQDH 2IH1B 4HGWA 1WIPA 4FQHB 4P46D 4DZ8A 5C2BL 1U4EA 4JPVH 4LLDA 2AV7B 4I9WD 2FO4A 2DM3A 2WLMA 4CBZA 1EAOA 5EU4A 4PWKA 5F0PB 1DQQA 5H37A 4AXWB 2NTFA 4PJ9D 2VZTA 3L3DB 1GZQB 3CC5B 4B96A 5GISL 1PZAA 2CIIA 1W72L 1EO8H 4PJFF 2WTOA 1VEPA 1CMOA 5IMMA 4NP9A 1BBDL 3NK3A 3L3GA 2E7CA 3MACL 1MLBA 1H3XA 4TF4A 3VXUB 4F15C 5E95B 4BSJA 3BE1L 4JFTA 3OB8A 5C0DA 4OFIA 5JORA 3TIEA 3UGEA 3LB6C 4KXZH 1VACA 1QFHA 2DYRB 4RAHA 4X6FB 4Y2DC 3VFTA 1S6NA 4YSOA 1EHNA 3KJ6L 3N1GC 1IT9L 4RRPA 4IOSD 1NBZA 1AI1H 2WVVB 4JFFD 5E6UB 1AHWA 4UNTA 3UOAB 4CMHC 4K71B 2K8MA 2OQJA 4L37A 1QLEH 3G5VA 2B9AA 3C6LB 3WLBA 5BRZD 4Q0XH 3N43B 4PD4J 3MGOA 4DGYH 2JCCE 2DWDA 1IM9B 1QASA 1UZ6E 4GYBA 4DN3H 2WZPA 4KY1H 1QFWL 2YSSA 4MNQA 4OM1L 3TX4A 5HHVH 3VSVA 5CF3A 3MV01 4YDKH 1G87A 1OCOB 3IAPA 3EOBA 5DD5L 1J18A 4MZ2A 3WXWL 1J7VR 3WYRA 2XFGB 4ELKA 2XN9E 3L9YA 1AIFB 2RIKA 2VLJE 3PCYA 1XHHA 1RZIA 3RNKA 4XVJL 1WAAE 4UAOC 4TQ8A 1NFAA 3QR2A 2AQ2A 1CFNB 2F6AA 2DDQH 4YZFF 1DEEB 2AJXH 3O8XD 3PWVA 3B7SA 4JPWL 1BXVA 4B7LA 4E5XG 1JNNH 1VGEH 3BSHA 2D0GA 5BUGA 3AADB 5L6YH 3KNBB 3TONA 1SMAA 3QUZD 3ZE1E 3CQFA 3WFBL 5B7FA 3R06A 3WXWH 5DGQA 4ODWB 1A9BB 5LVEA 1AO7D 4K8RC 4I3SL 4OZHA 3DETC 3MXWL 1T7YA 4XCCH 8PAZA 4A7QA 3KS0J 2WQUA 3WFZA 3VGFA 1NM9A 5KSAC 2VUYA 5M7QA 3ARPA 2QV2A 4TNVK 1BBJB 3MHZA 1NDTA 4YS4A 1IC4L 3G5WA 1QSFA 3UTSE 4ZUSA 1GOGA 1TZHB 2O6EA 3CFBB 4LLUA 3BVTA 3GIVB 4ODBD 3ES6B 4JM2F 2CLZB 1PZCA 2Y0SA 2AXGB 1YEGL 3WEXA 1U36A 4KJYA 2BNRD 2E46A 2UYLB 5GGUA 1NSNL 2OMNA 4FQCL 4A55A 2IFFH 5A2AA 3SBWC 4WKXA 2EE0A 4KRMB 4FQXD 5KYUB 3ULVD 3WJJA 2UXVA 3QUZA 4RGNB 2NY3C 3PWLB 4YSUA 5INCB 4JQXA 4QO1A 5GRWA 5E56A 2P26A 4XWGH 5F7DB 1YY9C 1IB5A 3Q06A 5L8LB 3ZR5A 3BUTA 4S1DC 4APQB 4LLYB 2AXWA 1UWEH 5L0QB 3MLZH 3H9HA 3QNZA 3OG6B 5F7NC 3S8WA 4RFOH 5B1BB 1JS4A 1KJ2L 2SEBB 1AAJA 1P1ZA 1B0RA 2CA3A 4I3GA 4FXLA 4KZDH 4QHKI 5J6SA 4YSEA 3V4PH 3KL5A 3PAYA 3WHE1 2OK0H 4P46A 2HRLA 2NY6D 4JHZA 1I7TB 4K3EH 4QRPB 2DM4A 5IB4A 1Q72L 3KXFD 3OKEA 5KYYA 1BXUA 3FQ1A 4MNQD 5INCA 5MENB 4LPWA 3Q6GH 4ZXBD 4XX1E 1PKQE 1EQWA 1MVUB 5GZOA 1BFVH 5DK0B 1IBDA 3RZCB 1K2DA 4K55A 1YMHB 1N3NB 3A21A 1BXAA 3ULVF 1L9MA 3B56A 3KL0A 3MJGX 1W8OA 5CZXD 4ZW3A 5C0AE 4ADJA 2OMVB 3HG1D 4PR5B 2FLMA 2E6PA 1FYHB 4YNYB 4YPJA 5IWLA 4L8SA 1DQIA 4Z7QF 1NBYB 4CADB 1AKJD 1AS7A 4N0FB 2I7OA 4CUCA 1FNHA 1T4KB 1IO4C 4JM2C 5KAQG 1AP2A 1N6VA 4DFIA 3T65A 3SD5A 1EO5A 4I2XE 1D7DA 3ESNA 3VG9C 2ZD0A 5FO9B 3VD0A 1RZFL 1XF5A 3W39B 1S5IH 1C1EL 4ZMWA 3CK0H 4QF1A 4G1MB 1F6AB 3BHBA 5HTSA 4PJAB 4UINH 2WCPA 2ODIA 4C56E 1XSKA 5JMRA 1GGTA 1L7IH 2O5XH 2V9TA 2F7RA 4NGHH 4P46C 4HKJA 2AFNA 4O58H 3RU8L 4AH2B 1JZEA 1XCQA 2BOBA 1FYTA 2D9CA 4K15A 2ZUVA 1X5GA 1JJUA 1KJ3H 4P2QB 1T22B 4M5YH 1F2QA 2CA4A 4U7SA 2R0ZH 3FUKA 4Y4HA 4F24A 1FFPA 2X4PB 4ONGH 5E4EB 4EUPH 5KWYC 3QHFH 3GNMH 4JMNA 4W6XB 3AWGA 4JDVA 5JQIB 5I30L 1AE6L 2YD0A 2RFXA 3IDIB 1A7QL 2C4FT 2ENQA 4TLKA 3C5SB 5F7AA 3FUMA 1FC2D 3MYZA 4PY8J 1PZUB 4XPHL 2MTPA 3QIBB 4ELME 2CDGB 3KLAB 1J11A 2MTAA 5D7JD 4H8QA 2RACA 5GS1C 4UM9D 3V4PL 3RBGA 1NAML 3FT3B 1WBZB 4XNMA 3OZ9H 3VRLF 5F93C 4WTZG 2YFOA 1I75A 1NGWA 2C3HA 3VXME 4NUMA 4WFEE 1KXVC 4NRXB 2KBGA 2CO6B 3HZKB 2VDOH 1CGVA 3VXQB 3ME0B 1P6WA 2IADB 3BO8B 1ACYL 3UFIA 3COOA 4KQ4L 3QBTB 4YMPA 2BSDA 4LCIH 1AR1B 4PBWD 3S9DB 1ZDQA 4J4PA 1KENH 4Z7QE 3II1A 2F58H 2GBVA 3QCUL 4DCQA 3UPRA 4NSKA 2AQNA 1FLTX 1JOIA 3H9SD 1NOFA 2XA8L 2LGNA 3RX7A 2V9QA 3LCYA 1BFSA 1LO4L 4AYMC 5HVHC 4N8VG 3L5XL 4KKCC 2X87A 4X99B 1JDDA 2VLLA 1M3IA 4XHJD 2V5TA 4KRPC 1RIUL 3RFZC 5FYJD 1CJYA 2YGVA 1XX9C 2ZOLA 3KGUA 4ZO8A 1LK3H 2WNXA 2APXA 1VADB 4U6HB 1SJEA 2WBJA 4X9BA 3F7RA 3T0ED 4UT6H 2QVKA 1BECA 1VCAA 3QXAB 3IJHA 2FWUA 1RSFA 1XH3B 1WZKA 2J8UA 4N0UE 3T1FB 3R7QA 3EO1B 2PTTB 3T6XA 1K5WA 3ZDZB 1MHHB 1OW0C 1VEOA 2C1PB 5IVXF 5I19L 3BKJL 4F8PA 1YC7A 1BCIA 3RGVB 3RYMA 4AGPA 3SN6N 1JGEB 4NC0B 5LGYA 4M7LT 1GRWA 5D1ZD 2Z8WC 3IGFA 5C07D 2R7EB 1XXDC 2IDSA 3NJNA 1R5IB 3SY0A 3H9YA 5E6SB 3BAYA 3T65B 2P42B 4GG6F 3R18A 1CDGA 1JF1B 3MO1A 3FMGH 4RFNC 3VI3B 3CDYA 4P5TD 4BDVB 2ZP9A 5JPMA 1SHMA 5H37H 1S7VA 4OIIL 1RMFH 4U1HA 3LQAH 5ANMB 1ML0A 1WK0A 1DEDA 2UX6A 3U0TB 3V0EA 5FA4B 3TN0D 3T5WA 4AE1A 1X5LA 4R3SB 4PW9A 3U4KA 4WZ9A 4CC1A 2HT4C 4JFZL 4L4TE 2BVYA 1MY7A 4DQAA 3APNA 1CFMA 1MAKA 4G11A 3CFKB 1J5CA 1QR1A 1N59A 1MVFA 4B3VA 3RPIB 4KUZH 3ZMEA 1FL5A 4PGBB 5D1ZC 2Q86B 4XX5A 4ONFL 1MREH 3SE9L 4BM7A 3EJJX 1RY7B 3PFQA 4V1DD 4HMEA 4QRUA 2H2SC 1IC7L 1U8PA 2XRAL 3O6FC 4NQDE 3ZQWA 3P0VL 2EKJA 4FQJH 4BFEA 4X6CE 4ABQA 5HD8C 5T3ZL 3HW7A 5DEFA 1HZHH 1ACXA 4PGCA 1SLWA 4XMXA 1P4LA 1JV5B 1I1AB 1YHPA 3U0TA 1MFUA 1A3RH 5CGBA 1JGIA 2E4TA 4N22A 4WUKL 3WE6B 4JFZH 4P5TA 5FUOH 4HLZG 3FTGA 2EXTA 3GSVA 5IB3B 2FX7H 4FNLL 4CILA 2EO1A 3UC2A 4AV0A 3QIBD 4IEFB 5I1JH 3WFDH 1XR8B 4FA6A 4PJDF 3P9WB 3MBEA 1DANT 3BDXA 5DEGB 1UB5A 3OJDB 4RNRA 3IMBA 5K1VA 3HB3B 2O6CA 3FT2B 1QX1A 3QT2A 4AZ8B 4I18A 2A6IB 4XXCA 3NIFF 4QCIA 1KF9B 3RKDC 4GBXA 4QRRB 1H6FA 3UTTE 3L6FA 1LK2A 3KYOA 5MEND 4FZEL 5AW3B 1CWVA 4FLQA 4GKOA 3ZIYA 5C9KA 5E1AA 3VFPA 3MX0A 4YFLF 3WUZA 2WBKA 1CDHA 3KPMA 1N8OE 3H0TB 4U6VH 2IFGA 4HXBL 1JNJA 4L4VB 4NCC2 3X14A 2N0MA 1RULH 2I60L 4XVOA 1F6LL 3EH5B 4R2GC 4LRNL 4AYBA 4LU5H 3GRWL 5B21A 4HLJA 1DQQB 5IBTH 3ZE2F 1MRFH 1QO3A 1S7SB 1A6WH 1IGJA 2WC7A 2BNQB 3BPCB 4C55A 1R5WA 2Y22A 3MLUL 3BP6A 2XXMB 3O0LA 4D0DB 5DRZA 2FQDA 2DQEL 2H3NA 4PJXE 4P48A 3UYRL 3GZPA 1K4DB 2R8SH 5DJCB 2V33A 5E1AB 3VFPB 4AOFA 3TZVA 2B9BA 5I6PA 1WP6A 2JCWA 4FL4C 4H8HA 5DURB 4WJ5B 2VDKH 2LHAA 3CNKA 3CZKA 2XWJA 4GKZA 4OLXL 3DUUB 4X5WB 3KWWB 5FIEA 2D03H 3QDJA 4L9DA 3TS8A 2H2PC 4LPXA 3FFCB 4H25A 4YX2H 2VXVH 3UC0H 1J8HE 1K3ZA 3E3QC 4Y88A 3PE9A 4Z3IA 4KNQA 1ZLEA 4OZ4A 5E2UL 4RWHA 3DMMA 3EYOB 5DRXB 4HG4J 4K71C 4B50A 4JFXA 2LR4A 3FOMB 4XCFL 3HN5A 3MJ7A 3S88H 1G7HB 3LD8B 3O3DB 2AQTA 4Y1TA 2DQFB 2WSDA 1QHOA 1IU1A 3B9KD 4PG9B 3TV3H 4I9WE 2H1LM 1DBAL 1EANA 1XCTA 2E9BA 3O0RL 4L4JA 5L2KB 2I07B 1AMYA 3KPLA 2YO3A 4LLVB 1LMIA 4KZ0A 1MQKH 3Q9PA 4FHJA 1K72A 2WYZA 5GPRA 5JHDA 3KYKL 3PP4H 3TEYA 4A2HA 4OFYA 5GZNC 1NUDA 2IPUK 5EU4B 4AXWA 4TQEL 1YMME 1QG3A 5LKNA 5FYLL 4UINL 3KHQA 3OXSB 5DS2A 4QXWA 5D4JA 3VNZA 5A3IC 5IJKA 2ZXWB 5IG7A 4WI2A 2QHLA 5H35B 1SVZA 2G2RB 4D3CL 4NB7A 4RFOL 3L3GB 3DX0A 1RK1B 2NR6C 4M5YL 4MXQC 3CQQA 5KUMA 4ZXBC 3WDIA 4CMHB 2VC2L 1RLWA 1IM3D 4KJWD 1NCDL 5FYKD 2X10A 3K8KA 1LNUA 1LEKA 4JNXA 3QFJA 3C60C 5J1AA 3FRPA 3SOBL 2FR4A 4OTXH 3QQ4B 3WN5B 3CZFB 2D0FA 4DGWC 3LMJL 4GFTB 4DPAX 1UQSB 3K91A 2G5BB 3WFBH 4A66A 2VH5L 4LLMB 4E5XB 5C0CB 1MJUL 1ZKAA 5BVJB 2GTWA 3K6SA 3CSGA 1BFVL 3WEMA 2FJGB 4HCGA 2OCFD 2OSLA 3ILQC 1HQRB 1P6AB 2ITCA 4CVXB 4JFFB 3RGBA 4BELD 4D9QD 4F8TA 5CR8A 2QMKA 2ILLA 1DE4A 3MCLL 4LCYA 3CDZB 3U83A 3FW6A 3ZE0F 1XGUB 1G0YR 1YYLH 3TWCL 2WSPA 3MJ8A 1LD9B 5JR1L 1BX2B 3HFMH 2UWEA 2XTJE 1R3JA 4KJWC 1ZLUK 1QO3B 4M4PA 1N4XH 3KPRE 5D71H 4OU3A 3AY4A 5BMFH 2AVFA 1CGWA 1JHLH 1SJHA 2R56L 4E5XA 1ZT1B 4YK4C 5FFLA 2BP0A 5DJDB 4GXUM 1GS6X 4UTAA 5IHHA 4ZPVB 1KENL 4URTB 5B7EA 3GS7A 4TN9A 1I85A 2QADD 5EBWB 1HXMA 3EJRA 3OD3A 5TDOA 3MJ9H 5ENWA 3GPSA 3TZVB 2DKSA 4NNYB 1E5BA 5EF1A 3KGTA 3TJHD 2YQBA 3NJVA 3MKGA 2GFBB 4RMWA 3HLAA 3T3PF 5E6ZA 3VJ6A 3O9WC 4X6DE 3KJ6H 2JF1A 3PAZA 4U1GC 3LQZB 4OI8A 4XBEL 2WWKT 3QYCA 2FZ3A 2RBLA 4HGKC 5JOFB 3L2NA 4O51B 4JFEE 1FNEB 4OGYL 4CVWA 4B41A 2FWSA 1IGIH 2Y6TE 2HA1A 3O4LD 1UT1A 5JTWA 3VWKD 2ZE0A 4BRJA 5KUKA 4MAYB 5F96L 2V5SA 1TTRA 3CCHB 2A5UA 3CSBA 4KK5D 4TUJB 1VSCA 3TYGL 1EFXA 2E56A 2VNCA 5DD5H 2UZYA 4LF3B 3JWNG 1EMTH 4H20L 1UH4A 1RK7A 3MRHB 5DJXA 1UXMA 3IBOA 4PYHA 3QHFL 2X6CA 3N42F 2V2XA 2NY4C 3WD5L 1DVZA 3B3IA 4YSQA 3L5HA 3NUKA 3GIZL 4HJGA 3RWHA 2X4TB 2QQNH 2NSQA 1NM4A 3AXLA 3GJFH 3H9ZA 2WD0A 2OAAA 2XX0A 3HHRB 2HJKB 1GVIA 1UD8A 4L4TD 2FB4H 4L0ZA 2DYSB 3SDXE 4PIBA 2DQHL 4L37B 4DAGH 4PCKA 3L4UA 4ZW8A 5GRZA 1PFCA 1L7IL 4W68A 1Q1JH 4LEBA 2ZOOA 2UZIH 4WF7A 3HS8A 3G08A 4ZUVA 3ZDYE 3HS0C 2J6WA 5T1DL 1QFOA 2VDRH 3QI9D 2WLLB 1G9EA 4GW4A 4ABWA 4BFJA 1VDGA 2IOMA 4J5VA 4HCFA 2IPTL 2HJFA 2XBDA 2FBRA 3I6LD 1DSWA 5HHNA 1BZ7A 3IETA 3A6OA 1J8RA 2R0KL 4YHIB 3SDCD 4RQQB 2C4FU 3VQ2C 3NDZE 4MWFB 1CDIA 3BVNB 3QCTL 4X9GA 2XWDA 1BREA 3NCCB 1A1NB 2AMGA 2XUWA 3K1DA 3UG4A 4A04A 4GAJH 1EBPA 2W0KA 4JCMA 2ZXGA 3PGCB 5T1KB 3KPNA 4B9IA 4ESKA 4O58L 1T7XA 3A24A 3QJVB 2MHAB 3LHPH 5CINL 1FE8H 1EUTA 2HH0L 4LSTL 1R3LB 1GAFL 3ABMB 1U3YA 2FJHB 1T66D 2QLYA 3ZKMD 1GZPA 4ADGA 5C08D 5DD6A 2FHFA 2KQNA 2CXKA 3GKWH 4C83A 1BYPA 4NHUB 1L4IA 1YEIL 4G6FD 1MCWW 2GSGA 4AITA 4TLTA 1OSZB 3HR6A 3FCSB 2HUEA 4GSDH 4MB5A 5D7HA 2EUVA 3OJMB 3ARYA 4OCXL 4ZX5A 4OZIE 2HG5B 5I2IA 5F6IC 2APBA 4BJLA 2VLKB 1L5GB 1Z0NA 3SBWA 5DTFA 1DDTA 5ID1B 1S7TB 3QZLA 1OPGH 2YAEA 3MRFA 3A6CH 1ULVA 3KPNB 3L5XH 4W1TA 3HS0B 3QWRA 4JRYB 4XNYL 3S8GB 1MXGA 1MCWM 5CZVH 4WI3A 4L2LA 4BK5C 3VO0A 5DHMC 5T5FH 3RWEB 1QP1A 1KWKA 4DTGL 2GBUA 2VYRE 1FVCB 2GITB 4IU2A 4PRDA 1HNFA 4PJ6A 1TEFA 1WLHA 3BQUC 5LN8A 5FCSH 3S0PA 1Z9OA 3F7PC 3UBXI 1L0XA 4A7TA 1P6FA 1RU9L 1I8KA 3QB7C 1BDYA 4IDJL 3EJZD 1T6BX 4XCEB 4QHKJ 5F7MC 3GXMA 1J8HA 1IGFL 2ICCA 1A6WL 1S46A 1BW8A 4PM1A 5DJYB 1YJDL 3D2TA 4BCZA 3GI9H 1NMBH 5DD1L 5EC2B 4U6HA 4Z7WB 3O11B 5IEKA 2BSCA 2F2HA 3X11B 5C8JA 1OPOA 1YJDC 1IZKA 2DLGA 2IF7A 2MH4A 5DHVH 4PRHA 1S7UB 4KNTA 3APFA 4ODTH 4G6MH 1EX0A 3UZEA 4P06A 3K72A 4WWKA 3TIDB 4ORGB 1RZIB 1HHHA 1O75A 1E2VA 4W9ZA 4IBWA 2H9GA 1UB6B 2BMKB 1RZKL 4ZFFB 4JHAL 3AJ7A 3D48R 4YX2L 2ADIB 4FAAB 4LOVA 3T09A 1J1PL 3N5AA 1W72B 4FG0A 3OKMB 2NXYB 2VLRA 4M5ZL 5FW6A 2Z0UA 3N42B 3ZYJA 2ZSVB 3GI9L 5CILL 1SDDB 1CD0A 3W3BA 2RFXB 1NMAL 3IDIA 1BA9A 1MNUL 4MD5A 5MEQB 5JPMB 2KS0A 4HKZB 2PO6C 4OY9A 4HHAB 4KBPA 1UCBL 1H9VA 5BUAA 3ILQD 4MNHB 5F1OB 4BK5A 1JWSA 5EOCH 4YAQB 1J1OL 4ODWA 3C87A 1IM3B 5GGVY 1GTFA 4ZS7H 2DMCA 3B2MA 1JE6A 2CO3A 2Y72A 5IBTL 4DGUA 2B20A 1NCNA 3N9GH 3AU1A 5ALBH 3V8OA 3GMLB 1NDMB 1IC7H 2GJ6A 2XRAH 4HU2A 5I1KH 4LRNH 5AVSB 1J8SA 4WY7L 2XQYA 1CBVH 2NUTA 4LCWE 3PU7A 1AGEA 1SOQA 3IRZA 3LZRA 4EUPG 4I3SH 5M95B 1E5ZA 1P7QB 1W0VA 2P5PA 2H47C 2MHAA 4NN7B 4NQXA 3S35X 5HD8D 3EXLA 3OSVA 1A2YB 4WU5B 3VCLA 1KT2B 2Q76B 4XBPA 1HHIB 3M86A 4PJGE 4XOEA 4PLJC 2LT9A 4DF9A 1AXSA 2R2EB 4WNQA 2ZKMX 4NZ8A 2FBJH 1CDUA 2C9RA 2RCSH 4X99A 5DK3A 4N2HA 1QLRB 4AGQA 1I7ZB 3D7PA 3PUCA 1UKSA 3P4OA 1ED3A 1OSZA 1YNTA 1CXEA 3FONA 5KS9F 1E4XH 3CIAA 2BX5A 4BE5A 3MV9A 1OP9A 2WINB 3AB0C 2XG4B 5CZRA 4JRXB 3CU1A 3ZRCC 3MRLB 4X4ZA 5HSFA 4LLYA 2WLHA 4GRMA 1A3RL 4KVCL 1UOKA 3D05A 5KSBB 5E9AA 2XV0A 4MSWA 4S1DD 5I76B 1GJWA 2D8KA 1DVUA 1IL1B 2CKNA 3EYUL 3HC4L 5L9DL 2EC9T 3BKYL 1JPTH 3ZRSA 5C7XH 4S1SH 3CSPA 5AW1B 3KWTA 1BV8A 3LRKA 4MXWH 5TE4L 2XKUA 3REWB 5A2LH 2A6JA 3QGVA 1MRCH 1K4CB 2ADFL 4R2GD 3ZQ9A 4OGAC 3KYAA 4QNPF 2C9QA 3UAFA 2IH9A 2J1ZA 2Q2LA 1OAZL 3MV7A 2O6FA 3QORD 4RVBA 2GJJA 3CHSA 4I0PA 5E0QA 3WMPA 3ULUH 1SVBA 3WFEL 1CICB 4WI4A 4J23A 4F57L 2EQDA 3Q05A 2H1PH 3SO3B 4EIZC 1MH5B 3GMPB 3U7WH 5EUKA 2FJUB 4PRHB 5HXMA 3F12A 3KPQB 4ZUWB 1HXYB 5IROC 2ZG1A 1QZNA 1THAA 2WQSA 4P57B 5J6GA 4L18A 4R0LC 1KN2H 1J8KA 5LWYH 3O41B 1PZ3A 1JXFA 4U1LA 4MJIE 4LPVA 3V6OC 3HPLA 1JZ3A 4FABH 3NCJH 3QUKA 2RGSA 3HZ3A 3HC0B 1I9JL 4DP1X 2DQJL 4FNSA 4M6MH 4HULB 2E6QA 4QWWC 4ZAKD 1N5AA 1M7UA 4PP2B 4UTCA 1KGCE 3CVIL 4U0RC 1MWAB 1WTGT 3WFCL 1T7WA 2L8AA 3AREA 4ANUA 4FQQA 4H8WH 2ARJB 2WP3T 4M8UA 4AL8L 2Q6WA 3ZMRA 3DA0A 3K2IA 4OW6A 3K6DA 4HSQA 3BKJH 4PVNA 2OSXA 1LO3H 1S8DB 1JHKL 1IBHA 2DQTH 4O2FA 4WEBL 4YXHH 2Y7OA 2I9TA 1XGPB 1Y1DA 2RCSL 1TFHA 3T0EA 2YEVB 3SJVE 2IV8A 1WH0A 3AWFA 4JM2B 4UANA 3GSVB 5IB3A 1DVFB 1FQ9C 2FE0A 4NO3B 4L9LB 5IQLA 4KXZI 1LK3L 3FSWA 5DHYA 3CHOA 1V7NH 1AQDA 5CD3B 2E8ZA 3SPHA 5BMFL 3KE0A 4NKDB 1JHLL 4JFEA 4G9DA 1UXSB 2H4EA 3HMWL 5K59F 3BEWB 5HGAB 1B2WH 2R2HA 4JKMA 1HI6B 2P48B 4H26B 4KXCA 4V1DB 1BP3B 4G3YH 3NIDF 3WIHH 2XV6B 1H19A 5PAZA 4F9PC 2UXGA 1A2YA 1AC0A 1YN6A 3MLTB 1S7SA 5HYQA 2YAFA 3FN0L 4U7KA 1NFDE 3IDJA 1UATA 1ZS8B 2HTKD 2VUKA 5L4JA 2D31A 4PI2A 3DOSB 5F7LB 4NM8L 3VI4A 3NEEA 4BWUA 4FQ1L 4JRYD 1K8IA 1AIFA 1DBBH 2QT6A 3BH8A 3EOAB 4J2QA 4TQEH 2W9DL 1YN7A 1V7MH 5HPOA 1WWCA 3VB9A 4QHUA 1LNUB 3U6RA 4N87A 2VXTH 2ADJB 1MJUH 4MYPA 5D1QA 5C71A 1SFHA 1F13A 4LCCB 1E5CA 3IWUA 4G59C 1M3JA 3MNWA 2K45A 4Y5YA 5LG6A 3KYMA 1EIBA 5EHFA 4FG6D 1NAMH 4HUWB 4X6CF 4WHDA 1KELL 1J9SA 2BNQA 3BPCA 3EYVB 2ORBL 3MJ9L 5KS9B 1BZ8A 1UZ6F 2OTUB 2NY4D 3G3LA 1SJVA 4ZDHB 3K6SB 2X4OB 3X3GL 5EU3B 5I76A 1NCDH 2R69H 5DUBA 3V8CA 5IQ9A 5CEZD 2EDYA 2HT2C 3IDJB 5DA0B 4EN2A 4LSSH 2H8PB 1X7QA 3QE5A 4AJYV 2Y06H 4FQHA 5GJSH 1ZLUH 4BWTA 2DF3A 4EBQL 1TZAA 4DKEH 1FUNA 5FYJU 5SWSE 5J4MA 1XGUA 4GW1A 5SWSD 1A6ZB 4KKCD 3KLDA 5DJAA 3KPLB 3ESVF 5GS0H 2WUBH 2YUZA 1X5AA 2YLHA 4JY6A 4NUJA 4OGQC 2CUIA 4FFZA 1E4HA 2Q8AL 4S0SD 3KPPB 2BOCB 1GY1A 1U2HA 1XMWA 3F64A 3IFLL 5TE6L 2COQA 4GKLA 1WE5A 4UILH 2J5LB 3RVWD 1IFHL 3B6SA 2NXZC 2OL3A 3VXNB 1U8KB 2MOQA 4JFSA 1GZHC 4LHUB 3IDGA 4NENA 2X89D 5DVOA 5AL0A 3MJWA 4OSUH 1WFOA 1N2RA 4YK4B 1FN4B 3F5WA 4AQAA 5EEXA 3CMOL 4YBLB 3RDJA 2DIAA 1UZ8B 3OPZL 4BH8B 1T83A 5GGUB 3LZFH 3U4EB 4ZS6C 1Q9OA 3HNSL 3T2OA 3MLXH 3GRWH 1Z5YD 3DWTA 4PRIB 5CWSB 1PKOA 3MRMB 1XIWB 3SHSA 3EJPA 3LHPL 1OAYH 5CINH 5CU5A 1A8ZA 2P4AB 2C26A 4DZBA 2CRIA 4JKNA 1FNGA 3NAAL 2Y24A 2YRPA 1XMEB 4P2OB 1MCBA 1G6RH 1T2QH 1OAXL 3GK8H 1IKNC 4HLZH 4BQ8A 2FECI 4GNKB 3VXNA 3RNQB 2EXSA 3AT8A 2E5EA 5MEPB 4UM9B 5T1JA 5D7JB 1FVEB 2QMJA 3C9NA 2IH1A 3I3DA 1EVTC 2H1XA 4UB0H 1JCKA 4ODHL 1H8NA 4JHVA 2N01B 3OHXA 4KX7A 4HJGB 3KYKH 4NDMB 1YEHH 2QQLH 3VSTA 1NMAH 1Q8MA 1ZXKA 3UH8A 2VLME 4XN1A 4YIQB 2J21A 3QDGE 1KV7A 1YEDB 1VGKA 1KGYE 3BIKB 1KELH 2PYED 1I8IA 4EXPX 3L3DA 5KYNA 4DP4X 3WNOA 1JCVA 2EVGA 1J0HA 2E8YA 1SYSB 2Z6FA 2DKMA 2YKLH 3BP5B 4KTYA 5GZNA 2D31B 4OQTA 5J5EA 2VTFA 1DVXA 4HSCX 1J5HA 2QQNL 3RY5A 3B7RL 4LSSL 1TNNA 2V6HA 2X3AA 4NI6A 5C0DB 4XP9H 3TO4C 4KNSA 4HISA 2YEQA 2E7BA 3ORJA 1X9UA 2GSIA 3QI9A 4QMEA 3NCMA 2Z92B 5FUZL 1F18A 1AQKL 2CIIB 4M5SA 1FFOA 1S7WA 3OXRA 3KLSA 1KGXA 2X1WL 3WN5C 2BNRA 1H3GA 4JDEA 3WLBB 3DRQA 4GBXB 1NJ9A 1KXHA 2DQEH 4RX4A 1E28A 1GYUA 1KJVB 1E3ZA 1HL4A 1Z9NA 4MVBC 4PCYA 4WGKA 5FGRA 1WGVA 2BS8A 4WUKH 5FYJE 3T04D 5DSCB 3OV6A 5CJ8A 3ASOB 4JHWL 3UADA 1RJLB 3OJ2C 2YGOA 2YXVA 4N2FA 2X1XR 3ARFC 4NZTL 4OD3L 4X6FA 3VFTB 1MFBL 5IVXB 1W72H 4DK6A 2ZYSA 1XAKA 3C5JA 1FYTB 5HDBF 4QJ4B 3UYPA 1EEZA 3LKQA 4QRFA 3P4MA 2FIKA 3C6SB 3QUYA 3HE6A 2PETA 2R83A 5D6CA 3KWUA 3H4HA 2QJDA 2XZQH 2R56H 1TTCA 3F7VB 3OR6A 4ZOEA 3I2CH 4KZEL 4XP6H 3FFDB 4A38A 3VQ1C 4XZUA 3IRPX 4GG6B 1NFIB 1A14L 3WN6A 3KW8A 4OZHF 3K2KA 1UCTA 4GAAA 4WFED 4KUCF 1KFGA 1RFDL 4WV1A 1HKFA 3UTTD 1PX8A 2H32H 3HUJE 3WSQH 3ZTJH 3KGSA 3I6GA 3V0VA 1LO3L 4WEBH 4YXHL 4R96A 2AJUH 5L88L 4MTMA 1JPTL 2CKBL 2PCXA 4JVUA 3UJTL 3P73B 5B7MA 1Q94A 5GGVH 3GSOA 3RX9A 1N5YL 1ZIAA 4LASL 3FO2A 1KEGH 2WXQA 1N4XL 1WBXA 1F4XH 1KIQA 4JKPL 4P5KB 4UWQB 4XMVA 2HTLC 2HLFC 3OAYH 3NG5A 2E27H 4XC1L 1SXSA 2IPKA 4JDZA 5EORH 4JCLA 1G7LA 2LVEA 3N6YA 4U4BA 5AAMC 3QUYD 5GZOC 1TTAA 1I4FB 1NMCC 3D2UB 3EYSL 4UQ2B 5GGTL 3WY2A 4J3UA 2MOGA 3QR0A 3S2AA 7TAAA 5K69A 3HG5A 2ATPA 3B5GA 2WAQA 3LDBB 5F8QC 1C5DB 4QHMA 4XWOD 3BEVA 4OKDA 3EW3B 2P5EA 1D5MA 3B3BA 3Q0HA 4HOWA 3QXTA 4L3AA 1JWMB 1GIGL 4KWUA 3DO7A 1BJ1H 2C7UA 3S36H 5B39B 2HX9A 3B9KC 5AB1A 1KOAA 3DSFL 1U4FA 3NFPA 1NKOA 4JDTH 4ZI8A 4S10A 4Y0GA 3AABA 1IKOP 4RDBA 2GTQA 2IC2A 1PIFA 4Y4KC 2W9LA 3OHXC 4X7EC 3NCYP 1OF2A 2AK1H 2IO5A 4I3RH 1NFDA 4FCHA 1NC2B 3WY3A 1HHJA 1E9OA 5ACZA 5H4YA 4TNGA 1YAIA 3FTUA 3G9VA 3T6VA 2Y5QA 1KG0B 2UXTA 1EFXB 1RUAH 2GVYA 3H7BB 1GGYA 5FX3A 4ADIA 4JX0A 3S3BB 1BPLB 4U3XA 4LAQH 3QXUA 4LNRA 3FUHA 1B0WA 2Z31C 1BAWA 4N0UA 4D0CB 3OKOA 5E00A 1AFVH 1HSBA 2XYBA 2XZAL 4L8BB 3AAZB 1CL7I 4IHOB 3DX6A 5CM1A 4O9HL 1PD0A 2JV6A 2WKGA 4DKEL 1ZOXA 3KGRA 2EIZB 3B9DA 1LO2L 4M62H 4O2CB 3QAZC 4TNWK 3K5SA 5C3TA 1SBSL 1URIA 4PJ8C 4CSPA 3QZBA 1F58H 3AS3A 5D1XC 2WMPA 1CL7L 4XZ4A 1KY6A 3BH9B 5T1MB 1MVUA 1R4XA 1DJWA 3ZE2B 4MNQE 3C5SA 1K2DB 1KLGA 5I66A 4M9OA 1J5IA 1BLNB 4M93B 2F53B 4XVTL 5SWSA 4WW2A 3AVEA 1PBYA 5K9JH 4PB9H 4CN4A 1CLVA 2CHWA 1G0DA 1DBKH 3GTNA 2PWDA 1F1AA 4QRPA 2DKUA 4A6YH 5I15H 4X8XA 1UENA 3TBCA 3L1FA 4U1IB 4P8QA 4KTGA 5FDWA 1W72A 2J2ZB 3O6FD 2J5WA 2FL5B 1C16B 4LP5A 3R7RA 4AGOA 3C6LC 4EUPB 5E8NA 1E27A 4FXTA 2PTVA 3V0WH 3ULVE 3BUBA 5FGCE 3D3VD 1FDLL 5T1LA 1AR2A 3R19A 1JDAA 3V0HA 2H0JA 4WW2B 1GA2A 4HF5L 3FTWA 4AEEA 2EXYD 3K2UL 1CC3A 2EC8A 3V6OE 1RZ7L 2DLFL 1T22A 3AT9A 5TQ0L 3FB7A 4ODXB 1QEWA 1KB5H 5T5NG 5CBEA 4Y9EA 2DOCA 3JWNH 5F3FA 3MXVL 1QBML 1LDPL 3HC3H 3L7FA 1FJ1B 3DI3B 2P3YA 2WIMA 2GBAA 1W16A 2BIIA 3FUNA 3JWOC 3LN5A 4QF1B 5IMKB 1QLEB 3QS3A 3FSAA 3GBDA 4FGMA 2PTTA 4I18B 2HVJB 2B1HL 3V0WL 4JM0A 4KKLC 4X0NA 3STZB 3FU3A 1V7ML 1U91B 1KBKA 1NGXB 2L3BA 4N2KA 2JK5B 4DVRL 1IZJA 4M6NH 4PYGA 1RIHL 4ZBJA 3RWIB 1XXFC 4TVPH 5FB8A 1B88A 3EBGA 7PCYA 1YDPA 5ICZB 1OCCB 2OMUA 1WBZA 3UTPE 1NAMB 1WCQA 4YR6B 3ULSB 1A3LH 4XCEA 3UMTA 2D0HA 4JO2L 1JZ4A 1AD0A 2WXFA 3W82A 4TSCH 1JF5A 2E7DA 4MHHI 2O61A 2NSXA 3NZHL 4HPOH 1U8CA 2VXQH 1UYWL 4UIMA 2H3KA 3W2DL 1SQ2N 4HYTB 4N1CA 2G30A 4NQVB 4RSYA 4HXAH 1X5MA 4NQUA 3KDPB 1I1AD 4Z7UA 4YSTA 2JVUA 3BP7A 5ESQB 2ZXQA 1FGNH 5DJ8B 2HRPL 4X5PA 4C56D 4MSWB 4HJIA 1HILB 3RUGF 2JK5A 4OZFB 2MQCA 1LMKA 1KEMH 1QBLH 3ARGD 4JO8A 1UA3A 4MZ3A 3MUHL 4PMEA 4WUUD 4NUQA 3EHBC 1NTDA 2XG5B 4FC3E 2P47B 1A1NA 2ADGB 4XNZC 4JFQB 2DQGH 2XIDA 3C5ZD 4YO0A 2Q8BH 3LOWA 5HHOE 3GSXA 4XXDB 4I88A 4LSPL 1I82A 2AMUA 2WZ6A 3UTZA 3GIVA 5IQNA 1JD9A 3DHUA 3RA7H 1ICTA 4OT1H 5F1NA 3VGAB 4KTEH 4LEOB 4P4KA 3O4LE 4L3FA 1Z6JT 4YHKH 3DMMB 4FQCH 2A0LD 2XFXB 4I18C 4PJDA 4PW3A 5JQ6H 1WZ1L 4GKNA 1E67A 2G2NA 4Q9BA 2GPZA 3HI5H 4R4BA 2X2UA 1RZPA 3K6NA 1S3RA 4W9EC 4CW1B 3VXOB 1OM3H 1EERB 1JNNL 2IWGA 2EIDA 1Q9LB 4AUJA 1PG7X 1BVNP 3B8SA 5ADPL 1QW9A 1S78D 3MVSA 2Q3AA 3LEYL 3FUIA 5I8OH 3THML 5L88H 4AKQA 1E5YA 3VFSB 5IJCC 3T0XA 3MRCB 3VMNA 3MNWB 5DHVB 4A6YA 1SZNA 3ZKQD 3WO4B 4ZPTB 2BSED 5IT2H 2QDWA 5E2VL 2R69A 4MB3A 4KROD 1ZT7B 2VIRA 3NJKA 4MXVF 4BFIB 4IBTA 2YZ8A 1A9EB 1HH9A 2BFGA 4G6KH 4MXQD 4J3BA 5E2WL 3MUGB 5FV1L 3KPRA 5F9DC 3MR9B 2C5DC 2GITA 4IU2B 1MCEA 2K7QA 4QUOA 3V0JA 4D9LL 1O7DC 4ZFGL 4OUUB 4HH8A 1HVXA 1AS6A 5BJTA 3IDUA 5MERB 5JOPE 2AJYH 3BDYL 5DUML 1P84J 3DHPA 1MFBH 2F1EA 1XV8A 1Z5HA 2YQ3A 1QFPA 4RRPG 2BXZA 3TLRA 4WWPA 5AVQB 5C3IA 1TKWB 3MOBL 5BZWB 3W0WA 3O3BA 3BGAA 4OLWL 3TBYA 4G9DB 4PRNB 4MA7H 5I1IH 1FNLA 1J9TA 3EFFA 1T0NA 1IKFL 3S37H 1LGVA 4BIKA 1TLKA 1PKQA 2YUXA 1IVLA 4WVRA 3DIFA 4GIPD 1JGDA 3WKPA 4AX3A 1Q0YH 3UO1H 1T04A 1NCCH 3QUML 5CU9A 5D7EA 4ANXA 1KTLB 3NYKA 1OWRM 3KLHD 1DYZA 2XN9B 5TTRA 3O3AB 3ATEA 2VWEC 4Y5XC 2ADFH 2GEQA 3UGUA 3U46A 2HVKB 1IBBA 1A47A 1U0QA 3JV4B 3U2SA 3AGVA 5C0FA 1YO4A 5D6DA 5D2LB 5I5JA 4K9EH 1RUKH 1FZMB 2W5PA 1CICA 4DKFH 4F7KA 5DYOA 4YWGL 2ESVB 1JFHA 4MD0A 3BUDA 3VFOA 3JZ7A 8FABA 5LQBL 1MNNA 3SGKA 5A3ID 2LU7A 1NEPA 4AQ1B 3MREB 5F1IA 4Y2OB 2BFVH 1OHQA 5C70A 4CU8A 5I6KA 5IW6A 3WS3A 3FQUA 5JPNA 3ESOA 4LVHB 1JFQL 3ZGHA 5CCHE 3IK2A 1MI5A 3QJUB 4KMLB 3L3OA 3SYQA 2LLGA 4BKSC 3K5RA 3CHPA 4Y19B 1ZHNA 3KYMB 4PJCE 4N20A 1DDHA 4HK3J 1TSHA 5EC1A 2MMXA 1ADQL 4KJPC 5KTEL 3TA3B 2WXIA 3G6JF 2VLJD 4Z7UE 5C9JA 5F3HA 1TJHH 4ANKA 4DPRA 1IM9A 4FTVA 5HJBA 5AG8A 2W60B 4POZC 3CCHA 5ISZE 3EBAA 4PWFA 4HUXA 4LF3A 3P0GB 4RBPH 5FPIA 1ETJA 1WHOA 3BFQG 1F3JB 3D0LB 5IF0B 3VXRB 1J5OL 4LSDA 1CT8A 1IAKA 4LGRB 2E75C 4HDIB 4YEEA 3FRPB 1I53A 4NQED 5I8EB 3X1BA 1CZ8L 4ELDA 2DLFH 4I7ZC 3KPPA 3GHBL 3DIDA 1AXTL 4ETQA 2PCYA 5TFSL 4FNTA 4ELMF 3S5LB 2WXLA 2LTQC 3GRBA 1CFSA 1NL0H 2YRLA 1KCLA 3H56A 3Q6GL 3CLEH 5DEFB 2AW2A 2DM2A 1JZ2A 2VITB 3N0PB 4Y5VA 5TE7H 2ZUTA 1M7DA 2WQRA 3CVIH 3DOSA 2EYSB 3RNQA 4AIZB 5I16B 1I1FB 3WJMB 3SPGA 3TH3T 3DMMC 2VKXA 2Y07L 4W6WB 2QVMA 1NKRA 5FDYA 3EF7A 3B83A 5HYSA 1GYWA 2AK4E 3ASNB 4XOBA 4UQ9A 2ZONA 4UAOB 4FNPA 3SSGA 4W4OA 3MRJA 5IW1B 1OGAD 2E76C 4QRPD 4WI5A 4TSBH 4H1LB 1EJ6A 1MFDH 5C2BH 4NZUL 1HINL 3EO9L 5JXEC 1PKQB 1ETA1 1KXTA 2EE6A 1TTFA 3NCBB 4XRCA 4WFGE 4DEUA 1HCVA 4W9JC 3FOMA 4ZUSB 3TH4T 3MJ7B 1LK2B 1SHSA 2JIXB 3KYOB 4JO1L 3VE0B 4KO9A 5C6WH 3WUWG 5MEPA 1GOFA 3MBXL 2X7LB 5E7BA 2E9GA 3T0DA 1FVEA 3I6GB 4RMTA 3TBWB 3V0VB 2BNUA 2L04A 5TQ0H 3U4BL 4LMQE 2VDQB 1TIUA 4R0LA 1KYOK 2AQRA 3NSCA 3FU5A 3QDHA 2X6MA 2DL2A 3WIIL 1RIVL 2Z1PA 1RKRA 2EH8H 5J1AB 4IBUA 4O51A 5J57B 1F56A 3WN5A 1RSYA 3AREB 4PLNC 1W15A 3ABKB 4GQ9L 3RY4A 5TK4A 2Z92A 3A4FA 1OGSA 2P8LB 4PBXA 1UFUA 5FOBA 1OM9A 4HJJL 4I2XA 5I5IA 4LOUC 5ESAB 1QI4A 4PJAE 1NOAA 3VD3A 5F88B 2AC0A 1JWUB 3D39A 15C8L 6FABH 1A4KB 3F5WB 4AQAB 5A7BA 3FZUD 3G04B 4G8FA 2VO8A 3BEVB 3GLDA 4HK0A 3NZSA 5BRZB 3DVFA 2AV7A 4IRJA 4EOWH 1YQVH 3VQMA 4IGBB 4BKLB 1D5ZB 3IE9A 1IEHA 4UV7H 3MLRH 2F74A 5T5FL 1IGTA 2BVTA 2Y3NA 1TG8A 3CXDL 3PREA 4KI5E 3SIKA 3ARDB 5AFAA 4ONHA 5CP7A 1DUZA 4IBSA 5E08L 5J11B 3QQ3B 3CU7A 5DWPA 3S4SG 3SDDD 2HFFB 3GSNL 3MRRB 1J9QA 3OJVC 3VI4E 5KVMC 4E41A 5B8CA 4F2ME 1I1AA 4JFXB 1T03H 4K8RL 4I1PA 2AVGA 1MN4A 4GH7B 4ZODA 1KC5L 2F5BL 3ARBB 3HKZA 1OAUH 5DVMA 5HYJE 4E9SA 2FEJA 3KMDA 2J71A 2JKJA 3OKOB 2GUOB 2OTWA 5C07E 4XNUH 1QVOB 3F00A 5DUPL 5L6YL 1I85C 5IJVA 5IB1B 2UWEB 4WHTB 3L4VA 3MRIB 1YVLA 2VAJA 1QUNB 4HV8A 4ZK8A 1YSOA 3EO0B 4ZRGA 2QSVA 1YNKH 1JAEA 4S1QL 4UMGA 3OR7A 2J8UE 1XGQA 1ZLSL 2GIXA 5EUOB 4JO4H 5KBMA 5SWZB 1FGVH 4TSAH 3T0EE 3NACH 1QSVA 3TNMB 1F6AA 2ZCZA 3BHBB 3ZKND 3BISA 1ONQA 2Q1EA 1OB1A 3IMVA 4GB9A 2ERJB 3LXCA 3ULVC 4I89A 2ISDA 2WM0A 1D5RA 5E4EC 1ASOA 1II4E 3U9PH 1JXGA 1HTYA 4QHMB 4DKTA 4ZNEA 4LCWD 2Q3XA 3HE6D 3BQUD 3MA7B 2WPGA 1A7BA 2VOTA 2WNKA 4Y1AE 5FYKU 1EEYA 2D3NA 4OB5H 5TDPB 1N67A 1FFPB 2GC7C 2VABA 1GCFA 3DSNB 1YLBB 2DJ4A 3CFTA 1F97A 2YKLL 4LP4A 4X9YA 3CFEB 1M7XA 2AKRA 2QPEB 4PV8B 2WKLA 4MMXC 2FYYA 4JJ5A 2C3GA 1BJMA 5EOTB 5E2TH 1NZRA 2ZYHA 4PD4K 1U8QA 2FX7L 3BQUB 2M2DA 2QTVA 3FFOA 1RK0A 1OGPA 3K6IA 1T2JA 1IC1A 3LRHA 2R2EA 4FLRA 4JB9H 4Y4KA 3LIZA 3FCTB 4MJ5B 5EIQA 3UZEC 4EDXA 1IE5A 1KBGH 3BZ4B 1BVLA 4NYLA 4R5VA 3BUQA 3SPVB 1SF5A 5IB4B 5T3ZE 3DYOA 4GSXA 4YHMH 5JOPD 4PRBA 1J1XL 2IBGA 2EIMB 1I9IH 2I25N 4WJKB 1MCPH 3ZDXE 1OF2B 3PQYD 4J6RH 4W9HC 2QPSA 1NC2A 3UTPD 1SVCP 1RUQL 5F6IB 3VACA 4FXKA 4F1SA 2R1XB 2X4NA 1MHCB 5FO8A 1T03L 4PJ9A 2VC2B 3N44B 3RIAK 4NSKB 2HJFB 1TJXA 4ORGA 4XX1G 2NY1B 3NFNA 2K4WA 4XPGL 2X41A 4PJFA 4IHOA 3QH3A 1UM4L 3QA3A 4IGBA 5DO8A 1HS6A 4JZOB 1OVZA 4NYLB 4JLRB 4ZMTA 1OY3B 4JGMA 1CXLA 2ZX8A 3TCLA 3CXFA 4BE6A 1G1KA 1R3IH 3BWAA 2QGEA 1LXMA 2A1WL 2ZSVA 2WIIA 1X3DA 4UB0L 2P28B 1UACL 4IDLA 3UO8B 3QJSB 2IPKB 1C16A 4H2CA 1QWHA 4JDZB 1WZ1H 4N3UA 4E41B 1AC6A 3Q8EA 1RFDH 3FQWB 1IAIH 2W0FB 1HH6A 4BGLA 5MHSD 3QNZB 4TVPL 3HN8A 4X6CB 5FO8B 2XWTB 3QARA 1MRFL 3LH9A 2GI7A 4YAQA 2D3VA 1IM3A 3AY2A 4LPCA 4HWEL 3CMGA 4PRDB 3ZRFC 1TF4A 4FX5A 1FHGA 2XTJC 2FX8L 5KVGL 4FNUA 1PSKL 1L0QA 4K5OA 4WUUE 3WJLC 2BP5M 2NNFA 2XTLA 3F2LA 1G7PA 4I77L 4R7LA 5MHSE 3DROB 1L5GA 2VLKA 3AU0A 5DTFB 4NFBA 4LKXB 5FO7A 3PJSA 4ES8A 4C4UA 3AS1A 1N5AB 1KCVH 2Z93B 4X4XA 5KBKA 1PD6A 2JJVA 4MQXC 5DO2C 3V52H 5C08E 1C8PA 1IEBA 5E8PB 4TLUA 3Q1EA 1JK9B 3FQWA 4RH4A 4DPBX 4FCAA 1A7PL 1M6UA 1W6WA 3FTXA 1YA5A 1QRNB 3B7TA 4CKVX 4QJ5B 3U1SL 1HAWA 4KPHH 3UZVA 1QNIA 3GHPA 3K72B 4NP4H 1MCIA 4WWKB 1QLRA 5LB1A 3SO3C 3ZDXF 2EUWA 2HB0A 5IFHH 4FDWA 1TJMA 2D73A 2HP4A 1EEYB 2OR9L 2ROYA 3DDGA 4UNIA 3D50A 3CTTA 1LP9E 3Q8AA 5MENA 5C09A 4AL8C 1OARH 1G9NL 3MLUH 1WZLA 3RL2A 4LEEA 5EC2A 5HYFA 5IZ7A 2X44D 4DWHA 2EH8L 1EHXA 3RDTC 4LOFA 4PY8I 1YEJH 5T1MA 4YWGH 3B1UA 4OD2B 2VDPB 3JV5A 3RFZB 3D6GA 3LRMA 3QUXD 3CFJA 4YVNA 4PR5A 4FULA 4BK8A 4FADA 2K6YA 1VESA 4JE4B 2V9UA 2FIRT 5BOJA 5BOZG 3U1SH 4JN2B 4M1DL 5C0CD 5KBLA 2BFVL 4LARH 4YDLB 1YDPB 4U2ZA 2C4XA 2KHAA 2DQCH 2HPOA 2C3XA 3H2WA 1B90A 5BPPA 2KZBA 4AMKH 4NZUH 3EO9H 1CGUA 2BSRB 3LXUX 2J44A 3PAVA 2HKHL 4PTUB 4J8RA 5I18L 4RMVA 1KULA 1T1YB 4EUPA 3OKKA 5EBMA 3HE7D 5AVYB 4YFLI 2W65A 4NQEB 3N3EA 1KN4L 3QW9A 3QG6B 2I9LA 5DRNB 5DJXB 4KU1A 5DZPA 1AIZA 3ALXA 3F84A 3VMPA 4IQHA 1JPFB 5FW8A 4PLKD 4Q9RL 3GXUB 5LDSA 1XB3A 2C9VA 4LGSB 1QI5A 5JNYA 2E9IA 2NUPA 5BS0A 4JFED 2H6UA 3U46B 4HJTA 1ZTXE 3OKEB 5D8JL 3W0WD 4MJIA 4WHYH 3RQ3A 5KYXA 4AQ8A 1ET7A 2NY5L 1QBMH 1XTLA 4TOYH 3GJEB 2CO6A 3HZKA 4TNEA 4N2LA 5L2KD 3OKNA 1KYOJ 3QNYB 4L4VD 4NO0B 3EUUA 3O11A 3BKCH 5E0FA 4F37F 2VDRL 1V3MA 3A67L 1DLHB 4LVNB 5IMKA 3VGAC 3UTQA 2VCOA 1KCRH 2XWTA 3GSNB 3CUPB 3LRSB 4JRLA 1J5OH 4Z0BL 2HLAA 4HIHA 4M7LL 4D8OA 3WAKA 3BIAX 2PO6B 3NCYS 2PW1A 3ZLQC 2HTKC 5GGRA 2IDQA 4Y9FA 5JXED 5CSBA 4NX0A 4DKFL 1IQWL 4DP8X 5AB9A 3NSJA 2R1WB 3VXUE 3B34A 5AYUL 2HLEB 3B2UC 2ZYIA 4AG4H 2IAMC 2HG0A 4ZW5A 5KN5A 5HDBB 2YPLB 3NJLA 5BXFA 2XDHA 1LDSA 5C0EB 3FQXB 4LBAA 5E5UB 1G84A 3CD4A 2FNWA 1JFQH 1PY9A 4IMLA 1KCUL 3G5YB 4L23A 4RBPK 3TT3H 1S9XB 1BQHA 5B39G 2B59B 2J4WH 3V0AC 4QTIL 5G4MA 1URLA 4NHUA 3C5ZC 3D34A 5F9OL 2H32A 1ECYA 4J3OH 3Q3GB 1DFBH 4OM0L 3GS0A 4XN9A 1EGJL 2WTRB 3GLZA 1JVLA 1AGBA 4KDTC 3T0VA 3TC9A 1OAKL 4NQCB 4XAWL 2R39A 3GXIA 2ZAGA 1S7TA 2R1YA 5ES4B 2EYTB 3EDKA 4HUWA 3JTTA 1M6OA 5C7XL 2WWMD 2YOAA 3GMQB 1YNKL 3G5XB 3DIFB 1I8IB 2IAMA 4FNRA 1ZEAL 1MWAH 1JVOA 4D7BA 3MN8A 1AZNA 4H8WC 1E40A 1S9XA 2AJSH 2A9NL 1GPOH 4QT5A 7FABL 2JJSC 4JANA 1IGMH 2YN5A 2HRGA 4U1MA 1V05A 2YFNA 3HNVH 4BBWA 1BVKB 3IFOA 3P4OB 2E0PA 2HVKA 4HOXA 1ET5A 4TPRH 1MWOA 1IKNA 4NO0D 3ZE1B 5A1AA 2B7DT 3RI5K 4F58H 4Q97A 2PCPB 3HHSB 5GGQH 1KIRB 3SE3C 4Q4IA 1VERA 5C92A 2R2BA 4UZGA 5I6XC 4UAHA 1CLOL 3JTBA 3RA7L 4DERA 4L3CB 4F7CB 3IKKA 3L4TA 3V6ZA 5GISH 4ZO6A 1OGAE 2A2QT 4IMKA 3UG5A 2DQUL 4CVUA 3QG6A 4Q6IB 4AYSA 5BS0D 4R3SA 3UBGA 3WUWA 4YHNB 4EOWL 4Q6YA 1LE5B 1P4LB 4UIKL 3TPUB 2A74B 4RMUA 4LSPH 2ITFA 4LNVA 3WFCH 2EZ0D 4KKLD 4AQEB 4HHGA 3BE1H 1Y7VA 1RIUH 2Q8BL 4J6RL 2X9ZA 3L1OH 3RKPA 1XB8A 3KVPA 2A9ML 4HJJH 1BSIA 1VADA 2QSCH 4DETA 2X70A 3P30L 4QXGL 5K39B 1SY6H 3QZPA 4W9GC 5CFAA 1HL5A 1SM3L 3Q2LA 3MRBA 4HKZA 4TUKL 3RWCA 4UOZA 2GAZA 3GDCA 1BF2A 5IOKA 5DO2D 3QG7H 2A6DB 1D6VH 2B4CC 1Z2KA 2P9RA 1A7OL 2G4GA 1FH2A 3SGEH 5IMMB 5ESAA 2N7BA 5DMGC 4KQ0A 4HCRA 4MCMA 5LCVL 2X4UA 5I1GH 4PG9A 3BH8B 1ZK9A 2MNWA 3PYCA 3R8QA 3MOQA 4I4WA 4DH2A 2J1KA 4NJ9H 3JV4A 4XNDA 5KVFH 3TASA 1OT4A 3S5ZA 1UM4H 3L3JA 5AAWC 4ZUTB 1KDJA 3SQOL 5I6XB 4Z3EA 1T0OA 3QWNA 3Q7JA 5HHQA 2V37A 2VW7A 5E4AA 5ICXB 1E4WL 3GBNH 4WLCA 2BOCA 4JFYA 5EN2A 3BOVA 3D85D 4N2CA 1F5WA 2CBQA 3FQ4A 1LP9A 2FSDA 2HAZA 2JB6B 1X4ZA 5MENE 5ID0B 3EADA 5FA4A 1HXKA 2BP8B 4M8RA 4M7KL 1RK1A 4X80L 4BZYA 4HP5A 4P4KC 1DVFA 3JQOB 1MUJB 5D9SB 3PQYB 1QWNA 4KI5D 4M02A 3MRJB 5IB1A 3RTLA 2L7UA 4N85A 5HHMD 1H15B 1JV2A 3CG8A 3DX7A 1H8OA 1RU9H 1KTKE 1HCFX 1PW3A 2G5BA 3FYEB 1DBAH 3SE4C 1Z9PA 2R15A 4R5TA 2PR4L 4QRTA 4F3FB 4N8VA 1UVQB 2VLKD 3MUGA 2Q87A 4P4RA 2YD9A 1NINA 3GEFA 3VE0A 1E9OB 5E23A 3SE8H 5ACZB 4I2XB 4MJJA 5I28A 2ALWA 4XNBA 1HQ4B 4QY8B 1R3HB 3QRLA 4X0KA 1A5FH 1QKZH 3CZGA 3MRGB 1B4TA 5LAXA 5K1NA 4IOIA 4YHLH 5FYKE 3REWA 1G7MA 1U93A 1XF2B 1K8IB 3K0WA 4MQSB 1XBRA 1B6UA 1URZA 4DO5A 3VFMB 4WU7A 5FGBC 3ENEA 4HH9B 1TJIH 2AAAA 4PJ8D 1F11B 3TO4B 4J6IA 1F2XK 1TQBC 3NGBB 3DX7B 1FORL 35C8H 4HBCL 5EZJB 3E38A 2WNGA 4GSUA 4X5XA 3PPSA 1S9WB 3IXAA 3D51A 3IMWA 3EYVA 1IGFH 3MYJA 5DZNA 3WLWD 3HG1B 1WS8A 5J8OA 3HFFA 3T2NL 4UDUA 4WRLA 1EAPB 2DMGA 2FYVA 2X6UA 4CGTA 5EOTA 4LCWA 5C0RL 5D1QC 5I1CH 1MCCA 3CX2A 3SDCC 3BYTA 4LHJB 5JIHA 1O6VA 1ORSA 5C0FB 1VFMA 2P5WD 3RUGB 2PR9A 3F58L 4IK7A 3GC3A 2HKAA 2QADB 3UAAA 3CX5K 4WHTA 1FPTH 5IQOA 2ZXEB 2PPDA 3NK4A 3OQRA 4XXWA 1AZVA 1WISA 4J7RA 1U8NB 5HVGB 4G42B 3FBKA 2V2TA 3E8VA 1NCGA 1BVZA 1O6TA 2O26U 2UUDK 2WBXA 4TUUA 4WNJA 4MJID 4AQ1A 5TK2A 3CZNA 4GXVH 3ZJAA 2O6PA 4HHWA 4ALAL 2ID5A 5DJCA 5SWQA 1FIGL 3U7WL 2BCMA 4RAUB 2F18A 1N19A 2GT9A 3SJVA 3VXSB 4QTHB 3U4EA 4FMFA 4JHBA 1Z3GH 4F57H 2RQEA 2C7UB 5HHXL 2NW3B 4X9IA 1TQBB 1ES0B 1G0XA 4JLRA 2GHWB 3QEQE 1OQOA 5CN2A 2WW8A 4Z7NB 4KDVA 3VU2A 1NCUA 4RGOH 1WC7B 4NO2A 1I8AA 4ZOAA 4EI5D 4Y1SA 1VGEL 2X5PA 2P8PB 3BUYA 1XCXA 1MW2A 1U8OB 1CD1A 4O9HH 3OG4B 2G60H 1NFIA 3ZTDC 4AVJA 1A25A 3MLVL 4XNAA 3QR1A 3ZZSA 1UGKA 4HIJB 4BCXA 4PJGB 4NKOA 4EO5A 5E5MA 2EE2A 1DJIA 4XCNB 3VD1A 1U6AL 4G8IA 3DPBB 1U33A 3CJJA 3UYPB 1A7RL 1X5YA 2VQ1B 3T4YA 2CMRH 3VFWB 4JK0D 2OMUB 1EHKB 1KJ3L 2CHXA 4GG8A 4KKBD 5CUSL 2Y4SA 4GSRA 1GZHA 5DYFA 4EZKA 2APFA 4X5LA 3Q9QA 3L48A 3DROA 3BMWA 5TPWH 1UWGH 6PCYA 1TOXA 3JWOH 1Z1WA 4YXKL 4MQXD 1FGVL 4C58B 4TUOB 1IGYB 5IMOA 3MNMA 3MI6A 2CUMA 4IKNA 1MQ8A 5HDQH 4UT6L 4UOW0 1FCGA 5EU6A 4AL8H 4S2SB 4YDIL 2EACA 4C83B 1Y07A 4XCNA 4KZEH 4G7YH 2F9BT 3FN0H 3EYFB 3IDMB 3RJQB 4Z5RA 3P73A 3CX5J 4UIKH 2Z31B 3BP4B 2JE8A 5DZOA 3MGTB 5AW0B 5KSAD 1C08A 4UM8B 4WWKC 4ZMAT 2XG5A 4B9GA 4GIOA 4Z8FL 4NUGH 5IWLC 1S9WA 4R9HA 1Y0LA 4NQDD 3VXSD 4AKPA 1E6JH 3FOLB 3GMNA 4N0RA 2CE6A 5DZJA 1J87A 1AJ7H 1EZVY 1UA6H 4UT9H 2CKBH 3ZUCA 5LUMA 1VJSA 3I9GH 1EXUB 1RJCA 3D4GA 3FAWA 1P1ZB 2YJQA 4XMTA 1OB1B 3DVIA 3LRGA 1SOSA 4TPRL 4V11A 5DUPH 4S2SA 5FLVA 3DTUB 3ZO0A 4EI5B 2OJZL 3ETBF 3ZZ1A 2AI0H 3QJHA 1ACCA 3GS4A 3NFPB 4KVNL 2WXMA 3BVWA 1KDIA 1VCBC 3TCLB 3QFJD 3LRLA 3MTRA 3HRZB 4O02A 4X6BA 1KIUA 3QDMD 3VSQA 2ZWLT 5HBBA 3GSNH 2OX5A 5D7IB 2LAGB 3S35L 5KJRH 1U9KA 2BC4B 1NWOA 4N2AA 4GRMB 3VXUD 1DJZA 2X89A 3ATBA 4X50A 1A7QH 2DMHA 2BWIA 3JV0A 1A3LL 1HH9B 1TITA 2J7LA 1UD2A 4JBSA 2X6AA 3BQUA 2ZUYA 1S4IA 5C0IB 2PPEA 3VXSA 3POHA 2ZX7A 1BZ9A 1ETB1 2Y2YA 1V5JA 4GFXA 2CBTA 2CUAA 5F9OH 3N1MC 4ZNCD 3DHMA 1E9QB 3QPQD 4EZJA 2F74B 5I1LB 3D0AA 2EDNA 5I73C 2WP3O 3BVUA 1WT5A 3EYQD 3II3A 4PRBB 3L2LA 5DQ9A 2BIHA 3PJSB 3GJEA 4Y4FA 1Z9LA 4NO2B 1WWAX 4L4VE 3SCMD 1OAZH 4C4KT 1M71B 1QR4A 4K2UH 3LAFA 5DK2A 4MD5B 3PL6D 4M1GH 5MI0B 2BC4A 3O3EB 1UADC 3FQNA 5J1SC 5CGYD 1C1EH 3LH2H 2ZKWA 5EU5A 3QG7L 5HI5D 5H8DA 1C5CL 1EVUA 1DCEA 3A6CL 4OLZL 1YCSA 2KQMA 2GSGB 3QZWA 4XNYH 2CSPA 1BZ9B 2O4EA 1D7FA 3PWPB 3OM3B 1PSKH 4OFVA 1TDQA 2R4SH 4AV4A 3DTXB 2V3EA 5EO1A 4CC4A 1ZLVH 1MW3A 3J2PA 4JG1H 3BJLA 1IFRA 2YBRA 3MA9L 4JDVB 4JKWA 4YZFE 3MRFB 4JM4H 5GRJL 1HOEA 3HS0A 4JRYA 3BPOB 2E7MA 4TULH 3DUSA 5DK2B 2BNRE 1YEHL 5IEKB 1IAIL 3L4XA 3KBEA 1UKQA 1IAII 3RGVC 5DMKB 4MZRA 1XWVA 3OGCB 3ZR6A 2X6VA 1ZJAA 3VRLE 3BPLC 1CUOA 3UBXB 1QSED 3KLAA 3MRQB 3RFRA 2ZUUA 3N55A 1N64H 1MNUH 2N7AA 3D4YA 1D5BB 2XQYG 3RX5A 3V6FB 1XVSA 3ZY7A 3DVNB 1QPKA 1TZIB 1SY6L 2H9GB 5KG9A 4P9HH 2YARA 2NNAB 1ADWA 4YR6A 2HWZH 2PABA 3FPXA 3WO4C 1VFBB 3GSWA 1BBJA 4ZFGH 3HG0A 1AO7E 4NHCH 3PGCA 5T1KA 4W9DC 5E8DH 2PP8A 4DUVA 1KB5B 1U95B </