1BXAA

Amicyanin reduced, ph 4.4, 1.3 angstroms
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for interprotein complex-dependent effects on the redox properties of amicyanin.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords PROTEIN (AMICYANIN)
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1998-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bxaA00
1NINA 1DZ0A 2NRDA 2R7EA 4N8UA 4HCGA 4PCYA 4YSTA 1PLCA 4DP8X 1BAWA 4DP2X 1JXFA 3AW5A 1BQ5A 5B7FA 5I28A 2W88A 2XV3A 4YVNA 4YSPA 2YQBA 4DPCX 3UADA 3DTUB 2Y69B 4F7KA 1FA4A 3SBQA 3PAZA 2UXVA 1EHKB 2IWFA 1GR7A 4E9YA 2FT8A 5LDUA 1SJMA 4E9TA 4FA7B 2X88A 3OQRA 2VN3A 3CVDA 3FPYA 2XX0A 2YXVA 1NIAA 3V9EA 3ZDWA 3FS9A 1JVLA 1E5YA 2GC7C 2JFCA 2P80A 1KCBA 3FSZA 3S8GB 3X1FA 4W1TA 2HX7A 2XLLA 4K9JA 3UAEA 3IEAA 4UAHA 3OMAB 1PLAA 2IDQA 4G7RB 2E86A 1QNIA 1ZIAA 4A2FA 1BQKA 2CBPA 2PCYA 4BWTA 3T9WA 1J5CA 1X9RA 2UX6A 9PCYA 1SF5A 3IBOA 3FYIB 2IDFA 4YSSA 3QJRB 2XU9A 3NJJA 3N2JA 2CCWA 3QJTB 1M57B 1AOZA 1EZLA 1L9SA 3DKHA 4X4KA 2BW5A 2YAMA 5AFAA 1IC0A 3NJLA 1NWOA 1L9OA 2MTAA 5I6LA 1SHXA 3MX0B 1AR1B 1KCWA 4YSEA 2FT7A 3ERXA 3NJFA 2QDWA 3TASA 4QKTA 3PCYA 3ZBMA 1PY0A 1IKOP 1SHWA 5E9NA 2ZONA 1AZUA 4QLWA 4M4RB 1ID2A 4DP4X 5B7MA 4KOBA 1ZV2A 4HZ1A 1RZQA 2X87A 2XV0A 4GP4B 3CDZB 2Q9OA 2YAFA 2DWSA 3FSVA 1AZBA 4YL4A 4AKOA 2IDUA 1OCZB 1PNCA 4AX3A 4E9VA 3WKQA 2TSAA 1GS6X 4JKNA 1IUZA 4A2GA 1N68A 2XXFA 1SDDB 1T5KA 2HZHA 2H47C 3G5WA 1J9SA 1L9TA 2YARA 4BDVB 1QLEB 5D4IA 3NSYA 1AZCA 1J9TA 2A3TA 2WO3B 1N70A 1V10A 1TU2A 2YAEA 5F7BA 1JVOA 2FTAA 1OF0A 8PAZA 1GYCA 2BWIA 2PPCA 2HLEB 3NJNA 4P5RA 1HAWA 1L9PA 1HAUA 5B7EA 2LLNA 1W6WA 2FNWA 3H4HA 2EIMB 3EH4B 5A7EA 2XVBA 1CUOA 1KYAA 1E30A 1BQRA 4YVUA 3ABMB 1UATA 2Y1AA 3QQXA 5TK4A 1NICA 2OJ1A 4W9ZA 1A4CA 2IAAC 2B08A 1NTDA 2XYBA 1KV7A 1W8EA 3C75A 2XXGA 2YXWA 5F7AA 1J9RA 1OV8A 2XUWA 2CUAA 3T6XA 3WIAA 3QJSB 2VW7A 1NPJA 4YSAA 1AACA 3PLYA 4GP8B 1WAEA 3TA4D 2PPFA 2PPAA 3QJVB 4A66A 5I6OA 1AG0A 1GS7A 3WI9A 2QPEB 2GSMB 1JOIA 2CAKA 4TXVB 1BXUA 2EIJB 1MZZA 4P5SA 2N0MA 2DYSB 2ZOOA 3NJKA 3UGEA 1NIEA 3H4FA 1W6LA 2IDSA 4E9QA 1ASQA 1MDAA 3NJIA 3FU7A 1FWXA 3FPXA 4KO7A 5EHFA 1AS7A 1PZBA 1AS6A 4E9SA 4KO9A 4CSZA 4HHWA 1JZFA 1RKRA 3FQ1A 4L0PB 1ILUA 4WTQA 4HCIA 1A8ZA 2IH9A 1PAZA 3WNJA 2HX8A 4E9XA 2W8CA 1XMEB 2EILB 5D4HA 3X1NA 1JXGA 4BDVA 4AI7A 1VLXA 1NDTA 4YSDA 4NB7A 3ABGA 3NYKA 2BP8B 4Q8BA 2IDTA 2JXMA 1ET7A 2YAOA 2YAHA 5D4JA 3AG4B 4PAZA 1ASOA 1CC3A 3NSCA 2PLTA 3JT2A 2VSKB 4ENZA 2FQGA 1OCCB 1NZRA 4HALA 4KNSA 2BHFA 3WNIA 3NP4A 3X2QB 1TEGA 4Q89A 4DPBX 5ANHA 1AIZA 1BYOA 2AZAA 2UX7A 3RYMA 3MBWB 2FQDA 2OCCB 1A3ZA 1ASPA 5PAZA 1KBWA 2BP0B 2EINB 3X1BA 2DYRB 2UXTA 4RH4A 3GDCA 1DYZA 5B1JA 1MG3C 5I6PA 1M56B 2I7SA 3CG8A 4G7SB 1BYPA 1NIFA 2ZWNA 1PZCA 2H3XC 2ZXWB 1ZDSA 4A67A 4YSCA 3ABLB 1QHQA 2BW4A 6PCYA 1A4BA 3NSFA 3ZX1A 4G72B 1WS7A 1F56A 4WKXA 2GIMA 3EH5B 2CJ3A 4GYBA 3ZIYA 1ILSA 1GW0A 4HIPA 4NERA 2VM4A 3EHBB 1SFHA 3OMIB 5B3SB 4GY4A 4BXSV 1ZPUA 4KNTA 5TK2A 4G7QB 2RACA 4KNUA 2J56A 4DP7X 1ZDQA 4ZK8A 3AG2B 4DPAX 1CURA 1TKWA 2BZ7A 4AKPA 5PCYA 3UAAA 1PMYA 4MFHA 2DY2A 4DP5X 4AKQA 3BQVA 2P80D 3NP3A 1PNDA 1V54B 2PPDA 3OD3A 2WSDA 3T6VA 3HEIB 4BXVA 5FC9A 3FSWA 4A2HA 2J5WA 7PCYA 3FQ2A 3FYEB 1JZIA 1PLBA 3GXUB 2BP8A 4KO5A 3SQRA 1JZEA 4M3HA 1NPNA 2BP0A 3ABKB 3JTBA 3FU8A 3QJQB 2AZUA 3NJGA 3H56A 3N55A 5B1BB 3S3DB 4HAKA 1RCYA 1GS8A 1XB3A 3WKPA 3CVCA 3NT0A 4GP5B 1KDJA 2IWKA 2FQFA 1YLBB 1OE1A 2BWDA 3CVBA 2GI0A 2PP9A 3T6ZA 3AG3B 1MZYA 2WO2B 1AS8A 3PAVA 1OE2A 4UANA 2HRGA 2FQEA 1NIBA 1FFTB 1M9WA 3X1GA 4EF3A 2PP8A 5I5JA 1AANA 2QPDB 3KW8A 4F2EA 1OCRB 1SF3A 2DWTA 1KBVA 5I26A 2YAQA 3FSAA 1GY1A 1KDIA 1SFDA 1PF3A 1XB8A 5B1KA 3NSDA 1AAJA 7PAZA 1NIDA 2BO0A 2IWEA 2XV2A 1ET8A 2AFNA 1OE3A 1B3IA 3V9CA 6PAZA 1J5DA 2JKWA 1BXVA 5AKRA 1IBYA 3PPSA 1BXAA 2QDVA 4N4YB 5I6NA 1OCOB 5I6KA 1E67A 3TBBA 1HFUA 2R7EB 3TBCA 2TSBA 1V55B 3S3CB 4DP0X 2HXAA 2HRHA 4A2EA 2J55A 4G70B 2FWLB 2Q5BA 2VSMB 3CZUB 1JZJA 2IH8A 2VM3A 3TU6A 3FT0A 3GYRA 3U25A 2EIKB 3PXLA 2CALA 1A4AA 3EH3B 4G71B 2MRYA 1CYXA 3IE9A 1J9QA 2FJSA 4E9WA 5IY5B 4YSUA 2H5UA 4YSQA 5I6MA 1KGYE 4KO6A 3WG7B 1GY2A 1PZAA 2XWZA 2OV0A 2GC4C 1WA1X 1ET5A 3KW7A 3HB3B 4F2FA 1AZRA 2UXGA 1WA2X 2PCFA 4E9RA 4YSRA 2PP7A 4YSOA 4UF7C 4NAJA 2AVFA 1WS8A 1AG6A 1JZGA 1I53A 3T6WA 3NJMA 1URIA 2B3IA 1ZIBA 2I7OA 4CSPA 5I5MA 1XB6A 3S3BB 3FU7B 2UXFA 1L9RA 3UABA 3D12B 1ADWA 1IBZA 2BZCA 4HHGA 4FAAB 1E5ZA 1OOWA 4AZUA 4BWUA 1ETJA 1L9QA 1A65A 1E65A 1PCSA 1AZNA 2YAPA 2QT6A 5B1JC 1CYWA 3NJHA 1X9UA 4A68A 1WA0X 1BEXA 1R1CA 3AY2A 1SDDA 3OMNB 4GXFA 4JHVA 4DP9X 3L45A 3IN2A 2VW4A 4JHUA 1NWPA 3DIVA 4BWWA 2GB2A 2I85A 2DV6A 4KOCA 2PPEA 1JERA 2FT6A 3AZUA 1AQ8A 1RZPA 3S8FB 2AANA 2VMJA 3X1EA 1JZHA 3UACA 2J57A 2XX1A 4DP6X 4BK5C 1MG2C 3FQYA 3OM3B 5AZUA 5B1AB 1JXDA 3EF4A 1GSKA 3SBRA 3AG1B 3T71A 2VW6A 3SBPA 3QPKA 1TEFA 2GHZA 3ASNB 4DP1X 3QJUB 2GBAA 4HCFA 3PAUA 3CDZA 2HX9A 3ASOB 3FU9A 4A2DA 3BVDB 1SNRA 5I5IA 3IN0A
chains in the Genus database with same CATH superfamily
1NINA 1WFMA 3PHQA 1JGUH 2OI9B 4XXCA 4JFOA 3QIBA 1NBZA 1E8XA 2F53A 5JPNA 5D5MB 2RFXB 5KTEH 2M26A 4JFZH 4HWUA 1TUPA 5LXGH 4K2UL 4N5ED 3D9AH 1T5WA 5EUKA 4NNPL 5KUKA 2X1QA 3AMLA 5DRNB 1J1OH 4PVNA 1BFOB 4MAYB 5IVNA 1IC5H 4U1NA 3WO4B 2HT3C 2PYFA 1MCRA 4NO5B 1AHWC 1NC4B 2YD0A 2ICES 2P43B 4E9TA 1ZS2A 1ZA3B 3CXHJ 3U48A 4D2NA 2HVKA 3VXPA 4OZGF 3FCSB 1HL4A 1NM4A 1NIAA 5EN2B 3FS9A 4OZ4B 3ZMRA 2JFCA 4N2LA 3HE6B 3UAEA 3D69B 4TNVK 3ULUE 3PP4H 4G7RB 1CB4A 2BSRB 1JVKA 4KX8A 3MO1A 2XG5A 5DA0B 3QXAA 1ZLVK 1C12A 5AUMB 4NFDA 4U3SA 2NNRA 4FFYH 1G9NH 4PJXB 5D5MF 5CBAA 3N91A 3BGMB 1GKEA 1UD6A 1SM3L 4Y89A 1OAKL 1YNTA 4S11A 1XGQA 3US9A 3LEVL 1N4XH 3ZDYE 2ZAIA 4G59C 1LNUA 3SKUD 2QKSA 1R19A 2D3NA 2DQTL 2AGJH 1U95B 3NJFA 4XMLH 5ESAA 1SXZA 4FD0A 2V2WB 3UMNA 3ZL4L 3H6JA 3QEGL 1PY0A 4XVSH 1H9VA 4OLXH 2YGOA 2WWKO 1J5IA 1F97A 3IXAB 1F5WA 1D5XA 3RWJA 3VI3B 3ZMNA 1YEDB 1ID2A 3WTSA 1E5CA 2IV9A 3PWPB 3H9SA 5J0BA 4L1SA 4K5NA 2OMVA 1YEKH 1CFNA 4YBLC 1RZQA 4GG6B 5E1AA 4I18A 1WHOA 1IEAB 1N5AA 4CVZB 4X6DA 1ODAA 2Y23A 2DWSA 2GT9A 2WUCL 3FZUC 4HIEB 4PY8I 4FZ8H 3QYNA 3MRMA 4DCQB 1CL7L 4L0YA 1M3IA 3FQXB 3RTQC 4E9VA 3LRHA 2CDFA 2G75A 1MW1A 1YZZA 4N0FB 2FK9A 2Z93B 4WVRA 2C4FU 2DLFH 4OZHA 5T3ZH 2RCSL 4LKCA 3TV8A 1KBGL 3KPOA 5DWUH 2BS8A 2J8UB 5J06A 3BDXA 2F58H 2GTQA 1V7MH 2ZOWA 1K8DB 3QUYC 4O4YL 4XMZA 5HI3D 1NGQH 1Z5LA 2CJUL 3QDMA 3UO1H 4EI5B 5DEGB 3BUPA 2QSCH 5D1ZB 3E6FB 1CF1A 2CM6A 5FV1L 1A64A 3EW3B 1EAPA 1LP9F 1JMZA 1XF1A 3MCLH 4ZOCA 1YYLH 1H9DA 3CLFL 3ULAB 3BAWA 2P1YA 1ZAGA 1SOSA 3EO1B 1OQXA 2LLNA 1UM4H 4NZJA 2MOVA 4QCIA 3VFWA 3B2UD 5D6CA 4J4PC 4NRZA 2HRLA 3CN0A 1U3HB 5E1QA 1SVBA 1WITA 2R0ZH 3FDWA 4NQDD 2B7DT 1U8NB 4Z7VF 2WPGA 4IOFD 2IGLA 3EUUA 1P69B 5C08D 2Q8BL 5ES4B 1OF2B 5F88A 1ZA3A 2QTEA 4PBVC 4KZDH 3QNYA 2Z7WA 4PJ8C 5HDBB 4TVSa 4HLJA 3SD5A 3N44F 4ZZKA 2BOBA 4ZOAA 4W6XB 1J9RA 3MRBB 1V3JA 3F7PC 1OAQL 2WLHA 2ZX5A 5KUMA 3SJVD 2E7MA 4Y0GA 5L9DL 1QWUA 1F4YH 5JHLH 3POHA 3WFZA 1KYOJ 4B95C 3CFBA 4JHWL 5C0AA 3UBXI 5I6OA 1LMIA 1T0MB 3MO1B 1WV7T 5C0JB 5E2TH 3MRGA 2OYKA 1RP8A 4BD4A 2DQIL 4TUJA 1JZ5A 4KZEL 1S7RB 5DVPA 1GH7A 4NUMA 2XACC 1FZMB 1IILE 3VFTA 4M62L 4NJAH 2X4SA 1PDKA 4PLJD 5FYLL 1R17A 1Y18A 2JKIS 5K9QI 1RU9H 5CJOL 4Y1AA 3A5VA 2WP3O 2H7WA 3FPXA 5E56A 2R2EA 5H4ZA 3E8UH 2MOQA 5MP6L 4E9SA 5EZIL 3US0A 4G7VH 3DX6B 4HHWA 2VR5A 2BNQE 5ENWB 3CCHA 2MNWA 2Z4QA 3GRWA 4RETB 5FYKE 5AYUL 4BFIB 1BZ8A 4L8SA 1V7NL 1A5FL 2VISB 1PIGA 3WHE1 2O61A 4U1JB 3WTUA 3VGHA 2C3VA 3D07A 3SHSA 1VLXA 3HUJA 4MJID 5EO9B 2BP8B 3ATBA 3MLVL 1B4JL 2RR3A 5I0YA 3PU7A 5SWSB 3FUKA 5DMGC 3HCVB 5AQ0A 1S9WB 1MFMA 3B4NA 4CU6A 2HJKA 4J3OD 1IX2A 4Y5XB 1AGEB 4DUWA 3Q8BA 5DZ9A 3MLPA 4H1LG 3AU0A 5I24A 1EEQA 4PJBA 3MGTB 5KBLA 4HS6A 2ADIA 4JMXA 2BVQB 1TEGA 3RWFB 2ZWKA 3K80A 3EDJA 3TZVB 4FZ8L 3S8WA 2E6PA 5C2BL 4J3TA 3V4UL 2F1BA 3IU4L 3L3HA 3UJJL 2MPAH 4FJZA 1NKGA 4PSRA 2BNUB 2PTTB 4XB7A 3DURB 3GZKA 5ICUA 1RJZA 2W65B 1BZ7B 4X8CA 3ZDXB 5J89A 3S9DB 2XI9A 4GUCA 5GGSA 4GOSA 4L3EA 3HG1A 1KJ2B 4A6YB 3TBVB 1NCUA 4ZMPA 4IIQB 1IGFL 3ARDA 4KKLD 3VQ1C 4J12A 1ZWIB 5AZEH 2AJYL 5MEOA 1UUNA 2F54E 1XCWA 3ETBJ 3I6GA 4XHQA 5C97A 1G7LA 1A4JB 5DMIL 2OP4H 4FNUA 3HVDA 1JK8B 1WUZA 4AC4A 1IEHA 4QXUH 3BH8A 4N87A 2QTVA 3GBNL 1ZPUA 3MLTA 4ODTL 4PJCE 5C0CB 3MN8A 2VMFA 5E8EB 5AB1A 1DVYA 2J44A 3B8YA 4DPAX 1MAJA 3CVIL 3QUGA 1CURA 1OY3B 4HSQA 3O9WB 1ECZA 3QFJD 3GDBA 1D9KA 4ODSL 1QLEH 3VFRB 2F74A 3KGUA 3CBRA 4HUXB 3UDWC 3FQ2A 3P0VL 3OF6A 3QISA 4PD4J 3CZNA 2H1XA 3QYCA 4KY1H 5AVQB 5MEQA 4OH2A 2GEEA 4JZJB 5KOMC 3OB8A 4LLUB 4XNQA 5D93B 4FN0A 2R4RH 2FJFB 2E8YA 5B1BB 1FZJA 2VXSH 4K15A 4YL9A 3V52L 4XX1G 1MHPH 3M7FB 3N40P 2HUHA 3HB3C 5D7SL 5EO1A 4M03A 4EOWL 5BUGA 2FHBA 2H6PA 2ZT9C 5D1ZI 2NW3B 5DHMC 2R0LL 2X4TB 4OV6F 4W9DC 1MY5A 4KRPC 4LVOB 2Q7YB 1LTXA 1M9WA 3HUJB 2DWEB 3NZHH 3S35X 1R3JA 1AANA 2CKBH 5A6LA 1JK9B 1UYWL 4ABQA 1U8MA 2FJGB 3KNBB 1PF3A 3HMWH 4TOYL 1IAKA 1W0WA 4P5KB 4UV4L 2EE2A 1YPZF 3CC1A 5IQNA 3MRIB 2AQNA 3GHEL 4JGMA 2LVEA 3U4BL 4PJBB 4XO8A 1E4KC 3WEBA 3X17A 4BGDA 5CSZB 3RB7A 3KZ8A 4AENA 3UTPE 1RULL 3ULSA 1KB3A 1D6EB 2QR0A 3IWVA 4A7SA 5F3HB 4NIYE 5L88L 2VR4A 2CBTA 4DTGH 1AD9B 1VCAA 2A4EA 1PLGH 4JFFA 4OM1H 5KSVA 5J5EA 3E1F1 2NY1B 1HSAA 2DBLL 4UQEA 4G9FB 1MH5B 4G8GD 3CFEA 2GKIA 4ZXBA 4O51B 1B4RA 1FZOA 5IB2A 4AGLA 3ARGD 2H9GA 3VMOA 5E0QA 4FTDA 4QIRA 4LSTL 4ZFGH 1S2EA 4C59B 5DUJA 4OF5A 3KWUA 1KJ2A 1Y6MR 3ECUA 4J8QA 3O4OB 3DA0A 2A4ZA 3IFOB 2H8PB 4I1RA 1NLBL 3S5LA 5FA3B 5JR1L 3QP3A 4J23A 5AB9A 2FHFA 1IZKA 2F5BL 4WO4A 3ZN6A 1QASA 4YSQA 5C0AD 2VDMH 1E28A 2P8LB 4GLRH 2XWZA 1MCNA 3FTXA 2G60L 1MJ7L 1AJ7L 1AZRA 2AXGA 1SJVA 4AITA 5F89B 1MWAB 4IRSA 4UF7C 3WKYA 1SBSL 4HT1H 1RJLA 5AW7B 5DU7A 2W0LA 3D4GA 4P2QE 3TVMD 5GS1A 1SXCA 3F05A 1JZGA 1I53A 4R26H 2BY0A 2Y5TB 3UYPA 5KJ4A 3DYPA 5DMYA 5HHXH 3QEQE 4Q2ZA 4GIAA 4NNXB 4E0RA 2VR9A 1SJEB 3QQ3B 1YNLH 2QGBA 4HQQL 1KJVA 5KVFH 2ZXQA 1E5ZA 4APXB 1NAMB 1XSOA 2NY3D 1CI3M 1JI2A 2NDFA 3L95B 5CIPA 5H8DA 4ODHL 4A68A 1S9XB 1U3HC 1BBDH 3I75A 5GS3A 1UT9A 3ZW3A 1BEXA 1UFUA 2DPKA 4NI3A 5JA8B 4JHVA 1O9ZA 4I0KA 3L1GA 3TJHC 4XNZB 4L5FE 3B2PA 3T77B 4MJIA 1FBIH 1I4FB 1R3LA 1UJ3B 4JO1H 4LRIA 4DGUA 3MV8E 4M00A 4BWWA 3DJRA 4Z7QE 2JKJA 1TCRA 1B4JH 3VH8A 3ZUNC 3BQUA 3IFNH 3VD3A 2DV6A 5M7QA 3MV9E 4XE0A 1DVZA 5F0PB 5HBBA 4TN9A 4DSYA 2E9JA 4I4WA 5E0FA 4BFJA 5ESVA 4BK5C 3QDAA 4MCMA 4XO9A 1MG2C 5C6TL 1PFOA 1JRHH 4AV5A 1BFVL 4XPHL 4CMHC 1U91B 4EI6B 1DUZA 3ASNB 4EJ1C 5JZ7D 4AQ1B 2ZWZA 5IBLD 1AD0A 1FYTD 5DHVH 4Y2NA 5DQDH 4LL4A 1RL1A 3GI8L 4NWUL 1Y0LB 2XFXA 4LNRA 4AQ8A 2VXVH 4WFHD 2YMXL 3V0AC 4HPOL 1JGIA 1S3RA 3PREA 2OJEB 3VD7A 4MJ6A 1EK3A 5TF1H 1RUAH 4R5TA 3ARZA 3K6IA 4P2AA 4BK8A 3IDIB 4OUUA 4KVCH 4DF9A 3ARDD 2LV4A 3BZ4B 4G5AA 1JUFA 2Y6TE 1WT5C 3M1BA 1O7VA 4Y4HC 4HIXL 1U8CA 3RGVC 3L5IA 4AK2A 5DRZB 2R8SL 4Z7UE 1PX8A 3OKYA 1TFPA 5FA3A 3OXRB 5F9DC 5KVGE 2R15A 1Q90A 3QHFL 3BUYA 2R2BA 1XF5A 3U36A 1HI6B 2XX0A 2YXVA 2NMSA 1BZ9B 2P8LA 3HNSH 4BZ1L 1S7WA 4H1LB 4ODUA 5EOTB 4JRYB 5E5MB 3X1FA 3ROLB 2GVYA 3QIUD 2O6EA 2PN5A 4H8WL 1AZVA 4JFQB 2IDQA 4KK9D 1EWHA 1KCRL 3QCUH 2QPSA 1T6VN 1K3IA 4A7UA 4MZ3A 2G4EA 3H3KA 4BWTA 1EVTC 1EJOL 1X9RA 4ZSOE 1JWMB 3IDGB 5DD1H 3VACA 1TJGL 4XP1H 4LLQB 4Q2ZB 3WFDH 3VJ6B 3PL6B 1XCQB 1NM9A 4X8GA 5GHWL 1AH1A 2WBXA 1XIWD 4J3VA 5TQ2H 3RWCA 1EAQA 3JWNG 2DMHA 2EDQA 1K8IB 2X1OA 3W1ZA 1S5IH 4BE5A 1KCWA 4YSEA 3CQQA 4UQIM 5HGDA 3UCQA 4ELKB 2YPLA 4QKTA 5I1DA 1U3NA 3T77A 3RVTC 4WI9A 1ONQB 3FFCA 5HTSA 5KZCB 1JHLL 3DX8A 4Q0XH 1A9EB 3V0VB 4B3VA 2QKIC 4KOBA 3ZTJH 1X5HA 3Q1SH 4LHQB 5GQBA 3SPHA 5DEFA 4BQ9A 1FJ1A 1GSMA 1ZY9A 4WNQA 2JELL 3MRDB 2FIKB 5KVGH 2PR4L 4YL4A 4AKOA 1OK0A 4HUVA 3RNKB 1RLBA 1OD9A 2Y7NA 3OKDA 4LLWB 4QXVA 2IBGA 1G5AA 3V9FA 2TSAA 5EBGA 3S37L 3X11B 5KS9A 1OAZL 4A2GA 4RISL 1N68A 4YDJA 4YR6B 1DQQA 5CP7A 2CZNA 2ODIA 3W9EB 4NUGL 1K9TA 5CLYA 4WHDA 4XC3H 1OGTB 5LBSL 1IGTB 4G8GA 3NAAL 2QSVA 3WO4C 1KGCD 2GG1A 3FUDA 2ARJQ 2CJTA 3ARGA 1OW0C 4JDEA 5E2UH 1SYVB 3BWSA 4FL4C 5I1AA 2CLRA 3G5YB 2ARJA 1AI1L 4XNXH 2D2CC 2JJWA 3W0WE 2HLEB 1QRNA 4Y16A 1I8KA 4PIRF 1L9PA 4EQ3A 3TWYA 1U2HA 2X4OA 4L2LA 1W8NA 2JVUA 3NPZB 4TUKL 4MKMA 4ZPVB 1UM5H 2DKMA 3OR6A 5FW8A 5DRNA 3J07A 4G11A 3G9AB 3B34A 2CO4A 4MCZA 1JPFA 2ZP9A 3BUYB 3VXOA 2FD6H 1TMCB 1AGBB 1GVIA 3CXDL 8FABB 1XXDC 4FJ6A 3N04A 3MV01 3B37A 4IRSD 2D0GA 2HYMA 3FCSA 2XYBA 3QQ4A 3WTYA 4L8DB 1CDIA 2W92A 3DJTA 3FN3A 5JW3L 2AQQA 1A7QH 1JF6A 2M83A 4PP2B 3STLA 4KGJA 2VW7A 3NGBB 2EEDA 3AQYA 3OJ2C 4K9EC 4UILL 1HU8A 4HEPG 5F7WC 1DEEB 1UZ8B 4AC2A 1N4XL 2VN7A 3U1QA 4DK5A 3CSFA 1D5IL 2X0WA 5EO9A 2A83A 3E8UL 1SLXA 3T2QA 3U46A 5DJXA 3PP3H 5IKCB 1RU9L 2P49B 9CGTA 5F97E 5CFHA 5AVTB 4D9RE 1BX2A 4WO0A 5AW8B 5EC1B 2I9TB 3RBSA 4PJ9A 5IVXE 1BZEA 2DM3A 1ACXA 3LEXA 4N90E 4PG9B 3RDJA 2P5ED 3MODH 1CT8B 2OL3A 1PQZB 2PUQT 2WQWA 2VDKB 1Z3GL 3PS6A 4Y5VB 4QNPE 1CLYH 2J2ZB 5D7IB 4N6QA 1E6OL 1ZA6B 1IGYB 1YNKH 4UMSA 1ZVNA 2FX9L 4WTQA 1A8ZA 1IQWL 5JW4Q 4JQVA 4QYOB 5ICZB 1Q72H 3DURA 2NUPB 1S7VA 2VDNL 2JCCB 4OJFL 4OIFA 1I9RH 4A6YA 4ZOBA 3QRBA 2DQJH 1F41A 2DS4A 3L2LA 2UVEA 5ELIA 2VLJD 3RU8L 4AL8C 5T1LB 4JO3H 1RQ5A 4U1MB 2VSKB 4GRLA 1EO5A 4ZFOL 1N2RB 4MDIB 1H19A 5EWIH 4TQIA 1IB5A 5J6HB 1UKQA 1CXEA 1SQ2N 3SQBA 1BYOA 5AVUB 5DJ8A 3BESR 3QZPA 3DHJA 1LL1A 2DDQL 3QAQA 1NCGA 1F3DH 3TN0D 2OR9L 2BP0B 2HUEA 2ARJB 1TVDA 2XZAH 2X9WA 3ISYA 2NX5D 4E5XA 1DYZA 1MG3C 2IGFH 1BYPA 1PZ5B 5IR1B 1D9KB 5JHDD 2D7TL 5JIQA 3H9ZA 2RCSH 3FW6A 5D7LD 1F90H 5KYYA 1ZD6A 3ULVE 1VFAA 1YJDH 1FVEA 4DKEL 4D8PB 4QF1B 1T0PB 5ALCH 1QNZL 2YPVH 3U7WH 2HTLD 3H7LA 1F56A 3R1GL 3EH5B 4X5WB 3SZKC 4B9YA 4Z7OF 2ATAA 2E46A 4UTBH 3MCG1 4HIPA 4NERA 1E8ZA 2YGPA 3MLUH 3VFOB 2OMUB 4G8FB 2B15A 3UXFA 4HF5H 3IM1A 4GY4A 1XZ0A 2APWA 2KKQA 3P02A 1INQA 2WBJB 2DH3A 1MCQA 3CUPB 1LK2B 3V0WL 4G7QB 3HE7A 4HJ1A 4FQCL 1TLMA 1J8RA 1YYCA 4DP7X 2BJMH 1D3CA 3BPLB 3BRFA 5F7MC 1Q9LB 1LDPL 2NW3A 5GZNA 4U6YA 4IKJA 3T0XA 3DI3B 4GSDH 5E8OA 4MMXA 1XIWA 5E99H 4DP5X 4V33A 2DWEA 1WTLA 2ZUYA 2VLKB 1N5YL 3SJVE 1OP9A 2X28A 5CBEB 3OKNB 1FP5A 4H20L 1OLLA 1OSYA 4PV9B 2G3XA 2W95A 4AY0A 2L4OA 3DMMA 3K91A 3U0PB 4X7SL 5T3ZL 3FFCD 2WUBH 4WW1A 1EEZA 3OSVA 1YUKB 4R4FH 1TTAA 2ZOTA 4OFYA 3ZE0B 3WKPA 4D0DA 3FCGA 2C4FT 1O6SB 3BN9D 2AJZB 2W9DH 5CGYC 3RZCC 2DLTA 2FGWH 1S7VB 4G7YH 3ZIMA 1MZYA 4JPSA 4ANVA 4WHCA 3KYOA 4WHTA 4CAGA 5ISZB 3EOBB 2C3VB 3KW8A 3CFDB 4KRLB 2Y3AA 3QO0B 1D5BB 4N0UE 3KYMA 2EDLA 2WKOF 4R2GD 1XB8A 1N59B 1NANH 1S9WA 2X89D 1U8LA 1J1OL 1JDAA 3RA7H 5E6SB 1VFUA 5LGKA 3O2VH 4K2UH 4EXPX 1MLBA 5FO9B 4P2QD 3D9AL 3OHMB 2O26U 3TFBA 4PGEB 3EOAA 4OB5H 4I9WD 3R4RA 1EFQA 2H2PD 4Z3IA 4N2OA 4WTZG 1T04B 5C0BB 1MCPH 3GSVA 4A63A 4ZO8A 3ZKSD 1E67A 2R7EB 3D0LB 2H2SD 2IQAA 2HXAA 4KDTC 3UERA 4A2LA 2AQSA 2RH0A 2JLPA 5D7HA 2O5ZL 3GJEA 5FUOH 4PMFA 4WUKH 4NO2A 5EV7A 5CJ5A 4X5XA 4WJG3 2F8OA 4BSWB 5DRXB 5D93C 3DXAA 3FT0A 3MJ7A 3S7GA 3E6HA 3TFKD 4JL1A 1JV5B 4FZEL 4NIKB 3TBWA 3IE9A 3BZFA 2V5MA 3FOMB 5MEOB 3Q5YA 4NQTA 1WIPA 5KYUA 4XBMA 4UOW1 2WC7A 5L4MA 3LN9A 4KUCD 1XSKA 4FQXA 4ESKA 1GY2A 1Z9PA 4PJCA 3OXSB 1DQLL 4OCYL 3QZWB 4PHXA 3U4KA 5A2AA 3DV4B 4LVEA 4XAWL 4GKSA 1Z1WA 2UYLB 4XVSL 4CDHA 4M8RA 1B0WA 5MERA 3KLHD 5I1HH 1K4DA 2K6WA 4J3OH 3GMQA 5DA4A 2AGJL 5JIKA 2ZCKL 1OAXL 1O7DE 3OKNA 5EUOF 4I5BB 2ARWA 5I8KL 4JQIH 4JCLA 3S3BB 5I1GH 2H2SC 4GI8A 5DEZA 1MRCL 2F18A 3DMMB 3HRZC 4KTEH 2ICWA 2V7HA 15C8L 2Y24A 1LM8V 3F7QA 4NOBA 4AZUA 4NQUA 4QRTA 2UZYB 1ETJA 1PZSA 3MJ9A 5IW1A 1ZGLM 1Y0LA 2XFXB 3CSYB 4H40A 4XMUA 2CDGB 3MGOB 3LRSB 1AQDB 1A6TA 1MCHA 1SDDA 3QUXC 3C5SB 1XL4A 4JE4B 1QUPA 3N3EA 2A9ML 2HMIC 2IAMB 1DVTA 2FWSA 5TF1L 1AHMA 1HZKA 2H45A 3WN5A 4KMTL 5HHPA 2AJ3B 1BM3L 1NAKH 3LKPA 4XBPB 1P7HL 3QDJE 3UJTL 1D2OA 1EO7A 5EDSA 3UBXG 1P4IL 2X9YA 4OLYH 3MFFB 2CA3A 3FQYA 4XRCA 5D8JH 4N0UA 4S1DD 1R9FA 1ZOXA 3T71A 2DI9A 2XQBL 1TEFA 2GHZA 3TN0A 1X5IA 5EOCL 4YDLB 3CX2A 3QORA 1G6RB 2ALWA 3GHBH 1M42A 2ZUVA 3ARYA 3FB8A 3VSQA 1I3UA 5F8QC 2QR0B 4K3DL 4LIQH 1TQVA 1KNOB 4KRNA 3RWHA 4Q6KA 5EULV 1VB9A 2R7EA 5D9SB 1F3DJ 1KF9B 4AUJA 3OGCA 4LSUH 1M7DB 4K71C 4GMTL 3CH8A 4NS0A 4DP2X 2MQCA 3GJEB 1T2QL 3PQYD 5C0GB 1UWEL 4Z7NB 2SEBB 2YQ3A 4DPCX 4JFPA 2R0WH 4PJ6A 4AV4A 4BSWA 2HT2C 4ETQA 2GFBB 3DUSA 3X3FL 1EHKB 3LKNA 5LDUA 4AM0A 3IF1A 3P3SA 4XPGL 3P2TA 1KB5H 2YA1A 2X88A 1YEGH 2J12B 2NY1C 4NSKB 4OT1H 1OO2A 2YD7A 4HWNA 1EZUA 1TJGH 1UZGA 3DETD 3FSOA 5CLWA 4JFVA 2AAAA 4XAKE 4Z7WF 3S8GB 4ORGA 3LZRA 4CW1A 2EDHA 4KDTA 1PLAA 1S8DA 1XAKA 1MQ8A 2P26A 4FXLA 4OVVA 4ZMNA 5KS9E 3HA0A 2VDLH 3SE9H 3L3IB 4R96A 2PCYA 4V1DB 2ERJB 1U58A 1HWGB 1WGVA 2WB7A 1WZAA 1SF5A 2JJSC 2DIJA 3U2IA 5F7EH 5SX4H 1OSEA 3L4YA 4S1QL 4CDGC 2YR3A 3ZYJA 1TO5A 4FFWC 1BEYH 2LOEA 4JFYA 3QUHA 1DEDA 1ML0A 5DGQA 2DMCA 1IFHH 5HGAB 2UZYA 1DQQB 5JQIB 4OD3H 2O5NA 4L37B 1I75A 2R56L 4HLZG 5D1XC 5HHOE 3V6ZB 4ZQTA 1EXHA 4PLKD 4ALAL 3GPEA 3CZSA 3OB0H 1RUPH 2YRBA 5F71A 2K70A 1X4XA 1JGLL 2EKSA 1TETL 5C0FA 5F7UA 1F8TH 2W0KA 3G6JB 5ID0B 2LFEA 5MENB 3DLQR 2EIDA 1HHHA 4N0YL 1A6UL 1ZSDA 4KTEL 2XBTA 4QT5A 4AQEA 3WFHB 3VH8B 1DVFD 1MKFA 1FO0L 4HC1L 2C9AA 3F83A 5DJAB 5DUBA 5FPIA 2RA1A 3RY6A 3SGEH 3A47A 5D2NE 2O72A 2WYIA 4MCZB 5CZKA 3U7AA 4KTYA 5JLZB 2HKAA 1IEBA 5EBWA 4LSSL 2ZOUA 4NGHH 4B96A 3FO9A 3DOHA 3DX2A 1LILA 2X6AA 1UXWB 3NRFA 3LQZB 5AW6B 5INCB 2HZHA 3FT2B 4AJ0A 3G5WA 1J9SA 2N4IA 2YARA 3AAZB 3NSYA 2WO3B 1DFXA 3MV7E 5D8JL 4F2MB 2ITDB 1TQCC 3ZKXB 4PW3A 4FGMA 3LPGA 4G3YL 3A4AA 1BQHG 1EHAA 1RUKL 3MDJA 1KZQA 1VJSA 5HJ3B 5A2BA 2HMID 1IAOA 2ZP0T 1JPSL 4UINH 3N85L 3VXRA 3OBAA 5CJQH 4LFHG 4AZ8B 5FLUA 5KN5A 1FH2A 3O8XA 3MLWH 2EXSA 4KFMA 4MQXC 2E9GA 4R4FL 3GMLB 4XTRD 5DURD 4NC2B 3O41B 1KYAA 4M1CC 1JE6A 4HMCA 5E6ZA 3ZPDA 5LVEA 4PWKA 4WUUA 4OQ1A 5DC0A 5DFAA 4KJPC 1DQJA 4H20H 3MACH 3C75A 3WY4A 3WLBA 2YXWA 4M9PA 4WDIA 5EFIA 4KHXL 1PZ3A 5CU9A 1Z9SB 2WVVB 4ILDA 5ICZA 5E8NA 1J9CT 3C60D 4H4NA 2X4QA 3DUHA 4F8OA 4Z77A 1YNTB 3I74A 4XXDA 5CN1A 2AJXL 5KVDE 4ZFFA 4ZUUB 4Z7WB 1AP2A 2KLRA 4U1IB 1EMTH 3P11L 4UT6A 2ZX8A 1U95A 5HJBA 3OR7B 4OCRL 1KPUA 5F1KC 2W9EH 4PRPE 4X6CA 5K9JH 4RMBA 4KJYA 4G43B 5FYLE 3O2DL 1YMMD 2FJHA 1I3GH 1NGYA 1WZLA 4NQVA 4GRLC 2GIYA 3QSKB 5ETUB 1YECH 2UWEB 2MHAB 3NJIA 3J7HA 1A4KB 5DJZB 3UGXA 4WU5B 2OX5B 1BSIA 1DANT 3D1MC 4L0PB 1WFIA 1CU4H 1FDLH 2CA4A 4HCIA 4GH7B 1PAZA 3GLDA 4OD2B 5AW0B 1J1XH 5TPWH 3VFGL 1KTLA 1H3TA 2K8MA 4MJHA 2ISDA 3DTXA 5I1EL 1DBJH 1NDMB 2F7OA 2FH6A 4DVRL 1C16B 4J6RL 3RTQA 4G83A 3L1OH 1FVEB 3ABGA 2FIKA 3HR6A 3UTZB 1MEXL 4NX0A 2IDTA 3ARWA 3BP7B 4GSDL 5JLZA 4KKAC 1F3RB 4LLWA 4N2MA 5L2KA 2TAAA 3GFUA 5T33H 4A04A 1FLRH 3KH4A 5JOPD 5L9DH 4HALA 2BHFA 5EN2A 4HF5L 3SSGA 4O02A 3NCJH 1I1YB 4XPBH 4NCDA 3WXWH 1GMEA 3OWEA 5IZ7A 4CKQA 2I5YL 3VW3L 3HIZA 2DL9A 4H26A 3K46A 1R4XA 1INEL 3MXWL 1FL3A 5B1JA 2GABA 3E9UA 4BFOA 4HSCX 4N8PA 4UOJA 2AJYH 2NY0D 4AYMC 1N3NB 2B0SL 4G9FE 4R7VA 1ORSB 2NNCA 3TV3L 5F0LB 1E3FA 2XTJD 1DCLA 1R5IA 5EZPA 5GJTH 1C5BL 2VXQL 3PWVB 1KPRB 5T5NF 4LQFL 5FGCB 5FGCE 1XIWC 4OLWH 3GBLA 4LLYA 3F04A 5KAQG 2AV7B 4JPIB 3AY4C 1BZQK 3JT0A 1O6SA 3QA3A 2NXYB 3D05A 4RLDA 2NYYD 3HAEA 4U0RB 2Y4SA 4ZMXA 2Z3FA 3WLWD 3ZTEA 3DRTA 3ZO0A 3WNMA 5DRWB 2GEQA 1IL1A 4D94A 3WS6A 3S2AA 3PWPA 2OW6A 3KHQA 3GO1H 2ATPB 5DD0L 5BRZA 4OR1A 1HEZA 3MFGB 2QGEA 4JPQA 3EOBA 2R51A 1RK7A 2GT9B 4Y4HD 4HWEH 2EEFA 1IGCL 1E9OA 2ADGA 3N44B 1T1WB 4LP8A 4MNHB 1T03L 2H1PL 3ALPA 3CMGA 3R8QA 2G75B 1GHFH 2EEXA 2WXHA 5B21A 4A2HA 2NTFB 1JHKL 4K7PY 4LSVH 3RY4A 4EIGB 6FABL 3QJFA 2NR6D 1IQWH 3GXUB 1F02I 1XGYH 4Z7IA 1JZEA 4M3HA 1MLBB 3I6LD 5FO9A 4PJ9B 5I71C 4EDWL 1FGVL 1FL6A 1PTZA 2RHEA 3IK2A 5GGRB 3MV7D 4OI8A 1CGUA 5E6UB 3AU1A 3NA9H 1XB3A 2JKTM 2ED9A 4Q6IC 2ZWLT 3NT0A 5IFHH 1SY6H 1PPIA 1BF5A 1IGYA 2YEQA 1Q94A 4PJFE 3VU2A 1VZHA 1UA3A 3EO1A 3KL3A 2DM7A 3MV8B 2NUPA 1AS8A 4PS4L 2WSPA 2P24A 3GZPA 5HHOB 1UM6H 5CILL 3FCBA 1S9VB 3RWFA 1OZUA 1LP9A 2PP8A 5JNYA 2QPDB 1E3XA 1M2VA 1A9BB 5FKAB 2IADB 5IK3A 4AWJC 3LEYL 4ZSOA 3KGSA 5FGRA 5KSAD 1JPTL 5AENA 5DQ9A 4AMWA 7PAZA 3CLEL 3HBZA 4EE2A 3IGKA 1Z32X 1MW3A 4OCWH 1QSFE 4APQA 2BCKA 4G2AA 5C70A 4L48A 5F93C 43CAB 2VDRB 4IKLA 6PAZA 3C5ZA 4IDLA 2WLIA 2NX5E 2WXKA 3RI5K 1Q0YL 5C7XH 4GG6F 1W91A 4JL2A 1DLFH 4Z3TA 1CR9L 1RIUL 5I6KA 1KBBA 2A73A 4J3OF 1T0MA 2QVKA 4QKXB 3ARFB 1MQKH 2COQA 2IFGA 4XR8C 1JN6A 3S3CB 3WN6A 3VG0L 1H8SA 4MA1C 2IDCA 2JE8A 1S7RA 3M07A 1A1MB 5CU5A 1VPOL 3ESVF 3T3PE 1GGIL 4JRLA 4UTAL 3PRZA 1CBVL 5IJKA 5LCVA 2ICWB 2IH8A 2V7HB 1DANU 1YHPA 4FQIL 2HTKC 5C9JA 3TU6A 3TCLA 3V4VH 3VFMA 1A4AA 3MUZ1 4DQOH 3MJ9H 4U7SA 4QRPE 3Q9QA 4E41A 1C7SA 1AFVL 2R2EB 4F9PC 1U93B 2VNCA 3G6DL 3CSGA 5I8OH 2O6FA 1X6NA 3MRQA 2OMUA 3WG7B 4P9HC 1JNNH 2XZCH 5DR5L 4BH8A 1T1XB 3HB3B 1JZ7A 1J0HA 1WA2X 3FF8A 1JYNA 4HU8A 4NT6B 5C09A 4HKZB 1RPQA 3HZYA 4IU2A 4PBWD 2BX5A 2GJZB 4IBUA 4JZJC 4NP4L 1ZANL 5GGUB 5E2VL 1YMHB 5B38A 1EHNA 1JTTA 1QTPA 3NJMA 4NKDA 4OBRA 2DQJL 4WHYG 3AMKA 2E76C 1HC1A 5EN3A 3JWOL 3MV7B 3FU7B 3QI9B 3MYJA 3D08A 3QJZA 4KZDL 3UABA 4Y1SA 2HLAB 1E90A 2IG2H 4UQ3B 5E4EB 3NBNA 4FAAB 4V1DD 3IJSB 4FNLL 3LHAA 1EUTA 1NMBL 3LH8A 4KKPA 1P9MC 4OZGA 1QBAA 1W8OA 1JCKA 3GKZA 5A2LH 4DK6A 4OQTA 2UVFA 3FQUA 3SGDH 2BY3A 1WA0X 2YSTA 1N12A 1ROWA 4LEBA 3W38A 3KPTA 2EVJA 3L45A 4KKBD 4QRQB 1UD3A 2R27A 5F3BB 5KTEL 3EDKA 5TQ2L 2QFPA 3CH1A 5IHUL 2MOGA 1JGUL 3KYKH 2R69H 1SM3H 5DFTA 3H9YA 1AI1H 1OHQA 4L3EB 2E9IA 2XX1A 1O9VA 4WI7A 5C0EA 3VGBA 1YMMB 4J8RA 1DVFC 1EXUB 4OIBA 1ECYA 5K9KB 1QFWH 1I8UA 4KMLB 5DQ9B 3EJZC 5L2JB 4JBSA 3KYMB 2Q3AA 1RD6A 1QOKA 1BVNP 2H1LM 3CDCA 5CXPA 1EBPA 2W60B 4U4IA 4G9FA 4M8QB 4QXTB 4XN7A 2CLZB 4OZHE 3ZKMC 3UTTE 4TPRH 3DECA 3GXIA 4AEIH 2VMCA 2GYSA 4OFDA 1ETZA 1GJUA 2R2HA 4EN3C 4F93B 2F15A 1ANUA 1HL8A 3D34A 3IFOA 3P2DA 4MNQE 2H32A 5I0DA 1NUGA 4N1HB 2VRQA 4G8EA 4HCGA 1KXTB 3CPLB 2KMWA 4W9EC 2WYTA 1XX9C 3SKMB 4KUZH 2G5BA 3D85D 3ZL4H 3M7OA 2OCJA 1FNSH 2IH1A 2FECL 3O45A 2D03H 5HDRA 5C0CE 1RSYA 2PKDA 3PGCA 4AGMA 4XOBA 1DQDL 4DKAA 3UADA 1PY9A 3TS8A 4NQEB 4X9HA 5DJCA 5DD0H 1F45A 4HJJH 1EDQA 2FNBA 2UXVA 1L6XA 4P5TB 5J1TC 2CXGA 5EIIG 1SJMA 4C8XA 3AS2A 3B2DC 1CE1H 2FBJH 3CVDA 1J1XL 2Y5TA 2AVGA 2E27L 3HVNA 4WY7H 4UT7L 1P6AB 3VM5A 2GC7C 4LSPH 5C08A 1SOXA 1DSFH 2XQYG 3EUDA 4PGDA 5CHNB 4FJYA 4DUVA 3R0NA 2XLLA 3DO4A 3HZYB 3KPQB 2ICWJ 4ZUVA 3OSKA 5FO2A 5I82A 4F57L 1BFVH 1UCBL 2B9AA 2WQAA 3RKPA 4G6KL 1SVCP 2J20A 3QUMH 1N18A 1B3JA 4O00A 1IMHC 8CGTA 2B0SH 3DETC 1WTGT 3QI9D 5IQ7L 3MV7A 2DQDH 4CUCA 4JFED 4I5BA 1L5GB 1MFNA 4HWZA 4I87A 2Q2EB 2H0FA 3I02A 3MR9A 4Q9BA 3LMJL 4Y9EA 2VGLM 2EUWA 4ABWA 4HGWA 3WE6B 1N10A 2QELA 1DBKH 3I84A 3BYYA 1PZUB 1PSKL 3TYGL 4S1RH 1JHLH 5C0DA 3L5JA 3L5XL 2GUYA 1TVHB 5IFAH 3UBHA 4K55A 4AE0A 4QHKJ 3RTLA 1KCVH 4QRQA 2P5WA 5I18L 2J4WH 4CMMA 1AZUA 1ORQB 5EEUA 1I9EA 3SOBL 4S0SD 2YSSA 1J11A 2C8NA 3NIGB 1A6WL 4HAGA 6CGTA 5KSAA 3N1QC 4OZFA 4HZ1A 4XN8A 3GMMB 4POZC 1QLFA 1UH2A 2E7CA 3K71A 4UZGA 4JKLA 3VXMB 3MBXL 4M5SA 4N0CD 4CN6A 4J7RA 3FSVA 4N0YH 4ZUTB 2ZOLB 5F7FA 4EUPB 2PW2A 4LSRL 2OA9A 4I48B 4Z0XB 1GCFA 4IOIB 3B3IA 5AB2A 2GBTA 3D0AA 4MSWA 4H8HA 5CEXA 2QMJA 1FNGB 2AAVA 2AP2A 2KDYA 2MSPA 1U2CA 4B3EA 4P48A 1UXSA 4UIMB 3VWKD 4M5ZH 3ROOB 3FB8B 1RLWA 5F9OH 1V10A 1XAUA 3AUVA 3MRFB 1UVQB 4JM2D 5H94B 1I1FB 2EH8L 4C4BA 2BSSA 2E8ZA 2R2BB 3QARA 4PJEE 1NFAA 4YHIA 4C56A 3FRPB 1CFVL 4YK4C 4WK2B 3VWKB 5SWZD 1S7XB 4CVXB 1G5GA 4Q52A 3UTQA 3TIEA 3DHPA 1KSRA 4I2XE 2NT1A 4X7EC 5FKPA 4FQHB 4JDTH 2YBGA 4YVUA 4N24A 5F6HI 1P84K 5C09D 2CG9X 3RL1B 1CD0A 2DH2A 3HG1D 3R18A 5DJDA 5GSRB 4LP5A 1Q9WB 1QLEL 4N8CL 3T0EC 2Z34A 5F9JA 2DQGL 4IMLA 1HKFA 4PJ7E 1ED3B 3HG3A 1WVZA 4ORGB 5DMKB 4TQ8A 3RFZA 3IDMB 3G5VA 2PXYD 4KV5E 2JK5A 2DRUA 3T4AB 3L5XH 4PVLA 1JF5A 1TZIA 3B2UC 2QPEB 4V1DA 5CINL 5AKVA 2NW2A 5DHVA 3CHRA 1JOIA 1NBZB 1QO3A 2G0KA 4LCWA 5DK3A 1JRHL 1BXUA 5L7XL 3N1GC 4XGZA 3HZMA 4QXUL 1G4RA 5I1KL 1VEMA 1TZHA 1JYXA 4GIPD 5JA9A 1WUNT 3UH8A 2C1OB 3HFFA 5E2WH 2XRAL 1IGJA 1JWUA 1VSCA 3K81A 5GISL 1A6AB 3UZEA 3MOAL 5CS7A 4YHLH 4YDIH 1HWHB 2HLFD 3RWEB 3NSJA 4G1MB 1Z6JT 5HD8D 1FC1A 5KSAC 3CVHA 4LCUA 5F9AC 4ELMA 3P0VH 2QPUA 3CFUA 5CN2A 1MRDL 4N0CC 3L3OB 3FZUD 5GPRA 1KYUA 3QULB 2XQ0A 5DRZA 3NQKA 2XTJB 2PXYB 2ZXEB 3TNNB 5IB3A 2YAHA 4N22A 4HK3N 4LLYB 3NZSA 4F20A 3TEYA 2ED8A 4R2GC 2PLTA 3BW9B 2H6OA 3H55A 3EJRA 4LAQL 3QA3B 3T6QC 1FNLA 1TETH 3G04B 3LPWA 2L0DA 3LSOB 1BQHB 4NNYB 1RAMA 4ZTOL 4NZUH 3RYMA 2P5EE 5ANMB 1U42A 1NFDE 4KKQA 3DBXA 4QWWD 3WJJA 3VXTA 1I1FA 3S5ZA 3LPFA 2DYRB 4D9QE 1GC1C 3U0WL 1F4XH 4AQZA 2Z8WC 3GDCA 2KQMA 4NN7C 4P3CH 3FO2A 2P7TA 3SO3C 3VJ6A 2NQDA 4UQ2A 4EDXB 3ZYZA 2E0PA 4JQVC 1XHHA 2AQRA 1QTSA 3VX1A 4OCYH 4NN5B 1A14L 2CH8A 5K69A 2OR8A 1WS7A 4OGAD 2Y7SA 4MD5A 2CJ3A 4DN3H 5FM5O 5ITBH 5D1QC 2DBLH 1KCLA 3RIAF 1OVZA 1ILSA 3MRMB 1GW0A 5DS2A 3O3BB 2AEQH 5IVXF 3BYTA 5LKNA 2BS9A 2EO7A 3EHBB 3JTSA 3ZUCA 2D0FA 3BN3B 3JVGA 3TO4B 1P7KB 2YO3A 5D72H 4LCVA 4BH7A 4MDJB 1MLCB 3JVGC 3QWOB 1XR9B 5JPMA 3LIZA 3FUNA 2O1AA 2BZ7A 4JFEA 4WO4D 5I66A 5LLIC 1QFWI 3M8OH 2H32H 1LP9E 4G6MH 3BQVA 2IBZY 2ALAA 2IPTL 2P80D 3GXNA 4FQLH 4HISA 1ZTXE 3VGEA 2NT0A 5AL8A 1N7MH 5DDHB 1BW8A 4DVBA 5IBUG 3IFPA 5AYUH 3F2LA 1COBA 5E9DA 4H44C 4UWQB 2HTLC 4MMZB 4S0TD 1NPNA 3TA3C 5LWYL 4UQDA 4NRZB 2X4RB 4P05A 3KLAB 1N5YH 4OTXH 1FNEB 4GO9A 2VC2H 4NM4H 5D96B 2GI0A 1QEWA 1ES0A 5LG1A 4M62H 1LDPH 3EJZD 1BF8A 3TEUA 4FA6A 4XC1L 3ZLQC 3DTXB 1IKFH 4X8XA 2D2OA 2W0PA 4N86A 3ZRSA 2X6VA 4KTDH 1IQDB 1FL5A 4RGMB 3VTTA 3S34H 4W9GC 3VGDA 1XGRB 2E47A 5GZOD 1RPUA 4AYFB 2CKNA 4PJHF 4Z18A 3WELA 4RGMC 5KZCD 4DKEH 1E9PB 2FX8L 2XC8A 1EFXB 4Q9QH 3BH9A 4GT7A 1GOGA 2E74C 3DO3A 4B0MM 2XIIA 1Z66A 3W39A 3MLVH 4KROB 5E00A 4J3XA 3LPPA 1BQSA 2FR4B 3FQWA 4GKOA 1CWVA 3NOIA 5DMIH 3KAAA 3OLIA 1V55B 3EJSA 1B0RA 4M3KB 5EOCH 4Q9CA 2RIKA 3H9SE 4NXSA 1WLHA 5BZXA 1YN6A 4WV1A 4KUCF 2WXMA 2X42A 4P2QB 1SJXA 4B60A 3RPIA 4Y7OC 4WI3A 3V8CA 4TUOA 1RK1A 1NUDA 3L16A 2EIKB 4ENEC 2QV4A 3S35H 1CLVA 2BCMA 4AGPA 4NYLB 1DQLH 2MPAL 1I1AA 3PV7A 5BRZE 3O3EA 2A9DA 4YSUA 3ECVA 2YLKA 1FV1A 3BXNA 4RGOH 2BVYA 1URLA 5DWUL 4PIBA 2BVOA 2NY2C 3QUZA 4MJ4A 2X2JA 1AGEA 3RWGA 3TJEH 3WHE0 4MJJA 2HG5B 4AEFA 5JPMC 5T1DL 1NCOA 1MCSA 5TFSL 4IRZH 2YWYA 4LF3B 2VUOA 3U9WA 3PY9A 5IT2L 2BVQA 4E36A 3U1SL 3A24A 5B4MD 3QHZH 1CL7H 3D2TA 2QV2A 1XH1A 3NIDF 3ZZLA 1AG6A 1U3YA 4GSXA 3OG6B 3GWJA 5D2LE 4FFTA 3PPEA 4E42A 2A9NL 4LCIL 1GPOH 3I2CH 4L05A 3VD9A 4IK6A 4LGPB 5DDHA 4F1ZA 1QR1A 3CBJB 3MLXH 3OKOB 1M1SA 3QG7H 1RHHB 4HHGA 3VI4E 2OJZH 4MDIA 2G2NA 3DSFL 4EQ2A 2HTKD 4UM8A 4NZDA 3KYOB 4NN5C 1P1ZA 2VZSA 4GG6A 2OFQA 4NN6C 1SLUA 4UV7L 4XVJH 1ETZB 4ZFZA 2CBQA 5FOBA 2Z0BA 2ZYIA 3AY2A 4GXFA 3RU8H 1T7VA 4JHAL 4JG5A 2FO1A 4D7BA 1T66D 1LEIA 2Q7NA 4JJ5A 2CNYA 4ZODA 1NWPA 3CSPA 4N0FA 3LKOA 4F7EB 4IKNA 5CZXC 4UQBA 1S46A 1Z0NA 3NG5A 2PPEA 5LWYH 1KG0B 5FYKL 3MLZH 2YPLD 3RHWF 5K9OB 3IKCA 4R0LC 1A1NB 3TVMB 4KK6C 3MSPA 1N67A 4L1BA 2Y2WA 3QE5A 5JNYB 2CJUH 1CTOA 2X1XR 4K7PH 4WKZB 2J8OA 1FGNH 4PJ7B 4MA7L 3E0GA 3L6FA 3SBRA 1G1YA 1YNKL 3AM8C 4KXZI 2B4CC 4UTBA 3LJ3A 1WK0A 3IMUA 3LXAA 2OI9C 4TNWK 3EYOA 4G8IA 1V8HA 3MGAA 1DVXA 2IXQB 3K8MA 2XZAL 4HCFA 2EABA 2P44B 3CDZA 4AMKH 3QS2A 1H6EA 1HL5A 4HV8B 2X3AA 5DFWH 4GRWB 1MXGA 3KS0J 3L3KA 3QXDA 2F7RA 5GGVL 1C5CH 4C47A 1XVSA 1DBBL 4JZJA 3FO0H 2EDNA 2VDQH 4P23B 4N8UA 4YHOH 4ZMQA 1XO8A 3BUIA 1DJWA 5CD5C 4DKFL 1PLCA 4Y2DA 4C4KO 3C6LC 4FQJH 4R7DA 1NOAA 5BQDA 1TJXA 4PRBB 3ZSSA 5EEYA 1ZSHA 1QYGH 2Z7ZA 4FXGC 4HMEA 4TSBL 5IJVB 4JFZL 4HGWB 3FOLA 3WE6A 4ZMAT 1DO5A 2EVHA 1FA4A 3VE0B 4JR9H 5C0DB 3IRCA 3QG7L 1MAML 4HCRH 2Y1ZA 4ONOA 2AABH 4U1KB 5C0JA 5JMOC 3DYOA 4RMUA 2IWGA 5DF0A 4B53A 3FRUA 3QUZB 1OQOA 3BAIA 3V0FA 1XH3A 4G6ML 1E5YA 3F7YA 4YX2H 2P80A 1JFHA 2YFOA 3DX7B 2X6UA 3OWRA 3G6AA 3MZTA 4FP8H 4Q0XL 4Z7UF 5KSAB 2VLRE 3PHOB 2YPVL 1QNIA 1DVUA 3SCMC 1N0LA 2X70B 1JV2A 3WKML 2P8MB 1IZJA 4O2FA 1E6JH 2CKBA 9PCYA 4WI6A 3WFEL 3IBOA 2AEQL 1AQDA 5GGSY 1J8HA 4IOIA 3NJJA 3K6FA 3J2PA 1EZLA 3MNWB 5GS2H 4CC0A 5HI5C 2IAMA 4D9QD 3B7RL 1BBJB 3GBMH 4K3JL 2GBVA 1NCIA 2CBOA 1UXLA 3HHSB 4LIQE 1N0XL 2IMNA 4X4ME 4WNJA 2FATL 4XBPA 1EBAA 1AR1B 1AR2A 2ESVA 2IFFL 3RAJL 3D3VB 2A9BA 2BIPA 3ERXA 4Q7DA 2DLEA 3OPUA 4N5EC 4N0UB 5C7ZA 3V4LA 4PJ9D 3WV0A 5H94A 1LWHA 1U0QA 4TLUA 3D0LA 1KMGA 2Y7QB 3DROA 4NQQA 3FQTB 3FT4B 4JO3L 4QLWA 1F4AA 2DYPA 3VXSD 1I7UB 1CGSH 1I9IH 4JK0D 4L23A 3I3BA 2FYVA 1T1ZA 1JFQL 1QQDB 3WXVL 4GP4B 4FQ1H 5I1KH 1FORL 3G7TA 2YD3A 1SDYA 4PP1D 4QHUB 2VH5H 3EO0B 4QRUB 1CIUA 4B9ZA 5JZ7C 4GSQA 4XMWA 2PO6D 5LXVA 5C07E 4HBCL 4ZW6A 5C0AE 1UHVA 4JKNA 5J3HD 3UYPB 3EO9H 5IBUB 3Q06A 2EAEA 2IGFL 2J21A 4LEXH 2QFRA 1PD0A 3TURA 1L9TA 3D25A 4I9WE 1BAFH 3UL4A 4ZUSA 3QQ3A 2CHWA 4L4VA 4YBQC 1T20B 4TNGA 1NCDL 3LIZL 4JGNA 2Q3XA 4LCCB 1KPVB 4K7PL 3H0TB 5IROA 4GRLD 3UAJA 4OLWL 2DQUH 1X5LA 2UZXB 3KPSE 4X6FB 4XC1H 3CXFA 4JNXA 2OR7A 4PBDA 4YHLL 3P3RA 3P3YA 2G5BB 4NXKA 4Y7MA 2YHGA 5FHBH 4DZ8B 3MLTB 1ULVA 2K78A 4O02L 5C0CA 1EAJA 1D5IH 5IQ9A 2CHXA 4NGHL 5LBSA 4K73A 2APTA 4Y19B 2WANA 1WEJH 3P3UA 5EORH 4WCYH 4Q4IA 5EUOA 2BVTA 1S8DB 5A7EA 2A6KA 1E30A 4WGKA 1I9RL 3EJJX 3LS5L 5D7LA 2ZZUT 2JKXA 4W9ZA 5FHAH 3L3JA 3WJLA 4KJPD 5GZNC 4HXAL 1CQYA 3VDCA 2E5EA 2F7PA 4Y9CA 4BZ2L 1OV8A 6TAAA 4JFYB 5DUPL 3CZFB 3G6AB 4YSAA 1AACA 1F00I 2A77H 4OLVH 4GP8B 2YPLE 5CNHA 3HG0A 5EU4A 5KVFE 4LOFA 1AO7A 4HG4K 1IM3D 3QJVB 5KG9B 3AXHA 4N8CH 4P57B 5KOVC 3FN0L 4YC2C 2WBKA 2P47B 5E8DH 4FG0A 3DGCR 3WSQL 5GZND 4D3CH 1SYSB 4L9LA 4F15C 2VZVA 1A25A 3FONA 3NZUA 4ZG1A 1SHMA 3H2WA 2VR7A 5JW4N 3QH3A 1Q1JL 3DIFA 5TJWK 1I7RA 3PIQB 3PWJA 4XPFH 2QQLL 3WENA 1A7RH 4U1NB 4OZIF 5AW4B 3EZJB 3B5TA 4G8GE 2CLVB 4NAMA 3S37H 4H8QA 4O2EA 4ETYA 1JZ8A 5DS8A 4X4MA 2WQSA 3UYRL 4RDBA 4NZTL 5G5DB 5H35B 3KXFB 5CP3A 4AENB 4AI7A 3IGUA 3DRQA 4FFVC 4MJIE 3VSUA 1FPTL 4UT6H 2Z31D 5B39A 4W70A 4MD4A 2VXTH 4Q8BA 5EIVA 3HS0B 3B9VA 2FJUB 3M8OL 3MV9A 1TOXA 4Z76A 3IF1B 1KGIA 2DJSA 4NQCA 4X7TB 1YPZB 4NDMB 4IBSA 3RVXD 2XJKA 5FA4B 2F53D 3D51A 3JTSB 2VB5A 1FFNA 4PJIB 2JJUA 4LSTH 3QCVH 3R06B 4PJIE 2I32A 1R5WA 4UAOB 5BOJA 5BW7C 1HYSC 3LTVA 4PJAB 4TTDC 4WFFD 5ANHA 4Y2DD 3U2SA 3FUHA 3HUJF 4EI5C 4E68A 3BZDA 4RQQB 2Q76A 2H3NB 2Y06L 4FADA 3WNNA 3A22A 1ZHNB 5GXBB 2JCCE 2WMPA 1M53A 1CTNA 2X4UB 4G42A 1FE8H 1NGXB 3PDOA 1SN5A 1NIFA 2JKSA 1SY6A 2B9BA 3FRPA 1OP5K 1BD2A 1J7VR 1CD1B 4P49A 3TTSA 3F58L 1BLIA 4ZPTB 4MMZA 3VXQA 4GAJH 1R0AH 3IDXL 2GIMA 5LBGA 4Z77B 3ML9A 2NR6C 4J3UA 4C83A 5FO8B 5LGJB 5BOZG 5AEAA 1ERNA 1MW0A 1XSJA 4PJ8B 2EH8H 1TT6A 4RCAA 3T1FA 3QRGL 3ELAT 1QUNB 2DM2A 5MENA 4R84A 5GSRA 1ZVSA 3VI3F 3Q2VA 4RX4A 2FL5A 1CJYA 3QWRA 3LNFA 4AQEB 2YRZA 1R3HB 1XGTA 1J8HD 3PG2A 5E94B 5ACMA 4EBQL 2ROYA 4JFHD 3T8XA 4DZBB 3WNOA 3O6ML 2IAMD 2RB8A 4P57A 4NZRH 1KIUB 2J6EA 2B4CH 3GSOA 2VXSL 3I75B 4PJ7F 3LNEA 2CBMA 2DOCA 4PB9H 5J1SC 2WSDA 3NFNA 4KU1A 1SYSA 1P4LB 1DLHA 3ILQC 3BZEB 2AHIA 2YKKA 1FO0H 4HC1H 2F54B 2WJ7A 3KPRE 7PCYA 4KQ3L 1UXWA 1FAIH 3LN5A 3MNZB 2OSXA 4JO5A 3CJJA 4EI5D 4KKCD 1AGFA 1Z5HA 2PW1B 1GZPA 5MEPA 1OSPL 4HCRA 3H9SD 4F7PB 1HXYA 4PGCA 3C09B 4H8UA 3QXWA 5IMLA 5I8CA 2CLVA 4M43H 1A0QH 4FFZH 5FWRA 2HWZH 3CVIH 3D4ZA 1OT4A 3P4LA 5H35A 4Y5YA 4XE5B 2ZYHA 4EIUA 3ZE2F 4JREB 4QLRA 2N1KA 5JDSA 5BO1L 1RZJH 2NYZA 1A2YB 3AS0A 4ANUA 5FCSH 1A3LH 4MNGB 2K7QA 4CADA 3X13B 2IGTA 4ABVA 3PAYA 4NZ8A 3E3QE 3OLDA 2FUTA 3BD5A 1AAJA 1XGPB 1UB5A 5B8CA 3QDMD 2IWEA 3TT1L 2ZYSA 3ML8A 4RWYH 3IJHA 2WWMD 3ARED 1E4XI 3QIWA 1J5DA 2KHAA 1A8JH 3VSTA 3DTDA 1WZ1L 1FZMA 1N8ZB 4HK3J 4PYHA 1B0GB 1H8LA 1Q0XL 1KZYA 5EA0L 2NQCA 5FM4A 3SDDA 4R7NA 3LEXB 2ZOKA 4FULA 5C0CD 5EMYA 3NQIA 3TBBA 4FC3E 1IT9H 1BAFL 4L4JA 5CM1A 1U92B 3QK0A 4Y5VA 4XO3A 1TU2B 5EH1A 1KPUB 2HJFB 1F4YL 4YZFE 5JHLL 1QR1B 3HMWL 4JRYA 2IPUK 3ZTNL 1TQTA 3J27A 4KITB 3IDNB 3OB0K 1TENA 2I24N 4D0BB 1O6TA 2VISA 3WGUB 2V5YA 1CXKA 2VLME 3L4CA 5CP3H 3MCYA 1MJ7H 1LO2L 5DJZA 1O5PA 1Q8MA 5IIEA 1CF8L 2L8AA 3LMJH 1XL6A 4F37K 4ZFOA 1RIUH 1OM3L 5IQ7H 5EORL 2F61A 5EC2A 1I7ZA 2XZQL 4HLZH 1R3HA 1XGTB 2IEPA 3PNWB 4XBGB 1W72L 2NY4B 4IOFC 2CR6A 3DX9B 4CL7A 1RP9A 4HULB 2WWOA 2AVFA 2NY5C 2ERJC 4WENB 1C5DA 3WIHA 5C0IB 3FULA 4L2YA 2AI0H 3P4NB 4JFOB 5E1GA 1P4LA 3P9WB 2O6PA 3CFTA 2CRYA 3IU4H 1BM3H 5AKSA 2UXFA 3NABL 5LCVH 1RJCA 2VKXA 3JWDL 3L3HB 3OAWA 1WBZA 2VO5A 1A65A 1E65A 2H2PC 4L8BA 2NY6B 1RJZB 2GJRA 4JQXA 4N2DA 3F6JA 2YAPA 4Y16C 4F37F 2WXPA 2WLLB 5IHUH 4PRID 3C08H 5T1KA 4ZS7H 2VH5L 3R4DA 4JDVB 4IIQA 4NFCA 5HDOA 1T0OA 3QPXL 2BNQD 4I13B 3R7QA 4RZCB 2D0HA 4IRJB 4UV4H 2H6UA 4BFEA 5IOPA 2F9BT 2A77L 4OLVL 4Y5YC 1QVOA 1SLVA 3V6OA 4X4XA 4YE0A 1N3NA 2FT6A 4O58H 5DK2B 3WEXA 1AQ8A 1RZPA 4IEFA 4FNPA 43CAA 4CMHB 3THML 1NLBH 4MAYD 4YXLL 2LT9A 2IG2L 3F7KA 4JPWH 4QHMB 3EHBD 3S36H 3AREC 4AIZA 4HZAA 4AH2B 5C0BD 2BNRE 2CCVA 1ZJBA 1XFPA 5EU7C 3RP1A 1FHGA 3CN2A 4DP1X 1TXKA 5GZOC 1IIIA 2X6CA 3EYUH 2DI7A 1GGTA 3FRUB 2V2XA 3HAEB 3NCWA 3QWNA 4WTZA 5K9QG 4O9HH 3CDYA 2WCPA 4AVHA 3GSNH 4U3HA 3ARBA 2IBZX 3WJMB 2DJ4A 2R69L 3GEWB 2FWOB 4WFGD 1PKQA 1UB6A 4FZEH 3PV6B 2GSGA 4ODXB 1BWWA 2L7QA 2XVGA 1YY8A 1J8HB 4JUTA 1P6WA 5I28A 4AQOA 5M95B 2XV3A 1D5XB 3VI3A 4BH8B 4HIIA 3SY0B 2IAMC 4ODWB 5JXAH 1ADQA 3GSXB 3RPIB 5KSBA 4FCAA 1CFNB 1JZ3A 1VIWA 1G7MB 5ISZA 5JYLA 4QTIH 4I2XB 3BP5A 5T3ZD 2NYYC 3OQRA 2VN3A 5DJ6A 4XMPL 2XJLA 2YOAA 4U1LB 3FNKA 1RIVL 2M1KA 2WSKA 3BKCL 4BJLA 3FFDA 3RVVD 5GSVB 1UA7A 3MYJB 4Q4EA 2R0ZL 1JNLH 1FNFA 1D9KD 5JHDB 3BWUC 4R0LB 3MHZA 3E7JA 4ZNEE 1D7CA 1E4HA 1E6OH 1RZKL 1ZIAA 2AKRB 3H7BA 3LVEA 1G9MC 2RBLA 5CJOH 2WP3T 1CLOL 2EDTA 5FIEA 4GLRI 3LYRA 4Z9KB 4GRMB 3NJXA 1FCGA 5FV2A 3FYIB 4EI5A 3UO8B 3T0EB 2DQUL 3P4OB 4QRBA 2FATH 2XU9A 1JAEA 5A3IC 3K2MC 2XWDA 3G5XB 5FCUH 3BCDA 4CC4C 1MVUA 2WXNA 5I17A 3DO7A 1GAFH 3C9NB 4N1CA 4YHKL 3ZU8A 1MCDA 4P4RA 3WS3A 3MI6A 1VADB 1C8PA 3ATEA 2ILLA 2JCCA 5DVOA 1F58H 2FT7A 2LHAA 1CICB 1E6JL 3QS3A 4MRCA 2NUTB 1SMDA 1YMMA 3OTTA 3ZKMD 5HHVL 5I0XA 3ZBMA 4RZCA 3ARFA 5DS1A 5EEZA 1K4CB 3KPRB 2CD0A 3S5LG 1JI1A 3CHXA 3LRGA 1MQKL 1GYAA 3RIFK 4LP4A 3IMVA 1CR9H 3RPKA 3DDGA 1IBFA 2JB6B 2OPCA 5JDJA 3D2UA 2C34A 2F5AL 4QHMA 1Q0YH 3UPRA 1TLKA 2KPNA 5EUOE 1E4WL 3NCYP 3WBDA 3V6OE 4E41B 4Y4FB 1L6PA 3L6FB 4P3DB 1T66C 2DQTH 1E7VA 4JFFD 1LEKA 2IANB 5E9DE 3S4SG 5LHDA 4WLCA 4ZT1A 4ZDHA 3CN1A 5ICYB 1ZT7B 2EDWA 3F6IA 1DBJL 3TH2T 3QBTB 3ULUD 2BERA 3TBSA 4NT6A 1BMWA 5FK9B 4KRMB 5DJCB 1NAMA 1JVOA 1UD2A 2FTAA 1OF0A 1FNHA 2GJZA 4A7VA 1C08A 1YEEH 4DGIL 1KGWA 3M1OA 3NAAH 1Q38A 4X5PA 5BVJA 3QR0A 3HRZA 1HAUA 2EYRA 1YSOA 4GIOA 4IJ3B 2BP3A 2CPUA 2XXMB 5F1OB 4XMTA 2EC9T 2WBJA 3CUPA 5HGHA 3FUEA 3MLSH 5DD6B 4L9LB 2MCMA 3PP4L 5IJBC 4HKXB 1RZKH 4F7TA 1EQWA 4FERA 1CUOA 1YAZA 1AQKH 1F6LL 3ABMB 1NEZB 1UOKA 1U33A 1WWAX 5E4EC 1EH9A 2ED7A 4K23H 4M7LH 4LMQE 1KIQA 3BLKA 3VW3H 3C6LB 2WTRA 4WF7A 1IVTA 5F7AA 3OC5A 3C8DA 1N6QL 3O6FD 3KLHC 1U91A 3WIAA 1NH6A 4TSBH 2ETWA 1BVNT 4OTXL 2D9QB 3B9DA 3ZK0A 4QGYA 1SXSA 4EVNB 3LV3A 4NEHB 2XPYA 2Y2TA 5CSBA 2OMZA 2X53A 3KVQA 2OMYA 3P9LB 2CU9A 4X7TA 1ZT1B 3BD3A 4AQAB 5D2NC 5DR5H 3H54A 3MYZA 4YO0B 3SYOA 1H6UA 4P4RB 4P2CG 2W59A 1NGQL 1UGNA 4UDTA 4OZFB 4HS3A 1S9YB 2YGNA 5LN4A 1UZ6F 2R1XB 3VX0A 2ESVB 3DPDA 4KXCA 1W72H 1XWVA 1YMME 2YKLH 3TBYA 3QO0A 2EDXA 4UOQA 1YEHH 1RJYA 3ZRCC 2X4PB 5KW9L 2C3GA 3VG9B 1ILUA 2PO6C 4XP6L 1P5VB 2FEEI 2OM5A 1LO0L 2E4FA 1P4BH 2HX8A 4NQXB 2B39A 5EBLB 1PJ9A 4PP1C 4AEHH 5AG9A 1X5FA 3VXSB 2WYHA 5D4HA 2LLLA 3X1NA 1HHKA 3K2UL 1R3KA 5CCHE 3FRPG 5JOFA 4BKLA 3HG5A 3MKKA 3L2NA 3R19A 2ATKB 4PV8A 3GSVB 1ET7A 2EYTB 2YAOA 2ZYRA 2K9UA 3ARBD 3HZKA 1EO8H 1PEZA 3NZ8B 1WYJA 3AG4B 3CVHL 3OG4B 1Y07A 3RVTD 4YHIB 4ZTPH 2BIHA 3RB5A 3VA6A 1T6WA 1X7TA 2V9QA 3QNFA 5IJCC 2XETA 1WBYA 1MF2L 4Q89A 3IJYB 1QWNA 1YYMH 4JPKL 3GF8A 4KKRA 5HYJB 4R90L 3TZVD 1E4JA 3V5HA 3DXAB 4IRJD 3X1BA 2EINB 4HUCA 5DURB 2UXTA 4LU5H 3UZEC 3P0GB 2Z8RA 3FT9A 1AYRA 3TA3A 4UDUB 2WLMA 3V79C 5CMAB 4XXWC 2D7PA 4Z7QB 2WWNA 3M46A 4LRIC 1GC1H 1QBML 4Y19A 1PEWA 3BHBA 3S88H 3WTTA 2Q7YA 5EUKB 5BO1H 1MY7A 4HUWA 1GZPB 5MEPB 1FLTX 2NZ1A 3K7UA 4J2QA 2VRKA 4TV3A 4W9JC 5FLVA 4AK1A 2R23A 3AWFA 1Z9NA 1M3JA 3IGLA 3QI9C 1NDGA 5I8CB 1SFHA 2WTRB 2P5WB 5HYQB 1D6VL 5TH2B 5JORB 3WMSA 3FO9B 2HVKB 5DVNA 1SXAA 1U8PA 4RISH 1TQWA 2GPZA 4UIKL 4Y5YB 4XMLL 1TKWA 1XR8A 2GTZA 3EGXB 4JY6A 3U9UA 2C1OA 3MUY1 5GISH 4MFHA 2VDOH 4GQ9H 4HJGB 2J1WA 3T4YA 2ITDA 2A6IB 2YUXA 3KYNB 2W80C 5KSVB 4XNYH 3TLRA 4DFIA 2X5PA 2YD1A 4N2NA 3W9DA 2GAZB 3NGBC 4J6IA 3UBXB 3C2AL 3FYEB 5I1LA 3QXAB 3VFGH 5HHMD 2B4CL 4KMTH 1U21A 3IJHB 5IVXA 3Q6FA 3TZVC 2E4TA 2EIZA 3O6MH 2BRQA 3RGVD 2BSBA 1WZ1H 2DIEA 4PTUB 1B4LA 1TR7A 3F12A 4FQLL 5I8EB 5SV4A 2UZPA 3S3DB 5L4FA 5LDSA 3CVCA 3FTSA 3VXUA 2IAND 1YLBB 3CVBA 3TT3H 5IFJA 2WNGA 1BQLL 5HPOA 1M1XB 5F7YC 2WO2B 3PAVA 1KCSL 4IBZA 4UANA 3EJUA 3LSOA 3O0RH 3SDXE 4EF3A 1VCBC 1R75A 3FHAA 1K6QL 4OZHF 2X4QB 5C0ND 2YAQA 3P4MB 4RRPM 2J5LB 3HZVB 2VC2L 3DARA 3SDYL 1A9VA 2DI8A 1TO4A 2H0JA 3NSDA 4N0RA 5CZVH 5J57B 2BO0A 4ZO7A 2UY6A 1A14H 1YEJH 4M7KH 5I2IB 4DCQA 5I1CH 1XH2A 2NY3B 1OT1A 1HINL 5FA4A 2XA8H 2Y5QA 2RAMA 4G43A 4QY8B 4Y16D 5AVWB 3PPSA 2F7QA 1H8OA 2CWRA 4DGVH 4LMQI 3ZKND 4IRZA 4G9FD 5E6IB 2C1PA 2ZUXA 4YK4B 2WBJD 1N7ML 2AK4E 1ZS8A 4BUQA 1SN0A 2CM5A 3VRLF 2P46B 3C5JB 1B2WH 1T7WA 4H8VA 4RIRA 2H4EA 4YHNA 3DVGA 3TVMC 5IOKA 1EAPB 4N2AA 1EV2E 1M6OB 4ALAH 1YNTF 4OAWB 1UJTA 4ZS6C 2IJ0C 2MFNA 4QHNB 4KX7A 2DF3A 2BC4A 1RZIA 2V8MA 5AOZA 3O6FC 1J88A 1SJHA 1A21A 1A6AA 5HVWA 1E50A 4X0NA 3ETTA 3K5RA 1JHTB 1OAXH 4WEMB 1CICC 1E9QB 1KGYE 3RFZC 3IMRA 3W3BA 1M7XA 3LS4H 5I0WA 4WI0A 4JFTA 5T1LA 3PJSB 4P06A 3QAZB 3KVDD 3V55A 1EIBA 2XN2A 3HMXA 1ZLEA 3GI9L 4RRPG 2MPVA 4YHZL 1CQKA 2XV6B 1KIUA 1OSPH 4L1HA 4M6ML 2O4EA 1N64H 2G4GA 3QFGA 3HZ3A 4R7XA 2P5EA 1RZFL 1OGAA 1WCBA 3BPNB 1S7UB 3KG5A 1FL3B 1ES0B 2XWBB 3UTTA 4G9DB 3DOSB 3T2NH 5HHMB 5HHME 1C9SA 2KERA 5DZAA 2CSPA 3GSUA 1F2QA 3BEVB 2R0WL 3NRPA 4AYBA 1DJYA 5EBMA 1D5ZA 1ZK5A 3SODB 4BUHA 1I3RB 4D0CB 3FCTB 3KHOA 3ZDZE 4NO0A 1T2JA 5EBWB 5HHNA 2DWDA 1TZOA 4MLIA 2AS5M 2E27H 2VLMD 1TQSA 3AT9A 1YEIL 5F0MB 4OB5L 3UG4A 5AWNH 2P5WD 3QHTC 1CXFA 3GS0A 1A2YA 1M05A 4Z7VB 1ADQH 3ZT6A 5I0ZA 1JXDA 1VZGA 5FHBL 3GB7B 3X13A 3MX0A 2AQ3A 2OMXB 1VFOA 2Z31B 5DZPA 3WFBH 3BPCA 2MCG1 1LDSA 4U6VL 3X12B 1U8IB 2K3HA 3U0TA 2NX5A 2HX9A 5JPMB 1KB5L 3IBEA 1HEHC 4OLYL 3L5WA 1B0GA 1X9QA 5JHDA 4HHAB 3TA3D 2LR4A 5JXEC 2ADIB 1IGML 3LS4L 3CK0L 4M6NH 1DZ0A 2WLJA 1NAKL 1O75A 1JPST 3CDGA 4QTHA 2B14A 4LPYA 3KPMA 4M56A 4G6KH 3F5WB 1AE6H 3O3EB 1DDHB 1FVCA 1HHJA 3P4OA 4YH6A 3LQAH 3REVA 4DVBB 4KAQH 2HJFA 5E9AA 3V6BR 3BRGC 2ZCZA 1EJ6A 2B1HL 1MFDH 3RWJB 1MI5E 5F3FA 1K5WA 1XF4A 4MCYB 4WO4C 5DEFB 3EIFA 4YPGA 4MA3B 4YZFF 4E9YA 3GMOB 4ZI8A 2IVFC 4AL8H 5FGSA 5BUAA 2R56H 4LU5L 4WNSA 1U8HB 2XVLA 4H0IA 3WYRA 3ESNA 3FPYA 1KUMA 4K7FA 3T3MB 3SDAB 1A5FH 5I8KH 2VDOL 2I07B 4Z95H 2W1NA 2X7LA 4PRAA 3OKEB 3TWCL 5F7EL 5ACZB 2IPKA 3BWAA 3O6FB 1F13A 3CFKB 1KCVL 2ZUWA 4KWUA 1Q1JH 1U8KB 3DMMD 3VNZA 4KMQA 2NZ9C 3BAKA 3CLWA 3EXLA 3HR5B 3QJRB 2HT4D 5CEZE 5AW2B 4DESA 3WHXB 3CMOH 3QJTB 1L9SA 4X4KA 5DTFA 4FA8A 1N6UA 1ZKAA 4S1SH 2GJ6E 3HC0B 2IANA 3ETBF 4N2EA 2HT2D 5D7SH 5B39G 3FFCE 2XTJC 43C9A 3KL5A 5AD0B 3D39E 1RURH 2YRLA 4AUYA 3MZGB 3IXTA 3DHMA 3AXLB 1QFWL 4GAYB 4OF3A 1OW0A 1UQSA 3PCYA 4NRYB 4FLRA 4K0OA 5BZWB 1USZA 5E9NA 4HK0B 1LE5A 3AT8A 3OKMA 1GIGH 2KBGA 1VESA 5F1NA 5DJ0A 5KWYC 1UFGA 4UT9A 4X4XB 2APSA 3KDMB 1MCOH 4JZNA 2X89A 2X87A 5EO1B 2OXHB 3CDZB 2JKNA 3VXME 1RFDH 2Q10A 3DPBB 4E42B 3QUXB 4JM2F 2IDUA 1NAML 3K4ZA 1CN4A 1UWXH 3U6RA 5INDB 2VT0A 4HLEA 5BJTA 1YC8A 5D6DC 1PG7X 1MFCL 1NCCH 3D0VB 3GMQB 1FNSL 3RAJH 2EICA 4XNDA 1AZCA 3P1VA 2X4NA 3ARBB 3W56A 1CXIA 3ZE2B 3IGAA 4R4NC 3PQYE 4QRTB 1MJ8L 1U6AL 3Q1EA 2JTYA 3AREB 1Y18B 3LB6D 4FTVD 4IBVA 1SEQL 4X6EB 5FUCC 1CGYA 1QSED 2YMOA 4LVHC 1DL7L 3E1ZA 3U6XS 1PS3A 5IMKB 4OGYH 2OK0L 1A6VH 2E6QA 4PWHA 1KENL 3GXMA 3P73A 3KLSA 5L2KE 1W15A 3TF7C 1DBAH 4ODWA 3VXUE 3BZ5A 4UBDC 1J1PL 1PD1A 2ZKMX 4PBXA 5GS1C 3PHOA 4KXDA 1YEFH 1TZGH 4LRNL 4I0PD 5DYOA 2Y1AA 4QRRE 1VACB 2VL4A 4M7JL 4HFWB 4MJ5A 4MS8C 4PJEF 3T0ED 4A6YH 3PABA 4CJ0A 1E9OB 2ADGB 1UOWA 3ESMA 5E2UL 2CIIB 4PJGA 2PYED 1P7QB 4JHAH 5FFGA 2NXYC 4WK0B 4PJDB 1KC5H 2LQRA 4FNRA 5EBLA 5I23A 4Y5VC 3NEOA 5CLZA 4QRSA 4X6BB 3E2HC 3CDFA 1TJHH 1WF5A 1GS7A 4ONGL 2JQAA 3EGSA 5F89A 4D9LH 3QO1B 4C58B 3O8XC 5D96C 3RWHB 3MLUL 4GKLA 3CZLA 3NZ8A 3HC4H 3P3TA 4UTAA 2YLHA 1JWSA 3DNKA 4DKFH 4HUUB 4KKZA 2L7EA 4U3CA 2A9NH 3C9NA 4LCIH 3BKMH 4M48H 5CGBA 4PR5A 3OAYK 2EACA 2IDSA 1MHEB 4MQXD 4N90D 1SJEA 5E5RB 4BQ6A 5GRJL 1LO0H 3EBAA 2YN5A 2WY3B 5I15L 4CSZA 3C8KB 5CCGE 5J11C 4RGNE 2OZ4L 5BZWA 4EN2A 1IJNA 4P23D 3VRIA 1TSHA 3I6KA 3QZNA 3Q3GB 1DFBH 4HZLB 2VOTA 4OM0L 3UX9B 1JBJA 1FZKB 3K8KA 1FGNL 3TP4A 2R1WA 4R4ND 4UMGA 5CLXA 5IQMA 4M6AA 1JXGA 2KT6A 2VUYA 3HE7B 3C5ZB 3BE1H 5IJVA 3QUXA 1X9LA 2NNXA 4F33A 5LGHL 2OBGA 1YQ2A 3G6DH 3NIGF 3NACH 2A6DB 2PTVA 3SEPA 1T7ZA 5JW4R 2ZX9A 3RILA 5FW7A 1WIUA 1HIMH 4FXGB 4XBEH 4YDVA 1AZZC 3UTSD 3QUMA 1CC3A 1JN6B 4FQIH 4JG9A 4LT7A 4KJQD 4W9KC 4ENZA 5EZJB 2YC1B 1NZRA 4GXUN </