1BXAA

Amicyanin reduced, ph 4.4, 1.3 angstroms
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (AMICYANIN)
publication title Molecular basis for interprotein complex-dependent effects on the redox properties of amicyanin.
pubmed doi rcsb
molecule tags Electron transport
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1998-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bxaA00
2DY2A 1TU2A 2EIJB 4CSZA 1WA1X 2ZONA 3NSCA 2H3XC 2GIMA 5I6KA 1R1CA 1NIBA 5B3SB 4AZUA 2OV0A 3AZUA 3TU6A 1W6LA 2FT8A 3TBBA 2YXWA 1AZRA 2CALA 1ET8A 1MDAA 4AX3A 1JXFA 2JKWA 1GSKA 2VN3A 3NSFA 2PPEA 3ZIYA 2YAMA 1J9SA 5E9NA 2VSKB 3PCYA 5I5IA 2DV6A 2FTAA 3S3CB 9PCYA 1SJMA 3FS9A 4DP8X 2IWEA 1E30A 5D4HA 2XUWA 5F7BA 2VW6A 5D4IA 1X9UA 1EHKB 1E65A 1N70A 1ID2A 1KDJA 4M4RB 1PNCA 7PCYA 4KNTA 5PCYA 3ABMB 2AANA 5ANHA 5B1KA 3X1GA 2BP8A 3EHBB 4E9TA 4BK5C 1QNIA 2AZUA 1BXVA 3FSAA 5I6MA 4E9YA 1CURA 1EZLA 1JVOA 3QQXA 1JXDA 2J57A 2IWKA 1FWXA 1SNRA 3NT0A 1AZNA 2IDQA 2VW7A 3X1EA 2GC7C 5I6PA 2IH9A 2EILB 1PNDA 1NWPA 2I85A 1F56A 2EIMB 3SBRA 2Y1AA 3V9CA 4YSEA 2A3TA 2I7SA 2FJSA 2IAAC 2BW4A 3IEAA 3JT2A 2CUAA 2NRDA 3QJQB 4YSPA 3NSYA 4AKPA 2W88A 4BWTA 3NJLA 3X2QB 2BZCA 5I6OA 4HCGA 5A7EA 2HRHA 2X88A 5TK4A 1NIFA 1WA0X 3H56A 4W1TA 2BW5A 4F7KA 2CJ3A 1TEGA 3NJHA 2PP9A 2W8CA 1E5ZA 3WG7B 1ZIAA 2VM4A 3FQYA 3BVDB 1L9TA 1AQ8A 3CVDA 1XMEB 2GC4C 7PAZA 1JZHA 2VSMB 2BP8B 3FYEB 3SQRA 3PAZA 1TKWA 3QJRB 4G7SB 1BYOA 2TSAA 2PCYA 2YQBA 3AW5A 3QPKA 1RKRA 1BQ5A 1PAZA 3FU9A 5AFAA 4NERA 3QJTB 2IDFA 3S8GB 2JFCA 4E9VA 1KDIA 4UAHA 2BP0A 2B08A 2VM3A 1HAWA 2FT7A 2CAKA 2P80D 4DP1X 5EHFA 1ZDSA 3S3BB 1UATA 1ASQA 4A2FA 4L0PB 4ENZA 1PLAA 3MBWB 2PPAA 3AG3B 1AR1B 1ZDQA 3WNIA 2VW4A 4JHVA 5I5JA 1KYAA 1GS8A 3S3DB 1HAUA 3ZDWA 1KV7A 1GYCA 1QLEB 1WA2X 2RACA 2GHZA 1NINA 2WO2B 3V9EA 2XXFA 3CDZA 5IY5B 3DTUB 2IDSA 1FA4A 3MX0B 2HRGA 1NTDA 1JXGA 1B3IA 4AKQA 3H4HA 3ABLB 3FSVA 1SDDA 1AZUA 1MG2C 4G7QB 1AAJA 4HALA 2MRYA 3GYRA 3CZUB 3N55A 5TK2A 2PPCA 3PAVA 3H4FA 1PZBA 4DP6X 3CVBA 2XX1A 2VMJA 1HFUA 3CVCA 2BWDA 3FU7A 4PCYA 4YSCA 3OM3B 1JZIA 4Q8BA 4KO9A 4UF7C 3UACA 1CC3A 2QPDB 2YXVA 2Q5BA 1J9RA 2FT6A 1ASPA 1J9TA 2BP0B 2DWTA 2IWFA 4YSSA 6PAZA 2MTAA 3EH5B 3KW7A 2GBAA 4F2FA 3PLYA 3NJIA 4AI7A 2PP8A 1ET7A 4BDVB 4G70B 4YSUA 4MFHA 1VLXA 1ZV2A 3NJNA 2UXVA 3L45A 4PAZA 4NB7A 1ADWA 1WS8A 1M56B 1BYPA 3C75A 2PP7A 1PZCA 1BEXA 2PCFA 3FPXA 3CDZB 3WKPA 4DP9X 4KNUA 1KBVA 3UABA 1V10A 1WS7A 3AG4B 2YAHA 1NICA 4K9JA 1SDDB 4A67A 4DP7X 4NAJA 3OD3A 1JZFA 4HIPA 2BHFA 3QJVB 5B7EA 2XV2A 3T6VA 3QJUB 4GP8B 5B1AB 4A66A 2BWIA 2GI0A 1URIA 1GW0A 4YSOA 2QT6A 1OE3A 1NPJA 1BQRA 1A4BA 1ZIBA 4E9SA 3FU7B 2H47C 3RYMA 2HX7A 3KW8A 4G7RB 1SF5A 1W6WA 3GXUB 1NDTA 3TBCA 1IBYA 4HHGA 1SHWA 1L9RA 4YSQA 3WI9A 1IBZA 2XXGA 3FSWA 2J55A 1PZAA 2TSBA 1JVLA 2AVFA 4E9QA 4E9RA 1ASOA 2FNWA 3G5WA 4DP4X 2HX9A 2UXFA 1XB6A 3NJKA 1OOWA 2YAEA 2PPFA 2XV0A 3UAEA 2CBPA 2PLTA 3T71A 2OJ1A 1ILSA 1AG6A 2XWZA 4YVNA 5FC9A 1DZ0A 3NSDA 1JZJA 1OV8A 1JZGA 3OMNB 2IDUA 1TEFA 3HB3B 1AS8A 3PPSA 3BQVA 3NP4A 1GY1A 3NJGA 2XLLA 1JERA 4X4KA 2UXTA 3T6XA 3ZBMA 3WIAA 4BDVA 2ZOOA 1MG3C 4WTQA 1E5YA 1NIEA 4JHUA 3PAUA 2Q9OA 1SFHA 1BXUA 4YL4A 3N2JA 3T6ZA 3ASOB 2ZXWB 2CCWA 4HCIA 1OE2A 1ET5A 2Y69B 2QPEB 1PMYA 1NWOA 1A8ZA 1SHXA 3QJSB 1BXAA 1SF3A 2EIKB 1XB3A 1CYWA 4WKXA 1RZQA 2HX8A 1OCRB 2FQFA 4TXVB 3D12B 3SBQA 3SBPA 4G72B 5D4JA 3X1NA 1AS7A 1IC0A 3EH4B 5PAZA 1OCCB 4DPCX 3CG8A 1GS7A 5I5MA 1AACA 1JOIA 1PY0A 1CYXA 3FSZA 4KO6A 5AZUA 3FQ2A 1ZPUA 2OCCB 1M57B 4QKTA 4W9ZA 4HHWA 3OQRA 2H5UA 1BQKA 3EH3B 3FPYA 3ABGA 1KBWA 2WO3B 1NIAA 3AG1B 5B1BB 5I6NA 3NYKA 4GYBA 3FU8A 5AKRA 4KOBA 4YSAA 4A2DA 3ABKB 1PLCA 1GY2A 1E67A 4KOCA 1W8EA 4KO7A 3WKQA 2EINB 3IE9A 4YSTA 1GR7A 3IN0A 1I53A 1RZPA 4ZK8A 2JXMA 5F7AA 4KNSA 1OF0A 2HXAA 2DYRB 2XX0A 4P5SA 4JKNA 1A3ZA 1MZZA 3PXLA 4DP0X 1OCZB 3EF4A 4G71B 4BXSV 4DP2X 3S8FB 3FT0A 1NIDA 1A4AA 5B7MA 2FWLB 5B7FA 1CUOA 2WSDA 1OE1A 4A68A 6PCYA 5I28A 3AG2B 5I26A 1YLBB 4GP5B 1AIZA 3T9WA 2I7OA 1KGYE 1J5DA 2YAQA 3NJJA 1AZBA 1DYZA 2FQEA 1IKOP 2ZWNA 2QDVA 4N4YB 2E86A 3TA4D 4DPAX 1A4CA 1L9PA 4A2EA 2N0MA 1NPNA 4FAAB 1V55B 4FA7B 1J9QA 4Q89A 3NP3A 4N8UA 2IH8A 2GSMB 4YVUA 2FQDA 1ILUA 3DIVA 2LLNA 4KO5A 2XVBA 2R7EA 3UADA 4UANA 1PCSA 3ERXA 4HZ1A 3T6WA 3U25A 1A65A 2FQGA 3ZX1A 1V54B 3AY2A 3JTBA 1J5CA 4HCFA 2QDWA 5I6LA 3UAAA 1MZYA 1AOZA 3X1BA 3FQ1A 1N68A 4YSRA 1KCWA 3OMAB 1QHQA 4QLWA 1L9QA 4GXFA 1X9RA 2YAOA 2AZAA 1AS6A 3ASNB 4HAKA 2XV3A 2BO0A 2X87A 2B3IA 2J5WA 4M3HA 4DPBX 2XYBA 3IBOA 3WNJA 4BWUA 3TASA 2DWSA 2YAFA 4AKOA 4DP5X 1NZRA 1BAWA 3UGEA 1M9WA 2YAPA 1L9OA 5LDUA 5B1JC 2J56A 5B1JA 1IUZA 1JZEA 2GB2A 4BWWA 1SFDA 2UXGA 2HZHA 2DYSB 3NJFA 2AFNA 4A2GA 3IN2A 4GP4B 4P5RA 4E9XA 1RCYA 3X1FA 3HEIB 1T5KA 2P80A 1L9SA 1XB8A 2UX7A 4GY4A 4EF3A 1PF3A 4YSDA 1AANA 2BZ7A 2UX6A 1KCBA 1WAEA 1ETJA 1OCOB 2R7EB 1GS6X 2XU9A 4F2EA 4CSPA 3GDCA 3DKHA 2PPDA 1PLBA 3OMIB 1AG0A 3NJMA 3FYIB 4E9WA 4A2HA 2YARA 8PAZA 4RH4A 1AZCA 2IDTA 4BXVA 2HLEB 1FFTB
chains in the Genus database with same CATH superfamily
5G5DB 2NX5E 3CFNA 4PJHF 1QSVA 3TV8A 4FNRA 5C7XH 2Y36L 2FR4B 2H3XC 4CILA 2DQIH 4GQRA 2ED8A 4G6FB 3V6FB 3ETTA 2WN3A 1G0XA 3FQ4A 2APXA 2R1YB 5SV4A 4GSQA 3IJ9A 3QR0A 4I5BB 3VH8A 4N1CA 1LQSR 5KYXB 4ZW3A 3W38A 3BE1H 4GEJA 4MNGA 4NKQB 4M02A 4DW2L 1AZRA 2F5BH 4PJAA 5GJSL 1MW3A 4F2ME 3MV7B 1ZD6A 1Q94A 4ODWB 1F3RB 4P4RB 4L8SB 5C0BB 1SN5A 3GS4A 4IRZL 1NC4B 2F61A 3BQUB 2NY4D 5DEZA 5DJ2B 5DJXA 1JZ7A 2UY6B 5IHZA 2Y7QB 3CC5B 3GSXB 4KKAC 2DV6A 4QRRD 3LXAA 1KTKE 1TQUA 3WHXB 4NRYA 2A1WH 1UCBH 1QNZH 4PWIA 2X7LA 1EFQA 3L5WA 4DTGL 3O4LB 3IMRA 1WAAF 1OAJA 3MRGA 4G3YH 5HI5C 4OD3H 4M4RB 1PIFA 1OAZH 3C5JB 3D18A 3G6JF 2R0KH 5IB2A 2DJSA 4PRIB 1OIOA 3DJZA 1K4DA 3GJFH 1SJHB 3GLZA 4P2OD 2BSBA 2QPFA 3I02A 1EDYA 4JKPL 2CDEA 2IIJA 2OX5B 1X5KA 4L37B 1OGAD 1D5ZB 4B0MM 4D2NA 4BKLB 4OQTA 3K6IA 5EA0L 3VI3E 3L3KA 2N1KA 5AVYB 4DZBA 1TETH 1UM5L 5E5MA 2EYSB 1JZDC 5CN1A 5L7XL 5EBLA 2TRYA 4BZ1A 3CWGA 4YHKH 1NBVH 3QHTC 1UGKA 4S2SB 3KM1A 5B38G 3D0AA 1YYML 1FVDB 4L3CA 3V0JA 1WZ1L 1JTPA 3A4AA 1UD5A 3QXAB 4F58L 3EGDA 1A7RH 4LARH 3BXNB 3GLAA 2Y0SA 2WBJB 1UD8A 4XI5C 5EZLB 4E0RB 1NEUA 2X4RA 2Z91A 4IOIA 1L0PA 1FHNA 4ZMTA 1NDGA 5I24A 5MEOA 3DTXB 1QI4A 4J4PA 5E2VL 4OT1L 4MDIA 3BUYA 4PBDA 5E4EB 4TVPL 2ILLA 4PRHA 2K8MA 3VXOB 4MAYD 5I1CH 3T0AA 2WKOA 2YEQA 4XPTL 4Z5RB 1UWGL 3T0EE 4A6YL 3UPRB 3ECQA 1ORQB 4K3DH 1AYOA 2H4EA 3B83A 3P1VA 2VR3A 4WJG3 2R1WB 1DANU 4WUKL 5TDNB 1UD6A 3QFJB 4UQEA 2NY5H 4AMKL 1O9VA 4PY7B 5GRWA 1WAAA 4MJ5B 4MA8H 4XN5A 3O0RH 3G6JA 4PB9H 2BP8B 3ZZSA 4JG0L 5FCUH 1GPOL 3OF6D 5IVXE 3QDMA 3P2DA 1T2JA 3NIGE 1O9ZA 1IM9A 5CCKL 4L18A 3DX3A 1EXGA 2VMFA 1RERA 2ZX8A 3LN4B 3MV8A 1D5MB 2B08A 2V3FA 3GC3A 4LCUB 5DRNB 2WSPA 1I1FA 4GT0A 1W0YT 4PN6A 4U33A 1IQWL 1M2VB 1ACYL 4KKQA 3WJJC 1ZDSA 2B0SH 1QLEH 1N5AA 4A2FA 3F7YB 4WFFE 3O4OC 3IU3B 2XKSA 3R06B 2B7DT 3VRIB 2CKNA 4GLRI 3TP4A 1MRFH 3CDYA 5EULV 1GYCA 4FFYL 4N2OA 2RACA 5A2KH 3QFGA 2WVSA 4QRPA 2EIZB 3VFGH 3B3IB 4XNMA 1OTUC 3DX7A 4QJ5B 3M1BB 1CI5A 4RAVA 3SO3B 3KS0J 2JCCE 3LRSB 4XNQB 2Z8WC 1U8JA 4HKZB 4ZNEE 2J7LA 3A67L 4GKZB 2HFGH 3DRQA 5CZRA 3L7EA 4LAQH 5DVMA 5EBWB 43CAB 4AV5A 4D9LL 3GYRA 5TK2A 2M83A 3EDDA 1J5OH 1KFAH 4JANA 1WDAA 1JCKA 3L6FB 2FD6L 2OMZB 2JQAA 4NFDA 4XBGA 2VLLA 3AU0A 3GBMH 5HYIA 5KBKA 2VDPB 5GS1B 3LXBA 1C16A 3AWGA 4Y5VC 5I71B 1IGTA 4AT6B 5AVUB 3VWJA 3MXWH 1S9YA 1XDTT 1SN0A 5D1XD 4TULH 3LMJH 3QYNA 1NEZB 4H20L 2IVFC 4DT2A 3QI9D 4ABWA 1CDIA 1ADQL 2JV6A 2PP8A 2WLJA 4ERSH 1TO5A 3EYOA 2AQNA 3A4FA 3IJSA 4H7VA 1HCZA 1JWSA 4JO8A 2XTLA 4KI5E 3V0VA 1M05A 4XNYH 2OMYB 3SDAA 1T83A 4OGAD 4OJEH 3BPCB 4ZFGL 1NCHA 1KYOK 4RFOL 2D7TH 3L45A 2XQBL 4HZLA 5J13B 4HFWA 1JBJA 5IQ9A 4JX0A 1KGCE 2EXYC 3VJ6B 3VWKB 3S4SB 5KSBF 2XNAB 3ZTNH 2G9HB 1D6VH 1CCZA 1V10A 5I1KH 1T3FB 3MNWB 4NNYB 5E4IA 3WS3B 2Y06H 1O7DE 3QEGL 1KCSH 1BZ8A 1RMFL 3DSFL 1BXXA 1QW9A 4DZ8B 3AU1A 4KTDH 2B59B 3MZGB 2Z7ZA 5I1DB 1CD0A 3VG9C 2DQJH 2QHRH 4ZMLA 3F05A 5D71H 3GBDA 5FLVA 3W5NA 4PRNA 4JFWA 3NGBB 4HLEA 2OLDA 3KVDD 3SZKC 3WFHB 3JSSA 3NTCH 3AACA 3O8XC 3QUGA 4GQZA 4PV8B 4TVPE 2ZYSA 3GMLB 4WFED 4FMFA 1I1YA 4R7LA 1A1OB 3LQZA 2R83A 5F0LB 2F1EA 3P2TA 1VCBC 4QXWA 1H6UA 2XXMB 3BPNB 2DEWX 3S7GA 5FYKL 3PL6B 4OD2A 1QYGL 1LM8V 2NXYC 5IFAL 5AL0A 5DK0B 5JHBA 2IPTL 5FEBA 4MXWL 5GIRB 3EJYD 3RDTB 4E9RA 1ASOA 2DWEB 1QTSA 3CSYB 1U8MA 1WQVT 1R3IL 2OJEA 2O61A 4CC0A 3ZN6A 1E8ZA 5AW2B 3O6KH 4WWOA 1HE8A 1RK1B 3FB7B 2VE6B 1P5UC 4Z0XA 4HIXL 4Q4IA 2ZWKA 4U1GB 2IDUA 1VGKA 3H9SB 5IW6B 3LN5A 2QKIC 2CGZA 2GJRA 2E75C 4MTMA 1LK3L 1M7IA 4RGNC 3S36X 3ZQ9A 1CE6A 1EFXB 2IBBA 3FO1B 5AB0A 4RISH 4XN4A 3IMWA 3BIBX 4P2OB 5JW3H 4AL8H 1FL3B 5J6HA 2VWEC 2WVUA 3BP7A 2SEBA 4JRYE 3TO2B 4KK5C 4ZUUA 4ZS7L 2OSLA 3K3QA 3D9AH 3DJRA 4FQQA 1JNLH 1Y18A 1HZHL 2WN2A 3MREB 3MA9H 1KG0B 4HOMA 2VDOH 2OW6A 3E80A 1OP3K 1QA9A 4PCSA 5DD3H 3P4NB 4P3WA 1SF3A 2NNAB 1ONQB 3ULUH 4MS6A 2V2XB 3B2MA 3ROLA 3L5JA 3EF7A 5LWYH 2QZ5A 4AQAB 2ZUSA 5HDQL 4A7UA 4JLRA 2DQHL 2E27L 2A6JB 4A38A 1C5BH 3MV9E 5BZZA 4AGPA 1V3KA 1GS7A 1SXCA 1N5YL 2ZYRA 3C12A 4W6YB 3HI5L 4Z7VB 2VR4A 4FL4C 4GIAA 2AABH 3IDXH 4MAYB 3QZMA 4TSBL 4KUZH 5IBTH 4DN3H 3U46B 4ZAKC 2MHAA 2DS4A 2HVJB 1NMBH 5FGRA 2WMPB 2ZJSH 1R0AH 5FR3A 4K3GA 1XMWA 2ZF9A 1O6SB 3PHSA 1IAII 1RZ7H 4D3CL 1AR2A 3PS6A 3QJZA 5AOJA 1A4KB 4PGDA 5LCVH 4U3SB 5F9AC 1ZSDB 3QYCA 2NQ3A 3ARFC 4LEOB 1IBDA 2PO6D 3IN0A 3U0TB 1RZPA 1YNKL 2V3DA 1J8HE 4X7FC 1Q1JH 4UTBL 5CJ5A 5GS0C 4Y2OA 1BFVL 1F41A 3L5XH 3E6HA 3MNZA 4N8CH 4C56D 4NQXA 1HQRA 4PYHA 3ZL2A 5BMFH 1RZJL 1KEMH 5DMGC 3S8FB 5H4ZA 3KHQA 5F88A 1E28A 1F42A 3HFML 4I87A 1FFPB 2D03H 3UYPA 4P8QA 5GGSY 2IGTA 1OE1A 1YNLL 2V6HA 4Z3TA 5AG8A 1KGYE 1J5DA 3OZLA 3TBSA 3K8LA 4PS4H 5FKPA 2VSCA 2IQ9H 3OPZH 4K9EH 2E86A 3CPLA 4AEIH 4NSKA 1G43A 4FAAB 1XF4A 1XGPA 2NSXA 4PTTA 3WFDL 2R0WL 2IQAB 3MXVH 3RJQB 1QFUH 1FE8L 4NQCD 3F64A 1D5BA 5E9DE 2JLLA 5TE4H 4Z3FA 2ENSA 2LTQB 1PQZB 3ZZ1A 4IOFC 4RMQA 2DL2A 5G4OA 4ACPA 3K7UA 4QHUA 2P43B 5IT2L 2EH7H 2COQA 5ABAA 5C09E 3U6XS 5FYKE 3AXIA 3A5VA 4GKNA 3HTLX 3WE6B 2ZCHL 4TTDC 3L3HA 2NY2D 2OTUB 5T1KD 4LSTL 1Z3RA 3EBIA 2HN7A 3ZRSA 4M6MH 2B4CL 3EZJB 4GAYB 1AS6A 2ORBL 4LQ1A 5IF0B 2PWEA 4BHUI 2F5AH 1QTPA 3O6FB 1H3PH 5KOVC 2BO0A 5LDSA 3RNQB 1N59A 1G9EA 2L8AA 3JUYA 1QD0A 4HK0A 5KN5A 4BWUA 4JKMA 4FQLH 3DRTA 2CG9X 4PGCB 2VLRB 3TF7C 4JO1H 1OAQL 4BFFA 1E9OB 1NGQL 5E8PB 3O3EB 5JMRA 4P23A 1J1XL 4UQ3B 1JZEA 5E8NB 4EI5A 4DN4L 4QTIL 1KYDA 3D3VE 4AGLA 1TYJA 4JFTA 4P5RA 3RB7A 5C07A 4GBXD 5HHMB 5A3IC 3FT2B 4OAWA 4JR9L 2FK9A 5ELIA 4BKTC 1QSEA 5IM7A 4EF3A 3B9KB 3IFLL 1YECH 3BAEL 4OLYL 3QULA 5EN2A 1NCIA 5TE7H 1HQ4B 2UX6A 1WAEA 4IRSD 1IC7L 4HP5A 1F8TH 2HVKA 4TN9A 1J18A 2QELA 3V0GA 1OHQA 5I73B 5BQDA 2R27A 2J25A 5IBLC 2YEZB 1AJ7L 2PPDA 1PLBA 4RMWA 2RQEA 2XWBA 1AG0A 3B7SA 3U4EB 3FYIB 2Y5TB 3B5TA 3L9EA 8PAZA 1DFBH 1MW1A 2VN4A 2IDTA 4FHJA 4BA8A 3WKMH 2HTLD 4M1DL 4LKCA 4CSZA 1XGQB 3ARYA 2WM0A 1D9KD 4RGOH 3LEYH 3T0WA 8FABA 1FRGL 1EAOA 1HI6A 4NBZB 3ZOAA 3MBEC 4OF8A 4AYSA 4EKXA 4YDLB 4MYPA 2Y5EA 3UC0L 4WQOA 1W6LA 1AHWA 1HYRC 4JHAH 2VJ0A 4GRMA 4F7EA 4A7GF 2WWMD 2VDKL 2WCSA 3G6DL 4NYLA 3RUGF 3OWRA 4MQSB 5CIPH 2PPEA 5D8JH 2XY1A 1DE4B 2OMNA 1KIRB 5LG6A 3HC0B 4JRXA 3E2HC 4HS6A 1IBGL 4EQ3A 3S3CB 2EC8A 4G6MH 2IWEA 1ODUA 1IGCL 3T77A 4GAAA 5LBGA 1E65A 3RILA 4PR5A 5CEYB 3D6GA 4NN7C 5F97E 3BX7C 4J3WA 3T0VA 3O9WD 4YR6B 5EBMA 3ZDXE 4H0GA 4ZBJA 3U1PA 4PJ8D 5FGBA 5E1GA 1EZLA 3SCMA 4V2CB 1KN4L 5KVDL 4BZYA 4PJEE 3BKCL 2Q0ZX 3N44B 3QG7L 4UNUA 2C7FA 2J57A 3I85A 2F53A 1L3NA 3QRBA 5E9AA 4UT9A 3QPXH 1AE6L 3EFDL 4BSVB 5CR1A 1YQ2A 5GXBB 5DF0A 1RSFA 3CZSA 3RGVA 4WV1B 1ZT7A 2QVKA 4DQAA 2K3HA 5AZ2L 2OR9H 3HS9A 3QUYD 4C4UA 3VXRD 1KUMA 1LJMA 2CKBB 1OLLA 1ZV5A 2A4EA 1G1CA 3STZB 2XWJB 5ID0B 4ZXBC 4MJ6B 4KZDL 4A7GA 1EAPB 1SYSA 1YPZF 1OAKH 4XXWC 2X88A 3RA7H 3RZCA 1TOXA 3B1TA 3FQTB 2WVVB 3MNDA 1N2RA 4XO8A 4RFNC 3GXDA 2JF1A 3NJHA 3UBFA 5JPMA 4L1DA 3QCVH 5I18H 1UWXK 2OP4L 3OLIA 4XWOC 2N0KA 1XV8A 1XH3A 5CSZA 4NRXA 1R3LB 1UD4A 4XRCA 3A6CL 4F15B 3LZNA 4P9HH 3HC4H 3ULAB 3E1F1 3OKEA 3E8UH 2WNGA 3QEQE 2J8HA 3PGDA 2PO6B 1TKWA 3QRFM 1CFQB 25C8H 2Q3AA 1BYOA 2X4PB 1X9QA 3D4GA 2PCYA 1RFDL 4HGKC 5DQ9B 1JGLL 4R7VA 5EIQA 1BJ1H 4C56B 2TRHA 3EYSH 1IBBA 1PSKL 1BBJB 3KYMB 4OW6A 2VM3A 1OTTC 3FOMA 1QFPA 2WB1A 3NZ8A 3SKUD 2XCMC 2H2SD 2XIIA 2IJ0C 5BRZB 4DVRL 4I18A 1JNHA 4H26B 5D72H 3S3BB 3SB3A 3RAJH 4GG8B 3SPIA 4F1ZA 4X6DF 2RB8A 1L0YA 2EAEA 4JCMA 1VHPA 3LH2L 4M7JL 4XN9A 1HXMB 4N90E 4JHVA 4GRLA 3SGDH 3EJCA 2RQ8A 3FCTA 1KV7A 2EDXA 4Z8FH 1OOAA 1N7MH 3CXFA 1A1NA 2YC1A 3DHJA 4N0UE 2WTRA 1KCKA 4TPRH 5EO0A 4Z78A 5AUMB 4ZSOE 2VLKB 3AB0B 3KGUA 2J6EH 1IC4H 1SLVA 3TT3L 2XACC 1YPZA 3HLAA 3VD3A 3D69A 3FSVA 3I74A 3MLSH 4J27A 4OF0A 5MERA 3IRCA 5K9QI 2EDWA 2GJ6E 5T1KB 4Z76B 4NKIL 5F44A 1T21B 2J71A 5INDB 4YNYA 3ULVL 3PYCA 4GUOA 3PAVA 2EC9U 2UY7B 5ETUB 3WKYA 5BV7H 2Y1VA 5KSBB 1LEIA 4EOWL 2MCAA 4PCYA 3CVCA 1AD0B 2BWDA 2Z4QA 3WSQH 5KBDA 2QADC 1GGIH 1S7SB 3D05A 4NLHA 1YNTA 4J3OD 4QRTA 3EOAA 1VKXB 2IWFA 3M8OH 4YXHH 4IJTA 1FNEB 4UU9B 1E40A 3KW7A 1I8MA 2GBAA 2I24N 2ITFA 4WRLA 4F2FA 5GRYA 3VYOA 4AYFB 5JDSB 4FE9A 4WTZG 3COOA 2UZXB 4TL4A 1Z9SA 5HDOA 4HWEL 4PYGA 4OGXL 4R4FL 4OGQC 5FOBA 5L2KE 1JZ3A 2IAMB 5JHDD 2HPOA 4JB9H 4WW2C 5T5FA 1R75A 3V79C 1TVBB 2DDQH 2VRQA 4RNRA 1KEGH 5HYJD 5KVDE 1T4KA 1S78C 5E8DH 1FYTD 1BZEA 4OCYL 4NXKA 5IJVB 3L9YA 4Q6IA 2CKBH 4IIQA 5FO2A 1J5HA 5LB1A 1NOFA 2YD1A 3LSOB 3QJHB 4PP2B 4CN6A 2UZIL 3IGAB 3N85L 4NAJA 4U1JB 4NO0D 1JFHA 5C0JB 1BF5A 2D7QA 5D5MF 5C3TA 4Y19D 1MIMH 1N67A 3OKDA 2MQGA 4RAUA 3B5GA 4B9IA 2H1XA 5EEXA 3Q13A 4KHTL 5HHVL 1LMIA 4WDIB 1G6RH 4LQFL 3TJPA 4F80A 3P9MA 1NSNH 4ZX3A 5I66B 3KW8A 4K3EH 1D9KB 2OMBA 1BWMA 1JCVA 1B0GB 2X40A 2JH2A 2EECA 3WE1A 5M94B 1MCWM 4H40A 4U6YB 4YSQA 4U1SA 4CKVX 2EACA 3ELAT 3NCJH 1FL5A 1FORL 5I19H 2XN9A 2BNQE 3KPLB 1YY9C 2OSWA 3NJKA 3UTPE 1MCDA 3KEHA 4XCFH 5F1IB 2YAEA 3T1WA 3M7OA 2VXQH 4PRDB 2BVOB 5TH2B 1TQBB 4B50A 2OJ1A 2VRKA 2Q7YA 1IBFA 2Z65C 3HVNA 5E8OB 5I8KL 4I8DA 4ZPVA 5T33L 1TEFA 4D9RD 2A9BA 2NZ9D 3U0PA 3MUZ1 5EF3A 1FH5L 3NJGA 1PIGA 3C8DA 4XP4H 3D2TA 1S6NA 2XA3A 3B7YA 3T2NH 1G5AA 2WLYA 3GMPB 2QLYA 2HP4A 3WNLA 5D1ZI 3U0WH 2PWDA 1YG9A 1A14H 2GBTA 3VGAC 5KSAC 5DJ8A 5CD3B 3GHEL 3K6SB 3V7MA 5H35A 4FQPA 3LHPL 3QZWA 1T80A 2B3RA 4Y5YA 1A6TA 1P7KA 4KQ3H 2R2HA 4DGWC 4Z3JA 2CD0A 1D5XB 4XP5H 1JRHH 4YEEA 4FI6A 1IAIL 2JNZA 2LV4A 2MEJB 5CMAA 1VRSA 5EPMB 1MCKA 3BVNB 1IILE 4AM0A 3C5ZC 4LVOB 4OLVH 1XXDC 2ZCKL 3OVUB 4XNUH 4JJ5A 4LCWB 2O5YL 5I1IL 3RGBA 5C6TH 1OARL 5DDHB 4OFKA 2XG5B 4FABL 4FQXD 4JQIA 4NPYA 3N41B 3F12A 5D4JA 5IUSA 4B96A 2BRRH 4Z77B 4Q7DA 3QIWB 1KJVB 1ZT4B 4UB0H 3VXMD 2J1XA 4JM0A 1RP8A 3EOBB 5FYKU 4L9LC 4QY8A 2ZUQC 3BH4A 3VI3F 3ULVE 5TQ2L 4GRWB 2OCCB 5DUPH 1M57B 2YR3A 3B37A 5C08E 2ZP9A 5BO1L 2NYKA 4K15A 2NX5A 3SDXB 3K2UH 4JREB 1U8CB 4ODHH 4YHNA 4XMLL 5TDOB 1G6VK 1TQWA 2NY3B 2WO3B 2OZNA 4G8GB 4QTFA 4XN2A 5AKVA 3VW3H 4PJDA 3AY4A 4U1LB 2Z31C 1J1PH 5K9QG 3V0IA 1GY2A 3SKJL 2P7TB 5L8JB 4WO4B 2VDQL 2EEDA 3GSNA 4Z95L 5KVGH 4HIIA 3SKMB 3EO0B 1ZAGA 3GNMH 4OZGB 3BWAA 4B0MB 4R0LB 1PBYA 4Z3EA 5DO2C 4MD4B 3SE8H 4EJ1C 2V2WB 3LIZA 5DRXB 3RTQA 5J8OA 4UT7H 2C8NA 5BZDB 3DUUA 4OZHF 4Y16B 3VXTB 2JCWA 1D7CA 3D34A 5JIPA 1IGJB 4P5TA 5FKAB 1A5FL 3X3GH 3MRCA 2X6CA 4K5LA 2DM2A 3KPRB 3B7UX 3M88A 4CMHB 3IPFA 4EN3B 2AXGB 4HUXB 1KB9J 1BD2D 1CLZL 1E6OH 2QDVA 3IFOA 5H94A 3TL5A 2PW1A 1K72A 2N0MA 5IVXF 3HZVA 3RX7A 5E8EB 3NIGF 3JVGC 1FC2D 5DS2A 4PJCA 3P4LA 3KHOA 4NT6A 1C7TA 5FW7A 4A39A 4UCFA 2NNXA 4H4NA 4I9WD 2YUVA 5ACZB 1M7DB 2ZKHH 1HH9A 2BH0A 1C1EH 2CJSA 2K3TA 2O5ZH 3ZR6A 3GSUB 4IOSA 4F91B 3EG9A 3D48R 3SDCA 2PCPB 4J2QA 4YIQA 4HCFA 1F11A 5CBEA 4IEFA 4JDVA 3S5LG 4J8RA 4HBCL 5CP7B 3BC9A 3L3JA 5BW7A 2WLIA 1BAFL 3FNKA 5FB8B 2Y3AA 2CIIA 1AQHA 1BGXL 4HK3J 1NMCC 4BINA 4UT6L 3EZ8A 3QUMH 3H7BA 1UVQB 1SMOA 3BLBA 3KBHE 2MCMA 2X53A 4XCNB 2VZSA 3C6LB 1MEXH 3ESNA 5BOJA 3EDKA 1N0XL 4U1IB 2VQTA 1HXKA 2XY2A 4APQB 3NACH 3U4AA 2JCCF 4QT5B 3T0EA 5ANME 1U3HB 1MWAB 5HDBB 4QLRA 2FX7H 5BS0B 4OZHA 3I84A 3L1OL 5HPMB 1TJHH 1CDHA 3NSXA 4R8WH 2GK0B 5LDUA 2YUZA 4NN6C 1U8QA 1NAML 3VMOA 4G8EB 4HJ0D 4JAMA 3QVAA 5JHDB 2AEWA 3KPSA 2PTVA 4A2GA 3KJ6H 4GUQA 5HYJB 4QRUB 1EO7A 4Y9CA 1CBVL 1FYTB 1F3DJ 4GMSL 3OXSB 2HMID 3QR2A 1QFWM 2C7UA 5J1TC 5LQBL 4TLSA 2P5ED 2WO4A 1EHNA 3ZZQA 3S35X 4KPHH 1FNFA 1U8HA 2GUOB 4KI5F 4FNSA 1N18A 4GRWH 2JK5A 4NO0B 3FO0L 4AMWA 2K9FB 4WUUE 2HKFH 4YHLH 1JYXA 2BVPA 3QFDA 5ID1A 5LNGA 3FK3A 3QUZC 4UDTA 1OSPH 5GZOA 2Z35A 5BQ7A 1H5BA 4U1KB 4XMPL 3CFEA 1T5XB 2V8LA 3PXJA 3QDGE 4G9DA 4GPVA 1J87A 3CIQA 4N9GB 2JIXA 2UYLA 5TDPB 3B2VH 4LLYA 4WK0B 2JCCA 4FFTA 1EVTC 2EKJA 1XZWA 3TU6A 4ZNEA 4RBPK 1R3JB 5ILTL 2F0CA 4G8AC 4ZTOL 4X7EC 1MDAA 3BUBA 1RZFL 3FFDA 1ZV9A 4I1NB 3WNKA 4C4BA 3H1ZA 1RD6A 2VDLB 2ZX9A 3F58L 4Y2DA 3U1SH 1QTYT 5IVZB 4K94H 2O26U 4R26H 3X14B 1HJBC 3ALXA 3HMWL 3ZYIA 1U6AL 4KKAD 5F9DC 1KYOJ 1PKOA 3IDJA 1AGBB 2XUWA 1E3FA 1JXKA 2ATKB 3D2UA 4IU2B 1X9UA 3HI6H 3FH5A 2JB5L 2GSGB 3PJNA 1KDJA 5HI5D 1LD9A 2P8MB 2YPLD 4X9FA 3H9HB 1TXKA 1K2DA 4NCC1 1BZ7A 3AM8A 5J11C 3M17B 2AJUH 1N6QH 4JFPA 2TAAA 1RZKL 1G5GA 1PVHA 2HT2C 4P0DA 1A6UL 3IJHB 4NC1C 2YD2A 2HA1A 2ZT9C 1S5HB 4JM2B 1MI5A 1CLOL 2Z0BA 1HHJB 2XN0A 2K78A 2Z1KA 4QOKB 4EUPB 2RAMA 4OFYA 4AQEA 5HHPB 1YEFH 3NBNA 2EC9T 1I1AD 3OKYA 1TQCC 4OD1L 4GINA 5IMMA 1KN2L 1NGYB 1QBMH 4LHQB 3GO1H 3VD1A 3S2AA 3ILQD 3VH8B 4Y4FA 4XI5D 3CZLA 4J3OH 5KBNC 4KTGA 2AERT 4MMXC 1MSPA 4PJAB 4YSPA 3WIHH 1Q94B 1X4YA 1GOHA 3MLYH 1PG7X 1TTCA 1V05A 5DJXB 1YEEL 4JVWA 5FLUA 4XMKL 1NIFA 3VM5A 5IHZB 4UQDA 1ZVSA 5KYYA 3H85A 3IMUA 4NS0A 2VO8A 3W57A 2WK2A 4NRYB 3WO3B 5FYJE 3FB6A 4Z3IA 2X7LB 3L5WB 4OJAA 5DEGA 5DSCA 5C97A 3DYMA 2YJLA 3V10A 3MRGB 1O6VA 1F4XH 3FULA 4A6YA 3TN0D 1TEYA 1HIMH 1YMME 3CVDA 2GIXA 3D18B 1P2CA 4R6UA 3KLHC 3TBVA 4G1MA 5E51A 3KWTA 3NEEA 3PAZA 3I02B 4GKSB 3N6YA 2EDOA 4U7MA 4L8DA 2B1AH 4S1DC 1X5LA 1ZOXA 1MFDH 2YJQA 1HN1A 3QZBA 5E5MB 4X99B 2JKIS 3ZSTA 1CFMA 4M1CD 1SJVA 3SDDD 4KRLB 3UJTL 3VXQA 4DP1X 4BUHA 4YUEL 5C0IA 4HWNA 4PJHB 2G3ZA 5I1HL 4ZQKB 4E41D 1EBAA 4ISVA 5BVPL 4HF5H 5GGRA 1QQDA 3DMMA 1UFUA 5EC1A 2FEDD 1HDMA 5F89A 3ET9F 3UTQB 3ZMEA 3CH8A 2C3VA 2X4RB 3ATAA 2Z91B 4IOIB 5DYFA 5EUKA 3AREC 1GS8A 3Q05A 2GHZA 3C87A 3BUYB 3MOAH 1NINA 4MDIB 2G5BA 3C60A 2V17H 4U3CA 5AVXB 4X5WA 1FA4A 4KGLA 5LGKA 4NO3B 4FF9A 4XWGL 1VENA 5KVEL 3QUKB 1I9IH 4TS6A 3OPUA 5GS3A 5I1JL 4YE4H 2P5WA 2VDLH 5HGAA 2IWGA 4UYQA 4H88H 4PD4J 1NCCH 2BSRA 1JN6A 4M6NH 4XMZA 3GSRA 5B39A 3RVWD 4OZIE 2OQJA 3G6JB 2Z34A 4FNLL 4BGLA 1GCFA 1O0VA 4I89A 3MV9A 2WJ5A 1SJXA 3QDMB 5AYUL 5EO9A 4UUJA 4KV5E 1CO1A 1IM9B 4GOSA 3I6KA 4AH2A 3QUXD 1E8YA 2R51A 1OM3H 3BH9A 3EFFA 1I1FB 4YQXL 3RVXD 3OV6A 2DQCL 2XZCH 4LFHD 2NY6C 3CCHA 5C0AE 2ED6A 1N5AB 1ET7A 2P26A 4P46C 3T4YB 4AQ1C 2X0WA 4YH6A 3RY6A 2VMEA 5D6DC 4IGBA 2EJ1A 2Z8VC 3B9EA 4I3RL 3CGTA 3THMH 2B39A 3TXAA 1B6DA 4GSUA 5KOMC 3SY0A 3ZDYE 4A04A 3F7KA 4W9LC 4KVNH 5CFAA 4YDZA 4QRPB 1HL8A 3QARA 4MAZA 1NGPH 2OZ4H 3UABA 1P4IL 1EMTH 3HR5B 3NFPA 3MAWA 4S10A 4RAVB 1LO3H 2CJTA 3QS2A 4X8XA 1GYAA 1EBPA 5C86A 4HS8H 1U8JB 2AVGA 4DP7X 2GI7A 4E42B 1GOGA 3PABB 2WNKA 3DRQB 4P49A 1CICD 2O6PA 3T6VA 4P2RD 3OKKA 1Z5YD 1QFHA 1G4RA 1Y0LA 2QEJA 3POHA 3V4UL 1OE3A 2VDRB 3KVPA 4XBGB 4HWBH 3O8XD 4E9SA 4U7SA 5DURD 4O4YH 3LD8B 2QQLH 1HKLH 4TLKA 4TKWA 4UZGA 3KPPA 3VXSD 4EZKA 1C16B 3BVTA 1IGTB 3RHWF 3IU4H 5DZ9A 5E9DA 1NJ9A 1S9YB 4ANVA 4O5LL 1IBZA 3FSWA 2NXYD 3HC3H 3L5IA 3IDYC 4NP9A 2CU9A 4DP4X 3EYOB 3IJSB 3IWUA 3EXLA 5C09A 1JWSB 4X6BA 3D39A 1XB6A 3V0VB 5BVJA 2P52A 1CF8H 3SDAB 5JPNC 2UUDK 2CWRA 4FDWA 1BVLA 1GIGL 4AXWA 1EJOL 1MW2A 4U7KA 4ZFFA 2GW5A 1U4EA 2R9HD 2XQ0A 4HZLB 1E6JL 4PSRA 4S1QH 5GRUH 1FO0L 3IKKA 1I7ZA 3PPSA 4YFEA 1DLFH 5SX4I 2YGOA 5F7DA 4R96A 4AVKA 4HHAA 4HD5A 1RIUH 1OAYH 2DD8L 2L7EA 4A55A 3P73A 5CJBA 4I0PC 2YRLA 4GSRA 1XR9A 4HJUA 3AU1B 1JF6A 4OUOA 1E8WA 1INDL 1W72H 4JZNA 4PRNB 5IHLB 3BSZA 2J4WH 2WWKO 5EIVA 3WN6A 1I1AB 3TBTA 1FLRL 4GAJH 1OPGH 4XAWL 3LQZB 4Z0BL 1ZA3A 3ARZA 2BHUA 3IT8D 2EIKB 4WK2B 4WKXA 1MFEH 1RZQA 2HFFA 4JM4H 5MP6H 3H0TA 3PP3K 5EOQH 2ZXCA 3WIFA 4IYKA 3NN8A 4FQJL 3ZDXF 5M7QA 2Q2LA 1FAIH 1IC0A 2W65B 3NCYP 1UYWL 4XVUD 4EEEA 1U8MB 3HUJE 1D5IL 2IH3A 2OJEB 2O61B 4PJEF 1PLGL 1F5WA 2I60L 4FYTA 5B38A 1EHAA 1DEEA 1R6VA 4I88A 5AQ0A 1QRND 5KJRH 4Z0XB 4OJFL 2Y7OA 3T8VA 1RIHH 4R84A 2XTJB 5DFTA 1MFMA 1MJUH 2NQDA 3A4DA 3LN5B 3RB5A 4BFGA 3LEVL 3LEXA 5IK3A 1AFVL 4QTHA 1MAMH 4F9LA 5CILL 1M7IB 3ZTJG 2G3XA 2FUTA 5JYLA 4IDJH 4NLAA 2VXTL 1MY5A 5L9DH 1Z3GH 1GR7A 2HB0A 1RJZB 1MJ8L 5FM5M 4ZK8A 5HP5A 1E42A 2SEBB 2X10A 1I9RH 4ZUUB 5GS2D 2OSLB 3ARRA 4Y1AD 2E7LA 3UFIA 4OR1A 3PJSA 3OJMB 2DYRB 2MMXA 1J0IA 4F33B 2RTTA 3KWVA 3SDDB 2EYTB 4F7TA 1AXIB 4QXGH 5F7NC 4UTBA 4W6XB 5A6IA 3PHAA 5J89A 5EORL 1OWRM 1QA9B 4E41B 3MOBH 5JORA 3FN0L 3K91A 5I28A 2C9UA 3MUGA 2VDRH 2G4EA 3ROLB 3WAKA 3GMRB 2QJDA 4GW1A 4JLRB 5DMIH 3NCMA 2WZ6A 1ORSA 5D1QE 1L9PA 5J1AA 4YPJA 4FA7B 1J9QA 2UZPA 4N8UA 1VZHA 3C9NB 3Q1SL 3D5OF 3KWUA 3BH8A 5MI0C 4N8VG 4PJEA 4AWJC 4EE2A 3Q8FA 1JZ2A 1WGVA 4YDNA 1TZHA 2ALAA 2R7EA 3RBGA 4CJ1A 4IOFD 3JV4B 3NH7H 2WB7A 4FP8H 1HJCA 4NUJA 1WTGT 1KGIA 2Z7UA 3N1MC 1ZTXL 3RFZC 4R2GD 1A7OL 1KCWA 3OMAB 3UTZB 4D7BA 2YA2A 4TTDD 4ZW5A 4OLWH 4GXFA 4X9HA 4WNSA 3AVEA 1E5BA 3F6IA 1K6QH 1TTBA 3AAZA 1L7TL 4ZNCD 2X87A 3FDWA 4Y2OB 3MLXL 4KJQD 3MNZB 3QUXB 4MGXA 2XYBA 1XFPA 4LPWA 4O02L 3F04A 1HQRB 4WFHD 1SBBA 1BPVA 2YAFA 4P2QD 5F88B 1E28B 3F2LA 4DP5X 3UYPB 2HKHL 3M1CA 4GS7B 2CSPA 4X7TA 2M2DA 3RURA 5L4JA 2PYFA 4N68A 4OIFA 3TZVA 3TBSB 1IMHC 3MGOA 5FKPB 2F58L 5SWSA 2XRAL 3TNNA 4FERA 4Y2NA 3CPLB 3V4VH 3UP1A 1LTXA 4NSKB 3BO8B 3QEQA 4PTTB 1JGEB 4ZUTA 1MCIA 2JELH 4NZTH 4ODTH 3ZKXB 3LS4L 1D5BB 5A3ID 4FQIH 2N1TE 4MWFA 1Q9LB 4GQ9L 4ZX4A 5LAXA 5C2BH 2X3CA 6FABL 5LLIC 5JXAH 1DBMH 4JO3L 1ULVA 3OWEA 5KSVA 2DLFL 3MJ8A 4QHUB 5C0EA 1RK0A 3WMQA 2N59A 3ZE2E 5K69A 5K9KA 3TEYA 4Z18A 1Q0XL 4GKNB 5IBLD 4OF3A 3FRUA 2LABA 3IM1A 4HKXA 4K73A 3IF1A 4P2RB 3UG3A 5BPPA 3LN9A 5L4IA 5K59E 1DUZA 5CXPA 3QQNA 2HT4D 4Y5XA 1TU2A 1XIWC 3IAGC 1EGJL 5DD5H 4LSSL 4N0UA 4UOZA 1P5VA 4WI8A 2E59A 4FZ8H 4MS8D 4M62L 2MJWA 3K2KA 5E7FA 4IJ3B 5KN5B 1DDTA 5LVEA 4RQQA 3QQ3A 4Z7NE 5ALCL 2ZE0A 4ZUWA 3DRTB 4YHYB 4XMTA 2F08A 1A64A 1W15A 2Z64C 2BNUA 4UV4H 1OQXA 2RD0A 4YGAB 4XPGL 2A77L 4CVXB 1JXFA 1ZANH 4P23B 3CSBA 3NSFA 4M1GH 4PGEA 3L9BA 5JHMA 4EI5B 2GJ6A 2KUTA 3H3KA 3SSGA 4EVNA 3WDHA 3GSVA 4M03A 3BT2H 4D0BB 4G83A 4YL9A 5G4MA 3MRDA 4PRBA 3WXVL 5IV2B 3US1A 4XPFL 4LOVA 3BP4A 5C07B 2YHGA 2DQ6A 3PFUA 2EDBA 1NEPA 4OAWB 5F7BA 4ANUA 1QSEB 1YMHB 4BFJA 1IJNA 3QULB 7PCYA 3FFCD 4TSAL 3T0DA 5PCYA 1EPFA 4JFOB 2BSTA 4C58B 2HVKB 4RVBA 3FSAA 1SEQL 5I1EH 4I2XB 1BYNA 3T3PE 3F8UB 3OLGA 5L2KA 4XVSL 1PY9A 2IDQA 1DQML 5E08L 4LKCB 4FQCL 2VO5A 2CM5A 3OZKA 2BVTA 8FABB 2FATH 3O3DA 1HI6B 2OKMA 1CD8A 2R2EA 4XB3A 4AVIA 1IAOA 3WTXA 5AL8A 1JPGB 3ZIMA 4XXDB 4DGIH 4FXGC 2J12B 3BCDA 3QAZC 2QQKL 1PYWB 3JT2A 4HISA 1CXEA 1AHWB 1ZTXE 4JFED 3E6FA 4TOYH 5ESAA 4GRMB 4F7EB 4CRPA 1MHCA 1CVRA 3NZUA 3X2QB 4N5UA 1GYUA 2BZCA 4NYLB 4YWGH 5A7EA 3I50H 2GCYA 4MQXC 2XWXA 4AENA 3UJIL 1CYGA 5E6YA 4JRXB 3EUDA 4HS6B 4IBZA 5FDWA 4KDTC 2BHZA 1MDTA 1NBZA 3ZE0E 1NMAH 1KELH 3GMNA 3RWFA 3CQQA 2WHVA 1OSEA 5DZVA 3WG7B 4PVLA 3U36A 1RVFH 4PR5B 4K5OA 4MNQD 1XMEB 4HJ1A 3W11C 3GGWA 5EIIA 4JJHA 2WNWA 4QPEA 3HG5A 4OZFG 2QTVA 3DI3B 4IW4C 5EBMB 4PHXA 1TYEB 1B4JH 4G7SB 5ABZA 3ULVF 3N42F 1T4WA 2BNQA 4B5ZA 1G7QA 3SCMB 1BQ5A 4Y1AB 3VXUA 1KULA 2Z93A 3KLDA 5AAWA 3VX0A 2XPGB 3S35L 5IROC 2BJMH 2FT7A 4PVMA 1OTTD 4J3XA 3ATFA 4L3EA 3WJJA 3CFCL 4N0YH 3RGVB 4HMDA 3RI5F 3Q6FA 1AVAA 1ZT7B 2VL5A 3LCYA 1VPOH 2MPVA 3ASWA 2AGJL 1AO7D 4ADGA 1H19A 1TZGL 5FO7A 1G7HA 4JPKL 4Y4KD 2Z92A 2F8IA 5AWNL 2XXFA 2J72A 4FQ1L 3A6BL 1SYSB 3MSPA 3RUGB 2YQ3A 4BV1A 4QI3A 3F01A 1NLDL 4EMZA 3RZCB 2I25N 3QP3A 1N2RB 3P40A 2W9DH 1XCWA 3GJEA 1JHTA 1MG2C 4F3FB 5JPMB 4JK0D 7TAAA 1I1CA 2GY7B 4LHUA 2VH5H 2QFPA 4OH2A 1OSYA 1JV5A 1KJ3H 1QHOA 3GBLA 2DW5A 4R2GB 1XH3B 1DQKA 5DC2A 4N5ED 1KLUB 4M7KH 4XRCB 3CBJB 1EERB 4ZO9A 2H2PC 3OKEB 5CLWA 4QF1A 1CZ8H 5BUGA 1T03L 2LU5A 1I3VA 1B4LA 4BZ2H 3Q43A 2OMXA 1KB5B 4NI3A 5LG1A 1WT5C 2GVYA 2O5XL 1ASPA 1XEUA 3NQIA 4KXZH 3IDUA 5C08A 6PAZA 1Y6MR 1LLAA 1HL4A 1TMQA 2I5YL 4HIJA 3QAQA 2XIBA 4I18B 2GHWB 2YKLH 3E1ZA 4BDVB 2IOIA 4NC1E 1AI1H 1RPKA 2NXZB 2H1PL 1MF2L 3NJNA 3V6OE 2Q2EB 1CU4L 1MCBA 3MLPA 3QDJD 3T0XA 1NCAH 5E6ZA 2WQ8A 3FCTB 1ADWA 2HTKD 1A1NB 2YC1B 4FFZH 5EF1A 2WTRB 3C75A 2G2RA 2EO9A 3BVWA 5EO0B 4POYA 4Z78B 1TZ8A 1S78D 4EZJA 5IEHA 5DA4A 1KBVA 3U9UB 4BEIA 1YPZB 3HLAB 3KXFA 5IFJA 4GW5A 1DBAH 4IOSD 2OJZL 4JPWL 3DGGA 5MERB 5GGQL 4GAFB 2BK8A 1GCYA 1MCNA 1AR1D 2R4SH 4BIKA 4HIPA 2BHFA 2M26A 5TE6L 5B7EA 1EEYA 4OLZH 4WLCA 5DD1H 3QJUB 5T1DH 1WVZA 4YNYB 4M9OA 2WLKA 2MWCA 2KLTA 1LEIB 2E76C 5CJOL 5FK9A 3F84A 4DKEH 4ZMQA 5CINL 1HESA 5I75B 3C09B 2GAZB 2Z4QB 3FXIC 3OKMB 4DO5A 4LXFA 2ZOWA 4QRTB 3TO4C 3EOAB 1NOAA 4W9IC 3MFFA 4PWGA 2EQDA 5C7ZA 1FUNA 5GS2H 5FS5A 1I8MB 4AIZA 4PV9A 1ZXQA 5HHOD 4U0RB 2Q8BH 3TYGL 2JSFA 2X41A 1SGKA 1Z9SB 3WS6C 1OAUH 4IHBA 1YY9D 4X6DB 4GUPB 1VDGA 4G5ZH 2A6DA 1JAEA 1NAKH 5FOBB 1WITA 2XWZA 3ENEA 4JZJA 4CBPA 1P5UA 1VSCA 4JFFD 1U30A 4NNPH 4WI7A 3V2AR 1U9KA 3ARQA 1T4KB 3CUPA 5EZJA 1BQHG 1Z7JA 4FA6A 5IKCB 2LFGA 2PXYC 1XBRA 1LGVA 2QKIA 5D96B 2O5NA 2MNUA 4IIQB 1DJIA 3MPCA 2MOGA 3VFPA 1FPTL 5ANMA 4HV8A 2F54D 3FONA 4M4PA 4M6AA 4YX2L 2PKDA 3T2QA 4J2XA 3NCCB 1SXSA 3ATDA 3BFQG 4JFYA 4H8PA 4P07A 3JTTA 2X4UB 3RIAF 2F7IA 2EVGA 4C83B 3OKDB 4RAUB 4WFFD 3D85A 4YL4A 4LZKA 1YO4A 2P45B 2OMUA 2Q86A 4HCIA 1IO4C 4NQDE 1OE2A 4G42B 5A2FA 1OTSC 4WSGA 4BFKA 3P9MB 4UM9D 3C5ZD 1I7RA 1XF1A 2WGXA 5DJZA 1SHXA 2W0KA 3QJSB 4J1UA 4PJ7E 4N1EA 3AROA 3D1MC 2FB4H 1KB5H 4U1SB 2VDNL 4X4ME 2VOTA 3LVTA 1F4WL 3NFSH 1FL5B 3BN9C 2DQGH 4M9PA 1EO8H 4MCNA 5FA3B 2FEEL 4DPCX 5L2JA 3H6JA 2ADFH 4X80H 5DU7A 2FGWL 4WENB 3FQ2A 1VCAA 4WUUA 3AABA 2Q7YB 5EEUA 2H5UA 3UDWC 4ZAKA 1MCOL 4WI0A 2IALA 3RQ3A 4OGZA 1QI5A 3ZL1A 2LFEA 2DQFA 5E0FA 3AG1B 1FSKC 1V8HA 2NUPA 1SDAB 2P24A 5FA4A 5F7EH 3EO1A 3QDGA 1CFNA 4PLNC 3WY2A 2KLSA 4LP5A 3N06B 4C4KT 2EINB 2WGNB 3NOIA 5DJ8B 3ARFA 5H35B 3QIBD 4HKBA 4JDEA 5T3XL 4Y5YB 1YEGH 3QZWB 4AYDC 1S9XA 1P7KB 5D5MB 2HXAA 2AEPL 5F7UA 3KCWA 3E3QE 3GM8A 2OMWB 3FB5A 2EUXA 3AJ7A 5GRZA 3HZMA 2ICEC 5CMAB 2AAAA 4MD0A 1OKEA 3CSFA 1EEUA 1QHPA 3FT0A 1LO0H 5CO1A 3O81A 3QS3A 2R39A 5B7MA 4XBEH 1KGCD 4JJ5B 1Q72H 1XAUA 3GD1C 1JJUA 2WUBL 5E6IC 5ECGA 2F74B 2F1BA 2E4FA 4TQIA 1AZBA 3GSWA 1AO7B 4NPYB 5DVKA 3LXCA 4N4YB 4I77H 1I7UA 4Y4KB 3UX9B 2BIIA 4BHUA 5IREA 4GNKB 2J20A 5AZEH 1FGVH 3RJOA 2IH8A 2X6BA 4QY8B 3TF4A 3HMXA 2WQXA 3MCLH 4QHKI 2RMNA 3GWJA 4W6WB 4ZODA 3D4ZA 2H3NA 4IMLB 5DC4B 1SQMA 5FO8A 4PEEA 1MFNA 4CVWA 2NX5B 3L4ZA 4YHNB 3T6WA 6FABH 3MBXH 3ARBC 3LKNA 4QXUH 3QPQC 3FT3A 1TJGH 1F86A 4Y4HC 3I9PA 3PJLA 5I6LA 3UAJC 1JGVH 3RIFF 1DJSA 2NDFA 2J6WA 7FABH 1L5GB 2VXUL 3S48A 1L9QA 5KAQG 1X9RA 4D0CA 3GSNB 4HIIB 3EBAA 1VGEL 1OLZA 2VITA 4F2MB 3L4CA 3GI8L 1CDGA 1X6LA 2HG0A 1MRCH 3ZTCC 1KT2B 3Q7JA 4ZO6A 1PZ5A 5CEZL 5H2BB 3ZW3A 4A2MA 1QSFE 3RTQB 2ZX7A 3ELQA 3MCKA 2AKRA 4U6XB 5FXCH 3DUUB 3VUAA 4RIRA 2IPUG 4XP1H 4P5TB 1SEBA 3QW9A 2IFGA 1UACH 4YDJA 1RUQH 2YFNA 1F1AA 1E4KC 1L9OA 2ITCA 4M29A 4JVUA 1XBDA 4HC1H 3S5ZA 2GPZA 4OZIF 4MA1C 3IFOB 5H94B 1I31A 5G4NA 4CU7A 4D7PA 2PW1B 3UTSE 5L6YL 3QJOA 1BEYH 3ZYJA 3TJHD 3HZVB 1XGYL 4WCYL 4JG5A 4XO5A 2DI9A 4JRYD 3LKOA 3X1FA 5CF3A 4NT6B 1DP0A 1C5DA 2GK2A 2UX7A 1DQVA 3VI3B 3BKML 1KYUA 2QGDA 3ZSSA 1IFHL 4WTZA 3QRLA 1SBSL 4M5ZH 5ECJE 4N2AA 3WNOA 1GC1L 3EG9B 3SGEI 1QUPA 3HVDA 3SDCB 2ADJA 3P9LA 2H41A 4K8RC 3VA2C 1NKRA 3G5ZB 4YIQB 3FC8A 1F11B 1R34A 4JDVB 4K2UH 5CBEB 4FMVA 4J8RB 4IBTA 1JGDA 1IBHA 3L3JB 2DI8A 1A6VH 3CPUA 2CIIB 2Y4SA 1QWHA 4TSCH 3H7BB 1HOCB 3RVUC 4U4BA 4JGJA 4FNTA 1OCWH 3N9GH 1ROCA 5EZOH 4UAOB 3MBEA 3T0EB 3K0YA 1QI3A 3AZUA 4KRPD 2WPGA 1YUHA 1DVYA 1EO5A 1TJXA 1U8QB 4OI9A 2BCMA 3LDBB 2FYVA 2NY7L 2BLFA 4G6AD 3ARGA 4OZIA 5DGQA 5LGJA 4WEBH 5F7FA 2PR9A 1UWEL 5T3XE 4FNQA 2R0LL 4DKFL 3Q48A 1CGWA 5E2TH 5IVXB 3GPEA 1VFBA 1DR9A 1J8HD 2MNWA 5DGRA 3NIGB 1QR1A 2FSDA 3JZYA 5EIIG 4NO2A 2C7UB 3BWUF 2DICA 2KERA 4ZTPL 1M6UA 1WICA 2G5RA 2JKLA 2VN7A 5ANHA 4AM0Q 3LQAL 1MNUH 2ZCLH 3BGFB 1TVHA 1U8HB 3JWNC 4ODSL 3JXAA 5C0AA 4BK5C 1LWJA 5HPOA 2R1XA 1J0JA 4JPQA 3OHXC 1JVOA 4KK8C 4RESB 4GSXA 2PYEE 4DGUA 5DRWA 4XP6L 1HXYA 3QXDA 1EWHA 1LMKA 5EFIA 3BPOC 1SM3H 2BVPB 3JZ7A 3QFDB 4UDTB 5IVOA 4TUKH 5DUBA 1FG9C 4UV7H 1PNDA 1H5BB 3LOWA 4AMXA 1AOHA 1IAIM 2KPWA 2XICA 5DTFA 5DXWA 4G9DB 4XPHH 5I1GL 4YZFE 4XNBA 4UM8B 3ZY7A 2JIXB 1TYRA 2UYLB 3O2WH 4H1LB 4ALAH 4LLYB 2O6CA 2JCCB 1TITA 2BXZA 4JHWH 2WZPD 2NZIA 4O2CA 1KENH 3CFKB 4W9JC 1JK8A 5FYKD 4ZMAT 2WUCH 3FFDB 3BJLA 3CLEL 4ZXBA 2HRHA 3CAFA 4Y2DB 1E4JA 2Z7WA 1T66D 3K6DA 2DQEH 3BGMA 4DK3A 3RY4A 4W1TA 4ZOCA 2CGRH 5JIDA 3RVVD 3SKNA 3IDJB 2W8CA 2BSSA 1OK8A 1E50A 4NJ9H 5CEZE 4PCKA 2CHWA 3D2UB 4BELD 4UTAH 3CIAA 1A6WH 1LD9B 1L9TA 3BWZA 5D2NE 3BP6B 1KTDA 4AK1A 3QHZH 4JFPB 4L8SC 5E2WH 4DEPB 3SYPA 4FN0A 3P9WB 1FLTX 3HUJF 3BQUC 4B9PA 3KLHD 3EYUL 2B1HH 3FUMA 3DPBA 4LKXA 3GSOB 5SX5K 5GZND 4XTRC 4PRAA 4YDVA 3MJ7A 3TWCH 3ZJAA 4S1DD 1S4IA 4AQEB 3HLKA 5CWSA 5DD0L 3VFTA 3D3VD 2PTTA 2ODHA 4LLUA 1LO4H 2XQYK 5IMMB 1N3NB 5AVWB 3SPVA 4EXKA 4R90L 3DV4A 5GISH 3FBKA 3AG3B 3WXWL 4Y4FB 3VTTA 2VMCA 3SJVD 3FO2B 2OXGA 4I7ZC 5JOFA 4LL9A 4LCYB 3ARED 4MAUH 5FHBH 4JVPA 1T0NA 4YDIL 3FCSB 1WIPA 3C8HA 1KTLB 3DTUB 3UCQA 1OM9A 4MXVE 2VLJE 5KYYB 1ZVSB 4BUQA 2WBJC 3ZHKA 3TA3D 4ZOEA 3DO4A 5F9OH 2A73A 3JUZA 3MTXA 5DEGB 3VX1A 1IC1A 2R29A 5DSCB 3HCVA 3G08B 4HG4K 5IFHH 1AAJA 1XTLA 2WNXA 4A6YB 3EGXB 3APNA 3CZUB 3O45A 1RXLA 3F7VA 1E7UA 1P2CB 4N26A 1ZVHA 3AS1A 3FAWA 4Y8DC 3ZKMC 3TBVB 4OM0L 4G1MB 3V95A 5MENE 3UGUA 1HFUA 1TMCB 3OM3B 1UADC 4BH8A 3HUJA 3BP5B 4L8DB 2DTSA 4KO9A 2BWQA 1DJWA 4FG0A 5GSRB 1CC3A 4EBQH 1U41A 2ARJB 2NT1A 3HJ0A 3PGCA 3VXQB 2M8XA 5C0IB 4JY5L 3EH5B 2AJVH 3QQDB 3IAPA 3PLYA 1OALA 2OK0L 1O75A 2F19H 1AGCA 1PEWA 3TNMA 4GG6E 2WV3A 4ISVB 2O4EA 3HAEB 4G70B 4XH2A 1GH7A 1QQDB 3DMMB 5EC1B 5GGRB 3IVKA 1HDMB 1ETZB 1PG7W 4Q9RH 1Z9OA 2C3VB 2Y6SD 4OCWL 2Q6WA 4FG2A 4PLKD 4DVBA 4JFVA 4U1NB 2DIBA 3K74B 3QNZA 1T89C 1WZLA 4JFSA 4F5CE 3QCTL 1QFOA 3LKPA 1BREA 2G5BB 2Y36H 4H1LH 3C60B 4JRYB 1MVYA 2DWDA 4U6VH 5CHNA 3PQYD 4DO6A 1OGTA 1DVFA 3X11A 1NICA 1BZ9B 3GKWH 3TT1L 5HD8D 2ZG1A 4P5MA 5A6MA 4MJHA 4DW2H 5GJSH 4KC3B 1MAKA 1KJMA 4NQTA 3W0WE 3UXFA 3CXDH 3GSRB 2BWIA 4IRZH 2WINB 2KS0A 2A9DA 4BM7A 4XZUA 3AXLA 5DLLA 4P3DB 5ICUA 1NPJA 5D1QA 1FFNA 3T04D 3MV9B 1N8ZA 5EU7E 1NKGA 3O6LL 2BPBA 3SO3C 5EO9B 4BQ8A 2D3LA 3BFOA 1E5AA 4UUJB 4OF5A 1HHIB 5DYOB 4DTGH 3I6KB 3J27A 1CD9B 1A3RL 3TV3L 2QQQA 3K1DA 1IBYA 3BH9B 4IRJA 5D1ZA 3CCHB 2ZAGA 1KPVA 3ZE2F 3MDJA 3OAUH 1RJCA 5LXGH 1LDPL 1IL1B 4LLQB 4IGBB 5K59F 1M71A 3OTTA 1BM3L 5GS1C 1DBKH 5I71C 3SY0B 1UJ3A 4M5SA 3X12B 4U1HA 5L7XH 1NBCA 5MEPB 3ZU8A 3TCLA 1J8HB 1WZ1H 1U95A 3ULSA 1P4LA 3NP4A 4IBYA 4AC2A 4F58H 3H55A 2XLLA 3NFPB 5KUKA 5E23A 4Z7NF 4MRCA 4R4NC 1CFSA 4AE1A 4OZGE 3GS0A 3W2DL 5D7LD 3SDYH 3Q2VA 1ML0A 3TH3T 3EHBD 3KD4A 4BKSC 2EIBA 3UIYA 4I0PD 2HRPH 5E2VH 1UT1A 2APWA 2NLJA 4OT1H 4X6CE 4HAGA 5KSAA 5B8CB 3VD5A 5J13C 3OKKB 3LPOA 1KXHA 1KF9B 1Y0LB 1KPRA 4B7IA 3NPSC 1UWGH 4KTEH 2VKXA 4NUGH 3BVUA 1XF2A 3KPPB 3RPKA 1UTDA 3QHFL 1UEMA 4WUKH 4AMKH 5FFGA 1BXAA 3KS0H 4XO4A 5E9DB 1Y6KR 3RZWA 1DQQA 1FZKA 2PCXA 5T1LA 2NTFA 5C6PB 3SBPA 3BGAA 4KZCA 1Z9MA 2DBLL 2XN1A 3FTYA 3HE7D 5HDRA 1PTZA 1EJFA 3NGBC 2FNBA 4JG0H 5C09B 1GPOH 4X6BB 5BVJB 3T3PF 4HKJA 1WAPA 4L9LA 3FSZA 4NKMB 1BVLB 5EU4A 4XO9A 4AXWB 4X9GA 3HAEH 4O00A 4ZFFB 1ZE3H 1BQKA 3BPNC 5I74B 1FBIL 1IQWH 3MOQA 3PL6C 4NIKB 1I7ZB 1JPFA 2YA1A 4F8NA 1RSYA 2E7CA 4QCIB 5F7DB 2YPVA 2XOTA 4R96B 5A2LH 4HHAB 2AMGA 2X1PA 5KSUB 2Z31A 2GTWB 1TJIL 4KO7A 3JVFC 3P73B 3IE9A 1XR9B 3EH2A 2AHIA 2NY4C 4FFYH 2A9MH 1SN2A 1YEIL 3SYOA 2OCJA 1F4YL 4QXTA 5HHNA 1U8PA 4U1GC 3US0A 1ED3A 4FOMA 2YXFA 3EYVB 2H0JA 4JZNB 5CU5A 3PP4L 3ZE0F 1CN4A 2IGFH 1OCZB 3D3VB 1GGBL 5DHYA 5AVSB 3BMVA 4FTVD 3VGBA 2DKSA 4KMTL 1ZA3B 3LB6C 4NAQA 2M1KA 3Q06A 3A67H 4NN5C 4P2OC 1A9BB 1IRAY 2GEQA 3FF7A 1OF2B 3R1GL 3H0TB 4NIYE 4YOKA 4LU5L 3WIFB 5DZAA 3NN8B 2VCOA 3F7PC 1X44A 1VEOA 1N12A 3DIFA 4KDWA 2VAAA 5IW1A 1GXEA 4TUJA 2IH3B 3JVGA 2ESVE 3L4WA 2A5UA 5B38B 1M2OA 1DEEB 3DIVA 2ROYA 4O58H 1YN6B 4R7NA 3MKGA 1RPQA 3QEHA 2CO7B 3OAWA 3PG2A 1UWFA 4RZKA 3T08A 4F93B 1U21A 1XVSA 2VQ4A 3SE4C 4UANA 4H20H 4L29B 1CGSL 1ADQH 4QHKJ 1HC1A 1V54B 3DVFA 3JTBA 4DAGL 5IK3B 2GTZA 4QTHB 3UBHA 3FQXA 5JZ7C 1J5CA 4LSPH 4OJYA 2P8PA 1G84A 1KLGA 1TPXB 2AAVA 3GHBL 2AEQL 3WJMA 4ZFGH 4RFOH 4M8QA 4MAYC 2XQBH 5H4YA 5T3ZL 3UTPD 1YEDA 3SKOA 3VGGA 4HOXA 1UA3A 1SXAA 3PJSB 1OW0C 2DQIL 4H2CA 2AQ2A 3MA7A 1H3WM 2QVTA 2Y72A 3PWJA 3QEGH 1OB1A 1CDCA 4LVNB 3WN5C 1G7JA 4M7ZB 3NCFB 1RMFH 2CO6A 3DSFH 3PWPE 3RWHA 5JORB 3HZ3A 3PUUA 4O02A 3MUGB 5B1JC 4J5VA 2CNYA 1RIVH 1Q90A 3MNVB 5HYQA 1ORSB 3LPWA 4DQOH 3NJFA 3ZDXB 4APXA 5J1AB 3HBGA 5JUEH 1TTGA 3PU7A 3BKYL 4H0LC 3DXAE 2WXQA 2I26N 1JDAA 2X4TA 3BH8B 2CHNA 3KYAA 4MD5A 4JL1A 4PJEB 1UCBL 1QNZL 1JK9A 4MA7L 5FYKH 2R7EB 2R23A 4OD3L 1EQWA 3UBXI 5IFAH 2RGSA 4MXWH 3L3OC 4NUJB 1I7TB 1OAZL 2R0KL 2CIKA 5TF0A 2E6PA 2VLME 1WGOA 3OMIB 4NM8L 3FUIA 3DX9A 1ZHKA 5E1AA 2HJLA 4KKBC 1JMZA 4HUNB 4HIXH 3VQMA 1TETL 2LTQC 3AAZB 1S7QA 3QUZA 4LDLB 4DK5A 4KVCL 3UPCA 3ULVD 5E6SB 2BNRD 4ORGB 4MNGE 1NBVL 3RU8L 4Q52A 5LGYA 1XL4A 1LK3H 3BIKA 4ZOBA 3NABL 4LARL 1A7RL 4IKIA 2MNJB 3IBEA 5F3HB 4H13C 4X7TB 5IMLA 2E9BA 2FRGP 1OXYA 2PYFB 4BQBA 2QMJA 3KZ8A 5GJTH 3AMKA 3TNNB 1H6FA 1ZTMA 4MVBD 4MJ2A 4NUMA 1O6TA 1ZSHA 3OAYH 1RHHA 3EYFB 3QEQB 2BSCA 5I1CL 3B9AA 4ZUTB 4DP8X 1CE1H 3NCEB 4K3DL 4PBWD 3FO9A 4BCZA 1EHKB 4MWFB 3KYKL 5LAXB 3T2OA 3QK0A 3MLVL 3V7AG 2NY5L 3VRJA 4AV0A 5KSVB 2DQHH 2E27H 3MJ8B 5ES4B 1E4WH 4OGAC 3EHBB 1RK0B 4R7XA 1X5ZA 1UB5A 5C0EB 4AW4A 2AZUA 3O0RL 1YEWA 2I9LA 4DJMA 1N5YH 3FRUB 2F15A 3HI5H 1BW8A 3IF1B 3H9YA 1W8NA 1DUZB 1EHXA 3V6OA 3NK3A 4TSBH 3WFEL 1SNRA 4Y5XB 3VYNA 2B9AA 3A4EA 1TU2B 1N8OE 5I6PA 4N0UB 2AMUA 4ZSOB 3O41A 3G5VB 3UO1H 2Y1AA 1QLEL 4LPCA 4D3CH 4ODUA 1YYLH 4WO0A 4ZUWB 4YSEA 2CR3A 5E24E 4PRHE 3K1KC 4HS3B 4HWUA 3QJQB 4QRQA 4MMXA 3ABZA 3FUHA 4IKJA 3VXPB 3LZPA 1MRFL 2IG2L 3V52L 5TGBA 4PGEB 4UTBH 4L4VE 4HU2A 2GJ6B 4EVNB 3L17A 4D0DA 5HJ3A 2BSED 4MQXD 5J6GA 1MAJA 1QATA 2VDKB 2EYRA 1DQLL 4WHTA 4PRBB 1TEGA 1PFOA 4CNIA 3HFMH 3BP4B 3GBNL 3GLEA 1U93B 4PY8I 4YDLC 2IANE 3QQ9D 5CN3A 4PJ7F 4IBSA 1A7QH 4ELKA 1YNLH 3EJYC 1ZHNA 3FQYA 3FQRA 1BOYA 4WJ5B 1AQ8A 5IB5B 4H8WL 2BSTB 1GGCL 3W11D 4GKLA 1KFAL 1JPTH 3KR3L 3VVVA 4WZ9A 3MV8E 4WTWA 3WFDH 2R0WH 1FE8H 3GBML 3OKNA 2IDFA 3K72B 5L2KB 4XVTL 1BQSA 1NUGA 1W0VA 5BV7C 3ZGHA 5IROD 1NFIA 2EDEA 1EX0A 4TQHA 2D7NA 4WY7L 3SGDI 4J12A 5IT2H 2ZAIA 2NY0D 2Y9RT 4MCYB 2R2EB 3CHRA 4G9FE 1IAOB 3GIVA 1D7BA 3ZPDA 2ZCHH 2BSDA 5B21A 3WNIA 4RRPA 3L4TA 3KLAA 4LSTH 1Z1WA 2E9JA 3E6FB 5EMYA 1CGYA 5ESAB 2B4CH 3S3DB 3WJLC 2ORBH 1MHCB 5EO1B 2A99A 2D7TL 2V5MA 3CDZA 1ZKAA 2GCYB 2CUMA 5GGTH 4AENB 1Q0YL 1NTDA 1YSOA 4RETB 4WV1C 4N86A 5FDWB 2X6UA 1NBZB 4NQDA 1WC7A 4OZ4A 4YDMA 3U7YH 1SDDA 3QBTB 2JQMA 1Q0EA 3P77B 1OAQH 3UBXG 1NGQH 1CFTB 1I9JL 3PY9A 4PJ7A 3U36B 1NQBA 1ZT1B 5FWRA 5LHDA 2FL5A 4W9FC 4WWKA 4Y9EA 3NEOA 4KTDL 4F7MA 3GGWB 3BZDA 1B2WL 4U6HA 4DN4H 2DQJL 4QTIH 4EDXB 1MHEA 2VMJA 3IYLW 4N8VA 4LGSB 2BNQB 3NTCL 4FHBD 1UKTA 2ENPA 2QPDB 4JZOA 2Z93B 2E3VA 4C57C 2YXVA 1J9RA 3RPIA 1FL6A 3WTUA 2X89D 1SOSA 1IC7H 2D7MA 2XYCA 1AQMA 4L3EB 3WD5L 1T1YA 3RL2B 4F15C 1V5JA 3Q6FB 1AJ7H 4P46A 4YSUA 2PO6C 2D4DA 4AQ1A 3BD3A 3P2BA 1WLHA 3RRQA 4P04A 1G7HB 2N7SA 3IMBA 1QAWA 2Z92B 4HT1L 3SE3A 4O9HL 1TSHA 3KNBA 5DJAA 1IU1A 1WS8A 3V0DA 4KRMB 2Q76B 1W0WB 1T22B 2Y25A 3MRBB 2WQSA 1FRGH 5DEFB 3ARXA 1HL9A 1UKQA 4M43L 3TBYB 1VFAB 4JFHE 3SYQA 4H8HA 3GJEB 3UC0H 2XZAL 1ID5I 4K7FB 1JZFA 4FTDA 3UTTE 3ZQXA 1JV5B 3KCPA 1IM3D 2VDKH 3PE9A 1JD9A 3QJVB 5JW3L 4AL8L 5ITBL 3O11B 5B1AB 3IDNA 1E4XH 4C54A 3D9AL 4QF1B 5JR1H 4J6RH 2X1WL 2KH2B 2OR8A 1IBGH 1CVSC 2KHAA 2OMXB 4WSKA 1JYNA 5JA9A 3DX1A 2BDNL 3GPSA 1HH6A 1IGCH 3N42B 2K1MA 1TTUA 2VDOL 4ZMVA 4MB4A 2X1OA 4RA0C 3OGOE 4TQEL 3F7LA 5C08B 2BY2A 1CL7H 2ZCZA 4ODBD 3ULUL 1K3IA 4HIJB 5I15H 5KYWA 4M93B 2AJZA 3DI2B 1EZVY 1A8JH 1A1MA 4KHXH 1E9PB 1C5BL 2KKQA 4NKOA 1WRFA 1YMMD 5JPNA 1KN4H 5KVDH 3BKCH 4IQHA 4O51B 1CGXA 3QG7H 3NIFE 5HYFA 4ZUSA 4RMVA 1DZ0A 2AABL 1JZJA 3IDXL 2ITEA 1JZGA 2HH0L 4OVVA 3PGFL 4W81A 5GGSA 1TSRA 1S46A 2G2RB 3EFDH 4ONOA 2KMWA 5IEHB 2CH8A 2LVEA 4HQQL 4PRPD 2A4ZA 3QRGH 2E4TA 3ZL4L 2WXNA 3T6XA 5IFJB 4AYBA 4GW5B 4DCQA 5E1HB 1L4IA 1QSFA 2AJ3A 2WVTA 5CP3H 1JRHI 5AZ2H 1RZ7L 2X4NA 4W9CC 3TTSA 1II4E 1DDHA 3DGGB 3FTGB 2IAMC 2X9YA 5LCVL 4B7LA 2WLMA 4NENA 4Z9KB 2FJHB 2QHLA 1SFHA 3V8OA 1BXUA 1RU9H 1IGML 4MMYA 1REIA 1Q8MA 4PJ9D 5F7LB 3UTSA 4N8CL 2GG1A 3KMDA 2Y69B 4WHDA 2ZKXA 1OTSD 4GLRH 1PMYA 1A8ZA 2KQMA 3U82B 4XCYA 1KEML 5DK3A 3IK2A 1XB3A 2D03L 1CYWA 2OP4H 1WFTA 2RR3A 5FGSA 4JHZA 3QE5A 3A6CH 1KZQA 4Y88A 2WTPA 4I0CC 4PV9B 4AIZB 4B3EA 3N50A 1XL6A 3VG0H 1PEZA 3QIUA 2IQ9L 4NZUL 3OPZL 1WPCA 4K9EL 4ES9A 3SD5A 1MFBH 3TURA 1RUAH 1L6ZA 1RFDH 1UKSA 1JGLH 2A6DB 2CLZA 1D9KC 1ZPUA 3MXVL 1QFUL 1TR7A 4W4OC 1PSKH 4W9ZA 4JZJB 2DLEA 4AG4L 4YHIB 5TE4L 3STLA 3CUPB 5EZJB 5GRJL 4DVRH 2JB6A 5CLTA 3MNMA 5B1BB 4OLXL 5I6NA 2QKIB 4YZFF 4RX4A 3OSKA 4MJID 2EH7L 4KOBA 2WWMC 4JFZL 3VFPB 2DH2A 5ISZD 5ANMB 3FONB 3LH2H 4KOCA 4M7JH 5E7BA 3WKQA 1TQBC 2CHXA 5AD0A 1F18A 5DC9B 3AADB 4JFYB 3WNNA 4BQ9A 3JTTB 4JQVA 4Z7UE 3OAZK 1K5WA 3DVNA 3TT3H 2OMUB 1BP3B 3HB3D 2DKUA 1ES0A 3VO0A 2AK4E 2C9XA 4KKNA 1IC5L 4Q0XL 4XE5B 4KK9D 2AQ1A 4FQLL 4J1UB 2BZDA 1H6TA 2ZOKA 1YC8A 2QL1A 5ACMA 4OZFA 2G3MA 3UOAB 3NJJA 2B20A 4JO1L 4PJ8C 4YXKL 3RHWK 1BVNT 2NNRA 4U3XA 4NOBA 4NKIH 4L4TE 3ULVH 1WFIA 1A9EA 4DPAX 4GO8A 4EOWH 3TONA 2OYPA 4Q89A 2ED9A 5L2JB 4CKQA 3H2PA 3U79A 4LVOC 3WY4A 2PYEA 3EGSB 4FL4B 1NUNB 2DI7A 4ZYKA 3DETD 4WUUB 1HSAA 5DCCA 2DYPD 4ZAKB 4IKLA 2IALB 4HFUL 3CSTA 4FC3E 2L3BA 1NFDE 4MSWA 2DQFB 5TE7L 3IDIA 2EO1A 2NUPB 3ARBD 3HN3A 2GJJA 2P24B 3QIWC 4Z7WF 3EO1B 2VXVL 3EJZC 3QDGB 1AOZA 3TEZA 3ULUE 4EI0A 4HWEH 2WZ0A 3UAJD 4XN7A 3RFZA 1M3JA 4R4FH 4IK6A 2YS4A 5IMOA 3ZUCA 1N6VA 5CD5D 2ZSWA 2UVEA 2YD4A 1DFBL 3IDMA 3JT0A 3QZOA 3ARFB 2XG4A 4PJXF 2UWEF 1S9XB 4N2IA 3SPCA 1KBPA 2ZOUA 4JREC 4DPBX 1NCWH 3FB5B 3LAFA 4OCYH 4MXVF 3HZMB 4PJ5E 4RGOL 4MD0B 3W9EA 4IS6B 1NZRA 1RURL 3B2UD 4HH9A 2Z9TA 3N85H 1FFQA 4J3UA 3VA6A 5IJKC 4LCCB 4JHAL 4NAMA 3UZQA 5D2NA 5CR8A 5GRVK 2GB2A 4R0LC 4KHTH 4KWUA 5HHVH 2DYSB 5HGDA 5D7EA 2W80C 5D8JL 3TBWA 1RULH 3V7AE 3J8F7 4PQXA 4E9XA 2I07B 5I0XA 4Y16C 3LPFA 1X5HA 2H2SC 4MBRA 5F72S 1TJMA 4MQ7A 3WGUB 4G6ML 1A7NH 2H3NB 1ZLWK 5FX3A 4K94C 1OT4A 1ZEAH 4CMHC 5FO8B 2VR9A 2EABA 1HHGA 3FN9A 4GG6F 2A9AA 5A7BA 3LKNB 2ATPA 3L4UA 3FT3B 5FECB 1MCLA 4K8RD 4LL4A 2XC8A 1FFRA 4Z7WA 3JYCA 1NC2A 3H3PL 1QKZL 4HCRH 4TVUA 4HG4J 1BX2A 4MLIA 3KGSA 3KDPB 3PWVA 2G2PA 4D8OA 3UL4A 5BJTA 5CCGE 1P7BA 1RUKH 5T33H 1XIWA 3O2DA 5T1MB 4OJCA 2UWEA 4PJXA 1C9SA 1FH5H 3HR6A 2X09A 1MELA 5FDYA 1PZ5B 1TIUA 3MCKB 2AKRB 3OKOA 2VLJA 2X1XR 3VI4F 4D8PA 4JKLA 1A7PH 1SEBB 2ITDA 4YDJB 3TBBA 4AVJA 2PR4L 4F8QA 2ITCB 1RHFA 1RJLA 3GHEH 4KQ0A 3LHPH 4UNIA 5J3HD 1YMMB 4QRRE 2VYRE 1AY1H 1KJ2H 1N64L 4G7VL 3BYYA 4J3OC 1ACCA 1IAIH 3J7HA 1OAKL 5DT1L 4APQC 1SZNA 5MENA 1PKQA 3LKOB 3RA7L 1IEAA 4JUSA 4A2LA 2ZCKH 1E30A 2ZG3A 3ZVVA 1C5DB 5I1IH 5KYUA 5D9SA 1IX2A 2PWGA 1OARH 5T5FL 4FABH 3QCVL 5I18L 1OGAE 2LR4A 4J23A 4LEEA 2NYYD 2ADJB 3P9LB 2E47A 4GG6A 4P9HL 3HC4L 5BZWA 1Z0NA 2F53E 5DJ0A 2WXJA 4Z3GA 5C0RL 1CURA 1JGDB 1BJ8A 1N26A 3B4NA 3HG4A 4S1SH 25C8L 3FW6A 1BQHA 5TQ2H 3E7JA 3O2VH 4NCC2 3VU2A 2H8PB 2ZWZA 1HL5A 1LYQA 2V37A 4X4XA 3EYSL 5EU6D 3X1EA 3HS0A 1ZHLB 1DJZA 4Y7OC 5C6WH 4XMLH 4X9IA 5E4AA 1F56A 1XZ0A 2EIMB 4CBZA 2D9CA 1Q38A 2ZWSA 2EVFA 3RAJL 3MBEB 2AJSL 2MCPH 4NJAH 1JFQL 2I7SA 2IAAC 2BW4A 4FXGA 1ZLUK 2HRLA 3SKJH 2CUAA 4RDQG 3VI4A 5JHAA 2VDQH 5JIMA 4X6CF 4V1DD 1G9ML 1TQVA 3NJLA 3ZLQC 5J06A 5AOMA 4J28A 1KNOA 3TEXA 3W0WA 3ARGB 3DROA 4OZIB 5KBMA 1GOFA 3T1FA 5LGJB 3DTDA 4U3HA 3H56A 2H3KA 4G6FD 3DSNA 1IGIL 4KDTA 1VFBB 4JBSA 1A5FH 3MLSL 1HX0A 3FZUC 3VTMA 2ICWI 2VNCA 1YDPA 2XWDA 4FZEL 3U7WL 1CLZH 7PAZA 1AD9A 1JZHA 2LU4A 1IZKA 1YQVH 3MV7D 3N3EA 2VSMB 4NN7B 4PY8J 2IBZY 1TVHB 5CKGA 5C0AB 2WQRA 2R1XB 1NC4D 4YGVA 3VFWA 3BQUD 5G55A 5BV7L 4GXVL 3Q8EA 3AW5A 4ZMWA 1BJ1J 2FHBA 5DRWB 4B53A 4YE0A 3MODL 3QXDB 3TS8A 1RUPH 5EFIB 1MIEH 2NZ9C 1B2YA 1L0QA 4UAHA 3HE6D 3ZDYB 3O4LD 2Y2WA 1F3DH 5DUBB 1CTOA 1JNJA 5KAQF 3IRZA 5DTFB 1MCQA 5E6RB 5AW0B 4PRID 3D52A 2ZPKH 3B2XA 4S0HA 3VDCA 4ELME 2PPAA 4JM2C 5E2JA 3QWRD 1BAFH 3VXNA 3FHQA 5SWZA 1BGXH 2VW4A 4O2CB 4UT6H 1YN7A 1AKJA 1CTMA 4AY0A 1JK8B 3IDGA 2WO2B 2QTEA 3QO1A 3HIZA 4JB9L 4X6CA 3V9EA 3WFBL 5EWIL 1A3QA 2DDQL 3GMQB 4OKDA 1N0XH 4JQIL 2CRYA 2HRGA 3J07A 2IF7A 4K5PA 3BGMB