1BXAA

Amicyanin reduced, ph 4.4, 1.3 angstroms
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (AMICYANIN)
publication title Molecular basis for interprotein complex-dependent effects on the redox properties of amicyanin.
pubmed doi rcsb
molecule tags Electron transport
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1998-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bxaA00
1AZNA 1ILSA 4JHVA 4K9JA 1ZDSA 2WO3B 3TA4D 4G71B 1A65A 2W8CA 3V9CA 3AW5A 4E9XA 2PCYA 3NSFA 1PAZA 2FQFA 3DIVA 1JVLA 2ZOOA 4GYBA 4A2HA 1SFDA 3NSYA 2CCWA 1SF5A 3NJFA 3OMAB 4G7RB 3ABGA 1RZPA 5PCYA 1ET8A 1OCRB 2GHZA 2AANA 6PCYA 3QQXA 3AG2B 2EIMB 2BW5A 4UF7C 2FQGA 2GC4C 1PLAA 1DYZA 2RACA 2DYSB 1BYOA 1RZQA 1RCYA 4HHWA 3IBOA 1DZ0A 2QDVA 2BW4A 4DP6X 1J9RA 1CYXA 1NIFA 5D4JA 2GI0A 4BXVA 2GBAA 3T6ZA 1B3IA 3CZUB 4A2FA 4G70B 1RKRA 2HZHA 4KO7A 1V10A 4UAHA 1SHXA 4M3HA 4DP8X 4YSSA 2AZAA 1OE2A 3QPKA 2AFNA 4E9VA 2B08A 1J5CA 1T5KA 1PZCA 1NIBA 4HALA 4QKTA 1IC0A 3NJJA 4KNUA 3S3DB 3WIAA 4G7QB 2Y69B 4DP5X 3CVCA 2BWDA 1ZPUA 3NJKA 1HFUA 1UATA 3G5WA 2BO0A 5B1BB 2MRYA 2J5WA 2VW4A 2YAMA 3FQ2A 2DV6A 4DPAX 1KBWA 2UXGA 3EH3B 1ET5A 1AG6A 1GR7A 4Q8BA 1XMEB 1JZHA 4KO9A 4HIPA 4A2EA 3ABLB 1QNIA 5D4HA 2GSMB 3FT0A 3AG3B 5I5MA 2AZUA 3SQRA 1KV7A 2EIJB 4YSAA 3FSAA 4X4KA 5B3SB 2TSAA 2XX0A 3CDZA 4YSQA 6PAZA 2XV0A 3WKQA 2Q9OA 4DPBX 1WA2X 2B3IA 3CDZB 4BWUA 1XB8A 4JKNA 2QDWA 1V55B 4CSZA 3X1NA 4HCIA 1A4CA 1N68A 1IBYA 1TU2A 1PCSA 5AKRA 4PCYA 3HEIB 1MG3C 2QPDB 2J56A 3FSWA 5LDUA 1PF3A 1OCOB 2VM4A 3NJNA 3X1BA 1ZDQA 1JXFA 3C75A 5ANHA 4YVNA 2IDFA 2R7EB 3H4FA 4BK5C 2Q5BA 1AAJA 1NINA 3QJUB 3OM3B 4G72B 3FPYA 2NRDA 3UACA 1KCWA 1FWXA 5A7EA 1GS8A 2HX9A 1JXGA 4N8UA 4GY4A 1IUZA 1ASOA 4BDVA 3TU6A 1NDTA 2HX8A 5B1KA 2AVFA 4BDVB 4NAJA 4BWWA 3N2JA 5IY5B 3CVBA 5F7BA 2PPFA 2PPCA 4YSOA 1AZUA 1NIAA 3JT2A 1OE3A 2H5UA 3KW7A 3ZBMA 2WO2B 1CURA 3ABKB 1OCCB 3OQRA 5I5IA 1AQ8A 3FPXA 1GS7A 4KOCA 1FA4A 5E9NA 1PZBA 1JVOA 5TK4A 1J9QA 1M57B 3MBWB 2P80D 1AZRA 5B7FA 2IWKA 2UXFA 4RH4A 4QLWA 3OMNB 3T6WA 1NICA 1R1CA 2VW7A 1NIEA 1NWPA 1WAEA 3H4HA 3H56A 1BQKA 3NYKA 2XLLA 5I6KA 4W1TA 2JKWA 2ZXWB 3IE9A 2YXWA 3N55A 3T9WA 3AG1B 3QJTB 3T6VA 2I7OA 3IN0A 1NIDA 2OV0A 1OOWA 3IEAA 2YARA 1ZIBA 4E9QA 2IDSA 4WKXA 4AKPA 1PZAA 4AZUA 3SBQA 4HCFA 1AZBA 2MTAA 3WKPA 4N4YB 1GSKA 2XXFA 7PAZA 3S3BB 3DKHA 1SDDA 1MDAA 5AZUA 1NPJA 1FFTB 1ASPA 3PXLA 1X9RA 3UABA 1AS8A 4DP1X 2H3XC 1SDDB 1W8EA 3NJMA 3MX0B 1J9SA 2VSKB 3AG4B 1CC3A 2I85A 3FU8A 1KBVA 3NSCA 7PCYA 3UAEA 1MZYA 2CAKA 2FTAA 2XUWA 3L45A 2IH8A 5B1JC 3PPSA 2BZ7A 4E9TA 4YSPA 1BXAA 2P80A 1A4AA 3U25A 3NJIA 5PAZA 4AKOA 1GY1A 1F56A 1TKWA 1OE1A 1E30A 2IDTA 1OCZB 1BYPA 3BQVA 2HRHA 1CUOA 2HRGA 2PP7A 2PP9A 3GYRA 4HCGA 3TBCA 1KGYE 3AZUA 3ERXA 2IAAC 4KO5A 1L9PA 3PAUA 2IDQA 1ET7A 4AX3A 8PAZA 1M9WA 2EINB 4DP7X 2QT6A 5I6OA 1PLCA 5I6MA 1URIA 2YQBA 3EF4A 2LLNA 2CUAA 4GP8B 4P5SA 1IBZA 2WSDA 1MG2C 4DP2X 1ADWA 4E9YA 2N0MA 3FS9A 1XB3A 4NERA 2PPEA 1AG0A 3ASOB 3FSZA 4W9ZA 3X1GA 4GP4B 2J55A 1E5YA 4AI7A 1SNRA 2XV3A 3S8FB 1CYWA 2BHFA 5AFAA 2IH9A 3WNJA 4FA7B 1PNDA 4Q89A 4A66A 1TEGA 4DP9X 2YAEA 1HAUA 2EILB 2FQDA 2OCCB 2VW6A 3CVDA 4NB7A 4FAAB 4BWTA 4A67A 3NJLA 3S8GB 1BXVA 3FYIB 2UX6A 4A2GA 1BQ5A 2VMJA 3ABMB 1V54B 2HLEB 3FQYA 2VM3A 2HX7A 1ID2A 2YAQA 3ZIYA 4UANA 2QPEB 3EH5B 2FT6A 1SHWA 1GYCA 1SF3A 4YVUA 1BAWA 1I53A 3FU9A 2TSBA 1AANA 4E9SA 2XYBA 3FQ1A 1AR1B 3PAZA 1SFHA 3WG7B 1ASQA 3PAVA 3NSDA 4GXFA 4KOBA 3S3CB 1OF0A 2FNWA 3ASNB 1NTDA 2UXTA 3UADA 3JTBA 3TASA 1QHQA 2X87A 1J9TA 3X1EA 2PPDA 3SBPA 4L0PB 4ENZA 2BP8A 1PMYA 3TBBA 1AACA 3WNIA 2XU9A 2FT8A 1IKOP 1KDJA 2BP8B 2BZCA 1YLBB 4JHUA 5FC9A 5B1JA 1BXUA 4HHGA 1WS8A 1M56B 3PLYA 2CBPA 2E86A 2UXVA 3BVDB 4YSUA 3T6XA 2JFCA 3OD3A 4YL4A 3D12B 4DPCX 4F2FA 4KNTA 2PCFA 1GY2A 4AKQA 4F7KA 2YAPA 1N70A 1ZIAA 2DY2A 5F7AA 2VSMB 3NT0A 2XXGA 1NWOA 1A4BA 1WA1X 1EHKB 1X9UA 2DYRB 1JZIA 3UGEA 2YAFA 4G7SB 1AZCA 1JZEA 2EIKB 4E9WA 4YSTA 4BXSV 1ETJA 2HXAA 3RYMA 4DP0X 3PCYA 1E5ZA 2XV2A 2ZONA 5I28A 2DWSA 3GDCA 5B7MA 3V9EA 3T71A 3NJHA 1E67A 1W6LA 1TEFA 3X2QB 1PLBA 2X88A 1BQRA 1WS7A 1JOIA 1L9OA 1J5DA 3HB3B 1ZV2A 1W6WA 2Y1AA 4KO6A 2BWIA 3ZDWA 1EZLA 3NJGA 2CALA 1NPNA 1L9TA 1PY0A 4M4RB 1NZRA 3KW8A 3NP3A 1QLEB 3QJSB 4YSRA 1SJMA 5I26A 5I6PA 4P5RA 4A2DA 2OJ1A 1AOZA 4GP5B 5I5JA 5TK2A 3IN2A 3WI9A 2IDUA 2GC7C 1HAWA 2XWZA 1GS6X 3NP4A 4A68A 2JXMA 3CG8A 2DWTA 4HAKA 3UAAA 1A3ZA 1A8ZA 2PP8A 2FWLB 5B1AB 1JZFA 2PLTA 4HZ1A 1AIZA 3FYEB 2YAHA 4YSCA 3QJQB 1JZJA 2YAOA 5D4IA 5I6NA 1KDIA 1BEXA 2IWEA 2FQEA 1L9RA 2GB2A 3OMIB 3FU7A 3ZX1A 2XX1A 3DTUB 4E9RA 5EHFA 1KCBA 2PPAA 3FU7B 3GXUB 2W88A 5I6LA 2R7EA 2YXVA 2FT7A 1JERA 4EF3A 4YSEA 1E65A 3EHBB 2BP0A 3X1FA 1ILUA 2ZWNA 1L9QA 2GIMA 4KNSA 1JZGA 3QJRB 2UX7A 2H47C 2BP0B 2IWFA 9PCYA 4MFHA 3SBRA 3FSVA 2A3TA 4ZK8A 1OV8A 2CJ3A 1KYAA 5B7EA 4TXVB 2VN3A 2XVBA 2FJSA 4YSDA 4F2EA 1JXDA 3QJVB 1AS7A 1WA0X 3AY2A 1XB6A 1VLXA 1PNCA 4CSPA 1AS6A 1GW0A 2J57A 2I7SA 4WTQA 1MZZA 4PAZA 1L9SA 4DP4X 3EH4B
chains in the Genus database with same CATH superfamily
3I9AA 2ZAIA 3HKFA 2YQ2A 3MOAH 1OWRM 1KN4L 4JFFD 4E9XA 3UEZA 1RJYA 2QKIC 4YO0B 3KLHC 2XPGA 1A9VA 1UJ3A 3EUDA 3U9PL 1UACL 1RULL 3UPRB 3QS3A 1DEEA 4PWEA 4MNQE 4GOSA 4GYBA 5D5MB 2WXGA 2BIQA 5IOPA 2UYLB 1JDCA 1QR1A 2JKIS 4PSPA 4ZXBC 4WI0B 1JD9A 5MEQB 2PW2A 3EO1B 3ELAT 2VUKA 1RIHL 5C3TA 3TYFA 4AYGA 1XGUA 1GYWA 2J1XA 5DLML 2Y5TB 2JJTA 3UL4A 4HD9A 3JTTA 2VITB 3MGOB 1CN4A 1E3ZA 2H32B 3R19A 2CMRL 3D06A 1J9RA 1IAKB 3OB0K 5J56B 1KTDA 2XN9D 4LIQE 3VXQB 1C5DA 1AMXA 4GSRA 3D2UD 3VXUA 4WUUD 3PXHA 2H9GB 3OWRA 3EYUH 4A2FA 2D4DA 1JNHB 3ZY7A 5FK9B 5IHZA 2Z8SA 1EAOA 4J3UA 4M3HA 5FHAH 5HYFA 2WQVA 2VN6A 3HZYB 4R5TA 4QHNA 1MF2L 1SXAA 3JYCA 5HYJD 3MKGA 3QQ4A 2UZYA 1CVRA 6TAAA 1KZQA 4PRPD 3NEOA 3VWJB 4W9KC 4CSTA 1P2CB 1UWGH 4IEFB 2DYPD 5IQLA 2FLBT 3M17B 4HPYH 4OFYD 4P4KA 1U8HA 1Z3GL 4MBRA 1AGBB 3JV4A 2ZXAA 1GA2A 4S1SH 2JB5L 2VL4A 3CBRA 4KX9A 5IF0B 5LG1A 4NZUH 2MSPA 3FQ2A 3MRKB 3IDGB 4DPAX 5DEFA 2CZNA 2X89D 3D2TA 5FDYA 2DH3A 2XSKA 4Y8DC 1T6BX 3S34H 1O6SA 1JGEB 4JDEA 5CFHA 3BZ4B 1OF2A 2GT9A 3UTSA 1AD9B 1DVTA 1FBIH 4LVHB 3MFFB 5D7IF 4AQEA 1NDMA 3N44B 5B22A 1YHPA 2VDNB 2P7TB 5AWNL 4FKHA 2CDGB 1NFDE 3UG3A 3T3MF 4U1MB 3OKOA 2OBGA 1H8SA 3WKQA 4JY5H 2XG5A 3GLZA 5EA0H 3UTTB 1FLRH 3CDZB 1YDPA 1P4LB 5CWSA 4GJTB 1UH2A 3HZMB 9CGTA 1A6PA 2AERT 3NJVA 4CN4A 3DJRA 2HTKC 4MQXD 4PLOB 5I17B 3Q05A 2HT4C 4QRFA 5E8PB 3OZ9H 4Z7OE 3TTYA 4XVOA 5DEGB 4N2OA 5BOZG 4MTMA 3LRHA 2UY7B 3NCXA 4N87A 2GVYA 2KLSA 3TT3L 5TDPA 2QELA 3UXFA 4HUWA 1DTUA 1LWJA 2WUBL 2HWZH 3MZGB 2YD3A 4TSBL 3LIZA 5GZOA 1OT4A 3KJ6L 4YDIH 5CINH 4MB5A 3MRDB 4UT7L 4DQAA 4N0CC 1INQA 1VPOH 5GGQL 43C9A 1RHHA 3BSZH 4OAWB 2HVJB 3RIFK 1IE5A 3IYLW 1DBJH 1JWSA 5E08H 4Z0XA 3JWDL 5HGBA 1M1XB 2OI9C 1C5BH 1VFUA 1OP3K 5CGMA 1EZVY 3O0RH 4NUPA 4U1KB 4YSOA 3HBQA 5LLIC 3TBTA 3ZT7A 2PF6A 4H4NA 4X9BA 5EB9A 4D0CA 5TFSL 2GSIB 2UUDK 1A7NH 3KPNB 4J3TA 4OR1A 2A74A 1I1FA 1N6VA 3DUUA 4EN3A 1AQ8A 3FPXA 3G6AB 1H9DA 1U8KA 3BWSA 4GKZB 3LJ3A 5MI0C 3RVWD 3CSFA 4U4BA 2ZD0A 5TTRA 3L5XL 2WNKA 1NM4A 2HFEB 5K39B 3DHMA 1WBXA 3FQUA 2XTLA 1E40A 2R2EA 4MNQA 2PWEA 3L5WA 4YDKH 1PZ2A 4PS7A 3QA3A 3HE6D 3W2DH 4HUVB 5IEKB 3DK2A 2BNRE 1XSJA 4HW6A 3MLUL 1KUMA 3ARBB 2V5SA 1NEZG 1KTBA 5FKPA 1LO4L 1RUMH 1UM4H 3HZVA 3NSJA 3N55A 2F15A 5AALA 3V6FB 3QW9A 1MPAH 1U8NB 4NQCA 2EYRA 1U8QB 4QXUH 4A7UA 2Y3AA 1WFJA 4LARH 3KPRE 3BUQA 4HUCA 2EYTA 5F7YC 1E3XA 3RTQA 4WW2A 3EJYC 1SJHA 2BVOB 2AI0L 5I6XC 4JGNA 1XX9C 5I74B 1E4XH 5GIRA 4XMLL 3NK3A 5JLZA 3N1MC 5MEOA 4XODA 4N4YB 5KBMA 2MQ0A 4IKJA 4XT1C 5C86A 1MWAH 1WRFA 3A6BH 3OKMB 4OCSH 4WHYG 3HC3H 3MXWH 1JWUA 1ASPA 3TN0C 3DX9B 3NA9H 5DMKA 2OMWB 2J4WH 3UABA 1ACZA 3VO0A 1NFIA 1KLUA 1LE9A 1H3PL 1MRCL 2V5RA 5E9DD 2I85A 3TOPA 1IGTA 1EANA 3NSCA 5DS8A 4PTUA 5FFLA 1GYUA 1IC7H 4HCRL 5FIEA 2WQUA 3MNDA 4X7EC 1KTLB 2X41A 2YWYA 4ODSL 5JPMB 2VZ1A 3IDYC 4NIYE 3V7AG 3PDDA 5PAZA 3MRHB 4BFNA 1GGBH 3AREA 5MENB 1MY5A 1OE1A 4AIEA 2OA9A 2AV7A 2ZXEB 1CUOA 4ZO6A 3VM7A 5EF1A 2ZE0A 1O9ZA 4N0YH 5GS1C 5LQBL 5E1AA 2FECI 1N7MH 4FF9A 4YFEA 2RH0A 2QLYA 4PV9B 1NFDA 1DSWA 3TBYA 1DLHB 3B5TA 3HC2A 3QRBA 3GINA 3ROOA 4Z8FL 7FABL 5IHBA 3WY4A 1TF4A 3CMGA 3AGWA 1CK0H 5IBUB 1HH6B 3MI6A 3SYQA 4WU5B 3HC4L 3OHXB 4HSAC 5AL0A 4L8CB 2OW6A 2ATPA 1QVOB 2WXFA 5JQ6L 3K81A 4AJWA 2QV2A 3KLSA 1RZ8B 4RLDA 3WTWA 2Y23A 3WNJA 1JFQL 4C59B 3QO1A 1YEEH 2B9AA 5AVRB 4ZFZA 3HG4A 2YAEA 2J5LB 4CADA 3PIQB 4KK8D 2IPKA 4BWTA 1ID5I 3KYKL 1UD2A 5DZJA 4GRLD 4M93C 1U92B 3VA2C 4MA8H 2Y7SA 4WSGA 3CBKB 3KPPB 1NLBH 3RIFF 3SJVE 1SN0A 3US1A 1GJWA 1BFOB 3G04A 1NKGA 5H35A 3BAJA 3CVHH 4HAFA 4NQSB 4F7TA 2X42A 1PZ5A 2VDOH 3LPFA 4UOQA 3D33A 4Z7AA 5HHNB 4QAMB 1BVLA 1KPRA 1NGYB 4ZW8A 2VTFA 4G8GD 3PDOB 4DERA 4WO4C 1YPZB 3UO8B 3GHBH 1MH5B 4H1LA 4NQDB 4OJFL 1NBZB 3STLA 5DMGD 5L7XL 1HXMB 2NTSP 3DO3A 5F2FA 5L2KE 1DVXA 4MMYA 5B8CC 2DIJA 1T22B 3A4AA 5FYLH 3GUTA 1AHWA 5I6NA 4PP1C 3WL9A 2D31B 4C83A 1CF8H 2YKLL 5HHXL 3ZVVA 1CFQA 3KYOA 1A4JA 1FNEB 3VA6A 2DWYA 2X4QA 5C0JA 5LXGH 5EPMA 1ONQA 2BDNH 5CJQH 4UDTA 1E0OB 3WNIA 3UGUA 3RVTD 3MJWA 3U4EA 5ADOL 2JF1A 4TPRL 5GRUH 4F7EB 5FAAA 1KGCD 2WWNA 2FWOB 3DMMA 3IAQA 4HLZG 2DM2A 5A3ID 1JL8A 2DD8H 2CXGA 3FULA 3VXOA 4L23A 2XQYA 5IMLA 2H7WA 1EHLH 2PCFB 2VAAB 4R2GC 1K6QL 1U9KA 4F9PA 4GT0A 2ATKA 1J9CT 3O6KH 2PR4H 3STBA 4X98A 4FQXA 5D5MF 1F4XL 4OM1L 2YMTA 2CJUL 1X9UA 2OXGB 3A67L 1INEH 4ICWA 4BBWA 5ID1B 3HCVB 1WBZA 2P5WE 2IBZY 2ADGA 3BUTA 4JZNA 2OTPA 4OZFB 3KPTA 2QADC 2OMYA 4JREC 1DJXA 4ZOAA 3QFDB 1E5ZA 5JR1H 5KAQF 3RDJA 2NY0D 4OVVA 3CSPA 5IEHA 2X2YA 4Q56A 1UFGA 1QFWM 2WN2A 1QYGH 4LGSB 1WS7A 4XC1H 3WFDL 4X6DA 2Q7YA 4DVRH 5T1JA 2W9EH 2Y9RT 4KO6A 4MAUH 4MJIE 4TL4A 4PJ5E 4YBQD 3H9ZA 3DX8A 4OD2B 2FH6A 3M07A 1FYTE 3CNKA 3QQ9C 4KHTL 5GRVL 5B4MD 3JXAA 4KJWD 3V4PL 3WFBL 4Q9QL 5I26A 2CXKA 4UILH 5HI5C 4KQ0A 1MAKA 2F7RA 1TO5A 3Q6GL 4JVPA 4ZW5A 2AQ2A 1TUPA 3FT9A 4KRNA 5IBTH 2ZWLT 3H9SA 4JFOA 3WDJA 1YY8A 1P69B 4JRYD 4LPYA 5F1IB 2PP8A 4WEUD 5C0BE 3BISA 1PEZA 2GTZB 2VLJD 3MXVH 4F92B 3WTXA 3IPFA 3GMOA 5EORH 3OAUH 3QC6X 2OMUB 3BEVA 5T5NF 4ZFGH 4KVNH 1R3HB 1OLZA 4P4KC 2GW5A 1JGVL 2GEQA 1BEXA 1ZTXH 1U41A 3BHBB 3KYNA 4IU2B 3ULSA 5DMYA 4WI9A 5AW1B 1HQ4A 5E8NA 2K9FB 2VKWA 1RHFA 2FHCA 1W91A 2WLHA 3O2DA 3FN9A 3IJHA 5EUKA 1E9OB 5CZRA 5E2TH 3MHZA 5KVEL 1MI5B 1H6EA 2BVUA 4UTBL 3EGXA 2WMPB 2WTOA 1A2YB 4APXB 1NUNB 1UD4A 3CFIC 1I7ZB 5JMOC 5D7LD 5K1JA 4GAFB 4ZUSA 4Y9BA 1KBGH 5EC1A 5TGBA 3SJVA 4N5ED 3SPHA 5HYSG 5IP4A 2WINA 3K91A 2RGSA 1FH2A 1S7UB 2PMZA 5FGCE 3TH3T 3BW9B 2FJSA 4FEIA 3D85B 4LL9A 5AW9B 3L3JA 4LBEA 3WMQA 3QUYD 5AYUL 1XO8A 4TSAH 5IK3A 5A6LA 3LV3B 2XNAB 1MZZA 1M2VA 1WFMA 2N4IA 4JBSA 4DP4X 3VXNA 1AC6A 3I02A 1P1ZA 5EU5A 4F24A 2YD1A 4HJ0C 2ENSA 4LO9A 4MKTA 5E94A 1JWMA 3SBWA 1HEZB 5DJXA 3CSYB 1ACXA 1X5IA 5IVZB 4XMPH 1WC7A 4KKLC 5HDRA 1QPKA 4IBWA 2B2XL 2NCMA 3T4AA 1M6OB 4ZMPA 5HYEA 3VD4A 2CLVB 1J5HA 1SMOA 4G7RB 2WN3A 4WWNA 4PGEA 1RZPA 2X6UA 5I1EH 1FFNB 3CV5A 1PY4A 5AVUB 1M7IB 2ZX9A 4XAWH 1YNTB 4M5TA 1WFTA 4AV5A 3QDJA 4GRWB 5E5LA 3U82B 4AQAA 1FO0A 3NGBB 4R90H 2FWSA 4GUPA 1UXLA 1PSKL 4F7CB 4C56B 1IKNA 4H7VA 3MA7B 5CM1A 1RPKA 5LCVA 3RFZA 1FGVL 3MYJA 4XN7A 2DZEA 2GBAA 1KJ2H 3D18A 4KQ3L 1DBML 3TGXA 4ABUA 3AWGA 1PG7L 3UROR 3K5SA 2XACC 1ZT4B 4XCFH 2A74C 3TURA 3UJIH 2R69A 5C0RH 1BAFH 2BVEA 3IMRA 2O26U 4FNPA 4DP8X 5A2LH 4FP8H 1OARH 2D3LA 3K4AA 2F54D 2AFNA 3IGFA 3E38A 3M6DA 3P0YH 4FXGA 3GSWB 4X9GA 2X2JA 3D0LA 2MPAH 5BOJA 3QULA 4O58L 3IMBA 1YEJH 2ZSWB 3CFUA 2JJWA 4JFFE 4M62H 4HALA 3S35L 3S3PA 3OAZH 1A6VL 3O6FD 3PUCA 1A4KA 4FFYA 1ZT7A 1TT6A 2GFBB 3IVKA 4B9FA 4P5TB 4FNLL 2JKTM 4AM0Q 2EVGA 4B9PA 2J5WA 1IAOA 2E4FA 2BIMA 1FCGA 2IAMA 5E5MB 4GT7A 4OFPA 2CPUA 4FGMA 3W39A 4JUSA 4WK2B 5BVJA 2BXZA 1D2PA 1H15A 2LTQC 1H3VA 1Q9WB 5E8DH 4RAVB 3CQFA 1EO8L 3RTQC 1VDGA 4WW2C 4O9HH 5EO0B 2J43A 2LU7A 1FYTA 2NY4C 4XRCA 3CXDL 3BIAX 1UQSB 2XN9E 3QEQB 1AI1L 4HH8A 5EC2A 4ODHH 4PJEE 2Z91A 3BKML 3LNHA 4ESKA 2X9ZA 1K4DB 2H8PB 3VSQA 1VACA 4DEWA 3CE1A 3TV8A 2P5ED 3COOA 3HE7D 1BZQK 4FFTA 1J18A 3CMOL 3BH4A 5F7WC 3QPXH 2HJLA 4ZJ9A 2F53D 3VFGL 4G83A 4FABL 3TYGH 4TUOA 3QORC 4IKIA 1JMZA 3OF6A 1U91A 5HYJE 3GZQA 4LAJH 5IW3A 4HSCX 1A1OB 4FXTA 2C3VB 4PRPE 5D2LF 4EDXA 3X1BA 4GSXA 5DHDA 2A9NL 5F96H 3TO4C 4XPAH 4RQQB 4XI5C 3IJ7A 2VXUL 3NIDB 4POZD 2Z1PA 1R17A 2E7CA 3AREC 3OGOE 1T4WA 4Z7VB 3HPJA 2YMXL 2V7HB 1PDKA 1S7XB 1I8KA 2CBQA 3VTTA 5FWRA 4NCC1 4UOW1 4AZ8B 3MJ7A 1PL3A 4BDVA 3DC0A 2D03L 3LIZL 3SYPA 4YN3A 5C0FA 2XWJA 4KGLA 1KPVA 4U31A 4XWGH 1XAKA 1KCSH 3O3DB 4WFHE 2W5PA 2YD9A 5CIPB 1S9KC 1NIAA 1RURL 4QRPA 4HC1H 5JHDD 3BDYH 2O5ZL 4LBAA 5K1NA 4M48H 4LRIA 1P5UA 1J11A 1D9KD 4HIJA 4ATWA 5I66A 4R5XA 3LH9A 3ECBA 2HMID 1E4WH 4RFOL 1G7MB 3VDAA 3NIGE 1WEJH 4K4KA 5K93A 5GSRA 4BH7A 2WAQA 1XR9A 3TVMC 1G6VK 1Z1WA 4HFUH 3BAEH 3EFFA 1PFCA 4S0TD 4AYBA 3Q8BA 1ZHKA 4RA3A 1M7DB 3BT2L 1SBBA 2F6AA 3OZLA 2X3AA 3H4HA 4NM8L 2VM9A 1RAMA 2QSCL 3CZJA 1FDLL 3OR6B 4IOSD 2VDKH 4W81A 5DZNA 3ZXAC 3L4YA 4PJHA 4JKKA 3IE9A 5J89A 4N9GB 3NZ8A 4GXUM 3MROB 1FH5H 1A3QA 1T1YB 4WAFA 2FR4B 4PWKA 3IDIB 3RDTB 4I0PB 1W16A 1BWWA 4X4XB 4JFWA 2NNRA 3DX4A 1SVCP 4NUGH 1KENH 5EWIL 3A4FA 1YPZF 4KRPC 2KHAA 1VIWA 4GS7B 3I75A 2H2PD 2X1QA 3QUKA 4XZUB 2DL9A 1AZBA 5IBLD 1F2XK 3WKPA 5CF3A 3ULUL 4HMDA 3ZKMD 1GVIA 2BP5M 1K85A 3BPOB 4GINA 1OB1A 2XXFA 4EN2A 1VFBB 1ZSDA 4TNEA 4JKMA 3GMNA 4P2QD 2JJSA 3B8SA 1PFOA 2IADA 3O8XD 5KYUA 1OCWH 4BELD 5I1HH 4NT6A 4J3WA 4UINL 1UM5L 2H6UA 4D2NA 3LZRA 4JFFA 4NP4L 4ELMB 3BP7A 4NO5B 5TE7H 3LZLA 3T5WA 3FJTA 2IV8A 2ZG1A 1S3KH 4JO3H 4BA8A 2CAKA 4R97B 3O2VH 4Q0XL 3L13A 3FW6A 4YSPA 4AGOA 3U25A 1I31A 4ZUVB 4C4KT 1MCDA 1Z6JT 5D4QA 2ZYSA 1FHGA 3T0VA 3HS0C 5I16B 3K2KA 3TTSA 2A77L 1DVQA 4OZIE 1WT5A 4PVBA 5C0GB 4M7LH 3QYNA 1CI5A 3AXLB 4JRXA 4P59H 1JI1A 1QI3A 4N0UE 1JYXA 2H3KA 2YQGA 1XBRA 5D71H 2IPTL 2VDPB 4PJEA 3TEZA 4FQXC 3UC0L 3W11C 4NGHH 1DQTA 1QEWA 2E7MA 2QT6A 4NN6C 4DGYL 1MHPH 3ATBA 4M61B 2VN4A 3WDIA 3L4CA 3V55A 2EDBA 4BQ9A 1MG2C 4L8DA 2NZ9D 5IB5B 1FPTL 4NFCA 2X4NB 5IQ9B 3L1OL 4PVMA 1NCOA 5HYJA 1CFTA 4WHYH 4IU3B 3B9KB 2HVKA 2OKMA 4D94A 1NMCC 5E9DE 3P4NA 3AXIA 1B2WH 4Q89A 3VRIA 4HPHA 4L37A 2VNCA 1A9BA 3GSUA 1T4KB 1PLGL 1FNAA 3W56A 4IOFC 4LEBA 2BY1A 1NC4A 5B8CB 1SUHA 3WNOA 2A2QT 3L1GA 5KJ4A 5I18L 1HNGA 1ML0A 2SEBA 5DK0B 4AIZA 1RUAH 3FYIB 4JQIL 4I48B 3QHZH 5JW4N 3QZMA 4ZSOE 2X89A 2G9KA 4X6CB 4WVRA 4KZ0A 4Y1AD 1T0NB 3FQYA 1WICA 1LYQA 3MTXA 3V9FA 1E6JH 2DWEB 1KB5L 4OU3A 4XNAA 3AACA 4A6YH 5DJYA 3RWDB 5M94B 4U1GB 2DQIL 5BS0D 3WHE1 2FRGP 1BBJB 1J8HD 3O11A 5GGSB 2UWEE 5D1ZA 2NNCA 2VDML 3HJ0A 3BSZA 3VSVA 3BH8B 1C12B 4FI7A 3ZT5A 3LHAA 4K9EC 5GHWL 3DVFA 2QZ5A 4NKDA 2M2DA 2ZUTA 4F5CA 4R7DB 1M7XA 4U0QB 1GC1C 1B9ZA 3EHBC 1CLYL 5EV7A 3JTBA 1I1YA 5BJTB 3D51A 1KIQB 3O45A 4NP9A 4J7RA 3BP5B 1SDYA 3M8OH 1KNOB 1O5DT 5J7CC 5DR5L 2X7LA 4X5LA 4RZCA 1B88A 3TBSA 5HI3C 2BP8B 2OTUA 4HJGB 1U95A 4M7JL 3NFSH 5J6HA 3OJ2C 5LUMA 1LTXA 1SOQA 3ZPDA 4HK0A 2IANE 3T6XA 2AQSA 2JFCA 1WSST 3OD3A 4M5YH 1S6NA 4E0RA 4AEEA 3SY0A 3FT1A 3I85A 3IFNL 1CD1B 4UUJB 5KN5A 3Q13A 5FA3B 2J44A 2GIYA 4IBUA 1FVCA 4AE0A 4MZ2A 3FQ4A 1J05A 3LNFA 2NXZB 4UV7L 5SX4H 4KRMB 1NWOA 3AQZA 3HUJE 3B5HA 3IXTA 1N59A 2NY3C 3CFQA 3NACH 3CX5K 4G8GE 3Q8FA 3U6RB 4CVZA 3IRZA 1A6WL 5ECJE 5GZND 3QJHB 5IESL 1KFAL 2YBRB 3LKQB 3T4AC 1Z3RA 3C5ZD 2E3VA 4YE0A 2CO4A 4U6HB 4WHTB 1IT9H 2HG5B 5I8OL 5KW9H 3S88H 2ENYA 2BVYA 4OLXH 3NJHA 2DLFH 1MWAA 1DLFL 1QPXA 4OCXH 5I30H 4LCCB 4ZS6D 1N64L 2X6AA 2H6OA 2VXSL 4EBQL 4MDJA 5HD8C 1UB6B 5EEWA 1F1AA 1IKNC 1PD6A 2KERA 5IM7B 1I4FA 1YYLL 3RFZC 4AT6B 4BFJA 4KK5C 1JK8B 4XNDA 4NPYA 4DUWA 5FKAA 1NPNA 4PJAE 4AH2A 3EDDA 3M86A 4F15B 4PJBB 5LBSH 1KGCE 2YEQA 2LFEA 1DFBH 3B7RL 4OZIA 1P5VB 5I6PA 1XSKA 2JK5A 3H9HA 4F3FB 5CEZL 3T2NH 1OSYA 5K33A 3SKNA 3L6FB 1NGZA 1BM7A 3IN2A 2H0FA 4K94C 3P4OA 4HLZH 4J3SA 4RAUA 4TVPL 5E8EB 5HGAB 3V7MA 1A02N 3VX0A 3FMGH 4PJIB 4FXGC 5ERWA 3QZWB 2JXMB 3LQAC 4U6YB 5E8OA 3VW3H 4HISA 2D8KA 3VG0L 3C08L 2QMKA 2ESVA 2YAOA 5AUMB 2G0KA 4N25A 2YK1L 2BIHA 5I19H 2HSIA 3I6KB 2IAMC 1G43A 3JVFC 1JPFA 3O2DL 2XN1A 4UU9A 3O3AA 3AQYA 4OCYH 3KDMA 4YSEA 2EKSB 1NBYB 1SVZA 4JFQB 2VXVH 4GAJH 1MLCB 5KVDE 3IXAA 1JZGA 5B39A 2X6VA 1L0XA 4JM4L 1BF2A 5ACMA 5HHVH 1S9VB 2H3NB 2C1OB 1JUFB 4TXVB 3BO8B 3HNTH 4F2EA 2N59A 5ECGA 3KPQB 1WA0X 2GCYB 4QPEA 4J3XA 3L81A 3CPLB 5ALBH 1KEMH 3V4VB 3E2HB 3L5JA 4AGLA 3FQNB 1NC2B 3X3FH 1BX2B 5I2IB 3GM0A 3TEXA 5ILTH 2BSCA 2UWEA 3CVHA 4JRYE 2Q6WA 2W60B 2AGJL 3ROLB 1DN0B 2VLJE 3C60B 3FU0A 3V0WL 4ZPTA 3EYVB 5IG7A 4L9LB 1TLMA 4MNGA 4K15A 3U6XS 1NGQL 2KH2B 3WE6A 5F9OH 3V5KB 3ZR6A 3BXNB 4RMVA 4UZUA 3VYOA 5A16B 1MFBL 3BUYB 3L4XA 4Y2OB 1A22B 1TTUA 2ZX5A 3BT0A 5FECA 4AJ0A 4OZGB 2KZWA 5IR1B 1RH8A 4U1HA 2GC4C 2XJLA 4H8HA 3SE3A 4MVBD 2RACA 1CLZL 4G59C 4W9DC 1IAMA 1FO0L 3TA3B 2WBJC 2J21A 2AAAA 2IANA 1S7TB 4OZHE 2AQQA 5E2UH 3HBGA 1AGDA 2Y6TE 2NY1C 2V6HA 1BQUA 5JIMA 4X5RA 5LCVL 2D2OA 4HS8H 1UD3A 3QI9B 4NHCL 2MCAA 3S9DB 1MHEB 5E1IA 1I9IL 4OF7A 1HNYA 4G8FA 1SHXA 2R2HB 3FO0L 4FFVD 2NY2D 1YJDH 3DPBB 5EDXA 3HUJA 1AHMA 3F00A 4L29A 3BAYA 1UYWL 2R69L 3BGMB 3QPKA 1LO2L 1W0VB 2QHRL 4M29A 4DNLA 2NY4B 4CL7A 3BZEB 2ADJA 1T2JA 2G2NA 4QUOA 1JGUH 3LRLA 5KWYC 1DE4A 3LQAL 1IC0A 1DSFL 1U8PA 1AO7B 3CFKA 3BIKB 1MFVA 3OXSA 5FFGA 2F61A 1MREH 1XSOA 5B1BB 4FFYL 1ZGLB 5FYJH 4JDZA 1ZEAL 4LEOB 1YEFH 2N1KA 4LP8A 3T8VA 3ECVA 1HIML 4ETYA 4K5NA 5I15L 35C8L 4WI7A 1MFEL 4V11A 3GB7A 4DKAA 4AW4A 1A9EB 3NEEA 1HSBB 3DSNB 4HKXB 4HF5H 4KTDL 4X50A 2N7BA 4R3SB 1ACYH 2F2HA 4WDIA 1BFVH 1UH3A 4K07A 4RWYL 4MQTB 1INDH 1OKEA 1N6UA 1L7TL 2CJTA 1KGUA 2XX0A 1YN7B 4M8QA 6PAZA 5DD1H 2GHWB 1Q8MA 2FX7L 4PWJA 4ELMF 1JYWA 3WMPA 3BAXA 4Z9KB 5EIIG 5KG9A 5I1JH 4XP1L 4XWOD 3VXPA 3QEUA 5FM5O 3U0WH 1MXDA 1JGDB 2I5YL 1BXXA 2F54E 3NUKA 4LQFH 4MNHB 5DUJA 3Q2LA 4ZBJA 4LSVL 3MOBH 2A9BA 3L2LA 2NR6A 8FABA 1SM3L 3MRPA 3JWOL 4QXVA 5SX4I 5IUCA 3WJJA 3BLKA 4LLMB 5HXMA 3FRPA 4JFDB 5E6IA 4MS8D 1AGEB 2I60H 2QSTA 3H4FA 3DHPA 5HGHA 2WOBA 2CO6B 2C26A 4I9XA 4S1DD 1CXLA 2VR9A 3BWZA 3PWVA 3CSTA 4YHOL 3BKJL 3US9A 2Y1YA 1WT5C 5DD6B 3VCLA 2LLGA 2X4RA 3TU6A 4YHNA 2OYPA 2OYMA 3LS4H 4AXWB 4OFKA 4KV5F 2GITA 2XA8H 3QDGD 4C47A 4UIMB 1YMHB 3MTRA 1AZUA 3ESNA 1D5MA 3INUH 4HFWA 5J5EA 5MP6L 1CD9B 3H2PA 1H3UA 3MV8B 3C2AL 4G7YH 3ZHFA 1K5NB 1JI2A 4KY1L 1KXVC 1M53A 1Q94B 1YQVH 2P5EE 4OCRH 1GS7A 4MQ7A 4YZFF 5LGHL 4ONOA 2VLJA 4R26L 2F53E 5TK4A 4JN2B 4DEPB 3STZA 2VQTA 5F9JA 1UGKA 3N50A 4QLWA 1Z66A 4FJYA 4OT1L 3QUZA 4JDTH 2VW7A 3IAPA 3VXMA 4HU8A 4ZTEA 1MAMH 3IU4L 4NO3A 1BQKA 3NCYP 1FSKC 3GMLA 1OXYA 3QG6A 4JM2D 4N6RA 1PKQE 5I1DA 2C7UA 4FRWA 1WIUA 3MOAL 5C0DB 1F3DJ 2ZWYA 1ZE3H 3G5VB 2WSPA 2BNRB 3RBSA 4JFXA 4AIOA 1AKPA 4DN4H 5CD3B 4FYRA 4OZHA 4U3HA 4X8JA 2VDLB 3KYMA 3P11H 5T1LA 1I8IA 1RIUH 3APCA 1FC1A 2J3SA 1BDYA 4P5MB 3CZKA 1MNUH 1EERB 4N85A 1B9KA 1IGJB 15C8H 1N5AB 4KDVA 3F64A 4Y5YC 1CFSB 5D1ZC 4OGYH 1OP5H 1MJ7H 1CTNA 3KPRB 2CH8A 3QISA 5D7EA 2ARWA 5JHDE 4PRBB 1BG9A 1SDDA 3L1FA 1NPUA 2PETA 4TS6A 4L0YA 4U3SB 1KJ2A 4MQXC 4YZWA 3ZL1A 2EDNA 2AJXH 3G9VA 1U8IA 1EJ8A 2XKNA 4NBYB 3RY4A 3SE9H 3EYUL 4NRZB 1ZHLA 2XY1A 2JCCA 1T1ZB 1X5KA 1TQBC 4XOAA 5FHAL 3CFCH 1BEYH 2B5IB 4LPUA 3H7BB 1YMMD 4AENB 2E7BA 1MCWW 2H6PB 1A25A 4JO1H 2V2WB 1X5AA 1YNLH 4RWHA 3RB5A 4FL4C 3LNEA 1UWGL 3BQVA 2WP3T 4HWZB 5AKSA 4U6VL 4HPYL 4OTXH 3EOYG 4TTGA 1KGYE 1Y1DA 3RWEB 3WE1A 4LFHG 5I5RA 1PD1A 1DBBH 4S1SL 5KAQG 3EH2A 5I8CA 2J88H 1DUYB 4NZUL 3H1ZA 2YEZB 3BVVA 2HAZA 4DP7X 4YHLH 3MLZH 2GTQA 5DJ6A 4AV0A 3A4DA 3L95B 4ERSH 5LVEA 4IIQA 3AWEA 3S34L 5TE4H 4JR9H 3RVWC 4JE4B 4YHIB 4WFED 4NQXB 2F54A 1LMIA 1FBIL 4P2QE 4LVNB 4AI7A 1HZKA 4N2DA 3ME0A 1JJUA 3EF7A 5C0EB 3HE6C 3DTXB 5IREA 4X7CC 3VE0B 4N3TA 4PJBF 2FUTA 4JY5L 5EA0L 3BFWA 1FLRL 2R0WH 3IE4A 5BQ7A 3CFTA 5AVWB 4GRMA 4N2MA 3LDBC 4GFTB 1B4RA 3RX9A 3BQUD 4X6BB 1QA9A 3QNXB 4Q6YA 3QNYA 3FO9B 3OZ9L 1EMTH 4NQEA 5T5NG 2K0RA 4PJIF 2A73B 3LNGA 2HLEB 3QAZC 1UXWA 1IM9B 1QSFB 2BJMH 3K4DA 2X4TB 1BVKA 2QPEB 2H41A 3W9EB 4EUPB 2ZCZA 4V33A 1FZOA 4ONFH 5LBGA 3CGTA 1OGAB 2QR0A 3DA0A 3N1PC 2HWZL 4OF3A 5SV3A 3QFJA 4OGAD 3VQMA 1H6TA 3MC0A 3R18A 4YDIL 5CINL 1D7DA 2P5EA 2W9LA 1A1NA 1VPOL 2YPVA 1OT2A 3BSZL 3GJFH 1UEYA 1DBJL 2I25N 1UWEH 4ONHB 4XOBA 4B9YA 5E08L 2FAUA 2YD8A 5IJVB 1C5BL 5AW0B 4HC1A 5IT2H 3O0RL 2NY6C 2BSSA 2XG4B 2OX5B 1COBA 4QY8B 2XWBA 1U8CB 3QO0A 5ES4B 3BAIA 1A7NL 1LQBC 4LAQH 2BVPB 4WNQB 3ZGIA 2CNYA 1PKQA 1WGVA 3ZTCC 2DH2A 4EIBA 3U48A 1KMGA 2VH5H 3G7TA 5BUPA 1BZ9B 5KVGH 2AP2A 3ZHNA 1ZLSH 2DMGA 3CDFA 2J6EH 1IBDA 3N40F 2WGXA 5CU5A 1KC5H 3W2DL 2J1WA 4IHBA 4Y1AE 3VACA 5DVOA 4IYKA 5GRXG 4AV4A 2LABA 5ISZD 1KCUH 4JFYB 1IGFH 1XGRB 5ANME 4Z7QB 1RUML 1UM4L 4I3GA 2B59B 1T3FA 4JQVA 3LB6C 4FYTA 4YHMH 3BD5A 5BS0E 1I8MB 1MPAL 4H88H 3M7OA 3ZN6A 4F7PA 4QXUL 3UGXA 4X8CA 1D9KA 1A6ZB 4LARL 1J8HE 4LEXH 2YAFA 3FRUB 3UGEA 5J11B 3CU1A 3KNBA 4WNSA 5DJCB 3DI2B 1B90A 3REWA 3GMPA 1ZS8A 3QXUA 2VXTH 2ICWB 1WZ1H 3MRJB 5F93C 3QEGH 1E4XL 5GGUA 3ARGB 2Y5QA 1EDQA 4V1DD 1E67A 3SE6A 3ZE0E 4KK8C 2P5WB 3X2QB 1DQQA 1P84K 3EDFA 5C0ND 4MA3B 5CP3H 3SE3C 3VFOB 4BFEA 2ERJC 1MWAL 4MCZA 4F91B 4OCSL 3A6BL 1JCKA 4QNPF 3HC3L 3MXWL 3HB3B 2GQHA 4M4RA 1F11B 3MVSA 1HHJB 3NA9L 2J4WL 3FOMA 4Z6AT 4NIKB 3H7LA 3DLQR 2W92A 5F1OB 3GBDA 5FLVA 3T1FA 2DQGH 3T2QA 4YSRA 3CH8A 4JDVB 1IC7L 4WW2F 2BS71 1MQ8A 3PGCB 2C5DC 4MJIB 2XVKA 4X9FA 2C9UA 2VT0A 1OGTA 4PJ5B 3UP6A 5I1AA 5F8RC 4JANB 4LMQI 4A7SA 2XQYK 4EQ2A 3LVTA 4BZ1H 1UA3A 2JKXA 2VZTA 5DMGC 3MUGA 3VXSD 3OKDB 1JNNH 1GGBL 5MEPA 1E90A 1NEZA 4J12A 4OD1H 5F1KC 5J9PB 2MCPH 4O51B 2MNJB 4F8LA 4N0YL 2WUCH 4KROD 3O4LA 3U1QA 2CSPA 3QFGA 3VWKD 1N7ML 4JHWH 1MVUB 1DFXA 5DQ9A 2K6YA 2PYED 3MCKA 1EEZB 2QFPA 1BQSA 1EEQA 2H26A 3BVTA 3RIKA 1CK0L 1ES0B 3OKKB 2K6ZA 2BP0A 2GIMA 1JZ3A 4J4PD 3TIEB 1MFAH 4XCYB 3ULAB 3ATDA 1EAPA 1Z32X 2QQKH 3AU0A 4JG0H 1TZGH 3MRNA 4TV3A 4UM9A 3U7YH 3ZTJG 3QDMD 1YEEL 2EC9T 1OD9A 3GMQA 5GJSH 1OT1A 1BJMA 2CDFB 3MA9H 1JPGB 1NFDF 2XWTA 3KGRA 1JZDC 3EFDH 4MA8L 5CXPA 1G9MH 5F1NB 3SD5A 2DJ4A 5F6IC 2NMSA 1NLBL 4R4BA 4RMUA 5FGCB 3U2SB 4MGXA 4EI5D 3ZT6A 3WJJC 4BZYA 2V3FA 3CVHL 1WWAX 4GNKB 4BSVB 4FG6C 5H4ZA 4X5PA 5IFJB 1AY1H 3X11B 2VDOL 3ARVA 3DIVA 4A6YA 4Z7OF 2NY0C 2Q8AH 4UTCA 1BP3B 1VRSA 1JHTB 4J28A 1BD2D 3ZO0A 2VUYA 1JN6B 5IBUG 3QARA 3GHBL 3L3DA 5C08D 1WISA 2AANA 3OLGA 3QP3A 3QQXA 2EIMB 1TZIA 2Z35A 3CFBB 3G08A 2Y07H 5FYLL 2EAEA 5HPOA 5IHHA 1CF8L 3QCUH 3MV7E 2Y5EA 4HHWA 1DZ0A 4FJ6A 4PJ6A 4M6NH 2WB7A 5B4MC 1ADQH 1S46A 1M42A 2A6KA 4LNVA 3N43F 5LXGL 3IETB 3AT0A 3CFDB 4ZFOA 3RWIB 2BDNL 1RKRA 3KM1A 5CJQL 3H8NA 1V10A 2PWFA 2I07B 1IFHH 1NBCA 1A3RH 2WK2A 2EIZA 3KPMB 5GRUL 3TZVD 5D6CA 2G9HB 5BS0A 1I7TA 3DVIA 4BGLA 1DQJB 2DD8L 1IFRA 3QUZC 1T7VA 3MX0A 4QYOB 2YS4A 1EHLL 2Q2LA 4KNUA 4KDWA 4QHMA 1XIWD 5SWZA 2DLEA 1ZPUA 5CBAA 1KT2B 3O6KL 3WUWG 2PR4L 2EADA 1LDSA 4GG8B 2IH3B 2F68X 1INEL 4MCYA 3BX7C 3QXDA 3TJHC 1EHXA 3SHSA 4G6MH 5JIPA 3OZKA 5JR1L 5AG8A 3FQTA 4GFXA 4N9OB 4B9GA 4X6FB 5DHYB 2CPCA 5EZIH 2OK0H 3CSGA 1QYGL 3GO1H 4FJZA 1S5IH 1U8MA 3NRQA 2V8LA 1AYOA 4XC1L 1CGVA 1YEDA 2PWDA 3MOQA 2Q9OA 4DPBX 4DVRL 4KMTH 3K4ZA 2W9EL 5LBSA 4U05A 5D7JD 3ULVD 4IJ3B 5J06A 2ODIA 2XN9B 4OFDA 4RFNC 2AEQH 2IV9A 4JVUA 2EDDA 3RWJA 2FIKA 3D2UB 1AQMA 1WVZA 4WUUB 3SKJH 4F20A 1HWWA 1GGCH 2HFGH 3GS0A 4LHUD 5GZNA 4UILL 1FUNA 1ZKAA 4LSTH 1QTSA 2Z93A 1JHLH 3OB0H 1SYSA 4IK6A 5IBTL 5JXAH 5C8JA 4KVCH 4AL8H 1AAJA 4FCHA 4BUGA 4CMHC 2ZJSH 1OIOA 2XC8A 1RLBA 3BP6A 5JZ7D 3MXVL 2NRDA 4OZFG 5BV7H 5EORL 3DSFH 3OAUL 4ZFGL 1T20A 4KVNL 2DYPB 1GTFA 3FU3A 3NCWA 1ZTXL 3ZDZB 4LE8A 3HHSA 4ODTH 5B1KA 1UVQB 4OH2A 3QRGH 3KMDA 4K71C 2OMTB 5F7BA 5CCGE 1V8HA 1MHCA 2VQ1B 3FHEA 1ZA6A 5E2TL 3LKRA 4QRBA 4JJOA 1PZUB 2IG2H 4M56A 5F70A 4ZMNA 3DOSB 4GKNB 4PJGE 4R7VA 3SDAA 1QNZH 3DYOA 3LZFH 3VGFA 5K9OB 32C2A 4RGMC 2BCKB 3RWCB 3QYMA 4PJDE 1DCEA 4LLDA 1KBGL 5I5IA 1TDQA 4KOCA 3GBNH 4FG0A 4IMLB 4QRRA 4XX5A 3BZ5A 5DD3H 4U3XA 4W6WB 4X5XB 3SCMA 2V7NB 5B7FA 3IDMA 4ZUTB 3RWGB 3U4AA 3LEXB 3EXJA 5DRXA 2NW2A 3UCRA 5J4MA 5LGYA 4TSAL 3H56A 1YYMH 3BN9C 5IB3A 4AGQA 5FM4A 4OJYA 1Z5LA 5EEUA 3MV7A 3U4KA 5DJ2B 1F4WH 1WQVT 4KUZH 2ZKHH 4G6FD 4BD4A 4XMPL 1RVFH 2X2HA 3ARWA 2X6CA 2XI9A 2W9DH 1AR1C 4PPTA 4UQBA 3P4LA 1NDGA 4X0KA 2GUOB 3QDGE 5I1EL 3CX5J 4G5AA 4XAWL 1YUHA 1EWHA 4OIAA 3HE7C 4NC2B 4R90L 2G2RB 1X7QB 3CCHB 1RK7A 1KGWA 3PPEA 3FB5A 3UTPD 4TQHA 4XBMA 2OL3H 3QQ3A 3ARDA 1XCXA 2C1PA 1P7HL 4LRNH 5SWSA 1KJ2L 3QIWA 1DDHB 5HYSA 3MNVA 3D25B 2NSXA 1XD0A 4FDWA 3DTDA 1SZNA 4DO5A 2XIDA 1FF5A 4XCFL 3UJIL 3E6HB 5C0RL 1RZGB 1BAFL 3IKCA 4JFED 3MLPA 4FP8L 2GAZA 4L1BA 1OARL 1OP3H 4RNRB 3K72A 4Y19D 1F86A 3P0YL 5EN2A 3U1SH 4FA8A 4GMSH 1LK2B 3U46A 5FDWB 2MPAL 2W91A 3GZPA 4XE0A 4MZRA 1YEJL 4PJ9D 4Z3JA 4H26A 2UUDH 3P73A 3KPOB 4M62L 3ESOA 4PLKD 5E56A 1WZKA 3KH3A 1TQWA 1E27A 2E5EA 3LN5B 3ERXA 4JQVC 1ET7A 3HI6H 4U2ZA 1JZ7A 3X14B 1M9WA 1D9KC 1FYHB 1A7OL 3JZYA 5I6MA 3MRGB 4FZEH 3AM8C 4UNIA 5E8DL 2C3HA 2WSDA 4HEME 4N0UB 2E0PA 4M43H 1XB3A 3MV9A 4O9HL 4AM0B 4AE1A 3ASOB 4W9ZA 1TVBB 4H0GA 4BKTC 2AJVH 3BWUC 2J55A 5KUMA 1XAUA 4DK6A 3FO1B 4C57C 4Z3GA 3N85H 3LZNA 5EU6A 5AFAA 4LKCA 1TTBA 1Y6KR 4ODHL 3RPIB 4FA7B 3TWYA 3HAEA 2NTFB 1KBKA 4JL1A 4DP9X 4OFQA 1JF1A 1JDDA 5LDSA 5JIDA 5HP5A 1W8NA 4L3FA 4N2EA 2BH0A 3QPXL 4HOXA 2VSCA 3CHOA 4PRDA 1YMME 3TYGL 3PNWB 3PWNB 5E9DB 4FQHB 5GRJH 3RP1A 3GLDA 3HG5A 3R4RA 1HHKB 4X99A 2VMJA 1N4XH 1H5BA 1V54B 1A8JH 2Y2TA 3INOA 1S7SA 2H2PC 5F96L 2FJFB 5B21A 4DIXA 4XPAL 4ZMTA 2L8AA 4NQVB 3PP3K 3DRQB 1DQVA 1HWHB 1IQWH 2Q86B 3WSQH 4JHAH 1AANA 1ZHBB 4PJGA 2ZF8A 3APMA 1UXSA 1A6TA 3V5HA 4PP2A 4OM0H 3N41F 1R5WA 4WI6A 3FTSA 2D9QB 3FBQA 1R5VB 3NVQA 4YDZA 3T2OA 2H32H 3FT3B 1LLAA 4YHYB 4XWGL 5CLXA 2RHEA 4WFEE 5DDHA 3B6SA 3LSOB 1KCSL 2RBLA 4ES8A 5EEVA 1NCTA 1JG9A 3OC8A 2P48B 4HC1L 4MA1B 1UCTA 3BDYL 4L3CB 2YC1B 4M48L 2ZX7A 4Y2LA 4CC0A 1AACA 4OLYH 2XKSA 1F6FB 1LWRA 4PUBH 3NCEB 3D9AH 3ARRA 1CFNB 1IKOP 1N3NB 5HJDA 4U6XA 1T0MB 1E4WL 5T1KB 4XVSH 4AMKH 1ZJBA 2BMKB 4ILDA 1WEJL 4G1MA 4ZMQA 2E86A 3FXIC 3HMWH 3MACH 4QRQB 2X3BA 4P3DB 4HFUL 3BAEL 5ICYA 1L9NA 2CE6A 2CHXA 3D12B 4QHLB 5AOJA 3ZUNC 5CEXB 2P44B 3CFEB 4FXKB 3FQXA 5INCB 4BSWA 4Z3FA 2UZIH 4HLEA 1SGKA 2QGBA 4Y2DB 3UTTD 3JVGC 3NSXA 4MJ5A 1KYUA 4GUCA 5E03A 4GRLB 3UBGA 2VDKL 3QDGA 1G7LA 5CP7B 5HJ3A 1QWNA 2E9BA 3PHQA 1FH5L 1G6RB 3P3RA 3TX4A 3SN6N 2B7DT 3H2QA 4ZRGA 5D9SB 2C4FU 2J8UE 5DD5H 1DUZA 2FSEB 4NUGL 2KT6A 1KENL 4TSCH 5FOBB 1JZEA 2ARJB 2IGFH 3SSGA 3QCTH 3P3UA 2R4RH 3TO2A 1Q0XH 3VFNB 4HX1B 5JOPD 1UGNA 4AEFA 1FNFA 1D2OA 2H0JA 4AYEC 2XY2A 2XV2A 1UKSA 5DK2A 4G8GB 5EUOB 3RZCB 3TCLB 4PWGA 1HEHC 4L48A 5IW6B 5DYOB 1DEDA 1XF5B 3HA0A 3MNZA 5A7BA 5DO2C 1TQSA 5I71B 4B7IA 3VXRB 4GQPH 4OV5B 1YA5A 4XP5H 5GS2D 4RGOH 4OF0A 1ZV2A 4U33A 1QSVA 3ZDWA 1OCWL 5I1HL 4JM2A 3US0A 1PY0A 1AQDA 3B2VL 3HRZA 4U1SB 4RSVA 1AXSB 1X3DA 5TE7L 3BUPA 3MRMB 2YD5A 4P5RA 1OTUD 4RISH 1S3KL 4JO3L 1BG1A 3DUSA 4Y5VA 1NMAH 3O2VL 1NBVH 4G9FE 4JHBA 4Y9EA 4PJAB 1GS6X 3V0AC 5ITFB 3CG8A 4N3UA 5JO5A 4N26A 1XH3A 5ISZE 2Z31A 2CR6A 4UI2A 2R1XA 5K9KA 1JZ5A 5J1SC 2EE2A 3DYMA 4MRBA 1RERA 5AZ2H 3ECWA 4P2RA 4XMVA 1WDAA 4M7LL 3V0VA 4FQJH 3FCSB 3ARBD 1CE6B 3LQZA 4P59L 5AOKA 1R6VA 4X4YA 1A7BA 5JW5A 2ORBH 4XO8A 4Q52A 1OY3B 1VGKA 5D71L 4HJUA 1NCBH 5DGRA 5FW7A 4IOIA 1YY9D 4NGHL 4H8QA 4Z7UB 2X70A 3OBAA 5IWLA 1MHPL 1Z9SA 3ABZA 4J8RA 3HBPA 4V1DE 3V5DA 3NPSB 2YUZA 2DQEH 4DF9A 3R0MA 4M03A 3QVAA 2FSDA 1MIMH 3RIAK 3S2CA 1YMMA 2FUQA 1D6EB 3BVNA 4GW4A 1RZIB 1Y6MR 4S0HA 5C2BH 1QAWA 2A6JB 2N1TE 4XXWA 1B2WL 1K8DA 1LNUA 4B97A 5ETUA 5G2NA 4F8NA 3WIHA 1XB6A 4HV8B 2P8PA 4PJEF 1CICD 1E4HA 4CSPA 2NNFA 4GPVA 1AS6A 2BIIA 4J23A 1WBYA 5KZCB 1RUAL 1N5YH 4BHUA 3QHZL 3RNKA 5C70A 3GS7A 3TA4D 2L3BA 3VXSE 3TV3H 5GZNC 2W8CA 2HKHH 1QFWH 2JQMA 3C5ZC 4K8RH 2NLJB 1CXKA 4L4TD 4JEGB 1E6JL 2XHNA 1AGFA 4M8RA 5T1DH 4KHXH 2B14A 1OZTG 3RKDD 2CCWA 4A6YL 4Y16D 3OMAB 4GUOA 5MEND 1N8ZA 4A7VA 1MEXH 2CIKB 4WI4A 3EGSB 2VQUA 3NAAH 1TQVA 3G6JB 3P30H 2PYEE 1ZLUK 2V2XB 3AG2B 1XGPA 2EEDA 3SDXE 2WBXA 2DMHA 4ALAH 4XCEB 3QDHA 5CD5D 4N8PA 1XTLA 3FUFA 3OLEA 2NY7H 4HIEA 3BQUA 3D69B 3GMMA 1WP6A 2GI0A 3CLFH 1IX2A 1OZUA 3SYCA 1J10A 3D87B 1OTSD 3EDJA 3M8OL 5K9QG 2H0PA 3WFZA 1HL8A 1KOAA 2VISA 3QDME 2JKRM 3WY1A 1HDMB 2WXJA 4ZFOL 3ZTJH 2QEJA 3VGBA 2IMNA 3ISRA 3ZKXB 3L3KB 5D7LB 4Z77A 3C09C 4YSSA 5HHMD 4IDJH 1M3IA 1T1WB 3ARXA 3NFSL 5L6YH 2J6EA 1S9XB 3SCMC 2UZXB 3NIGF 4M5YL 5F9WB 2DN7A 2EDYA 4AY0A 4XBPA 3QUYB 2WLKA 1VENA 4G8IA 5K59E 3OKNA 3L3OB 4MJ4A 4Z7WA 4TULH 2ICEB 2P8MB 5SX5K 3JWNH 1BD2E 4LCYB 5E2JA 3NACL 3BE1H 1FZKA 4QCIB 5CBEB 5C08E 4NKOB 5D8JH 2V9TA 2XWEA 2CO7A 4LASH 2AJZA 4R0LB 1TXKA 4E68A 4JKPH 2WQSA 2CRYA 3LKOA 1G1CA 4A2EA 1C16A 3ABLB 1QNIA 3OAWA 5D72H 1IT9L 1G7QA 4AQ8A 4ZNEE 5KJRH 5KW9L 3S88L 2ILLA 2NQ3A 3KXFA 1YYCA 4RIRA 4KKBC 3C8DA 3MKKA 1I9RH 2DLFL 4L8SB 4OLXL 1OHZA 5CP3A 5D96C 4OCXL 5I30L 2I9TA 2OMBA 3MAWA 4G9FA 5HHOB 2VZ3A 2TSAA 4XNXH 1N6QH 4P3CH 3UBXB 3VI3A 3LPOA 1RJLB 5ISZA 2YEVB 3OJDA 4NZFA 3TC9A 2WCGA 3EFOB 3ARDC 4BWUA 2QDWA 3N1GC 3QIWC 5LBSL 4CSZA 1DP0A 1IBYA 2IH1A 3TBVA 2A9AA 2TAAA 5INDB 3S5LA 1DFBL 1FGNH 1GMIA 2I32A 3T2NL 5E9AA 3BGFC 2QGDA 1OCOB 4HS3A 4BZ1A 3Q2VA 5AVZB 4UMGA 5JHBA 1E9QA 3HLKA 3F7YA 4YVNA 4TUJA 3FMGL 1R3JA 2FNBA 4FTDA 4AUJA 1VADB 2QBWA 4X42A 3RIAF 1SYVA 5CS7A 4DKFH 3VW3L 1ORQA 4MVBC 5A7EA 2IMMA 2WVVB 1QBLH 3G5ZB 2MQGA 3O6FB 2DRUA 4MSWA 4PJXB 1D5BA 2LOEA 1SY6A 1MDTA 5I19L 5I1LA 4OZIF 4BWWA 3N2JA 3ES6B 4O4YH 4PRNB 5E5UB 4G9DB 2BP3A 4MB1A 1IBFA 4XO9A 5DMIH 5ABDE 1BMWA 2DLGA 3Q6FB 3SKMB 4M8VA 4QO1A 4OCYL 3RUGE 2NY2C 4HWEH 5IVXB 4GQ9H 3AU1A 5AEAA 1F0LA 3ZBMA 2VXVL 4GAJL 1CURA 1RXLA 3P02A 4O2CB 2XTJE 4D9RE 4S2SA 3VXSA 2M1KA 3DOHA 1UJ3B 3UG4A 1MCWM 5HHVL 3ULVE 5T3XD 1DEEB 2BK8A 2PYFB 4WEEA 4AIXA 5ACLA 5FYKU 3HNTL 1KJVB 5KJ7E 5DVLA 4MAYD 3F12B 1QR1B 6CGTA 3D3VD 1ICTA 1CJYA 3PP4H 4N68A 5ALBL 1KEML 4B53A 3SDCA 3HE7B 1WZAA 3R7QA 1EXUA 1WAEA 2IIJA 2BS8A 5E6RB 3TXAA 5HVFB 2QSVA 3X3FL 5T3ZD 2DOCA 5ILTL 2CHDA 3WAJA 2CBMA 3SDXA 4WWKD 5CJ5A 2O6EA 2WVSA 2V3DA 2ZXGA 4KK6D 2XBTA 4XB7A 4Z1PA 1ZTMA 1H5BC 2YGOA 4XPBH 5CHNB 2BSRB 3DX6B 1RIVH 1S7WB 2WY3B 1T04B 4PB9H 4OZFH 5F9OL 4PG2A 1NQBA 1K9TA 4AZUA 3VXTA 5DJDA 3O3EA 4Y1TA 2AXHA 3FBKA 4Z78A 4IBTA 2AXWA 5CMAA 5D7IA 2G60H 1G87A 3TNNA 2OJEA 1CDYA 1ADQA 4BKLB 1UZ8A 2UWEF 4XWOC 2WNXA 2AVGA 2QHLA 5E2UL 2WC7A 3QJOA 2XFGB 4PV8A 4PGJA 1J9SA 2VSKB 3CVIH 3VUAA 3T08A 4HS8L 3FOLB 1O5PA 1LVEA 1P84J 4KXDA 4X7SH 5JHDB 3DETC 1SJEB 1CVSC 5ADPH 2V5YA 3KBEA 3A6CH 3UAJD 3B9VA 1VSCA 1XGTB 4G6AC 5H2BB 1RK0A 1QFWI 2CGRH 2P80A 5E1GA 1GYVA 1UB5A 3LZOA 1F5WA 5DUBA 4EXPX 3GSVA 4ZZFA 3LKSA 1XF2A 2IDTA 1JGUL 4K7PH 2HRGA 5JOFA 1WFNA 2OXHB 1TKWB 2OMXB 3IK2A 4ZNEA 1P7QA 4R96A 4U1NB 1C08B 4UAOB 5GS0D 3UBHA 3QWRA 4APQA 1MREL 4HWBH 1YG9A 4N20A 4NYLA 5IKCB 2VIRA 3GSQA 1M71A 3NCYS 5FYJL 3QRFM 2XG5B 3CC5A 1YEFL 3PABA 1VKXA 3HUJF 3QHFH 1MIEH 1URIA 3GIZH 3O41A 1V3KA 5IOKA 1QRNA 3OR7B 2HJKA 3SO5A 4NNXA 4QWWC 4HF5L 1Z9PA 3UTPE 2FHBA 4XNQB 1ACYL 4LLWA 5FCSH 2BHFA 1CCZA 1BFVL 4WU7B 1XMWA 5HYQB 4I2XE 1INDL 1IQDA 3FO2B 1G7JB 4Y0GA 3MRIB 5IW1B 5DD1L 4DO4A 4L4VB 4IQHA 4JM2C 1DO5A 4P2QB 3O8XB 4YC2B 5D2NE 5I1JL 1TQCC 3HRZC 2W81C 3DVNB 3D0VA 3U0WL 4LQFL 4Y19E 1I9EA 2EDXA 2Y6SD 43C9B 4PJAF 3MOBL 4YEFA 1XDTT 4RX4D 5AB0A 3BP4B 3GIVA 1AOHA 4Y5VC 4H20H 3EO0A 2Z8VC 4JZJA 2RB8A 2FZ3A 2IQ9H 1TQUA 2VL5A 5EO9A 2I60L 2YPKB 4BA0A 5FA4A 5GXBB 4ADGA 2HLFC 3ZSTA 3HG0A 5CGYD 1NEPA 5CJOH 5JIHA 3QEHB 5KVFE 2B39A 2FB4H 3GC3A 5HVWA 1OP9A 4Y9FA 1OP4A 3BJ91 2PTTA 3WTVA 3PAVA 3LS4L 4FS0A 4KOBA 4Z7UF 3UADA 5KOVC 1WBXB 5IMKA 4P5TD 2OP4H 1TZHB 4H8PA 2XA8L 3L5WB 5ESVB 5EZJA 1L5GA 5AD0B 4YHPA 2W65B 1QHQA 2VYRE 2X87A 1AKJA 5HYIA 5LN8A 3INUL 3PFUA 4Y5XA 3V6OA 3T0XA 1IO4C 1BMZA 3GXNA 1LDPH 4XXDB 4EI6A 4G7YL 2ED6A 5FF6A 1YQVL 4OCRL 4HH9A 2RR3A 3GZKA 4XXWC 3QEQD 4IHOA 3BVDB 4R8WH 4HIIA 3GRGA 4HUXA 4D8OA 1SJHB 5EMYA 1WCBB 2HFFA 4JDTL 2AJ3A 2ED7A 5EBMB 3PWUB 5CCJA 1MNNA 1MAML 5L8JB 5MEOB 1CE1H 1HHHB 4AYMC 5JQIB 2WZPD 2AXFA 2APVA 4HBCH 3L7FA 3PHAA 4FQQB 4JFHD 2PO6D 3GI9H 4UMSA 5JXEA 1I8LC 4Y1AB 5TDNA 4DN4L 4DFHA 4G7SB 1AZCA 3KL3A 3P11L 2DB8A 3P54A 1PKOA 1V5JA 5ANMB 2GJ6D 2GKIA 4F27A 2BHZA 1MNUL 1XT5A 4H2AA 4IBZA 15C8L 6FABH 2EC8A 3MSPA 1HHIA 4OGYL 2H45A 1MJ7L 1J8HB 2Z7WA 1TEFA 5J1TC 2WZ0A 2DQDH 4FTVA 4XP6H 1T21B 3QUMB 2G2PA 2G4GA 4GO9A 4HDIA 3S37H 1J5DA 1NCCH 3UTZA 2OL3A 3B7YA 4FFWD 1QZ1A 3BQUC 2AV7B 1T03H 1TG8A 3D8MA 2AJXL 3SE9L 1JZ2A 5EEXA 1DL7H 4OZHF 2X2IA 1U6AH 3VGAC 3IDJB 3MJ8A 4N1CA 3BPCB 2CGZA 1I1CA 1GGUA 1W8OA 2DMKA 4N6QA 2IO5A 3CFCL 1BEYL 4ZMOA 3TBYB 3PWLA 2O5YH 3UTTE 1NCAH 4CGUB 4PBWD 1MJJA 3NTCH 2QFRA 2WM0A 5JPNA 1FP5A 1OPGH 2WTRB 3QUXA 4JO1L 4MS6A 1YNLL 4TVSa 4QIRA 1W72H 3ALPA 3I6LE 4LT7A 2PLTA 5DHVB 2YAHA 1JZJA 4OTXL 1B0RB 2FQEA 3MLVH 1SLVA 4YFDB 3KJ4B 4ZAKD 1PBYA 1VERA 4UCFA 1DBBL 3QO1B 3UTQA 5A43C 2J88L 5JOPE 2HA1A 4I2XA 3WNNA 4CADB 1OSEA 5DUMH 2XQYG 3RDTD 2IPKB 3BWAB 3MLZL 2DQFA 2JJVA 4I0PD 2R0LH 3LXCA 4FQ1H 3BH9A 5DSCA 2OZ4H 4ERSL 5C0IA 4K23H 1TJMA 5TE4L 2O5NA 1THAA 3DURA 4JR9L 1D7CA 1EEYA 5EBWB 3K1DA 5J13B 4HIXH 2K9UA 2HB0A 5H35B 2C9PA 1XR8A 3V4UH 1KB5B 1XCWA 4ZFFB 3BSHA 4ZK8A 3F65A 4PJ9A 3ATAA 4H0LC 1VCBC 4JCLA 3NZUA 2XVBA 4P46B 1LILA 5D6DA 4RETB 4YXKH 3GHEH 1MCPH 3QJVB 5JQHC 2NNAA 4DWHA 5DRZA 5FO9A 4B9IA 2NT1A 3ESMA 4HGWB 2R0WL 3VRJA 4H1LB 3VRLE 3U30C 2OM5A 3CFMA 4FLQA 3EH4B 2VDQH 3O4OB 1HSAB 5AYQA 2NXYB 4MMYB 3LXAA 3GUTB 3TESA 1AHWB 3UPRA 4TQPA 2AKRB 3WL9B 4C83B 1EMTL 3L7EB 1GGTA 3VSUA 2C7FA 1JF5A 5D5MA 5ESQB 2BJML 1W0WB 4WI0A 1EBPA 4XBEH 1IAIH 5MEQA 4KXCA 2VE6B 1SFDA 3EO1A 1ONQB 1TTFA 5G5DB 4ONFL 3D39D 3C09B 3Q3GA 3KL5A 1TPXC 5F8QC 2Y5TA 3TS8A 2H1PL 2VITA 2H32A 3IMUA 4MCNA 1IAKA 4J27A 4MXQD 1I7RB 5AZEH 4FKKA 2WWMD 3DMMB 3VXQA 1C8PA 1UWEL 3QR2A 3P40A 2H9GA 5IT2L 1JSYA 1JNHA 4P23D 1BWMA 1ULVA 2G5BB 5FK9A 4PJCE 3ET9F 4KKPA 3D09A 4WGKA 2ZP8A 3PG2A 1AD0B 4KO7A 5DU7A 3HZYA 5IB2B 1IL1B 2IALA 4WV1B 3OSVA 4LAQL 3SYOA 4X7FC 1JE6A 4NNPH 3E6FB 3WNKA 3UIZA 3AY4A 1T66C 2VH5L 5ABAA 3VWJA 1ROCA 1JK9B 1P2CA 4P9HC 5KVGL 1ZLSL 2P47B 4P2OA 3M17A 4KROC 2J6EL 1TNNA 3IGKA 1KC5L 4Y88A 1AGBA 3SDCC 2YN5A 1NGWB 5D70H 2D0FA 5IF0A 3VFMB 1LMKA 4L4TE 3KHQA 1KCUL 2ZICA 3FU5A 1IGFL 3NJKA 4U4IA 3U7WH 3MRKA 1IEBB 2VDPH 2A38A 2JIXD 3IDGA 4X6DB 2KDGA 1JMXA 2Q7YB 2YAMA 4YHML 5MENE 4AJYV 4H88L 2WXLA 1VEMA 3Q2CA 1JGEA 1HILB 4LEXL 1ET5A 1LEIB 1ITBB 2IGLA 3BZ4A 3WN5B 4PG2C 1AD9A 1XMEB 3BGFB 4NLAA 5EU4B 2DWDB 4BK5A 3EJRA 2VXTL 3GKZA 5HPMB 1WZ1L 2Q8BH 3AG3B 3QEGL 2P7TA 2AZUA 2CDGA 3JWNE 3LZQA 4W9CC 3RVUD 2I9LB 4U1MA 3QNFA 1LK3H 1RUKH 5C3IA 2HPTA 3TM6A 4B27A 2AQNA 1R3KB 3H9SB 4WCYH 3UTTA 3CDZA 2XV0A 3B83A 1P4LA 4GAAA 2YWZA 5HVHC 3HBZA 5JDSB 4X7DC 3ATEA 3GMOB 3KVDD 3FQWB 3BEVB 3MRRA 5I17A 3X1NA 1LGVA 3FN0H 1ERNA 5HHME 5E8PA 5DEGA 5E1HB 5AKRA 3ULSB 2DQGL 3KYNB 2UY7A 3AMLA 3FSWA 1A6UH 1HQ4B 4WNJA 1FG9C 2YHGA 3PV6A 3IJHB 3FZUD 2NY2B 3BWUF 3LS5H 4WKZB 2HYMA 4BZ1L 5AB1A 1U33A 3W1ZA 1JNNL 3GXMA 2KKQA 4OD1L 4J39A 1EXGA 2ZXQA 2MCPL 3MRDA 4D9LL 4ZX6A 5F3BB 4QJ4B 1MELA 3CJJA 1JXGA 4L8BB 4OAWA 1WIPA 4XHJD 4FG2A 2WUCL 4IKLA 1VEPA 1PCXA 1M1XA 2WQWA 2CQVA 5I0XA 4APQC 4LSDA 2NXZD 4JHWL 4QAWA 4M7ZC 4KUCD 4BSJA 3L3JB 1SY6L 2PPFA 1D7FA 1G7PB 4TKWA 2J6WA 2GSIA 4NQDE 3KPNA 2X1PA 3QC5X 4FD0A 4RGND 5HTSA 3KGUA 4ZMVA 1OE3A 1EPFA 1PVHA 1FVDB 4UIKH 3G6AA 3SPCA 4LLAA 1F02I 1MFAL 4AC4A 1YECH 2XVLA 2HFEA 5K39A 5AW5B 2XJKA 3IRCA 1H8LA 2QQKL 4JG0L 3VD9A 1TZGL 3U7YL 3MBWB 1J87A 5IEKA 1WC7B 5GJSL 4LOVA 5HDLA 2R51A 4GXVH 4PJDB 4Y4HA 3MA9L 3T2PA 4PGEB 3EFDL 3NYKA 3FFCD 2DJSA 1G9ML 2Q76B 1WJ3A 2WLYA 3WKNA 3V6FA 3E9TA 1S7RB 3ZQXA 1CB4A 1U8QA 1NJ9B 1J88A 3VGHA 3QJTB 2DKMA 3W0WD 4JZJC 3T6VA 2WZAA 3QJFB 1AY1L 3MCYA 2BVOA 4QHUB 2VLRB 1GAFH 3D18B 2Q8AL 4E9QA 1X7TA 3ZGHA 3D48R 4X6EB 3B7UX 2FE0A 4QR7A 3U0PB 4PRHD 4HCFA 4ZW7A 3N42F 3MJ9H 4LVOC 3N3EA 2ADIB 4ANKA 3OKMA 4H5SB 2Y7LA 1RJCA 2XTJC 1GSKA 2Y07L 3DX9A 4X4ME 1GYAA 2OMWA 3EKCA 5D7JC 4RMTA 5IIEB 4KAQH 3ULVC 3QCUL 1FFTB 2B16A 2YUWA 3ESUF 3QULB 4M6NL 3DV6B 1ADQL 1HTYA 4NJ9H 4TLTA 1E6OH 1BVZA 1U3HD 1W8EA 1LEKB 2O61B 5T3XE 1T7ZA 1A4KB 1G5AA 5KYWA 4Q6IC 4W9GC 4P4RB 4URTB 3UAEA 1IFHL 1KTLA 2Y7MA 1A3RL 5IV2B 1VB9A 2FTAA 2WANA 3D3VE 2VB5A 1H9VA 3SIKA 2FYYB 3B1UA 3MRHA 2DQ6A 5MENA 3VI4E 1LEGB 3R06B 4HJ1A 5T3ZE 2Q7NA 4AKOA 2K8QA 3U6XA 4BINA 4M6OH 4KZEH 2K3TA 4MMZB 1P7BA 2PP7A 4XRCB 5HDBB 5TDOB 2OS7A 3DGGB 1CWVA 4AEHH 4X5WB 3GJEB 5EZLB 4PV9A 3UCQA 1D5XA 2Z91B 1DLHA 4MX7B 3IGAA 4CW1B 4AX3A 3UBFA 3LNIA 3C60D 3ESVF 1HH6A 1QSED 2WQRA 2Y06H 2DQCH 1IZKA 3OHXA 3ISYA 4L8CA 1QVOA 4G6ML 1KULA 4OIBA 2N0MA 3R7RA 5FGRA 1RZ8A 2CG9X 1IEAB 5DFWH 5HDQH 3WEBA 4TNFA 5G55A 5EO1B 2PTVA 3JT0A 1MI5E 2OK0L 3PIQA 1IEHA 2QVTA 3GO1L 5JW4M 1S5IL 3DBXB 4A66A 3GEFA 4H8WC 3ZE0F 1QKZH 4GAYB 1U92A 4NQTA 1B0GB 1S7QB 4KMTL 3TA3D 1WUZA 4F7MB 5CN1A 2FEDC 3HPJB 3KPPA 5LNGA 3WS3A 1IM3D 1W80A 3P9MB 3OVUB 2P43B 5KBPA 5F88B 4EQ3A 4AYFB 2AEQL 1BFOA 3SKJL 3QI9D 4Y2NA 3ZKSD 1GGCL 2FJGB 1ZVSB 2HFGL 3RGHA 4YEEA 4O5LH 3BZFB 2FO4B 4NQSA 4NXSA 3UX9B 3MRCB 2YRPA 5HHNA 4LSTL 4KZCA 4MLIA 1NGYA 4B0MM 1JHLL 2YAQA 1HKLL 2F08A 4M4PA 3JTSB 1KCLA 4Q9CA 5CCHE 4YHZH 3C8HA 5JXAL 4QRPB 4KVCL 1YPZA 5GSVB 3SZ6A 3QUXC 4N0FB 4AL8L 1MH5A 4NQDA 5E4EC 1NBZA 4OFIA 1HXMA 2ZJSL 1I1AD 2EDLA 4QT5B 5BV7L 3GRWH 2X4PB 3DSFL 2ICES 2F8OA 5GISH 3N5AA 2D31A 4U1LB 2CHZA 3P2TA 3S0PA 1AO7D 1GPOH 1OTTC 2K70A 5DC4B 2HT2D 4ODTL 3VG9C 1FNEA 2AJUH 4NC0B 3QRGL 4DW2H 1S8DB 4JFVA 4JUTA 2V0AA 4BZ2A 1MRFL 3TASA 3EJPA 5K9QI 1BZ7B 5F9AC 2E6PA 3FONB 2IG2L 3SBPA 8CGTA 5LXVA 4GRWE 3NZHH 1QNZL 3LZFL 1N12A 3P2BA 4F7EA 1XZWA 3DX0A 3NCJH 5IB4B 1R75A 1S5HA 4LIQH 2FWOA 3GBNL 3QXAB 4KH9A 3AUVA 4B9JA 1E50A 4PJ9C 5DD3L 3U9UB 1JHKH 4PLKC 4I13B 4JKWA 2PCFA 4XNZC 2VAAA 1C8QA 1YYML 2EXWD 4TRPH 3M45A 1KTCA 3BCFA 3OB8A 2OXGA 5ID1A 4YDJB 5TQ0H 3HCVA 1ZSDB 4WI5A 1VFAA 2VABA 3GMNB 1BLNA 4OZFA 1IIIA 4JFDD 1F4WL 1H6UA 4TOYH 3QFDA 4KUZL 1KGIA 2WQXA 2ZKHL 1RVFL 1Z7JA 1UWYA 3LPWA 2W9DL 5LKNA 1V05A 4JGMA 1NGPH 5GGRB 2DWSA 3R1GH 4RFEB 5B7MA 3V9EA 4PWIA 3CFNA 5BRZD 3RY5A 1JS4A 3FHQA 2HT3D 3CC1A 4JPWH 4NBZB 3RAJH 1JXJA 1FFRA 1CXEA 2Y7OA 4WLCA 4OD2A 2D4FA 4KZDH 2OL3L 1BM3H 3A0OA 4N2KA 2NCEA 4LRNL 2D0GA 4AQ1B 3QEQE 1QLEB 2G3ZA 3IMTA 3SGKA 3CH1B 4JRXB 1AVAA 2D0HA 3MV8D 5DHMC 3T65B 2EDKA 1FPTH 1T7XA 1SQMA 5CGBA 3RQ3A 4PIRF 3RL1B 2WQ8A 1UA7A 3AY4C 4FXLA 5F1IA 3KL0A 4Y4KA 3VWJC 1BLIA 2GTZA 1ZPLA 1WUNT 3U1SL 4GI6A 2OMUA 3TF7C 4GMSL 3VD1A 4V2CB 1R3HA 1HC1A 1BGXH 3C5JB 2ZF9A 4FE9A 4IU2A 3BHBA 2QKSA 1AIZA 1T5WB 1OW0C 1CFTB 5IMMA 1GZHA 3EOAB 5AB9A 1QACA 1I8AA 1ZOXA 2GB2A 5EOTB 1L3NA 2HVKB 1E9OA 3S96B 3QIBD 4JPSA 4LCVA 1MI5A 2HP4A 4AMXA 3V95A 2GJ6E 3BJLA 2X38A 3NIDE 2QGEA 2PPAA 3HI6L 3KLAB 3QB7C 4Z7VE 3PGFH 2WMPA 1IKFH 1QBMH 2ZQKA 2QKIA 3QS2A 4APXA 1HE8A 2FT7A 3AWFA 1I7ZA 4FZEL 5DJ8B 1I1RA 1QP1A 5DI8B 4NRYB 3NIFB 4LVHC 1O7SA 4M43L 3X1FA 3BPNB 1S4IA 4MWFA 3Q44A 2AJVL 2E74C 2H47C 1S7UA 2UX7A 3GDBA 4XN5A 3BW9A 3D85A 3D4GA 2GK2A 3N85L 3FSVA 4HS6B 4V1DB 1Q9OB 4ZDHB 2P42B 4G3YH 1JXDA 2P8LB 4W9HC 1NMBH 3LV3A 2XNAA 3MBED 1EHNA 2WWKT 4OJDH 4O02B 3GXTA 1UOWA 2YZ8A 3ZDXB 4E36A 1CO1A 4JHVA 1NSNH 3S2AA 5GRJL 5T1MB 1HEZA 2CR0A 3CSYA 2PCYA 2YIHA 5IVZA 4CU8A 3CX2A 1OK0A 1N4XL 4DVBB 1Y0LB 4J3OD 4UQDA 3APNA 3QZNA 1M6OA 2VDLH 3HZKB 2CLVA 1GCYA 4LK4A 3T0ED 3O45B 2EH7H 5FYKD 2ADYA 1FFNA 5L0QB 1M7IA 1IQWL 2KMWA 3WSQL 5HHPB 2VAJA 4ZMWA 4HZAA 4I87A 3F83A 3K71B 1XQ4A 4F7CA 4OM0L 4C56A 3ILDA 3W82A 4H44C 4I1NB 5D1QD 1RZQA 2KUTA 1SXZA 1RCYA 2J25A 3VWKB 2QDVA 4AQZA 1FL5B 3SGEH 1E2VA 4E0RB 2VR7A 4Y7OC 1ZT4A 1OTUC 4KX7A 2PYEB 1B3IA 1VZGA 4ZQKB 5F3HB 3KG5A 3VB8A 3WJLA 4XNUH 3PV7A 1G5GA 4OLYL 12E8H 4PUBL 3D9AL 2EKJA 2OR7A 4W6YB 2B4CC 3EBIA 4XVSL 4PJGF 4AMKL 1FV1B 1DQIA 2J1YA 1OO2A 3MACL 3HMWL 4PJDF 5IZ7A 4RCAA 3QDMB 2X53A 5LGKA 4WTZG 3ARBC 3QXTA 2UZIL 4WQOA 2CLRB 5ESAB 2GFBA 3IJEB 4P5TA 1TITA 2QQLH 3ZYZA 1BZDA 2LW3A 1YY9C 4EIUA 2LV4A 5ITBH 2XPZA 5E5MA 3BC9A 5D1XB 1UD5A 1CIDA 4E2OA 3M46A 5I1IH 2MRYA 4EI5B 1B4LA 1Q9WA 4CU7A 4MXVE 2FK9A 3NFNA 4L5FE 5DD5L 1KBWA 5EO0A 1QSFD 4TSCL 2IGFL 5KBDA 3KYAA 3SQOH 5I74C 3QCTL 2R4RL 4Q8BA 1Q0XL 3NQKA 4N2NA 4R7NB 1UQSA 1BD2B 5GGSY 5B38B 2AQTA 2BSED 3SQRA 2UZPA 1K4DA 2BX5A 2EIJB 2H8PA 5C08B 4RAUB 3D7PA 3L9RB 5CR8A 5IGXH 1QHPA 2DQHH 4XP5L 4RGOL 5GRZA 2B3IA 3V52H 4FNQA 3VD7A 4MMXB 1HXYB 4OLVH 3P3TA 4K9EH 1NOLA 1G4RA 2QV4A 3IS1X 1A1OA 3GWJA 4M1GH 2R4SH 1JPEA 4BRVA 4ADIA 1MVFA 4NN7B 1GC1H 4Y4FD 4PCYA 4RISL 3HEIB 2BINA 4L2LA 3C5SB 5JPMC 1NMAL 2YGVA 3RU8H 4OW6A 1NBVL 2WLLA 3RKDC 4Y16C 1MW0A 3TZVB 4OKDA 2E56A 4NKMB 4Z7VA 3O3AB 1FG2B 5K5YA 3GBEA 1NINA 1W72A 2EZ0C 2Y7QB 3FN3A 1S7XA 4JJ5B 4GEIA 4AZ8A 5AZ2L 3PJSA 5B39B 4X6CE 5CD5C 3ZKND 1EGJH 1L6ZA 4ANXA 1PX3A 4JM2F 3H3BC 4FQJL 3JWNC 5E1QA 1XIWB 4AK2A 2ORBL 5CIPA 5CGTA 4F80A 2G4EA 2CKBB 1FRGH 1NCBL 1MJ8H 4HKZB 5D55A 4P5KB 2OZ4A 1XD1A 4A7QA 3MUUA 3OHXC