1BXDA

Nmr structure of the histidine kinase domain of the e. coli osmosensor envz
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
161
structure length
161
Chain Sequence
TGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure of the histidine kinase domain of the E. coli osmosensor EnvZ.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Transferase
molecule keywords PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
total genus 25
structure length 161
sequence length 161
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1998-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1bxdA00
2O1VA 4NH8A 3VHCA 4V26A 4GGLA 5CTWA 4HZ0A 4LWIA 3TZ5A 1I59A 1YESA 4L8ZA 2BYIA 3CGZA 1UYLA 3BMYA 3T1KA 4XIPA 3D2RA 4K4OA 2Q8GA 3T0ZA 2Q8FA 1AMWA 2YE4A 4EGIA 2YE6A 4KSHA 4CWRA 4GEEA 2YKJA 4CWPA 1B3QA 5M4EA 4DZYA 4LWFA 3D0BA 2IWSA 2BTZA 1AH8A 2BYHA 4Q20A 4MPNA 2YGFA 4CE3A 4ASGA 4V25A 1Y8NA 3RLQA 1YT0A 5M4PA 4H85A 3CRLA 2GFDA 4AWOA 2WI3A 3LNUA 3ZKDA 1QZRA 1AH6A 2YE7A 1AM1A 4MPCA 1JM6A 3TZ0A 4CWTA 1US7A 5FNDA 4URLA 4LWHA 2CH4A 4ASBA 4URNA 5F3KA 1EA6A 3JZ3A 4MP7A 3A0ZA 3R92A 4URMA 1AJ6A 3Q5KA 4MB9A 3OMUA 2YKBA 4ZVIA 5D7RA 4GQTA 3QTFA 4BXIA 3A0RA 3R4MA 5BOCA 2IOQA 3T0HA 3FT8A 4EGKA 4I5SA 5CTUA 2ESAA 2BREA 3KE6A 3WHAA 5M4HA 2XCMA 4BIUA 1UYGA 4PRXA 5IDJA 4GCZA 4XKOA 2QG0A 1L0OA 2YJXA 2O1WA 1ZWHA 4PU9A 1TH8A 4O04A 4XTJA 4BQGA 4O09A 2VCIA 3OPDA 2YEHA 4O07A 2YK9A 3VHAA 4XE2A 3RKZA 3NMQA 2XJGA 1YETA 4LWGA 4O05A 5J71A 1YT2A 1UYCA 1S14A 4CWSA 4HY1A 4MPEA 4HY6A 4NH7A 4P8OA 1I5CA 2HKJA 4JAUA 5M4MA 5D6QA 3U67A 1UYMA 2YKCA 3G7BA 3INXA 2Q2EB 5BODA 3FV5A 1TIDA 1QYEA 4YKYA 2WI7A 1U2OA 3C0EA 2QF6A 3ZXOA 4GT8A 3T2SA 2YKEA 3U2DA 1NHHA 5F5RA 1THNA 3ZM7A 1OSFA 2XX2A 4KSGA 3D36A 4KP4A 1TBWA 5CTYA 2E0AA 3EHHA 4XKKA 2YE5A 4YKWA 3VHDA 2FWZA 3VADA 2UWDA 1Y8OA 2QG2A 3B27A 2FYPA 1GJVA 2YEBA 4XD8A 2YJWA 2H55A 1S16A 2WERA 5FNCA 1KIJA 1TC0A 3QDDA 3RLPA 2XDUA 2BU7A 2ZBKB 1UY7A 4HYMA 1QY8A 2O1UA 4CWNA 4P7AA 2YEDA 2XHTA 4PRVA 1R62A 2XK2A 2YK2A 4EFUA 2FWYA 1GKXA 3B28A 2CCUA 4E02A 2BSMA 2YE8A 4XCJA 5D6PA 4O0BA 3TTZA 2AKPA 1YS3A 2YE9A 4FMTA 3CRKA 4BIZA 3MNRP 3B26A 1GKZA 2Q8HA 2XHXA 4L91A 4AWPA 4CWQA 3GIFA 4U7NA 2PNRA 1I5DA 3U2KA 2XD6A 4PL9A 4HXZA 2XDLA 2XABA 3EHGA 4LP0A 5C93A 4YKQA 4KTNA 4WUBA 4B7PA 4R3MA 1A4HA 1Y4SA 4ASAA 1Y8PA 2XX4A 4DUHA 3HYZA 4U7OA 4E00A 3HYYA 4L94A 2IOPA 3EKOA 2WI5A 3Q5LA 3K99A 4U93A 2VCJA 2FXSA 3K60A 3RLRA 2K5BA 4B6CA 1BGQA 5IN9A 3TUHA 4FPPA 3HEKA 3A0XA 3H4LA 4MOTA 2XHRA 4FCRA 4I3HA 3WQ9A 2IORA 4XKAA 4ASFA 2CG9A 3G75A 4L93A 4E01A 2YEEA 4MP2A 4XITA 1YC1A 2WI4A 4KFGA 3K98A 5D7DA 2YEJA 1Z5BA 4XIQA 3PEHA 2VWCA 1UY8A 3ZXQA 2CCTA 5M4KA 2EXLA 4YKRA 1BXDA 4LWEA 2VW5A 2YI5A 3GIEA 2BU6A 2YI7A 3A0WA 1YC3A 1I5BA 2ZKJA 2JKIA 2WI1A 3HHUA 2GQPA 4HYPA 2XJJA 3CWVA 2ZDYA 5CF0A 2YGAA 4YKUA 1I5AA 5CTXA 1BYQA 3O6OA 1EI1A 3H80A 4KQVA 3INWA 3G7EA 2BZ5A 4YKTA 2WEQA 2YI0A 3B25A 3TZ2A 2CGFA 2IWUA 4XIRA 2XDXA 2BT0A 4YKZA 4WUDA 3R4OA 2YEGA 5CPHA 3R91A 5FNFA 1H7UA 5J6AA 4FCQA 1YSRA 2YGEA 4QPKA 4CE1A 1BKNA 1YC4A 2YEFA 4R1FA 3LPSA 3FT5A 2BRCA 3A0YA 4BQJA 4LPBA 3O2FA 5IDMA 1ID0A 1PVGA 2IWXA 1Y4UA 2BU2A 4FCPA 2XDSA 3OWDA 2HCHA 4L90A 4AS9A 4AWQA 4BAEA 1B63A 2YE3A 2H8MA 4EM7A 1YERA 3OW6A 2CCSA 4JAVA 4CE2A 2YE2A 3GIGA 3PEJA 2WEPA 1Z5AA 1I58A 4R3AA 4EFTA 2QFOA 1TILA 1UYEA 3IEDA 4NH9A 2JJCA 3A0TA 1MU5A 2YECA 3HZ5A 4EMVA 3SL2A 1Z5CA 1UY6A 2YKIA 2YEIA 2C2AA 1TC6A 1Z59A 2YEAA 3T10A 3HZ1A 4WUCA 3EHFA 1MX0A 1UYHA 4CWOA 3OWBA 3Q5JA 2WI6A 4EGHA 1UYFA 4H7QA 2Q8IA 5M4NA 2BU8A 1H7SA 1UYDA 2BU5A 4H81A 4JQLA 3EHJA 4X9LA 4HZ5A 2WI2A 2ZDXA 1KZNA 2XJXA 4XC0A 1UY9A 2HG1A 3R4NA 2YI6A 4ZKIA 1ZXNA 4GFNA 4JASA 1NHIA 4UROA 3K97A 3R4PA 3CGYA 1B62A 4W7TA 1ZW9A 1UYKA 4XDMA 1YT1A 1YSZA 4MBCA 3TZ4A 4EEHA 3BM9A 4XCLA 1ZXMA 3ZKBA 2XX5A 3B24A 3DGEA 5FWKA 5L3JA 5D7CA 3GIGB 4HXWA 3EKRA 1U0ZA 4YKXA 4CWFA 4QPJA 2XDKA 5GGZA 3C11A 1UYIA 1NHJA 3O0IA
chains in the Genus database with same CATH superfamily
2O1VA 4NH8A 3VHCA 4V26A 4GGLA 5CTWA 4HZ0A 4LWIA 3TZ5A 1I59A 1YESA 4L8ZA 2BYIA 3CGZA 1UYLA 3BMYA 3T1KA 4XIPA 3D2RA 4K4OA 2Q8GA 3T0ZA 2Q8FA 1AMWA 2YE4A 4EGIA 2YE6A 4KSHA 4CWRA 4GEEA 2YKJA 4CWPA 1B3QA 5M4EA 4DZYA 4LWFA 3D0BA 2IWSA 2FTKA 2BTZA 1AH8A 2BYHA 4Q20A 4MPNA 2YGFA 4CE3A 4ASGA 4V25A 1Y8NA 3RLQA 1YT0A 5M4PA 4H85A 3CRLA 2GFDA 4AWOA 2WI3A 3LNUA 3ZKDA 1QZRA 1AH6A 2YE7A 1AM1A 4MPCA 1JM6A 3TZ0A 4CWTA 1US7A 5FNDA 4URLA 4LWHA 2CH4A 4ASBA 4URNA 5F3KA 1EA6A 3JZ3A 4MP7A 3A0ZA 3R92A 4URMA 1AJ6A 3Q5KA 4MB9A 3OMUA 2YKBA 4ZVIA 5D7RA 4GQTA 3QTFA 4BXIA 3A0RA 3R4MA 5BOCA 2IOQA 3T0HA 3FT8A 4EGKA 4I5SA 5CTUA 2ESAA 2BREA 3KE6A 2C1IA 3WHAA 5M4HA 2XCMA 4BIUA 1UYGA 4PRXA 5IDJA 4GCZA 4XKOA 2QG0A 1L0OA 2YJXA 2O1WA 1ZWHA 4PU9A 1TH8A 4O04A 4XTJA 4BQGA 4O09A 2VCIA 3OPDA 2YEHA 4O07A 2YK9A 3VHAA 4XE2A 3RKZA 3NMQA 2XJGA 1YETA 4LWGA 4O05A 5J71A 1YT2A 1UYCA 1S14A 4CWSA 4HY1A 4MPEA 4HY6A 4NH7A 4P8OA 1I5CA 2HKJA 4JAUA 5M4MA 5D6QA 3U67A 1UYMA 2YKCA 3G7BA 3INXA 2Q2EB 5BODA 3FV5A 1TIDA 1QYEA 4YKYA 2WI7A 1U2OA 3C0EA 2QF6A 3ZXOA 4GT8A 3T2SA 2YKEA 3U2DA 1NHHA 5F5RA 1THNA 3ZM7A 2HHIA 1OSFA 2XX2A 4KSGA 3D36A 4KP4A 1TBWA 5CTYA 2E0AA 3EHHA 4XKKA 2YE5A 4YKWA 3VHDA 2FWZA 3VADA 2UWDA 4E72A 1Y8OA 2QG2A 3B27A 2FYPA 1GJVA 2YEBA 4XD8A 2YJWA 2H55A 1S16A 2WERA 5FNCA 1KIJA 1TC0A 3QDDA 3RLPA 2XDUA 2BU7A 2ZBKB 1UY7A 4HYMA 1QY8A 2O1UA 4CWNA 4P7AA 2YEDA 2XHTA 4PRVA 1R62A 2XK2A 2YK2A 4EFUA 2FWYA 1GKXA 3B28A 2CCUA 4E02A 2BSMA 2YE8A 4XCJA 5D6PA 4O0BA 3TTZA 2AKPA 1YS3A 2YE9A 4FMTA 3CRKA 4BIZA 3MNRP 3B26A 1GKZA 2Q8HA 2XHXA 4L91A 4AWPA 4CWQA 3GIFA 4U7NA 2PNRA 1I5DA 3U2KA 2XD6A 4PL9A 4HXZA 2XDLA 2XABA 3EHGA 4LP0A 5C93A 4YKQA 5JENA 4KTNA 4WUBA 4B7PA 4R3MA 1A4HA 1Y4SA 4ASAA 1Y8PA 2XX4A 4DUHA 3HYZA 4U7OA 4E00A 3HYYA 4L94A 2IOPA 3EKOA 2WI5A 3Q5LA 3K99A 4U93A 2VCJA 2FXSA 3K60A 3RLRA 2K5BA 4B6CA 1BGQA 5IN9A 3TUHA 4FPPA 3HEKA 3A0XA 2C1GA 3H4LA 4MOTA 2XHRA 4FCRA 4I3HA 3WQ9A 2IORA 4XKAA 4ASFA 2CG9A 3G75A 4L93A 4E01A 2YEEA 4MP2A 4XITA 1YC1A 2WI4A 4KFGA 3K98A 5D7DA 2YEJA 1Z5BA 4XIQA 3PEHA 2VWCA 1UY8A 3ZXQA 2CCTA 5M4KA 2EXLA 4YKRA 1F51A 4LWEA 1BXDA 2VW5A 2YI5A 3GIEA 2BU6A 2YI7A 3A0WA 1YC3A 1I5BA 2ZKJA 2JKIA 2WI1A 3HHUA 2GQPA 4HYPA 2XJJA 3CWVA 2ZDYA 5CF0A 2YGAA 4YKUA 1I5AA 5CTXA 1BYQA 3O6OA 1EI1A 3H80A 4KQVA 3INWA 3G7EA 2BZ5A 4YKTA 2WEQA 2YI0A 3B25A 3TZ2A 2CGFA 2IWUA 4XIRA 2XDXA 3LMMA 2BT0A 4YKZA 4WUDA 3R4OA 2YEGA 5CPHA 3R91A 5FNFA 1H7UA 5J6AA 4FCQA 1YSRA 2YGEA 4QPKA 4CE1A 1BKNA 1YC4A 2YEFA 4R1FA 3LPSA 3FT5A 2BRCA 3A0YA 4BQJA 4LPBA 3O2FA 5IDMA 1ID0A 1PVGA 2IWXA 1Y4UA 2BU2A 4FCPA 2XDSA 3OWDA 2HCHA 4L90A 4AS9A 4AWQA 4BAEA 1B63A 2YE3A 2H8MA 4EM7A 1YERA 3OW6A 2CCSA 4JAVA 4CE2A 2YE2A 3GIGA 3PEJA 2WEPA 1Z5AA 1I58A 4R3AA 4EFTA 2QFOA 1TILA 1UYEA 3IEDA 4NH9A 3S5TA 2JJCA 3A0TA 1MU5A 2YECA 3HZ5A 4EMVA 3SL2A 1Z5CA 1UY6A 2YKIA 2YEIA 2C2AA 1TC6A 1Z59A 2YEAA 3T10A 3HZ1A 4WUCA 3EHFA 1MX0A 1UYHA 4CWOA 3OWBA 3Q5JA 2WI6A 4EGHA 1UYFA 4H7QA 2Q8IA 5M4NA 2BU8A 1H7SA 1UYDA 2BU5A 4H81A 4JQLA 3EHJA 4X9LA 4HZ5A 2WI2A 2ZDXA 1KZNA 2XJXA 4XC0A 1UY9A 3CYGA 2HG1A 3R4NA 2YI6A 4ZKIA 1ZXNA 4GFNA 4JASA 1NHIA 4UROA 3K97A 3R4PA 3CGYA 1B62A 4W7TA 1ZW9A 1UYKA 4XDMA 1YT1A 1YSZA 4MBCA 3TZ4A 4EEHA 3BM9A 4XCLA 1ZXMA 3ZKBA 2XX5A 3B24A 3DGEA 5FWKA 5L3JA 5D7CA 3GIGB 4HXWA 1IXMA 3EKRA 1U0ZA 4YKXA 4CWFA 4QPJA 2XDKA 5GGZA 3C11A 1UYIA 1NHJA 3O0IA
chains in the Genus database with same CATH topology
2O1VA 4NH8A 3VHCA 4V26A 4GGLA 5CTWA 4HZ0A 4LWIA 3TZ5A 1I59A 1YESA 4L8ZA 2BYIA 3CGZA 1UYLA 3BMYA 3T1KA 4XIPA 3D2RA 4K4OA 2Q8GA 3T0ZA 2Q8FA 1AMWA 2YE4A 4EGIA 2YE6A 4KSHA 4CWRA 4GEEA 2YKJA 4CWPA 1B3QA 5M4EA 4DZYA 4LWFA 3D0BA 2IWSA 2BTZA 1AH8A 2BYHA 4Q20A 4MPNA 2YGFA 4CE3A 4ASGA 4V25A 1Y8NA 3RLQA 1YT0A 5M4PA 4H85A 3CRLA 2GFDA 4AWOA 2WI3A 3LNUA 3ZKDA 1QZRA 1AH6A 2YE7A 1AM1A 4MPCA 1JM6A 3TZ0A 4CWTA 1US7A 5FNDA 4URLA 4LWHA 2CH4A 4ASBA 4URNA 5F3KA 1EA6A 3JZ3A 4MP7A 3A0ZA 3R92A 4URMA 1AJ6A 3Q5KA 4MB9A 3OMUA 2YKBA 4ZVIA 5D7RA 4GQTA 3QTFA 4BXIA 3A0RA 3R4MA 5BOCA 2IOQA 3T0HA 3FT8A 4EGKA 4I5SA 5CTUA 2ESAA 2BREA 3KE6A 3WHAA 5M4HA 2XCMA 4BIUA 1UYGA 4PRXA 5IDJA 4GCZA 4XKOA 2QG0A 1L0OA 2YJXA 2O1WA 1ZWHA 4PU9A 1TH8A 4O04A 4XTJA 4BQGA 4O09A 2VCIA 3OPDA 2YEHA 4O07A 2YK9A 3VHAA 4XE2A 3RKZA 3NMQA 2XJGA 1YETA 4LWGA 4O05A 5J71A 1YT2A 1UYCA 1S14A 4CWSA 4HY1A 4MPEA 4HY6A 4NH7A 4P8OA 1I5CA 2HKJA 4JAUA 5M4MA 5D6QA 3U67A 1UYMA 2YKCA 3G7BA 3INXA 2Q2EB 5BODA 3FV5A 1TIDA 1QYEA 4YKYA 2WI7A 1U2OA 3C0EA 2QF6A 3ZXOA 4GT8A 3T2SA 2YKEA 3U2DA 1NHHA 5F5RA 1THNA 3ZM7A 1OSFA 2XX2A 4KSGA 3D36A 4KP4A 1TBWA 5CTYA 2E0AA 3EHHA 4XKKA 2YE5A 4YKWA 3VHDA 2FWZA 3VADA 2UWDA 1Y8OA 2QG2A 3B27A 2FYPA 1GJVA 2YEBA 4XD8A 2YJWA 2H55A 1S16A 2WERA 5FNCA 1KIJA 1TC0A 3QDDA 3RLPA 2XDUA 2BU7A 2ZBKB 1UY7A 4HYMA 1QY8A 2O1UA 4CWNA 4P7AA 2YEDA 2XHTA 4PRVA 1R62A 2XK2A 2YK2A 4EFUA 2FWYA 1GKXA 3B28A 2CCUA 4E02A 2BSMA 2YE8A 4XCJA 5D6PA 4O0BA 3TTZA 2AKPA 1YS3A 2YE9A 4FMTA 3CRKA 4BIZA 3MNRP 3B26A 1GKZA 2Q8HA 2XHXA 4L91A 4AWPA 4CWQA 3GIFA 4U7NA 2PNRA 1I5DA 3U2KA 2XD6A 4PL9A 4HXZA 2XDLA 2XABA 3EHGA 4LP0A 5C93A 4YKQA 4KTNA 4WUBA 4B7PA 4R3MA 1A4HA 1Y4SA 4ASAA 1Y8PA 2XX4A 4DUHA 3HYZA 4U7OA 4E00A 3HYYA 4L94A 2IOPA 3EKOA 2WI5A 3Q5LA 3K99A 4U93A 2VCJA 2FXSA 3K60A 3RLRA 2K5BA 4B6CA 1BGQA 5IN9A 3TUHA 4FPPA 3HEKA 3A0XA 3H4LA 4MOTA 2XHRA 4FCRA 4I3HA 3WQ9A 2IORA 4XKAA 4ASFA 2CG9A 3G75A 4L93A 4E01A 2YEEA 4MP2A 4XITA 1YC1A 2WI4A 4KFGA 3K98A 5D7DA 2YEJA 1Z5BA 4XIQA 3PEHA 2VWCA 1UY8A 3ZXQA 2CCTA 5M4KA 2EXLA 4YKRA 1BXDA 4LWEA 2VW5A 2YI5A 3GIEA 2BU6A 2YI7A 3A0WA 1YC3A 1I5BA 2ZKJA 2JKIA 2WI1A 3HHUA 2GQPA 4HYPA 2XJJA 3CWVA 2ZDYA 5CF0A 2YGAA 4YKUA 1I5AA 5CTXA 1BYQA 3O6OA 1EI1A 3H80A 4KQVA 3INWA 3G7EA 2BZ5A 4YKTA 2WEQA 2YI0A 3B25A 3TZ2A 2CGFA 2IWUA 4XIRA 2XDXA 2BT0A 4YKZA 4WUDA 3R4OA 2YEGA 5CPHA 3R91A 5FNFA 1H7UA 5J6AA 4FCQA 1YSRA 2YGEA 4QPKA 4CE1A 1BKNA 1YC4A 2YEFA 4R1FA 3LPSA 3FT5A 2BRCA 3A0YA 4BQJA 4LPBA 3O2FA 5IDMA 1ID0A 1PVGA 2IWXA 1Y4UA 2BU2A 4FCPA 2XDSA 3OWDA 2HCHA 4L90A 4AS9A 4AWQA 4BAEA 1B63A 2YE3A 2H8MA 4EM7A 1YERA 3OW6A 2CCSA 4JAVA 4CE2A 2YE2A 3GIGA 3PEJA 2WEPA 1Z5AA 1I58A 4R3AA 4EFTA 2QFOA 1TILA 1UYEA 3IEDA 4NH9A 2JJCA 3A0TA 1MU5A 2YECA 3HZ5A 4EMVA 3SL2A 1Z5CA 1UY6A 2YKIA 2YEIA 2C2AA 1TC6A 1Z59A 2YEAA 3T10A 3HZ1A 4WUCA 3EHFA 1MX0A 1UYHA 4CWOA 3OWBA 3Q5JA 2WI6A 4EGHA 1UYFA 4H7QA 2Q8IA 5M4NA 2BU8A 1H7SA 1UYDA 2BU5A 4H81A 4JQLA 3EHJA 4X9LA 4HZ5A 2WI2A 2ZDXA 1KZNA 2XJXA 4XC0A 1UY9A 2HG1A 3R4NA 2YI6A 4ZKIA 1ZXNA 4GFNA 4JASA 1NHIA 4UROA 3K97A 3R4PA 3CGYA 1B62A 4W7TA 1ZW9A 1UYKA 4XDMA 1YT1A 1YSZA 4MBCA 3TZ4A 4EEHA 3BM9A 4XCLA 1ZXMA 3ZKBA 2XX5A 3B24A 3DGEA 5FWKA 5L3JA 5D7CA 3GIGB 4HXWA 3EKRA 1U0ZA 4YKXA 4CWFA 4QPJA 2XDKA 5GGZA 3C11A 1UYIA 1NHJA 3O0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1V A;  4NH8 A;  3VHC A;  4V26 A;  4GGL A;  5CTW A;  4HZ0 A;  4LWI A;  3TZ5 A;  1I59 A;  1YES A;  4L8Z A;  2BYI A;  3CGZ A;  1UYL A;  3BMY A;  3T1K A;  4XIP A;  3D2R A;  4K4O A;  2Q8G A;  3T0Z A;  2Q8F A;  1AMW A;  2YE4 A;  4EGI A;  2YE6 A;  4KSH A;  4CWR A;  4GEE A;  2YKJ A;  4CWP A;  1B3Q A;  5M4E A;  4DZY A;  4LWF A;  3D0B A;  2IWS A;  2BTZ A;  1AH8 A;  2BYH A;  4Q20 A;  4MPN A;  2YGF A;  4CE3 A;  4ASG A;  4V25 A;  1Y8N A;  3RLQ A;  1YT0 A;  5M4P A;  4H85 A;  3CRL A;  2GFD A;  4AWO A;  2WI3 A;  3LNU A;  3ZKD A;  1QZR A;  1AH6 A;  2YE7 A;  1AM1 A;  4MPC A;  1JM6 A;  3TZ0 A;  4CWT A;  1US7 A;  5FND A;  4URL A;  4LWH A;  2CH4 A;  4ASB A;  4URN A;  5F3K A;  1EA6 A;  3JZ3 A;  4MP7 A;  3A0Z A;  3R92 A;  4URM A;  1AJ6 A;  3Q5K A;  4MB9 A;  3OMU A;  2YKB A;  4ZVI A;  5D7R A;  4GQT A;  3QTF A;  4BXI A;  3A0R A;  3R4M A;  5BOC A;  2IOQ A;  3T0H A;  3FT8 A;  4EGK A;  4I5S A;  5CTU A;  2ESA A;  2BRE A;  3KE6 A;  3WHA A;  5M4H A;  2XCM A;  4BIU A;  1UYG A;  4PRX A;  5IDJ A;  4GCZ A;  4XKO A;  2QG0 A;  1L0O A;  2YJX A;  2O1W A;  1ZWH A;  4PU9 A;  1TH8 A;  4O04 A;  4XTJ A;  4BQG A;  4O09 A;  2VCI A;  3OPD A;  2YEH A;  4O07 A;  2YK9 A;  3VHA A;  4XE2 A;  3RKZ A;  3NMQ A;  2XJG A;  1YET A;  4LWG A;  4O05 A;  5J71 A;  1YT2 A;  1UYC A;  1S14 A;  4CWS A;  4HY1 A;  4MPE A;  4HY6 A;  4NH7 A;  4P8O A;  1I5C A;  2HKJ A;  4JAU A;  5M4M A;  5D6Q A;  3U67 A;  1UYM A;  2YKC A;  3G7B A;  3INX A;  2Q2E B;  5BOD A;  3FV5 A;  1TID A;  1QYE A;  4YKY A;  2WI7 A;  1U2O A;  3C0E A;  2QF6 A;  3ZXO A;  4GT8 A;  3T2S A;  2YKE A;  3U2D A;  1NHH A;  5F5R A;  1THN A;  3ZM7 A;  1OSF A;  2XX2 A;  4KSG A;  3D36 A;  4KP4 A;  1TBW A;  5CTY A;  2E0A A;  3EHH A;  4XKK A;  2YE5 A;  4YKW A;  3VHD A;  2FWZ A;  3VAD A;  2UWD A;  1Y8O A;  2QG2 A;  3B27 A;  2FYP A;  1GJV A;  2YEB A;  4XD8 A;  2YJW A;  2H55 A;  1S16 A;  2WER A;  5FNC A;  1KIJ A;  1TC0 A;  3QDD A;  3RLP A;  2XDU A;  2BU7 A;  2ZBK B;  1UY7 A;  4HYM A;  1QY8 A;  2O1U A;  4CWN A;  4P7A A;  2YED A;  2XHT A;  4PRV A;  1R62 A;  2XK2 A;  2YK2 A;  4EFU A;  2FWY A;  1GKX A;  3B28 A;  2CCU A;  4E02 A;  2BSM A;  2YE8 A;  4XCJ A;  5D6P A;  4O0B A;  3TTZ A;  2AKP A;  1YS3 A;  2YE9 A;  4FMT A;  3CRK A;  4BIZ A;  3MNR P;  3B26 A;  1GKZ A;  2Q8H A;  2XHX A;  4L91 A;  4AWP A;  4CWQ A;  3GIF A;  4U7N A;  2PNR A;  1I5D A;  3U2K A;  2XD6 A;  4PL9 A;  4HXZ A;  2XDL A;  2XAB A;  3EHG A;  4LP0 A;  5C93 A;  4YKQ A;  4KTN A;  4WUB A;  4B7P A;  4R3M A;  1A4H A;  1Y4S A;  4ASA A;  1Y8P A;  2XX4 A;  4DUH A;  3HYZ A;  4U7O A;  4E00 A;  3HYY A;  4L94 A;  2IOP A;  3EKO A;  2WI5 A;  3Q5L A;  3K99 A;  4U93 A;  2VCJ A;  2FXS A;  3K60 A;  3RLR A;  2K5B A;  4B6C A;  1BGQ A;  5IN9 A;  3TUH A;  4FPP A;  3HEK A;  3A0X A;  3H4L A;  4MOT A;  2XHR A;  4FCR A;  4I3H A;  3WQ9 A;  2IOR A;  4XKA A;  4ASF A;  2CG9 A;  3G75 A;  4L93 A;  4E01 A;  2YEE A;  4MP2 A;  4XIT A;  1YC1 A;  2WI4 A;  4KFG A;  3K98 A;  5D7D A;  2YEJ A;  1Z5B A;  4XIQ A;  3PEH A;  2VWC A;  1UY8 A;  3ZXQ A;  2CCT A;  5M4K A;  2EXL A;  4YKR A;  1BXD A;  4LWE A;  2VW5 A;  2YI5 A;  3GIE A;  2BU6 A;  2YI7 A;  3A0W A;  1YC3 A;  1I5B A;  2ZKJ A;  2JKI A;  2WI1 A;  3HHU A;  2GQP A;  4HYP A;  2XJJ A;  3CWV A;  2ZDY A;  5CF0 A;  2YGA A;  4YKU A;  1I5A A;  5CTX A;  1BYQ A;  3O6O A;  1EI1 A;  3H80 A;  4KQV A;  3INW A;  3G7E A;  2BZ5 A;  4YKT A;  2WEQ A;  2YI0 A;  3B25 A;  3TZ2 A;  2CGF A;  2IWU A;  4XIR A;  2XDX A;  2BT0 A;  4YKZ A;  4WUD A;  3R4O A;  2YEG A;  5CPH A;  3R91 A;  5FNF A;  1H7U A;  5J6A A;  4FCQ A;  1YSR A;  2YGE A;  4QPK A;  4CE1 A;  1BKN A;  1YC4 A;  2YEF A;  4R1F A;  3LPS A;  3FT5 A;  2BRC A;  3A0Y A;  4BQJ A;  4LPB A;  3O2F A;  5IDM A;  1ID0 A;  1PVG A;  2IWX A;  1Y4U A;  2BU2 A;  4FCP A;  2XDS A;  3OWD A;  2HCH A;  4L90 A;  4AS9 A;  4AWQ A;  4BAE A;  1B63 A;  2YE3 A;  2H8M A;  4EM7 A;  1YER A;  3OW6 A;  2CCS A;  4JAV A;  4CE2 A;  2YE2 A;  3GIG A;  3PEJ A;  2WEP A;  1Z5A A;  1I58 A;  4R3A A;  4EFT A;  2QFO A;  1TIL A;  1UYE A;  3IED A;  4NH9 A;  2JJC A;  3A0T A;  1MU5 A;  2YEC A;  3HZ5 A;  4EMV A;  3SL2 A;  1Z5C A;  1UY6 A;  2YKI A;  2YEI A;  2C2A A;  1TC6 A;  1Z59 A;  2YEA A;  3T10 A;  3HZ1 A;  4WUC A;  3EHF A;  1MX0 A;  1UYH A;  4CWO A;  3OWB A;  3Q5J A;  2WI6 A;  4EGH A;  1UYF A;  4H7Q A;  2Q8I A;  5M4N A;  2BU8 A;  1H7S A;  1UYD A;  2BU5 A;  4H81 A;  4JQL A;  3EHJ A;  4X9L A;  4HZ5 A;  2WI2 A;  2ZDX A;  1KZN A;  2XJX A;  4XC0 A;  1UY9 A;  2HG1 A;  3R4N A;  2YI6 A;  4ZKI A;  1ZXN A;  4GFN A;  4JAS A;  1NHI A;  4URO A;  3K97 A;  3R4P A;  3CGY A;  1B62 A;  4W7T A;  1ZW9 A;  1UYK A;  4XDM A;  1YT1 A;  1YSZ A;  4MBC A;  3TZ4 A;  4EEH A;  3BM9 A;  4XCL A;  1ZXM A;  3ZKB A;  2XX5 A;  3B24 A;  3DGE A;  5FWK A;  5L3J A;  5D7C A;  3GIG B;  4HXW A;  3EKR A;  1U0Z A;  4YKX A;  4CWF A;  4QPJ A;  2XDK A;  5GGZ A;  3C11 A;  1UYI A;  1NHJ A;  3O0I A; 
#chains in the Genus database with same CATH topology
 2O1V A;  4NH8 A;  3VHC A;  4V26 A;  4GGL A;  5CTW A;  4HZ0 A;  4LWI A;  3TZ5 A;  1I59 A;  1YES A;  4L8Z A;  2BYI A;  3CGZ A;  1UYL A;  3BMY A;  3T1K A;  4XIP A;  3D2R A;  4K4O A;  2Q8G A;  3T0Z A;  2Q8F A;  1AMW A;  2YE4 A;  4EGI A;  2YE6 A;  4KSH A;  4CWR A;  4GEE A;  2YKJ A;  4CWP A;  1B3Q A;  5M4E A;  4DZY A;  4LWF A;  3D0B A;  2IWS A;  2FTK A;  2BTZ A;  1AH8 A;  2BYH A;  4Q20 A;  4MPN A;  2YGF A;  4CE3 A;  4ASG A;  4V25 A;  1Y8N A;  3RLQ A;  1YT0 A;  5M4P A;  4H85 A;  3CRL A;  2GFD A;  4AWO A;  2WI3 A;  3LNU A;  3ZKD A;  1QZR A;  1AH6 A;  2YE7 A;  1AM1 A;  4MPC A;  1JM6 A;  3TZ0 A;  4CWT A;  1US7 A;  5FND A;  4URL A;  4LWH A;  2CH4 A;  4ASB A;  4URN A;  5F3K A;  1EA6 A;  3JZ3 A;  4MP7 A;  3A0Z A;  3R92 A;  4URM A;  1AJ6 A;  3Q5K A;  4MB9 A;  3OMU A;  2YKB A;  4ZVI A;  5D7R A;  4GQT A;  3QTF A;  4BXI A;  3A0R A;  3R4M A;  5BOC A;  2IOQ A;  3T0H A;  3FT8 A;  4EGK A;  4I5S A;  5CTU A;  2ESA A;  2BRE A;  3KE6 A;  2C1I A;  3WHA A;  5M4H A;  2XCM A;  4BIU A;  1UYG A;  4PRX A;  5IDJ A;  4GCZ A;  4XKO A;  2QG0 A;  1L0O A;  2YJX A;  2O1W A;  1ZWH A;  4PU9 A;  1TH8 A;  4O04 A;  4XTJ A;  4BQG A;  4O09 A;  2VCI A;  3OPD A;  2YEH A;  4O07 A;  2YK9 A;  3VHA A;  4XE2 A;  3RKZ A;  3NMQ A;  2XJG A;  1YET A;  4LWG A;  4O05 A;  5J71 A;  1YT2 A;  1UYC A;  1S14 A;  4CWS A;  4HY1 A;  4MPE A;  4HY6 A;  4NH7 A;  4P8O A;  1I5C A;  2HKJ A;  4JAU A;  5M4M A;  5D6Q A;  3U67 A;  1UYM A;  2YKC A;  3G7B A;  3INX A;  2Q2E B;  5BOD A;  3FV5 A;  1TID A;  1QYE A;  4YKY A;  2WI7 A;  1U2O A;  3C0E A;  2QF6 A;  3ZXO A;  4GT8 A;  3T2S A;  2YKE A;  3U2D A;  1NHH A;  5F5R A;  1THN A;  3ZM7 A;  2HHI A;  1OSF A;  2XX2 A;  4KSG A;  3D36 A;  4KP4 A;  1TBW A;  5CTY A;  2E0A A;  3EHH A;  4XKK A;  2YE5 A;  4YKW A;  3VHD A;  2FWZ A;  3VAD A;  2UWD A;  4E72 A;  1Y8O A;  2QG2 A;  3B27 A;  2FYP A;  1GJV A;  2YEB A;  4XD8 A;  2YJW A;  2H55 A;  1S16 A;  2WER A;  5FNC A;  1KIJ A;  1TC0 A;  3QDD A;  3RLP A;  2XDU A;  2BU7 A;  2ZBK B;  1UY7 A;  4HYM A;  1QY8 A;  2O1U A;  4CWN A;  4P7A A;  2YED A;  2XHT A;  4PRV A;  1R62 A;  2XK2 A;  2YK2 A;  4EFU A;  2FWY A;  1GKX A;  3B28 A;  2CCU A;  4E02 A;  2BSM A;  2YE8 A;  4XCJ A;  5D6P A;  4O0B A;  3TTZ A;  2AKP A;  1YS3 A;  2YE9 A;  4FMT A;  3CRK A;  4BIZ A;  3MNR P;  3B26 A;  1GKZ A;  2Q8H A;  2XHX A;  4L91 A;  4AWP A;  4CWQ A;  3GIF A;  4U7N A;  2PNR A;  1I5D A;  3U2K A;  2XD6 A;  4PL9 A;  4HXZ A;  2XDL A;  2XAB A;  3EHG A;  4LP0 A;  5C93 A;  4YKQ A;  5JEN A;  4KTN A;  4WUB A;  4B7P A;  4R3M A;  1A4H A;  1Y4S A;  4ASA A;  1Y8P A;  2XX4 A;  4DUH A;  3HYZ A;  4U7O A;  4E00 A;  3HYY A;  4L94 A;  2IOP A;  3EKO A;  2WI5 A;  3Q5L A;  3K99 A;  4U93 A;  2VCJ A;  2FXS A;  3K60 A;  3RLR A;  2K5B A;  4B6C A;  1BGQ A;  5IN9 A;  3TUH A;  4FPP A;  3HEK A;  3A0X A;  2C1G A;  3H4L A;  4MOT A;  2XHR A;  4FCR A;  4I3H A;  3WQ9 A;  2IOR A;  4XKA A;  4ASF A;  2CG9 A;  3G75 A;  4L93 A;  4E01 A;  2YEE A;  4MP2 A;  4XIT A;  1YC1 A;  2WI4 A;  4KFG A;  3K98 A;  5D7D A;  2YEJ A;  1Z5B A;  4XIQ A;  3PEH A;  2VWC A;  1UY8 A;  3ZXQ A;  2CCT A;  5M4K A;  2EXL A;  4YKR A;  1F51 A;  4LWE A;  1BXD A;  2VW5 A;  2YI5 A;  3GIE A;  2BU6 A;  2YI7 A;  3A0W A;  1YC3 A;  1I5B A;  2ZKJ A;  2JKI A;  2WI1 A;  3HHU A;  2GQP A;  4HYP A;  2XJJ A;  3CWV A;  2ZDY A;  5CF0 A;  2YGA A;  4YKU A;  1I5A A;  5CTX A;  1BYQ A;  3O6O A;  1EI1 A;  3H80 A;  4KQV A;  3INW A;  3G7E A;  2BZ5 A;  4YKT A;  2WEQ A;  2YI0 A;  3B25 A;  3TZ2 A;  2CGF A;  2IWU A;  4XIR A;  2XDX A;  3LMM A;  2BT0 A;  4YKZ A;  4WUD A;  3R4O A;  2YEG A;  5CPH A;  3R91 A;  5FNF A;  1H7U A;  5J6A A;  4FCQ A;  1YSR A;  2YGE A;  4QPK A;  4CE1 A;  1BKN A;  1YC4 A;  2YEF A;  4R1F A;  3LPS A;  3FT5 A;  2BRC A;  3A0Y A;  4BQJ A;  4LPB A;  3O2F A;  5IDM A;  1ID0 A;  1PVG A;  2IWX A;  1Y4U A;  2BU2 A;  4FCP A;  2XDS A;  3OWD A;  2HCH A;  4L90 A;  4AS9 A;  4AWQ A;  4BAE A;  1B63 A;  2YE3 A;  2H8M A;  4EM7 A;  1YER A;  3OW6 A;  2CCS A;  4JAV A;  4CE2 A;  2YE2 A;  3GIG A;  3PEJ A;  2WEP A;  1Z5A A;  1I58 A;  4R3A A;  4EFT A;  2QFO A;  1TIL A;  1UYE A;  3IED A;  4NH9 A;  3S5T A;  2JJC A;  3A0T A;  1MU5 A;  2YEC A;  3HZ5 A;  4EMV A;  3SL2 A;  1Z5C A;  1UY6 A;  2YKI A;  2YEI A;  2C2A A;  1TC6 A;  1Z59 A;  2YEA A;  3T10 A;  3HZ1 A;  4WUC A;  3EHF A;  1MX0 A;  1UYH A;  4CWO A;  3OWB A;  3Q5J A;  2WI6 A;  4EGH A;  1UYF A;  4H7Q A;  2Q8I A;  5M4N A;  2BU8 A;  1H7S A;  1UYD A;  2BU5 A;  4H81 A;  4JQL A;  3EHJ A;  4X9L A;  4HZ5 A;  2WI2 A;  2ZDX A;  1KZN A;  2XJX A;  4XC0 A;  1UY9 A;  3CYG A;  2HG1 A;  3R4N A;  2YI6 A;  4ZKI A;  1ZXN A;  4GFN A;  4JAS A;  1NHI A;  4URO A;  3K97 A;  3R4P A;  3CGY A;  1B62 A;  4W7T A;  1ZW9 A;  1UYK A;  4XDM A;  1YT1 A;  1YSZ A;  4MBC A;  3TZ4 A;  4EEH A;  3BM9 A;  4XCL A;  1ZXM A;  3ZKB A;  2XX5 A;  3B24 A;  3DGE A;  5FWK A;  5L3J A;  5D7C A;  3GIG B;  4HXW A;  1IXM A;  3EKR A;  1U0Z A;  4YKX A;  4CWF A;  4QPJ A;  2XDK A;  5GGZ A;  3C11 A;  1UYI A;  1NHJ A;  3O0I A; 
#chains in the Genus database with same CATH homology
 2O1V A;  4NH8 A;  3VHC A;  4V26 A;  4GGL A;  5CTW A;  4HZ0 A;  4LWI A;  3TZ5 A;  1I59 A;  1YES A;  4L8Z A;  2BYI A;  3CGZ A;  1UYL A;  3BMY A;  3T1K A;  4XIP A;  3D2R A;  4K4O A;  2Q8G A;  3T0Z A;  2Q8F A;  1AMW A;  2YE4 A;  4EGI A;  2YE6 A;  4KSH A;  4CWR A;  4GEE A;  2YKJ A;  4CWP A;  1B3Q A;  5M4E A;  4DZY A;  4LWF A;  3D0B A;  2IWS A;  2BTZ A;  1AH8 A;  2BYH A;  4Q20 A;  4MPN A;  2YGF A;  4CE3 A;  4ASG A;  4V25 A;  1Y8N A;  3RLQ A;  1YT0 A;  5M4P A;  4H85 A;  3CRL A;  2GFD A;  4AWO A;  2WI3 A;  3LNU A;  3ZKD A;  1QZR A;  1AH6 A;  2YE7 A;  1AM1 A;  4MPC A;  1JM6 A;  3TZ0 A;  4CWT A;  1US7 A;  5FND A;  4URL A;  4LWH A;  2CH4 A;  4ASB A;  4URN A;  5F3K A;  1EA6 A;  3JZ3 A;  4MP7 A;  3A0Z A;  3R92 A;  4URM A;  1AJ6 A;  3Q5K A;  4MB9 A;  3OMU A;  2YKB A;  4ZVI A;  5D7R A;  4GQT A;  3QTF A;  4BXI A;  3A0R A;  3R4M A;  5BOC A;  2IOQ A;  3T0H A;  3FT8 A;  4EGK A;  4I5S A;  5CTU A;  2ESA A;  2BRE A;  3KE6 A;  3WHA A;  5M4H A;  2XCM A;  4BIU A;  1UYG A;  4PRX A;  5IDJ A;  4GCZ A;  4XKO A;  2QG0 A;  1L0O A;  2YJX A;  2O1W A;  1ZWH A;  4PU9 A;  1TH8 A;  4O04 A;  4XTJ A;  4BQG A;  4O09 A;  2VCI A;  3OPD A;  2YEH A;  4O07 A;  2YK9 A;  3VHA A;  4XE2 A;  3RKZ A;  3NMQ A;  2XJG A;  1YET A;  4LWG A;  4O05 A;  5J71 A;  1YT2 A;  1UYC A;  1S14 A;  4CWS A;  4HY1 A;  4MPE A;  4HY6 A;  4NH7 A;  4P8O A;  1I5C A;  2HKJ A;  4JAU A;  5M4M A;  5D6Q A;  3U67 A;  1UYM A;  2YKC A;  3G7B A;  3INX A;  2Q2E B;  5BOD A;  3FV5 A;  1TID A;  1QYE A;  4YKY A;  2WI7 A;  1U2O A;  3C0E A;  2QF6 A;  3ZXO A;  4GT8 A;  3T2S A;  2YKE A;  3U2D A;  1NHH A;  5F5R A;  1THN A;  3ZM7 A;  1OSF A;  2XX2 A;  4KSG A;  3D36 A;  4KP4 A;  1TBW A;  5CTY A;  2E0A A;  3EHH A;  4XKK A;  2YE5 A;  4YKW A;  3VHD A;  2FWZ A;  3VAD A;  2UWD A;  1Y8O A;  2QG2 A;  3B27 A;  2FYP A;  1GJV A;  2YEB A;  4XD8 A;  2YJW A;  2H55 A;  1S16 A;  2WER A;  5FNC A;  1KIJ A;  1TC0 A;  3QDD A;  3RLP A;  2XDU A;  2BU7 A;  2ZBK B;  1UY7 A;  4HYM A;  1QY8 A;  2O1U A;  4CWN A;  4P7A A;  2YED A;  2XHT A;  4PRV A;  1R62 A;  2XK2 A;  2YK2 A;  4EFU A;  2FWY A;  1GKX A;  3B28 A;  2CCU A;  4E02 A;  2BSM A;  2YE8 A;  4XCJ A;  5D6P A;  4O0B A;  3TTZ A;  2AKP A;  1YS3 A;  2YE9 A;  4FMT A;  3CRK A;  4BIZ A;  3MNR P;  3B26 A;  1GKZ A;  2Q8H A;  2XHX A;  4L91 A;  4AWP A;  4CWQ A;  3GIF A;  4U7N A;  2PNR A;  1I5D A;  3U2K A;  2XD6 A;  4PL9 A;  4HXZ A;  2XDL A;  2XAB A;  3EHG A;  4LP0 A;  5C93 A;  4YKQ A;  4KTN A;  4WUB A;  4B7P A;  4R3M A;  1A4H A;  1Y4S A;  4ASA A;  1Y8P A;  2XX4 A;  4DUH A;  3HYZ A;  4U7O A;  4E00 A;  3HYY A;  4L94 A;  2IOP A;  3EKO A;  2WI5 A;  3Q5L A;  3K99 A;  4U93 A;  2VCJ A;  2FXS A;  3K60 A;  3RLR A;  2K5B A;  4B6C A;  1BGQ A;  5IN9 A;  3TUH A;  4FPP A;  3HEK A;  3A0X A;  3H4L A;  4MOT A;  2XHR A;  4FCR A;  4I3H A;  3WQ9 A;  2IOR A;  4XKA A;  4ASF A;  2CG9 A;  3G75 A;  4L93 A;  4E01 A;  2YEE A;  4MP2 A;  4XIT A;  1YC1 A;  2WI4 A;  4KFG A;  3K98 A;  5D7D A;  2YEJ A;  1Z5B A;  4XIQ A;  3PEH A;  2VWC A;  1UY8 A;  3ZXQ A;  2CCT A;  5M4K A;  2EXL A;  4YKR A;  1BXD A;  4LWE A;  2VW5 A;  2YI5 A;  3GIE A;  2BU6 A;  2YI7 A;  3A0W A;  1YC3 A;  1I5B A;  2ZKJ A;  2JKI A;  2WI1 A;  3HHU A;  2GQP A;  4HYP A;  2XJJ A;  3CWV A;  2ZDY A;  5CF0 A;  2YGA A;  4YKU A;  1I5A A;  5CTX A;  1BYQ A;  3O6O A;  1EI1 A;  3H80 A;  4KQV A;  3INW A;  3G7E A;  2BZ5 A;  4YKT A;  2WEQ A;  2YI0 A;  3B25 A;  3TZ2 A;  2CGF A;  2IWU A;  4XIR A;  2XDX A;  2BT0 A;  4YKZ A;  4WUD A;  3R4O A;  2YEG A;  5CPH A;  3R91 A;  5FNF A;  1H7U A;  5J6A A;  4FCQ A;  1YSR A;  2YGE A;  4QPK A;  4CE1 A;  1BKN A;  1YC4 A;  2YEF A;  4R1F A;  3LPS A;  3FT5 A;  2BRC A;  3A0Y A;  4BQJ A;  4LPB A;  3O2F A;  5IDM A;  1ID0 A;  1PVG A;  2IWX A;  1Y4U A;  2BU2 A;  4FCP A;  2XDS A;  3OWD A;  2HCH A;  4L90 A;  4AS9 A;  4AWQ A;  4BAE A;  1B63 A;  2YE3 A;  2H8M A;  4EM7 A;  1YER A;  3OW6 A;  2CCS A;  4JAV A;  4CE2 A;  2YE2 A;  3GIG A;  3PEJ A;  2WEP A;  1Z5A A;  1I58 A;  4R3A A;  4EFT A;  2QFO A;  1TIL A;  1UYE A;  3IED A;  4NH9 A;  2JJC A;  3A0T A;  1MU5 A;  2YEC A;  3HZ5 A;  4EMV A;  3SL2 A;  1Z5C A;  1UY6 A;  2YKI A;  2YEI A;  2C2A A;  1TC6 A;  1Z59 A;  2YEA A;  3T10 A;  3HZ1 A;  4WUC A;  3EHF A;  1MX0 A;  1UYH A;  4CWO A;  3OWB A;  3Q5J A;  2WI6 A;  4EGH A;  1UYF A;  4H7Q A;  2Q8I A;  5M4N A;  2BU8 A;  1H7S A;  1UYD A;  2BU5 A;  4H81 A;  4JQL A;  3EHJ A;  4X9L A;  4HZ5 A;  2WI2 A;  2ZDX A;  1KZN A;  2XJX A;  4XC0 A;  1UY9 A;  2HG1 A;  3R4N A;  2YI6 A;  4ZKI A;  1ZXN A;  4GFN A;  4JAS A;  1NHI A;  4URO A;  3K97 A;  3R4P A;  3CGY A;  1B62 A;  4W7T A;  1ZW9 A;  1UYK A;  4XDM A;  1YT1 A;  1YSZ A;  4MBC A;  3TZ4 A;  4EEH A;  3BM9 A;  4XCL A;  1ZXM A;  3ZKB A;  2XX5 A;  3B24 A;  3DGE A;  5FWK A;  5L3J A;  5D7C A;  3GIG B;  4HXW A;  3EKR A;  1U0Z A;  4YKX A;  4CWF A;  4QPJ A;  2XDK A;  5GGZ A;  3C11 A;  1UYI A;  1NHJ A;  3O0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...