1BXDA

Nmr structure of the histidine kinase domain of the e. coli osmosensor envz
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
161
structure length
161
Chain Sequence
b'TGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
publication title NMR structure of the histidine kinase domain of the E. coli osmosensor EnvZ.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Transferase
total genus 25
structure length 161
sequence length 161
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1998-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1bxdA00
1UYHA 2ESAA 4EEHA 1I5BA 3H80A 3INWA 4URLA 4MP2A 3U2DA 4KFGA 1YS3A 2WI7A 2BRCA 4BIUA 4L8ZA 3HEKA 1EA6A 2YECA 3T0HA 4R1FA 2YEAA 4URNA 1TC0A 1TILA 3PEJA 2XJJA 4E02A 1Y8NA 4NH7A 5M4NA 4KQVA 1B3QA 4K4OA 3B28A 4XC0A 3C0EA 3K98A 4MPCA 4LP0A 1S14A 4URMA 1ID0A 4XTJA 3G7BA 3TZ4A 4QPKA 3A0WA 3T1KA 1U2OA 1UY6A 4EMVA 2BSMA 2O1VA 3CRKA 4L90A 3C11A 2YI6A 4EGHA 3INXA 3IEDA 4MB9A 2FWYA 2XX5A 3VHCA 3LNUA 3WQ9A 3H4LA 3OMUA 2YE3A 2QG2A 1GKZA 5M4EA 1A4HA 2WEQA 2E0AA 1ZXMA 2AKPA 4HZ0A 3LPSA 4O09A 4B7PA 2HG1A 5M4MA 5CTWA 4W7TA 3G75A 2XD6A 2ZBKB 4ZKIA 4EM7A 5BODA 1YERA 3A0YA 5IDJA 2ZKJA 2JJCA 1I5DA 2BYIA 1YESA 2H55A 3EHFA 4HXWA 2YE4A 2YEJA 4NH8A 4YKTA 2YI7A 4R3AA 2YE2A 3RLPA 1TBWA 3TUHA 4GCZA 4XKAA 3GIFA 2YEHA 4JASA 3U2KA 4P8OA 2BU6A 5M4KA 5CTUA 4GQTA 4KTNA 4CWOA 4FPPA 3R4MA 4O04A 4O05A 2CG9A 4XIPA 2VCIA 3VADA 1PVGA 2BTZA 2XHXA 1YC3A 4KSHA 4LWFA 3EKOA 4H85A 3O6OA 2K5BA 4XE2A 3FV5A 1S16A 4XIRA 4XCLA 5FNDA 2YI0A 2HCHA 1L0OA 2YK2A 2YEIA 1AMWA 5CPHA 4FCPA 1NHHA 2YJWA 1YETA 2YGAA 3CGYA 2HKJA 4YKXA 5FNCA 1UYDA 2WERA 5L3JA 3TZ2A 2EXLA 4U93A 1Y4UA 2Q8HA 3GIGB 4FCRA 4E00A 2YE8A 4UROA 4EGKA 1JM6A 3R91A 1QZRA 4LWEA 3HYYA 5F5RA 1Y8OA 5C93A 2XX4A 4BQGA 1YT0A 2BU2A 2Q2EB 4PRXA 3K60A 5D7CA 1ZXNA 2CCUA 3HHUA 1Y4SA 1GJVA 5FNFA 2XK2A 1GKXA 4CE1A 3OWBA 2XDSA 4HYPA 4LWIA 3WHAA 4YKQA 2IWUA 1TH8A 4ASBA 4P7AA 4H81A 1BGQA 2IORA 3O2FA 3T2SA 3CGZA 4XCJA 2CCTA 3ZXQA 3G7EA 2WI1A 4LWHA 1U0ZA 2YGEA 3R4OA 2Q8IA 1TIDA 2IOPA 2WI3A 2IWSA 2Q8FA 2XDKA 3OW6A 1BKNA 5D6QA 2BU8A 4EFTA 4WUBA 1YSRA 2H8MA 4U7NA 3EKRA 5IDMA 1OSFA 2YEDA 3VHAA 3D2RA 4H7QA 2Q8GA 4ASGA 4ZVIA 2BREA 5CTXA 4MBCA 4JQLA 3B24A 3K97A 2FYPA 1YT1A 3A0TA 2YEEA 4EGIA 2YJXA 4PL9A 3CWVA 3OPDA 4V26A 2YKEA 2WI5A 1KIJA 1H7SA 4XITA 3BMYA 2WI6A 2YKBA 1UYGA 4HY1A 1Y8PA 4U7OA 2YI5A 3FT8A 3CRLA 4YKWA 3K99A 4ASFA 2XHRA 2QFOA 1I5AA 4XKKA 5M4HA 2FXSA 4I3HA 2WI2A 2XCMA 1Z5CA 3GIGA 4FCQA 3QTFA 1MX0A 2XX2A 2YEGA 3B27A 1BXDA 2XJXA 1UYMA 3HZ1A 4YKRA 1UY9A 3EHHA 5F3KA 2YE6A 1UY8A 1YC4A 4CWQA 2BU5A 4WUCA 4PU9A 1B62A 4O0BA 4Q20A 2IWXA 1UYLA 5M4PA 3TZ0A 4BAEA 4CWFA 3BM9A 3OWDA 3VHDA 3FT5A 4MPEA 4EFUA 1UYIA 2BYHA 1UYFA 4QPJA 3GIEA 3RLRA 2CH4A 4YKZA 2C2AA 2ZDYA 1NHJA 2XDUA 1B63A 1QYEA 4CWRA 4DUHA 5J6AA 1ZWHA 4CE2A 3SL2A 2XABA 1THNA 4YKUA 2XDLA 3HZ5A 2UWDA 4BIZA 4X9LA 3B26A 1US7A 2YEBA 1UYKA 3R92A 4CWTA 5CTYA 1KZNA 3DGEA 4XDMA 4L94A 4YKYA 3D36A 4L91A 1UYCA 1QY8A 4V25A 4BQJA 1MU5A 3Q5KA 3RKZA 2CCSA 3QDDA 4GGLA 4JAUA 4XD8A 4KP4A 5D6PA 2YE7A 4XKOA 3JZ3A 3U67A 4MP7A 4CE3A 3A0ZA 3EHJA 3PEHA 4MOTA 3O0IA 3HYZA 1ZW9A 5BOCA 2GFDA 2PNRA 4MPNA 3A0RA 1AH8A 3TTZA 3ZM7A 4PRVA 5D7RA 5D7DA 2O1UA 4DZYA 1AJ6A 4GEEA 2YE5A 4GT8A 2VCJA 2WEPA 1YSZA 1I59A 4AWPA 5FWKA 1I58A 3R4NA 4R3MA 4AWQA 5GGZA 2O1WA 2YGFA 3T0ZA 4CWNA 2VWCA 4JAVA 4AS9A 2WI4A 3D0BA 2YKJA 2BZ5A 4LPBA 5J71A 3B25A 4NH9A 2ZDXA 4ASAA 4LWGA 1UY7A 4GFNA 3EHGA 4I5SA 2QF6A 4HXZA 4O07A 4B6CA 5IN9A 1NHIA 2JKIA 4HY6A 2YE9A 2YK9A 4HZ5A 3RLQA 3KE6A 3TZ5A 4CWSA 1EI1A 4AWOA 3R4PA 2FWZA 1YT2A 2XJGA 2XDXA 4WUDA 4KSGA 1R62A 4HYMA 1H7UA 1TC6A 1AM1A 1I5CA 2GQPA 2YKIA 3A0XA 4BXIA 5CF0A 3ZXOA 2QG0A 2VW5A 4L93A 1UYEA 2BT0A 2XHTA 4XIQA 3Q5LA 2BU7A 1AH6A 1Z5BA 2IOQA 2YEFA 3MNRP 1YC1A 3ZKBA 3T10A 3Q5JA 4FMTA 3NMQA 4E01A 1BYQA 2YKCA 1Z59A 3ZKDA 4CWPA 2CGFA 1Z5AA
chains in the Genus database with same CATH superfamily
1UYHA 2ESAA 4EEHA 1I5BA 3H80A 3INWA 4URLA 4MP2A 3U2DA 4KFGA 1YS3A 2WI7A 4E72A 2BRCA 4BIUA 4L8ZA 3HEKA 1EA6A 2YECA 3T0HA 4R1FA 2YEAA 4URNA 1TC0A 1TILA 3PEJA 2XJJA 4E02A 1Y8NA 4NH7A 5M4NA 4KQVA 1B3QA 4K4OA 3B28A 4XC0A 3C0EA 3K98A 4MPCA 4LP0A 1S14A 4URMA 1ID0A 4XTJA 3G7BA 3TZ4A 4QPKA 3A0WA 3T1KA 1U2OA 1UY6A 4EMVA 2BSMA 2O1VA 3CRKA 4L90A 3C11A 2YI6A 4EGHA 3INXA 3IEDA 4MB9A 2FWYA 2XX5A 3VHCA 3LNUA 3WQ9A 3H4LA 3OMUA 2YE3A 2QG2A 1GKZA 5M4EA 1A4HA 2WEQA 2E0AA 1ZXMA 2AKPA 4HZ0A 3LPSA 3CYGA 4O09A 4B7PA 2HG1A 5M4MA 5CTWA 4W7TA 3G75A 2XD6A 2ZBKB 4ZKIA 4EM7A 5BODA 1YERA 3A0YA 5IDJA 2ZKJA 2JJCA 1I5DA 2BYIA 1YESA 2H55A 3EHFA 4HXWA 2YE4A 2YEJA 4NH8A 4YKTA 2YI7A 4R3AA 2YE2A 3RLPA 1TBWA 3TUHA 4GCZA 4XKAA 3GIFA 2YEHA 4JASA 3U2KA 4P8OA 2BU6A 5M4KA 5CTUA 4GQTA 4KTNA 4CWOA 4FPPA 3R4MA 4O04A 4O05A 2CG9A 4XIPA 2VCIA 3VADA 1PVGA 2BTZA 2XHXA 1YC3A 4KSHA 4LWFA 3EKOA 4H85A 3O6OA 2K5BA 4XE2A 3FV5A 1S16A 4XIRA 4XCLA 5FNDA 2YI0A 2HCHA 1L0OA 2YK2A 2YEIA 1AMWA 5CPHA 4FCPA 1NHHA 2YJWA 1YETA 2YGAA 3CGYA 2HKJA 4YKXA 5FNCA 1UYDA 2WERA 5L3JA 3TZ2A 2EXLA 4U93A 1Y4UA 2Q8HA 3GIGB 4FCRA 4E00A 2YE8A 4UROA 4EGKA 1JM6A 3R91A 1QZRA 4LWEA 3HYYA 5F5RA 1Y8OA 5C93A 2XX4A 4BQGA 1YT0A 2BU2A 2Q2EB 4PRXA 3K60A 5D7CA 1ZXNA 2CCUA 3HHUA 1Y4SA 1GJVA 5FNFA 2XK2A 1GKXA 4CE1A 3OWBA 2XDSA 4HYPA 4LWIA 3WHAA 2FTKA 4YKQA 2IWUA 1TH8A 4ASBA 4P7AA 4H81A 1BGQA 2IORA 3O2FA 3T2SA 3CGZA 4XCJA 2CCTA 3ZXQA 3G7EA 2WI1A 4LWHA 1U0ZA 2YGEA 3R4OA 2Q8IA 1TIDA 2IOPA 2WI3A 2IWSA 2Q8FA 2XDKA 3OW6A 1BKNA 5D6QA 2BU8A 4EFTA 4WUBA 1YSRA 2H8MA 4U7NA 3EKRA 5IDMA 1OSFA 2YEDA 3VHAA 3D2RA 4H7QA 2Q8GA 3LMMA 4ASGA 4ZVIA 2BREA 5CTXA 4MBCA 4JQLA 3B24A 3K97A 2FYPA 1YT1A 3A0TA 2YEEA 4EGIA 2YJXA 4PL9A 3CWVA 2HHIA 3OPDA 4V26A 2YKEA 2WI5A 1KIJA 1H7SA 4XITA 3BMYA 2WI6A 2YKBA 1UYGA 4HY1A 1Y8PA 4U7OA 2YI5A 3FT8A 3CRLA 4YKWA 3K99A 4ASFA 2XHRA 2QFOA 1I5AA 4XKKA 5M4HA 2FXSA 4I3HA 2WI2A 2XCMA 1Z5CA 3GIGA 4FCQA 3QTFA 1MX0A 2XX2A 2YEGA 3B27A 1BXDA 2XJXA 1UYMA 3HZ1A 4YKRA 1UY9A 3EHHA 5F3KA 2YE6A 1UY8A 1YC4A 4CWQA 2BU5A 4WUCA 4PU9A 1B62A 4O0BA 4Q20A 2IWXA 1UYLA 5M4PA 3TZ0A 4BAEA 4CWFA 3BM9A 3OWDA 3VHDA 3FT5A 4MPEA 4EFUA 1UYIA 2BYHA 1UYFA 4QPJA 2C1GA 1F51A 3GIEA 3RLRA 2CH4A 4YKZA 2C2AA 2ZDYA 1NHJA 2XDUA 1B63A 1QYEA 4CWRA 4DUHA 5J6AA 1ZWHA 4CE2A 3SL2A 2XABA 1THNA 4YKUA 2XDLA 3HZ5A 2UWDA 4BIZA 4X9LA 3B26A 1US7A 2YEBA 1UYKA 3R92A 4CWTA 5CTYA 1IXMA 1KZNA 3DGEA 4XDMA 4L94A 4YKYA 3D36A 4L91A 1UYCA 1QY8A 4V25A 4BQJA 1MU5A 3Q5KA 3RKZA 2CCSA 3QDDA 4GGLA 4JAUA 4XD8A 4KP4A 5D6PA 2YE7A 4XKOA 3JZ3A 3U67A 4MP7A 4CE3A 3A0ZA 3EHJA 3PEHA 4MOTA 3O0IA 3HYZA 1ZW9A 5BOCA 2GFDA 2PNRA 4MPNA 3A0RA 1AH8A 3TTZA 3ZM7A 4PRVA 5D7RA 5D7DA 2O1UA 4DZYA 1AJ6A 4GEEA 2YE5A 4GT8A 2VCJA 2WEPA 1YSZA 1I59A 4AWPA 5FWKA 1I58A 3R4NA 4R3MA 4AWQA 5GGZA 2O1WA 2YGFA 3T0ZA 4CWNA 2VWCA 4JAVA 4AS9A 2WI4A 3D0BA 2YKJA 2BZ5A 4LPBA 5J71A 3B25A 4NH9A 2ZDXA 4ASAA 2C1IA 4LWGA 1UY7A 4GFNA 3EHGA 4I5SA 2QF6A 4HXZA 4O07A 4B6CA 5IN9A 1NHIA 2JKIA 4HY6A 2YE9A 2YK9A 4HZ5A 3RLQA 3KE6A 3TZ5A 4CWSA 1EI1A 4AWOA 3R4PA 2FWZA 1YT2A 2XJGA 2XDXA 4WUDA 4KSGA 1R62A 4HYMA 1H7UA 1TC6A 1AM1A 1I5CA 2GQPA 2YKIA 3A0XA 4BXIA 5CF0A 3ZXOA 2QG0A 2VW5A 4L93A 5JENA 1UYEA 2BT0A 2XHTA 4XIQA 3Q5LA 2BU7A 1AH6A 1Z5BA 2IOQA 2YEFA 3MNRP 1YC1A 3ZKBA 3T10A 3Q5JA 4FMTA 3NMQA 3S5TA 4E01A 1BYQA 2YKCA 1Z59A 3ZKDA 4CWPA 2CGFA 1Z5AA
chains in the Genus database with same CATH topology
1UYHA 2ESAA 4EEHA 1I5BA 3H80A 3INWA 4URLA 4MP2A 3U2DA 4KFGA 1YS3A 2WI7A 2BRCA 4BIUA 4L8ZA 3HEKA 1EA6A 2YECA 3T0HA 4R1FA 2YEAA 4URNA 1TC0A 1TILA 3PEJA 2XJJA 4E02A 1Y8NA 4NH7A 5M4NA 4KQVA 1B3QA 4K4OA 3B28A 4XC0A 3C0EA 3K98A 4MPCA 4LP0A 1S14A 4URMA 1ID0A 4XTJA 3G7BA 3TZ4A 4QPKA 3A0WA 3T1KA 1U2OA 1UY6A 4EMVA 2BSMA 2O1VA 3CRKA 4L90A 3C11A 2YI6A 4EGHA 3INXA 3IEDA 4MB9A 2FWYA 2XX5A 3VHCA 3LNUA 3WQ9A 3H4LA 3OMUA 2YE3A 2QG2A 1GKZA 5M4EA 1A4HA 2WEQA 2E0AA 1ZXMA 2AKPA 4HZ0A 3LPSA 4O09A 4B7PA 2HG1A 5M4MA 5CTWA 4W7TA 3G75A 2XD6A 2ZBKB 4ZKIA 4EM7A 5BODA 1YERA 3A0YA 5IDJA 2ZKJA 2JJCA 1I5DA 2BYIA 1YESA 2H55A 3EHFA 4HXWA 2YE4A 2YEJA 4NH8A 4YKTA 2YI7A 4R3AA 2YE2A 3RLPA 1TBWA 3TUHA 4GCZA 4XKAA 3GIFA 2YEHA 4JASA 3U2KA 4P8OA 2BU6A 5M4KA 5CTUA 4GQTA 4KTNA 4CWOA 4FPPA 3R4MA 4O04A 4O05A 2CG9A 4XIPA 2VCIA 3VADA 1PVGA 2BTZA 2XHXA 1YC3A 4KSHA 4LWFA 3EKOA 4H85A 3O6OA 2K5BA 4XE2A 3FV5A 1S16A 4XIRA 4XCLA 5FNDA 2YI0A 2HCHA 1L0OA 2YK2A 2YEIA 1AMWA 5CPHA 4FCPA 1NHHA 2YJWA 1YETA 2YGAA 3CGYA 2HKJA 4YKXA 5FNCA 1UYDA 2WERA 5L3JA 3TZ2A 2EXLA 4U93A 1Y4UA 2Q8HA 3GIGB 4FCRA 4E00A 2YE8A 4UROA 4EGKA 1JM6A 3R91A 1QZRA 4LWEA 3HYYA 5F5RA 1Y8OA 5C93A 2XX4A 4BQGA 1YT0A 2BU2A 2Q2EB 4PRXA 3K60A 5D7CA 1ZXNA 2CCUA 3HHUA 1Y4SA 1GJVA 5FNFA 2XK2A 1GKXA 4CE1A 3OWBA 2XDSA 4HYPA 4LWIA 3WHAA 4YKQA 2IWUA 1TH8A 4ASBA 4P7AA 4H81A 1BGQA 2IORA 3O2FA 3T2SA 3CGZA 4XCJA 2CCTA 3ZXQA 3G7EA 2WI1A 4LWHA 1U0ZA 2YGEA 3R4OA 2Q8IA 1TIDA 2IOPA 2WI3A 2IWSA 2Q8FA 2XDKA 3OW6A 1BKNA 5D6QA 2BU8A 4EFTA 4WUBA 1YSRA 2H8MA 4U7NA 3EKRA 5IDMA 1OSFA 2YEDA 3VHAA 3D2RA 4H7QA 2Q8GA 4ASGA 4ZVIA 2BREA 5CTXA 4MBCA 4JQLA 3B24A 3K97A 2FYPA 1YT1A 3A0TA 2YEEA 4EGIA 2YJXA 4PL9A 3CWVA 3OPDA 4V26A 2YKEA 2WI5A 1KIJA 1H7SA 4XITA 3BMYA 2WI6A 2YKBA 1UYGA 4HY1A 1Y8PA 4U7OA 2YI5A 3FT8A 3CRLA 4YKWA 3K99A 4ASFA 2XHRA 2QFOA 1I5AA 4XKKA 5M4HA 2FXSA 4I3HA 2WI2A 2XCMA 1Z5CA 3GIGA 4FCQA 3QTFA 1MX0A 2XX2A 2YEGA 3B27A 1BXDA 2XJXA 1UYMA 3HZ1A 4YKRA 1UY9A 3EHHA 5F3KA 2YE6A 1UY8A 1YC4A 4CWQA 2BU5A 4WUCA 4PU9A 1B62A 4O0BA 4Q20A 2IWXA 1UYLA 5M4PA 3TZ0A 4BAEA 4CWFA 3BM9A 3OWDA 3VHDA 3FT5A 4MPEA 4EFUA 1UYIA 2BYHA 1UYFA 4QPJA 3GIEA 3RLRA 2CH4A 4YKZA 2C2AA 2ZDYA 1NHJA 2XDUA 1B63A 1QYEA 4CWRA 4DUHA 5J6AA 1ZWHA 4CE2A 3SL2A 2XABA 1THNA 4YKUA 2XDLA 3HZ5A 2UWDA 4BIZA 4X9LA 3B26A 1US7A 2YEBA 1UYKA 3R92A 4CWTA 5CTYA 1KZNA 3DGEA 4XDMA 4L94A 4YKYA 3D36A 4L91A 1UYCA 1QY8A 4V25A 4BQJA 1MU5A 3Q5KA 3RKZA 2CCSA 3QDDA 4GGLA 4JAUA 4XD8A 4KP4A 5D6PA 2YE7A 4XKOA 3JZ3A 3U67A 4MP7A 4CE3A 3A0ZA 3EHJA 3PEHA 4MOTA 3O0IA 3HYZA 1ZW9A 5BOCA 2GFDA 2PNRA 4MPNA 3A0RA 1AH8A 3TTZA 3ZM7A 4PRVA 5D7RA 5D7DA 2O1UA 4DZYA 1AJ6A 4GEEA 2YE5A 4GT8A 2VCJA 2WEPA 1YSZA 1I59A 4AWPA 5FWKA 1I58A 3R4NA 4R3MA 4AWQA 5GGZA 2O1WA 2YGFA 3T0ZA 4CWNA 2VWCA 4JAVA 4AS9A 2WI4A 3D0BA 2YKJA 2BZ5A 4LPBA 5J71A 3B25A 4NH9A 2ZDXA 4ASAA 4LWGA 1UY7A 4GFNA 3EHGA 4I5SA 2QF6A 4HXZA 4O07A 4B6CA 5IN9A 1NHIA 2JKIA 4HY6A 2YE9A 2YK9A 4HZ5A 3RLQA 3KE6A 3TZ5A 4CWSA 1EI1A 4AWOA 3R4PA 2FWZA 1YT2A 2XJGA 2XDXA 4WUDA 4KSGA 1R62A 4HYMA 1H7UA 1TC6A 1AM1A 1I5CA 2GQPA 2YKIA 3A0XA 4BXIA 5CF0A 3ZXOA 2QG0A 2VW5A 4L93A 1UYEA 2BT0A 2XHTA 4XIQA 3Q5LA 2BU7A 1AH6A 1Z5BA 2IOQA 2YEFA 3MNRP 1YC1A 3ZKBA 3T10A 3Q5JA 4FMTA 3NMQA 4E01A 1BYQA 2YKCA 1Z59A 3ZKDA 4CWPA 2CGFA 1Z5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UYH A;  2ESA A;  4EEH A;  1I5B A;  3H80 A;  3INW A;  4URL A;  4MP2 A;  3U2D A;  4KFG A;  1YS3 A;  2WI7 A;  2BRC A;  4BIU A;  4L8Z A;  3HEK A;  1EA6 A;  2YEC A;  3T0H A;  4R1F A;  2YEA A;  4URN A;  1TC0 A;  1TIL A;  3PEJ A;  2XJJ A;  4E02 A;  1Y8N A;  4NH7 A;  5M4N A;  4KQV A;  1B3Q A;  4K4O A;  3B28 A;  4XC0 A;  3C0E A;  3K98 A;  4MPC A;  4LP0 A;  1S14 A;  4URM A;  1ID0 A;  4XTJ A;  3G7B A;  3TZ4 A;  4QPK A;  3A0W A;  3T1K A;  1U2O A;  1UY6 A;  4EMV A;  2BSM A;  2O1V A;  3CRK A;  4L90 A;  3C11 A;  2YI6 A;  4EGH A;  3INX A;  3IED A;  4MB9 A;  2FWY A;  2XX5 A;  3VHC A;  3LNU A;  3WQ9 A;  3H4L A;  3OMU A;  2YE3 A;  2QG2 A;  1GKZ A;  5M4E A;  1A4H A;  2WEQ A;  2E0A A;  1ZXM A;  2AKP A;  4HZ0 A;  3LPS A;  4O09 A;  4B7P A;  2HG1 A;  5M4M A;  5CTW A;  4W7T A;  3G75 A;  2XD6 A;  2ZBK B;  4ZKI A;  4EM7 A;  5BOD A;  1YER A;  3A0Y A;  5IDJ A;  2ZKJ A;  2JJC A;  1I5D A;  2BYI A;  1YES A;  2H55 A;  3EHF A;  4HXW A;  2YE4 A;  2YEJ A;  4NH8 A;  4YKT A;  2YI7 A;  4R3A A;  2YE2 A;  3RLP A;  1TBW A;  3TUH A;  4GCZ A;  4XKA A;  3GIF A;  2YEH A;  4JAS A;  3U2K A;  4P8O A;  2BU6 A;  5M4K A;  5CTU A;  4GQT A;  4KTN A;  4CWO A;  4FPP A;  3R4M A;  4O04 A;  4O05 A;  2CG9 A;  4XIP A;  2VCI A;  3VAD A;  1PVG A;  2BTZ A;  2XHX A;  1YC3 A;  4KSH A;  4LWF A;  3EKO A;  4H85 A;  3O6O A;  2K5B A;  4XE2 A;  3FV5 A;  1S16 A;  4XIR A;  4XCL A;  5FND A;  2YI0 A;  2HCH A;  1L0O A;  2YK2 A;  2YEI A;  1AMW A;  5CPH A;  4FCP A;  1NHH A;  2YJW A;  1YET A;  2YGA A;  3CGY A;  2HKJ A;  4YKX A;  5FNC A;  1UYD A;  2WER A;  5L3J A;  3TZ2 A;  2EXL A;  4U93 A;  1Y4U A;  2Q8H A;  3GIG B;  4FCR A;  4E00 A;  2YE8 A;  4URO A;  4EGK A;  1JM6 A;  3R91 A;  1QZR A;  4LWE A;  3HYY A;  5F5R A;  1Y8O A;  5C93 A;  2XX4 A;  4BQG A;  1YT0 A;  2BU2 A;  2Q2E B;  4PRX A;  3K60 A;  5D7C A;  1ZXN A;  2CCU A;  3HHU A;  1Y4S A;  1GJV A;  5FNF A;  2XK2 A;  1GKX A;  4CE1 A;  3OWB A;  2XDS A;  4HYP A;  4LWI A;  3WHA A;  4YKQ A;  2IWU A;  1TH8 A;  4ASB A;  4P7A A;  4H81 A;  1BGQ A;  2IOR A;  3O2F A;  3T2S A;  3CGZ A;  4XCJ A;  2CCT A;  3ZXQ A;  3G7E A;  2WI1 A;  4LWH A;  1U0Z A;  2YGE A;  3R4O A;  2Q8I A;  1TID A;  2IOP A;  2WI3 A;  2IWS A;  2Q8F A;  2XDK A;  3OW6 A;  1BKN A;  5D6Q A;  2BU8 A;  4EFT A;  4WUB A;  1YSR A;  2H8M A;  4U7N A;  3EKR A;  5IDM A;  1OSF A;  2YED A;  3VHA A;  3D2R A;  4H7Q A;  2Q8G A;  4ASG A;  4ZVI A;  2BRE A;  5CTX A;  4MBC A;  4JQL A;  3B24 A;  3K97 A;  2FYP A;  1YT1 A;  3A0T A;  2YEE A;  4EGI A;  2YJX A;  4PL9 A;  3CWV A;  3OPD A;  4V26 A;  2YKE A;  2WI5 A;  1KIJ A;  1H7S A;  4XIT A;  3BMY A;  2WI6 A;  2YKB A;  1UYG A;  4HY1 A;  1Y8P A;  4U7O A;  2YI5 A;  3FT8 A;  3CRL A;  4YKW A;  3K99 A;  4ASF A;  2XHR A;  2QFO A;  1I5A A;  4XKK A;  5M4H A;  2FXS A;  4I3H A;  2WI2 A;  2XCM A;  1Z5C A;  3GIG A;  4FCQ A;  3QTF A;  1MX0 A;  2XX2 A;  2YEG A;  3B27 A;  1BXD A;  2XJX A;  1UYM A;  3HZ1 A;  4YKR A;  1UY9 A;  3EHH A;  5F3K A;  2YE6 A;  1UY8 A;  1YC4 A;  4CWQ A;  2BU5 A;  4WUC A;  4PU9 A;  1B62 A;  4O0B A;  4Q20 A;  2IWX A;  1UYL A;  5M4P A;  3TZ0 A;  4BAE A;  4CWF A;  3BM9 A;  3OWD A;  3VHD A;  3FT5 A;  4MPE A;  4EFU A;  1UYI A;  2BYH A;  1UYF A;  4QPJ A;  3GIE A;  3RLR A;  2CH4 A;  4YKZ A;  2C2A A;  2ZDY A;  1NHJ A;  2XDU A;  1B63 A;  1QYE A;  4CWR A;  4DUH A;  5J6A A;  1ZWH A;  4CE2 A;  3SL2 A;  2XAB A;  1THN A;  4YKU A;  2XDL A;  3HZ5 A;  2UWD A;  4BIZ A;  4X9L A;  3B26 A;  1US7 A;  2YEB A;  1UYK A;  3R92 A;  4CWT A;  5CTY A;  1KZN A;  3DGE A;  4XDM A;  4L94 A;  4YKY A;  3D36 A;  4L91 A;  1UYC A;  1QY8 A;  4V25 A;  4BQJ A;  1MU5 A;  3Q5K A;  3RKZ A;  2CCS A;  3QDD A;  4GGL A;  4JAU A;  4XD8 A;  4KP4 A;  5D6P A;  2YE7 A;  4XKO A;  3JZ3 A;  3U67 A;  4MP7 A;  4CE3 A;  3A0Z A;  3EHJ A;  3PEH A;  4MOT A;  3O0I A;  3HYZ A;  1ZW9 A;  5BOC A;  2GFD A;  2PNR A;  4MPN A;  3A0R A;  1AH8 A;  3TTZ A;  3ZM7 A;  4PRV A;  5D7R A;  5D7D A;  2O1U A;  4DZY A;  1AJ6 A;  4GEE A;  2YE5 A;  4GT8 A;  2VCJ A;  2WEP A;  1YSZ A;  1I59 A;  4AWP A;  5FWK A;  1I58 A;  3R4N A;  4R3M A;  4AWQ A;  5GGZ A;  2O1W A;  2YGF A;  3T0Z A;  4CWN A;  2VWC A;  4JAV A;  4AS9 A;  2WI4 A;  3D0B A;  2YKJ A;  2BZ5 A;  4LPB A;  5J71 A;  3B25 A;  4NH9 A;  2ZDX A;  4ASA A;  4LWG A;  1UY7 A;  4GFN A;  3EHG A;  4I5S A;  2QF6 A;  4HXZ A;  4O07 A;  4B6C A;  5IN9 A;  1NHI A;  2JKI A;  4HY6 A;  2YE9 A;  2YK9 A;  4HZ5 A;  3RLQ A;  3KE6 A;  3TZ5 A;  4CWS A;  1EI1 A;  4AWO A;  3R4P A;  2FWZ A;  1YT2 A;  2XJG A;  2XDX A;  4WUD A;  4KSG A;  1R62 A;  4HYM A;  1H7U A;  1TC6 A;  1AM1 A;  1I5C A;  2GQP A;  2YKI A;  3A0X A;  4BXI A;  5CF0 A;  3ZXO A;  2QG0 A;  2VW5 A;  4L93 A;  1UYE A;  2BT0 A;  2XHT A;  4XIQ A;  3Q5L A;  2BU7 A;  1AH6 A;  1Z5B A;  2IOQ A;  2YEF A;  3MNR P;  1YC1 A;  3ZKB A;  3T10 A;  3Q5J A;  4FMT A;  3NMQ A;  4E01 A;  1BYQ A;  2YKC A;  1Z59 A;  3ZKD A;  4CWP A;  2CGF A;  1Z5A A; 
#chains in the Genus database with same CATH topology
 1UYH A;  2ESA A;  4EEH A;  1I5B A;  3H80 A;  3INW A;  4URL A;  4MP2 A;  3U2D A;  4KFG A;  1YS3 A;  2WI7 A;  4E72 A;  2BRC A;  4BIU A;  4L8Z A;  3HEK A;  1EA6 A;  2YEC A;  3T0H A;  4R1F A;  2YEA A;  4URN A;  1TC0 A;  1TIL A;  3PEJ A;  2XJJ A;  4E02 A;  1Y8N A;  4NH7 A;  5M4N A;  4KQV A;  1B3Q A;  4K4O A;  3B28 A;  4XC0 A;  3C0E A;  3K98 A;  4MPC A;  4LP0 A;  1S14 A;  4URM A;  1ID0 A;  4XTJ A;  3G7B A;  3TZ4 A;  4QPK A;  3A0W A;  3T1K A;  1U2O A;  1UY6 A;  4EMV A;  2BSM A;  2O1V A;  3CRK A;  4L90 A;  3C11 A;  2YI6 A;  4EGH A;  3INX A;  3IED A;  4MB9 A;  2FWY A;  2XX5 A;  3VHC A;  3LNU A;  3WQ9 A;  3H4L A;  3OMU A;  2YE3 A;  2QG2 A;  1GKZ A;  5M4E A;  1A4H A;  2WEQ A;  2E0A A;  1ZXM A;  2AKP A;  4HZ0 A;  3LPS A;  3CYG A;  4O09 A;  4B7P A;  2HG1 A;  5M4M A;  5CTW A;  4W7T A;  3G75 A;  2XD6 A;  2ZBK B;  4ZKI A;  4EM7 A;  5BOD A;  1YER A;  3A0Y A;  5IDJ A;  2ZKJ A;  2JJC A;  1I5D A;  2BYI A;  1YES A;  2H55 A;  3EHF A;  4HXW A;  2YE4 A;  2YEJ A;  4NH8 A;  4YKT A;  2YI7 A;  4R3A A;  2YE2 A;  3RLP A;  1TBW A;  3TUH A;  4GCZ A;  4XKA A;  3GIF A;  2YEH A;  4JAS A;  3U2K A;  4P8O A;  2BU6 A;  5M4K A;  5CTU A;  4GQT A;  4KTN A;  4CWO A;  4FPP A;  3R4M A;  4O04 A;  4O05 A;  2CG9 A;  4XIP A;  2VCI A;  3VAD A;  1PVG A;  2BTZ A;  2XHX A;  1YC3 A;  4KSH A;  4LWF A;  3EKO A;  4H85 A;  3O6O A;  2K5B A;  4XE2 A;  3FV5 A;  1S16 A;  4XIR A;  4XCL A;  5FND A;  2YI0 A;  2HCH A;  1L0O A;  2YK2 A;  2YEI A;  1AMW A;  5CPH A;  4FCP A;  1NHH A;  2YJW A;  1YET A;  2YGA A;  3CGY A;  2HKJ A;  4YKX A;  5FNC A;  1UYD A;  2WER A;  5L3J A;  3TZ2 A;  2EXL A;  4U93 A;  1Y4U A;  2Q8H A;  3GIG B;  4FCR A;  4E00 A;  2YE8 A;  4URO A;  4EGK A;  1JM6 A;  3R91 A;  1QZR A;  4LWE A;  3HYY A;  5F5R A;  1Y8O A;  5C93 A;  2XX4 A;  4BQG A;  1YT0 A;  2BU2 A;  2Q2E B;  4PRX A;  3K60 A;  5D7C A;  1ZXN A;  2CCU A;  3HHU A;  1Y4S A;  1GJV A;  5FNF A;  2XK2 A;  1GKX A;  4CE1 A;  3OWB A;  2XDS A;  4HYP A;  4LWI A;  3WHA A;  2FTK A;  4YKQ A;  2IWU A;  1TH8 A;  4ASB A;  4P7A A;  4H81 A;  1BGQ A;  2IOR A;  3O2F A;  3T2S A;  3CGZ A;  4XCJ A;  2CCT A;  3ZXQ A;  3G7E A;  2WI1 A;  4LWH A;  1U0Z A;  2YGE A;  3R4O A;  2Q8I A;  1TID A;  2IOP A;  2WI3 A;  2IWS A;  2Q8F A;  2XDK A;  3OW6 A;  1BKN A;  5D6Q A;  2BU8 A;  4EFT A;  4WUB A;  1YSR A;  2H8M A;  4U7N A;  3EKR A;  5IDM A;  1OSF A;  2YED A;  3VHA A;  3D2R A;  4H7Q A;  2Q8G A;  3LMM A;  4ASG A;  4ZVI A;  2BRE A;  5CTX A;  4MBC A;  4JQL A;  3B24 A;  3K97 A;  2FYP A;  1YT1 A;  3A0T A;  2YEE A;  4EGI A;  2YJX A;  4PL9 A;  3CWV A;  2HHI A;  3OPD A;  4V26 A;  2YKE A;  2WI5 A;  1KIJ A;  1H7S A;  4XIT A;  3BMY A;  2WI6 A;  2YKB A;  1UYG A;  4HY1 A;  1Y8P A;  4U7O A;  2YI5 A;  3FT8 A;  3CRL A;  4YKW A;  3K99 A;  4ASF A;  2XHR A;  2QFO A;  1I5A A;  4XKK A;  5M4H A;  2FXS A;  4I3H A;  2WI2 A;  2XCM A;  1Z5C A;  3GIG A;  4FCQ A;  3QTF A;  1MX0 A;  2XX2 A;  2YEG A;  3B27 A;  1BXD A;  2XJX A;  1UYM A;  3HZ1 A;  4YKR A;  1UY9 A;  3EHH A;  5F3K A;  2YE6 A;  1UY8 A;  1YC4 A;  4CWQ A;  2BU5 A;  4WUC A;  4PU9 A;  1B62 A;  4O0B A;  4Q20 A;  2IWX A;  1UYL A;  5M4P A;  3TZ0 A;  4BAE A;  4CWF A;  3BM9 A;  3OWD A;  3VHD A;  3FT5 A;  4MPE A;  4EFU A;  1UYI A;  2BYH A;  1UYF A;  4QPJ A;  2C1G A;  1F51 A;  3GIE A;  3RLR A;  2CH4 A;  4YKZ A;  2C2A A;  2ZDY A;  1NHJ A;  2XDU A;  1B63 A;  1QYE A;  4CWR A;  4DUH A;  5J6A A;  1ZWH A;  4CE2 A;  3SL2 A;  2XAB A;  1THN A;  4YKU A;  2XDL A;  3HZ5 A;  2UWD A;  4BIZ A;  4X9L A;  3B26 A;  1US7 A;  2YEB A;  1UYK A;  3R92 A;  4CWT A;  5CTY A;  1IXM A;  1KZN A;  3DGE A;  4XDM A;  4L94 A;  4YKY A;  3D36 A;  4L91 A;  1UYC A;  1QY8 A;  4V25 A;  4BQJ A;  1MU5 A;  3Q5K A;  3RKZ A;  2CCS A;  3QDD A;  4GGL A;  4JAU A;  4XD8 A;  4KP4 A;  5D6P A;  2YE7 A;  4XKO A;  3JZ3 A;  3U67 A;  4MP7 A;  4CE3 A;  3A0Z A;  3EHJ A;  3PEH A;  4MOT A;  3O0I A;  3HYZ A;  1ZW9 A;  5BOC A;  2GFD A;  2PNR A;  4MPN A;  3A0R A;  1AH8 A;  3TTZ A;  3ZM7 A;  4PRV A;  5D7R A;  5D7D A;  2O1U A;  4DZY A;  1AJ6 A;  4GEE A;  2YE5 A;  4GT8 A;  2VCJ A;  2WEP A;  1YSZ A;  1I59 A;  4AWP A;  5FWK A;  1I58 A;  3R4N A;  4R3M A;  4AWQ A;  5GGZ A;  2O1W A;  2YGF A;  3T0Z A;  4CWN A;  2VWC A;  4JAV A;  4AS9 A;  2WI4 A;  3D0B A;  2YKJ A;  2BZ5 A;  4LPB A;  5J71 A;  3B25 A;  4NH9 A;  2ZDX A;  4ASA A;  2C1I A;  4LWG A;  1UY7 A;  4GFN A;  3EHG A;  4I5S A;  2QF6 A;  4HXZ A;  4O07 A;  4B6C A;  5IN9 A;  1NHI A;  2JKI A;  4HY6 A;  2YE9 A;  2YK9 A;  4HZ5 A;  3RLQ A;  3KE6 A;  3TZ5 A;  4CWS A;  1EI1 A;  4AWO A;  3R4P A;  2FWZ A;  1YT2 A;  2XJG A;  2XDX A;  4WUD A;  4KSG A;  1R62 A;  4HYM A;  1H7U A;  1TC6 A;  1AM1 A;  1I5C A;  2GQP A;  2YKI A;  3A0X A;  4BXI A;  5CF0 A;  3ZXO A;  2QG0 A;  2VW5 A;  4L93 A;  5JEN A;  1UYE A;  2BT0 A;  2XHT A;  4XIQ A;  3Q5L A;  2BU7 A;  1AH6 A;  1Z5B A;  2IOQ A;  2YEF A;  3MNR P;  1YC1 A;  3ZKB A;  3T10 A;  3Q5J A;  4FMT A;  3NMQ A;  3S5T A;  4E01 A;  1BYQ A;  2YKC A;  1Z59 A;  3ZKD A;  4CWP A;  2CGF A;  1Z5A A; 
#chains in the Genus database with same CATH homology
 1UYH A;  2ESA A;  4EEH A;  1I5B A;  3H80 A;  3INW A;  4URL A;  4MP2 A;  3U2D A;  4KFG A;  1YS3 A;  2WI7 A;  2BRC A;  4BIU A;  4L8Z A;  3HEK A;  1EA6 A;  2YEC A;  3T0H A;  4R1F A;  2YEA A;  4URN A;  1TC0 A;  1TIL A;  3PEJ A;  2XJJ A;  4E02 A;  1Y8N A;  4NH7 A;  5M4N A;  4KQV A;  1B3Q A;  4K4O A;  3B28 A;  4XC0 A;  3C0E A;  3K98 A;  4MPC A;  4LP0 A;  1S14 A;  4URM A;  1ID0 A;  4XTJ A;  3G7B A;  3TZ4 A;  4QPK A;  3A0W A;  3T1K A;  1U2O A;  1UY6 A;  4EMV A;  2BSM A;  2O1V A;  3CRK A;  4L90 A;  3C11 A;  2YI6 A;  4EGH A;  3INX A;  3IED A;  4MB9 A;  2FWY A;  2XX5 A;  3VHC A;  3LNU A;  3WQ9 A;  3H4L A;  3OMU A;  2YE3 A;  2QG2 A;  1GKZ A;  5M4E A;  1A4H A;  2WEQ A;  2E0A A;  1ZXM A;  2AKP A;  4HZ0 A;  3LPS A;  4O09 A;  4B7P A;  2HG1 A;  5M4M A;  5CTW A;  4W7T A;  3G75 A;  2XD6 A;  2ZBK B;  4ZKI A;  4EM7 A;  5BOD A;  1YER A;  3A0Y A;  5IDJ A;  2ZKJ A;  2JJC A;  1I5D A;  2BYI A;  1YES A;  2H55 A;  3EHF A;  4HXW A;  2YE4 A;  2YEJ A;  4NH8 A;  4YKT A;  2YI7 A;  4R3A A;  2YE2 A;  3RLP A;  1TBW A;  3TUH A;  4GCZ A;  4XKA A;  3GIF A;  2YEH A;  4JAS A;  3U2K A;  4P8O A;  2BU6 A;  5M4K A;  5CTU A;  4GQT A;  4KTN A;  4CWO A;  4FPP A;  3R4M A;  4O04 A;  4O05 A;  2CG9 A;  4XIP A;  2VCI A;  3VAD A;  1PVG A;  2BTZ A;  2XHX A;  1YC3 A;  4KSH A;  4LWF A;  3EKO A;  4H85 A;  3O6O A;  2K5B A;  4XE2 A;  3FV5 A;  1S16 A;  4XIR A;  4XCL A;  5FND A;  2YI0 A;  2HCH A;  1L0O A;  2YK2 A;  2YEI A;  1AMW A;  5CPH A;  4FCP A;  1NHH A;  2YJW A;  1YET A;  2YGA A;  3CGY A;  2HKJ A;  4YKX A;  5FNC A;  1UYD A;  2WER A;  5L3J A;  3TZ2 A;  2EXL A;  4U93 A;  1Y4U A;  2Q8H A;  3GIG B;  4FCR A;  4E00 A;  2YE8 A;  4URO A;  4EGK A;  1JM6 A;  3R91 A;  1QZR A;  4LWE A;  3HYY A;  5F5R A;  1Y8O A;  5C93 A;  2XX4 A;  4BQG A;  1YT0 A;  2BU2 A;  2Q2E B;  4PRX A;  3K60 A;  5D7C A;  1ZXN A;  2CCU A;  3HHU A;  1Y4S A;  1GJV A;  5FNF A;  2XK2 A;  1GKX A;  4CE1 A;  3OWB A;  2XDS A;  4HYP A;  4LWI A;  3WHA A;  4YKQ A;  2IWU A;  1TH8 A;  4ASB A;  4P7A A;  4H81 A;  1BGQ A;  2IOR A;  3O2F A;  3T2S A;  3CGZ A;  4XCJ A;  2CCT A;  3ZXQ A;  3G7E A;  2WI1 A;  4LWH A;  1U0Z A;  2YGE A;  3R4O A;  2Q8I A;  1TID A;  2IOP A;  2WI3 A;  2IWS A;  2Q8F A;  2XDK A;  3OW6 A;  1BKN A;  5D6Q A;  2BU8 A;  4EFT A;  4WUB A;  1YSR A;  2H8M A;  4U7N A;  3EKR A;  5IDM A;  1OSF A;  2YED A;  3VHA A;  3D2R A;  4H7Q A;  2Q8G A;  4ASG A;  4ZVI A;  2BRE A;  5CTX A;  4MBC A;  4JQL A;  3B24 A;  3K97 A;  2FYP A;  1YT1 A;  3A0T A;  2YEE A;  4EGI A;  2YJX A;  4PL9 A;  3CWV A;  3OPD A;  4V26 A;  2YKE A;  2WI5 A;  1KIJ A;  1H7S A;  4XIT A;  3BMY A;  2WI6 A;  2YKB A;  1UYG A;  4HY1 A;  1Y8P A;  4U7O A;  2YI5 A;  3FT8 A;  3CRL A;  4YKW A;  3K99 A;  4ASF A;  2XHR A;  2QFO A;  1I5A A;  4XKK A;  5M4H A;  2FXS A;  4I3H A;  2WI2 A;  2XCM A;  1Z5C A;  3GIG A;  4FCQ A;  3QTF A;  1MX0 A;  2XX2 A;  2YEG A;  3B27 A;  1BXD A;  2XJX A;  1UYM A;  3HZ1 A;  4YKR A;  1UY9 A;  3EHH A;  5F3K A;  2YE6 A;  1UY8 A;  1YC4 A;  4CWQ A;  2BU5 A;  4WUC A;  4PU9 A;  1B62 A;  4O0B A;  4Q20 A;  2IWX A;  1UYL A;  5M4P A;  3TZ0 A;  4BAE A;  4CWF A;  3BM9 A;  3OWD A;  3VHD A;  3FT5 A;  4MPE A;  4EFU A;  1UYI A;  2BYH A;  1UYF A;  4QPJ A;  3GIE A;  3RLR A;  2CH4 A;  4YKZ A;  2C2A A;  2ZDY A;  1NHJ A;  2XDU A;  1B63 A;  1QYE A;  4CWR A;  4DUH A;  5J6A A;  1ZWH A;  4CE2 A;  3SL2 A;  2XAB A;  1THN A;  4YKU A;  2XDL A;  3HZ5 A;  2UWD A;  4BIZ A;  4X9L A;  3B26 A;  1US7 A;  2YEB A;  1UYK A;  3R92 A;  4CWT A;  5CTY A;  1KZN A;  3DGE A;  4XDM A;  4L94 A;  4YKY A;  3D36 A;  4L91 A;  1UYC A;  1QY8 A;  4V25 A;  4BQJ A;  1MU5 A;  3Q5K A;  3RKZ A;  2CCS A;  3QDD A;  4GGL A;  4JAU A;  4XD8 A;  4KP4 A;  5D6P A;  2YE7 A;  4XKO A;  3JZ3 A;  3U67 A;  4MP7 A;  4CE3 A;  3A0Z A;  3EHJ A;  3PEH A;  4MOT A;  3O0I A;  3HYZ A;  1ZW9 A;  5BOC A;  2GFD A;  2PNR A;  4MPN A;  3A0R A;  1AH8 A;  3TTZ A;  3ZM7 A;  4PRV A;  5D7R A;  5D7D A;  2O1U A;  4DZY A;  1AJ6 A;  4GEE A;  2YE5 A;  4GT8 A;  2VCJ A;  2WEP A;  1YSZ A;  1I59 A;  4AWP A;  5FWK A;  1I58 A;  3R4N A;  4R3M A;  4AWQ A;  5GGZ A;  2O1W A;  2YGF A;  3T0Z A;  4CWN A;  2VWC A;  4JAV A;  4AS9 A;  2WI4 A;  3D0B A;  2YKJ A;  2BZ5 A;  4LPB A;  5J71 A;  3B25 A;  4NH9 A;  2ZDX A;  4ASA A;  4LWG A;  1UY7 A;  4GFN A;  3EHG A;  4I5S A;  2QF6 A;  4HXZ A;  4O07 A;  4B6C A;  5IN9 A;  1NHI A;  2JKI A;  4HY6 A;  2YE9 A;  2YK9 A;  4HZ5 A;  3RLQ A;  3KE6 A;  3TZ5 A;  4CWS A;  1EI1 A;  4AWO A;  3R4P A;  2FWZ A;  1YT2 A;  2XJG A;  2XDX A;  4WUD A;  4KSG A;  1R62 A;  4HYM A;  1H7U A;  1TC6 A;  1AM1 A;  1I5C A;  2GQP A;  2YKI A;  3A0X A;  4BXI A;  5CF0 A;  3ZXO A;  2QG0 A;  2VW5 A;  4L93 A;  1UYE A;  2BT0 A;  2XHT A;  4XIQ A;  3Q5L A;  2BU7 A;  1AH6 A;  1Z5B A;  2IOQ A;  2YEF A;  3MNR P;  1YC1 A;  3ZKB A;  3T10 A;  3Q5J A;  4FMT A;  3NMQ A;  4E01 A;  1BYQ A;  2YKC A;  1Z59 A;  3ZKD A;  4CWP A;  2CGF A;  1Z5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...