1BXDA

Nmr structure of the histidine kinase domain of the e. coli osmosensor envz
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
161
structure length
161
Chain Sequence
TGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
publication title NMR structure of the histidine kinase domain of the E. coli osmosensor EnvZ.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Transferase
total genus 25
structure length 161
sequence length 161
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1998-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1bxdA00
1I5AA 2WEPA 2CCSA 4XE2A 3CGZA 2YEEA 4DUHA 5M4HA 1UY7A 1B62A 4GFNA 1TBWA 3EHFA 3C0EA 5M4EA 4JQLA 3T0ZA 2YEIA 1AH6A 4LWIA 3ZXQA 4XD8A 4Q20A 1MX0A 3IEDA 3D0BA 3EKRA 3LPSA 5M4MA 1TILA 4GCZA 3VHCA 2WI3A 4NH8A 3A0XA 4XCLA 3HZ5A 1UYLA 1MU5A 5IDMA 4XIQA 2BU2A 3Q5LA 3A0RA 5CPHA 4JASA 5D7CA 3CRKA 5CF0A 1YSRA 1UYCA 4ASGA 3GIGB 4MP2A 4UROA 2YEBA 4ZKIA 3B24A 3U2DA 3EKOA 4QPJA 3RLPA 2IORA 2IOPA 3OMUA 4WUCA 2CH4A 2XJGA 1QZRA 4XKOA 5M4PA 4MBCA 3G7BA 2BRCA 3EHJA 2XX5A 2IWXA 2BU6A 2YEHA 2WI4A 4B7PA 2YECA 4CWOA 1ZW9A 2ESAA 5CTYA 1S14A 1TIDA 3R4OA 4CWNA 4AS9A 4HZ0A 2IWSA 1Y8NA 4P8OA 3R4PA 2YEAA 4X9LA 4HYMA 4XC0A 2VCIA 2O1VA 1TH8A 4JAUA 2XJXA 1YT2A 4FCPA 2PNRA 2AKPA 3G75A 2CG9A 4I3HA 3B25A 4YKUA 4U7NA 3HYYA 3CRLA 1KZNA 2YGAA 4MPCA 2YKCA 4DZYA 4LPBA 4EFUA 1NHIA 2IOQA 2GQPA 2BU5A 1BXDA 4BXIA 4HY1A 4B6CA 2YEDA 1AM1A 4L94A 2YKIA 4O09A 3OWDA 4MOTA 3K97A 3H80A 3HYZA 5BOCA 4CWPA 2H55A 1UYGA 3EHHA 5L3JA 2K5BA 4CE3A 4O0BA 5CTXA 3BMYA 1YESA 2Q8FA 4HYPA 2Q8IA 5BODA 1UYKA 1NHHA 3QDDA 1H7UA 1YSZA 2ZKJA 2WERA 4XCJA 4KQVA 1Z59A 3B27A 4CWSA 2WI6A 2ZBKB 1US7A 1ZXMA 5J71A 4HXWA 4L90A 1I5CA 1H7SA 3WQ9A 2BT0A 1UYMA 2WEQA 2ZDYA 4BIZA 4L91A 5D6QA 3D36A 3FT8A 3QTFA 2YE4A 4URLA 2YGFA 2WI5A 4H85A 4FCQA 3T10A 2YE7A 4NH9A 3EHGA 1QY8A 4EGHA 2XK2A 3ZKDA 4R3AA 4R1FA 4BAEA 3R4NA 1A4HA 4LWHA 1YS3A 3GIFA 2XX2A 4JAVA 3H4LA 1YT1A 2VCJA 2CGFA 4YKZA 5M4NA 2VWCA 2ZDXA 3LNUA 3TTZA 2GFDA 3GIEA 4MP7A 2YE8A 3RLRA 5FNCA 3TZ0A 3ZKBA 3TZ2A 3CGYA 4CE1A 4XKAA 2YEJA 1YC4A 2Q8GA 1U0ZA 5F3KA 1BYQA 1YERA 4WUDA 1YETA 4EM7A 2BREA 1Y8PA 4XITA 2YEGA 4HZ5A 4HXZA 3T2SA 4AWPA 2YE2A 3O2FA 5CTUA 3T1KA 4KTNA 4FMTA 2XDKA 1U2OA 1AH8A 1UY6A 2YJWA 3D2RA 1I58A 3O6OA 4P7AA 3KE6A 1B3QA 4YKTA 2C2AA 4L8ZA 3TZ4A 4KSGA 2XX4A 4GQTA 4PU9A 2HCHA 2EXLA 3ZXOA 2YE3A 1JM6A 2XHXA 2YKBA 4W7TA 2XD6A 1EI1A 4R3MA 2FWZA 2YE9A 5CTWA 5J6AA 4FPPA 4GT8A 1PVGA 1TC6A 4NH7A 3K99A 4EGIA 1YC1A 3OW6A 4H81A 4PRXA 2BSMA 2YK2A 1Z5BA 2XDLA 4CWQA 4MPEA 3R91A 4MB9A 4XTJA 4V26A 2QG2A 4L93A 4LWGA 3INWA 2JKIA 2HG1A 2BU8A 4I5SA 1Y4UA 3HHUA 1NHJA 3INXA 4XIRA 3MNRP 3GIGA 2YI7A 4BQGA 1I59A 4ZVIA 2O1WA 4YKRA 1AJ6A 2IWUA 2YK9A 4EGKA 3Q5JA 3BM9A 4H7QA 3A0ZA 4U7OA 2WI2A 2YI0A 2BYIA 4U93A 3SL2A 2FWYA 4LWFA 2QF6A 1Z5AA 5FNDA 1BGQA 2YE5A 1UYHA 2YKJA 4KP4A 2VW5A 3RLQA 3PEJA 5D6PA 1UYIA 3PEHA 3NMQA 4AWQA 1UYDA 2Q2EB 5M4KA 1QYEA 2QFOA 2YKEA 3OPDA 4EFTA 5C93A 1GKZA 1YT0A 4MPNA 2HKJA 1UY8A 5GGZA 3DGEA 2FYPA 4O05A 2XDXA 1L0OA 4ASAA 2BU7A 1OSFA 1Y8OA 2H8MA 1ID0A 4KSHA 3VHAA 3TZ5A 1I5BA 2BTZA 4CWFA 4E00A 3JZ3A 4HY6A 4EMVA 1S16A 1EA6A 1YC3A 2JJCA 4K4OA 3R4MA 2WI1A 3U2KA 4KFGA 3Q5KA 3TUHA 2XHRA 3O0IA 3R92A 3CWVA 3ZM7A 1GKXA 4BQJA 5FWKA 2O1UA 4ASBA 1Y4SA 1UYFA 4URMA 3T0HA 4BIUA 2YJXA 1I5DA 3VHDA 4CE2A 4E01A 4URNA 4CWTA 4XIPA 5FNFA 5IN9A 5IDJA 2XDUA 4YKWA 1ZXNA 2YI5A 3B26A 4YKYA 1R62A 3A0WA 1Z5CA 2FXSA 2QG0A 2XHTA 2YE6A 3HZ1A 5F5RA 5D7DA 3C11A 2CCUA 3K60A 4O04A 3A0YA 1THNA 4QPKA 4GGLA 2UWDA 5D7RA 4YKQA 3U67A 2WI7A 2BYHA 4V25A 4E02A 4EEHA 4GEEA 1AMWA 2E0AA 1KIJA 4ASFA 4CWRA 3K98A 1UY9A 1TC0A 3A0TA 4YKXA 3B28A 4FCRA 4PL9A 1B63A 4PRVA 4XDMA 2XDSA 4AWOA 3RKZA 2XJJA 3G7EA 2Q8HA 4XKKA 4LWEA 1UYEA 4LP0A 2CCTA 2YEFA 1ZWHA 2XABA 3VADA 1BKNA 3WHAA 1GJVA 3OWBA 2YGEA 4WUBA 3FV5A 2YI6A 4O07A 3HEKA 3FT5A 2XCMA 2BZ5A
chains in the Genus database with same CATH superfamily
1I5AA 2WEPA 2CCSA 4XE2A 3CGZA 2YEEA 4DUHA 5M4HA 1UY7A 1B62A 4GFNA 1TBWA 3EHFA 3C0EA 5M4EA 4JQLA 3T0ZA 2YEIA 1AH6A 4LWIA 3ZXQA 4XD8A 4Q20A 1MX0A 3IEDA 3D0BA 3EKRA 3LPSA 5M4MA 1TILA 4GCZA 3VHCA 2WI3A 4NH8A 3A0XA 4XCLA 3HZ5A 1UYLA 1MU5A 5IDMA 4XIQA 2BU2A 3Q5LA 3A0RA 5CPHA 4JASA 5D7CA 3CRKA 5CF0A 1YSRA 1UYCA 4ASGA 3GIGB 4MP2A 4UROA 2YEBA 4ZKIA 3B24A 3U2DA 3EKOA 4QPJA 3RLPA 2IORA 2IOPA 3OMUA 4WUCA 2CH4A 2XJGA 1QZRA 4XKOA 5M4PA 4MBCA 3G7BA 2BRCA 3EHJA 2XX5A 2IWXA 2BU6A 2YEHA 2WI4A 4B7PA 2YECA 4CWOA 1ZW9A 2ESAA 5CTYA 1S14A 1TIDA 3R4OA 4CWNA 4AS9A 4HZ0A 2IWSA 1Y8NA 4P8OA 3R4PA 2YEAA 4X9LA 4HYMA 3CYGA 4XC0A 2VCIA 2O1VA 1TH8A 4JAUA 2XJXA 1YT2A 4FCPA 2PNRA 2AKPA 3G75A 2CG9A 4I3HA 3B25A 4YKUA 4U7NA 3HYYA 3CRLA 1KZNA 2YGAA 4MPCA 2YKCA 4DZYA 4LPBA 4EFUA 1NHIA 2IOQA 2GQPA 2BU5A 1BXDA 4BXIA 4HY1A 4B6CA 2YEDA 1AM1A 4L94A 2YKIA 4O09A 3OWDA 4MOTA 3K97A 3H80A 3HYZA 5BOCA 4CWPA 2H55A 1UYGA 3EHHA 5L3JA 2K5BA 4CE3A 4O0BA 5CTXA 3BMYA 1YESA 2Q8FA 4HYPA 2Q8IA 5BODA 1UYKA 1NHHA 3QDDA 1H7UA 1YSZA 2ZKJA 2WERA 4XCJA 4KQVA 1Z59A 3B27A 2FTKA 4CWSA 2WI6A 2ZBKB 1US7A 1ZXMA 5J71A 4HXWA 4L90A 1I5CA 1H7SA 3WQ9A 2BT0A 1UYMA 2WEQA 2ZDYA 4BIZA 4L91A 5D6QA 3D36A 3FT8A 3QTFA 2YE4A 4URLA 2YGFA 2WI5A 4H85A 4FCQA 3T10A 2YE7A 4NH9A 1IXMA 3EHGA 1QY8A 4EGHA 2XK2A 3ZKDA 4R3AA 4R1FA 4BAEA 3R4NA 1A4HA 4LWHA 1YS3A 3GIFA 2XX2A 4JAVA 3H4LA 1YT1A 2VCJA 2CGFA 4YKZA 5M4NA 2VWCA 2ZDXA 3LNUA 3TTZA 2GFDA 3GIEA 4MP7A 2YE8A 3RLRA 5FNCA 3TZ0A 3ZKBA 3TZ2A 3CGYA 4CE1A 4XKAA 2YEJA 1YC4A 2Q8GA 1U0ZA 5F3KA 1BYQA 1YERA 4WUDA 2HHIA 1YETA 4EM7A 2BREA 1Y8PA 4XITA 2YEGA 4HZ5A 4HXZA 3T2SA 4AWPA 2YE2A 3O2FA 5CTUA 3T1KA 4KTNA 2XDKA 1U2OA 1AH8A 1UY6A 2YJWA 4FMTA 3D2RA 1I58A 3O6OA 4P7AA 3KE6A 1B3QA 4YKTA 2C2AA 4L8ZA 3TZ4A 4KSGA 2XX4A 4GQTA 4PU9A 2HCHA 2EXLA 3ZXOA 2YE3A 1JM6A 2XHXA 2YKBA 4W7TA 2XD6A 1EI1A 4R3MA 2FWZA 2YE9A 5CTWA 5J6AA 4FPPA 4GT8A 1PVGA 1TC6A 4NH7A 3K99A 4EGIA 1YC1A 3OW6A 4H81A 4PRXA 2BSMA 2YK2A 1Z5BA 2XDLA 4CWQA 4MPEA 3R91A 4MB9A 4XTJA 4V26A 2QG2A 5JENA 4L93A 4LWGA 3INWA 2JKIA 2HG1A 2BU8A 4I5SA 1Y4UA 3HHUA 1NHJA 3INXA 4XIRA 3MNRP 3GIGA 2YI7A 4BQGA 1I59A 4ZVIA 2C1GA 2O1WA 4YKRA 1AJ6A 2IWUA 2YK9A 4EGKA 3Q5JA 3BM9A 4H7QA 3A0ZA 4U7OA 2WI2A 1F51A 2BYIA 2YI0A 4U93A 3SL2A 2FWYA 4LWFA 2QF6A 1Z5AA 5FNDA 1BGQA 2YE5A 1UYHA 2YKJA 4KP4A 2VW5A 3RLQA 3PEJA 5D6PA 1UYIA 3PEHA 3NMQA 4AWQA 1UYDA 2Q2EB 5M4KA 1QYEA 2QFOA 2YKEA 3OPDA 4EFTA 5C93A 1GKZA 1YT0A 4MPNA 2HKJA 1UY8A 5GGZA 3DGEA 2FYPA 4O05A 2XDXA 1L0OA 4ASAA 2BU7A 1OSFA 1Y8OA 2H8MA 1ID0A 4KSHA 3VHAA 3TZ5A 1I5BA 2BTZA 4CWFA 4E00A 3JZ3A 4HY6A 4EMVA 1S16A 1EA6A 1YC3A 2JJCA 4K4OA 3R4MA 2WI1A 3U2KA 4KFGA 3Q5KA 3TUHA 2XHRA 3O0IA 3R92A 3CWVA 3ZM7A 1GKXA 4BQJA 2C1IA 5FWKA 2O1UA 4ASBA 1Y4SA 1UYFA 4URMA 3T0HA 4BIUA 2YJXA 1I5DA 3VHDA 4CE2A 4E01A 4URNA 4CWTA 4XIPA 5FNFA 5IN9A 5IDJA 2XDUA 4E72A 4YKWA 1ZXNA 2YI5A 3B26A 4YKYA 1R62A 3A0WA 1Z5CA 2FXSA 2QG0A 2XHTA 2YE6A 3HZ1A 5F5RA 5D7DA 3C11A 2CCUA 3K60A 4O04A 3A0YA 1THNA 4QPKA 4GGLA 2UWDA 5D7RA 4YKQA 3S5TA 3U67A 2WI7A 2BYHA 4V25A 3LMMA 4E02A 4EEHA 4GEEA 1AMWA 2E0AA 1KIJA 4ASFA 4CWRA 3K98A 1UY9A 1TC0A 3A0TA 4YKXA 3B28A 4FCRA 4PL9A 1B63A 4PRVA 4XDMA 2XDSA 4AWOA 3RKZA 2XJJA 3G7EA 2Q8HA 4XKKA 4LWEA 1UYEA 4LP0A 2CCTA 2YEFA 1ZWHA 2XABA 3VADA 1BKNA 3WHAA 1GJVA 3OWBA 2YGEA 4WUBA 3FV5A 2YI6A 4O07A 3HEKA 3FT5A 2XCMA 2BZ5A
chains in the Genus database with same CATH topology
1I5AA 2WEPA 2CCSA 4XE2A 3CGZA 2YEEA 4DUHA 5M4HA 1UY7A 1B62A 4GFNA 1TBWA 3EHFA 3C0EA 5M4EA 4JQLA 3T0ZA 2YEIA 1AH6A 4LWIA 3ZXQA 4XD8A 4Q20A 1MX0A 3IEDA 3D0BA 3EKRA 3LPSA 5M4MA 1TILA 4GCZA 3VHCA 2WI3A 4NH8A 3A0XA 4XCLA 3HZ5A 1UYLA 1MU5A 5IDMA 4XIQA 2BU2A 3Q5LA 3A0RA 5CPHA 4JASA 5D7CA 3CRKA 5CF0A 1YSRA 1UYCA 4ASGA 3GIGB 4MP2A 4UROA 2YEBA 4ZKIA 3B24A 3U2DA 3EKOA 4QPJA 3RLPA 2IORA 2IOPA 3OMUA 4WUCA 2CH4A 2XJGA 1QZRA 4XKOA 5M4PA 4MBCA 3G7BA 2BRCA 3EHJA 2XX5A 2IWXA 2BU6A 2YEHA 2WI4A 4B7PA 2YECA 4CWOA 1ZW9A 2ESAA 5CTYA 1S14A 1TIDA 3R4OA 4CWNA 4AS9A 4HZ0A 2IWSA 1Y8NA 4P8OA 3R4PA 2YEAA 4X9LA 4HYMA 4XC0A 2VCIA 2O1VA 1TH8A 4JAUA 2XJXA 1YT2A 4FCPA 2PNRA 2AKPA 3G75A 2CG9A 4I3HA 3B25A 4YKUA 4U7NA 3HYYA 3CRLA 1KZNA 2YGAA 4MPCA 2YKCA 4DZYA 4LPBA 4EFUA 1NHIA 2IOQA 2GQPA 2BU5A 1BXDA 4BXIA 4HY1A 4B6CA 2YEDA 1AM1A 4L94A 2YKIA 4O09A 3OWDA 4MOTA 3K97A 3H80A 3HYZA 5BOCA 4CWPA 2H55A 1UYGA 3EHHA 5L3JA 2K5BA 4CE3A 4O0BA 5CTXA 3BMYA 1YESA 2Q8FA 4HYPA 2Q8IA 5BODA 1UYKA 1NHHA 3QDDA 1H7UA 1YSZA 2ZKJA 2WERA 4XCJA 4KQVA 1Z59A 3B27A 4CWSA 2WI6A 2ZBKB 1US7A 1ZXMA 5J71A 4HXWA 4L90A 1I5CA 1H7SA 3WQ9A 2BT0A 1UYMA 2WEQA 2ZDYA 4BIZA 4L91A 5D6QA 3D36A 3FT8A 3QTFA 2YE4A 4URLA 2YGFA 2WI5A 4H85A 4FCQA 3T10A 2YE7A 4NH9A 3EHGA 1QY8A 4EGHA 2XK2A 3ZKDA 4R3AA 4R1FA 4BAEA 3R4NA 1A4HA 4LWHA 1YS3A 3GIFA 2XX2A 4JAVA 3H4LA 1YT1A 2VCJA 2CGFA 4YKZA 5M4NA 2VWCA 2ZDXA 3LNUA 3TTZA 2GFDA 3GIEA 4MP7A 2YE8A 3RLRA 5FNCA 3TZ0A 3ZKBA 3TZ2A 3CGYA 4CE1A 4XKAA 2YEJA 1YC4A 2Q8GA 1U0ZA 5F3KA 1BYQA 1YERA 4WUDA 1YETA 4EM7A 2BREA 1Y8PA 4XITA 2YEGA 4HZ5A 4HXZA 3T2SA 4AWPA 2YE2A 3O2FA 5CTUA 3T1KA 4KTNA 4FMTA 2XDKA 1U2OA 1AH8A 1UY6A 2YJWA 3D2RA 1I58A 3O6OA 4P7AA 3KE6A 1B3QA 4YKTA 2C2AA 4L8ZA 3TZ4A 4KSGA 2XX4A 4GQTA 4PU9A 2HCHA 2EXLA 3ZXOA 2YE3A 1JM6A 2XHXA 2YKBA 4W7TA 2XD6A 1EI1A 4R3MA 2FWZA 2YE9A 5CTWA 5J6AA 4FPPA 4GT8A 1PVGA 1TC6A 4NH7A 3K99A 4EGIA 1YC1A 3OW6A 4H81A 4PRXA 2BSMA 2YK2A 1Z5BA 2XDLA 4CWQA 4MPEA 3R91A 4MB9A 4XTJA 4V26A 2QG2A 4L93A 4LWGA 3INWA 2JKIA 2HG1A 2BU8A 4I5SA 1Y4UA 3HHUA 1NHJA 3INXA 4XIRA 3MNRP 3GIGA 2YI7A 4BQGA 1I59A 4ZVIA 2O1WA 4YKRA 1AJ6A 2IWUA 2YK9A 4EGKA 3Q5JA 3BM9A 4H7QA 3A0ZA 4U7OA 2WI2A 2YI0A 2BYIA 4U93A 3SL2A 2FWYA 4LWFA 2QF6A 1Z5AA 5FNDA 1BGQA 2YE5A 1UYHA 2YKJA 4KP4A 2VW5A 3RLQA 3PEJA 5D6PA 1UYIA 3PEHA 3NMQA 4AWQA 1UYDA 2Q2EB 5M4KA 1QYEA 2QFOA 2YKEA 3OPDA 4EFTA 5C93A 1GKZA 1YT0A 4MPNA 2HKJA 1UY8A 5GGZA 3DGEA 2FYPA 4O05A 2XDXA 1L0OA 4ASAA 2BU7A 1OSFA 1Y8OA 2H8MA 1ID0A 4KSHA 3VHAA 3TZ5A 1I5BA 2BTZA 4CWFA 4E00A 3JZ3A 4HY6A 4EMVA 1S16A 1EA6A 1YC3A 2JJCA 4K4OA 3R4MA 2WI1A 3U2KA 4KFGA 3Q5KA 3TUHA 2XHRA 3O0IA 3R92A 3CWVA 3ZM7A 1GKXA 4BQJA 5FWKA 2O1UA 4ASBA 1Y4SA 1UYFA 4URMA 3T0HA 4BIUA 2YJXA 1I5DA 3VHDA 4CE2A 4E01A 4URNA 4CWTA 4XIPA 5FNFA 5IN9A 5IDJA 2XDUA 4YKWA 1ZXNA 2YI5A 3B26A 4YKYA 1R62A 3A0WA 1Z5CA 2FXSA 2QG0A 2XHTA 2YE6A 3HZ1A 5F5RA 5D7DA 3C11A 2CCUA 3K60A 4O04A 3A0YA 1THNA 4QPKA 4GGLA 2UWDA 5D7RA 4YKQA 3U67A 2WI7A 2BYHA 4V25A 4E02A 4EEHA 4GEEA 1AMWA 2E0AA 1KIJA 4ASFA 4CWRA 3K98A 1UY9A 1TC0A 3A0TA 4YKXA 3B28A 4FCRA 4PL9A 1B63A 4PRVA 4XDMA 2XDSA 4AWOA 3RKZA 2XJJA 3G7EA 2Q8HA 4XKKA 4LWEA 1UYEA 4LP0A 2CCTA 2YEFA 1ZWHA 2XABA 3VADA 1BKNA 3WHAA 1GJVA 3OWBA 2YGEA 4WUBA 3FV5A 2YI6A 4O07A 3HEKA 3FT5A 2XCMA 2BZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5A A;  2WEP A;  2CCS A;  4XE2 A;  3CGZ A;  2YEE A;  4DUH A;  5M4H A;  1UY7 A;  1B62 A;  4GFN A;  1TBW A;  3EHF A;  3C0E A;  5M4E A;  4JQL A;  3T0Z A;  2YEI A;  1AH6 A;  4LWI A;  3ZXQ A;  4XD8 A;  4Q20 A;  1MX0 A;  3IED A;  3D0B A;  3EKR A;  3LPS A;  5M4M A;  1TIL A;  4GCZ A;  3VHC A;  2WI3 A;  4NH8 A;  3A0X A;  4XCL A;  3HZ5 A;  1UYL A;  1MU5 A;  5IDM A;  4XIQ A;  2BU2 A;  3Q5L A;  3A0R A;  5CPH A;  4JAS A;  5D7C A;  3CRK A;  5CF0 A;  1YSR A;  1UYC A;  4ASG A;  3GIG B;  4MP2 A;  4URO A;  2YEB A;  4ZKI A;  3B24 A;  3U2D A;  3EKO A;  4QPJ A;  3RLP A;  2IOR A;  2IOP A;  3OMU A;  4WUC A;  2CH4 A;  2XJG A;  1QZR A;  4XKO A;  5M4P A;  4MBC A;  3G7B A;  2BRC A;  3EHJ A;  2XX5 A;  2IWX A;  2BU6 A;  2YEH A;  2WI4 A;  4B7P A;  2YEC A;  4CWO A;  1ZW9 A;  2ESA A;  5CTY A;  1S14 A;  1TID A;  3R4O A;  4CWN A;  4AS9 A;  4HZ0 A;  2IWS A;  1Y8N A;  4P8O A;  3R4P A;  2YEA A;  4X9L A;  4HYM A;  4XC0 A;  2VCI A;  2O1V A;  1TH8 A;  4JAU A;  2XJX A;  1YT2 A;  4FCP A;  2PNR A;  2AKP A;  3G75 A;  2CG9 A;  4I3H A;  3B25 A;  4YKU A;  4U7N A;  3HYY A;  3CRL A;  1KZN A;  2YGA A;  4MPC A;  2YKC A;  4DZY A;  4LPB A;  4EFU A;  1NHI A;  2IOQ A;  2GQP A;  2BU5 A;  1BXD A;  4BXI A;  4HY1 A;  4B6C A;  2YED A;  1AM1 A;  4L94 A;  2YKI A;  4O09 A;  3OWD A;  4MOT A;  3K97 A;  3H80 A;  3HYZ A;  5BOC A;  4CWP A;  2H55 A;  1UYG A;  3EHH A;  5L3J A;  2K5B A;  4CE3 A;  4O0B A;  5CTX A;  3BMY A;  1YES A;  2Q8F A;  4HYP A;  2Q8I A;  5BOD A;  1UYK A;  1NHH A;  3QDD A;  1H7U A;  1YSZ A;  2ZKJ A;  2WER A;  4XCJ A;  4KQV A;  1Z59 A;  3B27 A;  4CWS A;  2WI6 A;  2ZBK B;  1US7 A;  1ZXM A;  5J71 A;  4HXW A;  4L90 A;  1I5C A;  1H7S A;  3WQ9 A;  2BT0 A;  1UYM A;  2WEQ A;  2ZDY A;  4BIZ A;  4L91 A;  5D6Q A;  3D36 A;  3FT8 A;  3QTF A;  2YE4 A;  4URL A;  2YGF A;  2WI5 A;  4H85 A;  4FCQ A;  3T10 A;  2YE7 A;  4NH9 A;  3EHG A;  1QY8 A;  4EGH A;  2XK2 A;  3ZKD A;  4R3A A;  4R1F A;  4BAE A;  3R4N A;  1A4H A;  4LWH A;  1YS3 A;  3GIF A;  2XX2 A;  4JAV A;  3H4L A;  1YT1 A;  2VCJ A;  2CGF A;  4YKZ A;  5M4N A;  2VWC A;  2ZDX A;  3LNU A;  3TTZ A;  2GFD A;  3GIE A;  4MP7 A;  2YE8 A;  3RLR A;  5FNC A;  3TZ0 A;  3ZKB A;  3TZ2 A;  3CGY A;  4CE1 A;  4XKA A;  2YEJ A;  1YC4 A;  2Q8G A;  1U0Z A;  5F3K A;  1BYQ A;  1YER A;  4WUD A;  1YET A;  4EM7 A;  2BRE A;  1Y8P A;  4XIT A;  2YEG A;  4HZ5 A;  4HXZ A;  3T2S A;  4AWP A;  2YE2 A;  3O2F A;  5CTU A;  3T1K A;  4KTN A;  4FMT A;  2XDK A;  1U2O A;  1AH8 A;  1UY6 A;  2YJW A;  3D2R A;  1I58 A;  3O6O A;  4P7A A;  3KE6 A;  1B3Q A;  4YKT A;  2C2A A;  4L8Z A;  3TZ4 A;  4KSG A;  2XX4 A;  4GQT A;  4PU9 A;  2HCH A;  2EXL A;  3ZXO A;  2YE3 A;  1JM6 A;  2XHX A;  2YKB A;  4W7T A;  2XD6 A;  1EI1 A;  4R3M A;  2FWZ A;  2YE9 A;  5CTW A;  5J6A A;  4FPP A;  4GT8 A;  1PVG A;  1TC6 A;  4NH7 A;  3K99 A;  4EGI A;  1YC1 A;  3OW6 A;  4H81 A;  4PRX A;  2BSM A;  2YK2 A;  1Z5B A;  2XDL A;  4CWQ A;  4MPE A;  3R91 A;  4MB9 A;  4XTJ A;  4V26 A;  2QG2 A;  4L93 A;  4LWG A;  3INW A;  2JKI A;  2HG1 A;  2BU8 A;  4I5S A;  1Y4U A;  3HHU A;  1NHJ A;  3INX A;  4XIR A;  3MNR P;  3GIG A;  2YI7 A;  4BQG A;  1I59 A;  4ZVI A;  2O1W A;  4YKR A;  1AJ6 A;  2IWU A;  2YK9 A;  4EGK A;  3Q5J A;  3BM9 A;  4H7Q A;  3A0Z A;  4U7O A;  2WI2 A;  2YI0 A;  2BYI A;  4U93 A;  3SL2 A;  2FWY A;  4LWF A;  2QF6 A;  1Z5A A;  5FND A;  1BGQ A;  2YE5 A;  1UYH A;  2YKJ A;  4KP4 A;  2VW5 A;  3RLQ A;  3PEJ A;  5D6P A;  1UYI A;  3PEH A;  3NMQ A;  4AWQ A;  1UYD A;  2Q2E B;  5M4K A;  1QYE A;  2QFO A;  2YKE A;  3OPD A;  4EFT A;  5C93 A;  1GKZ A;  1YT0 A;  4MPN A;  2HKJ A;  1UY8 A;  5GGZ A;  3DGE A;  2FYP A;  4O05 A;  2XDX A;  1L0O A;  4ASA A;  2BU7 A;  1OSF A;  1Y8O A;  2H8M A;  1ID0 A;  4KSH A;  3VHA A;  3TZ5 A;  1I5B A;  2BTZ A;  4CWF A;  4E00 A;  3JZ3 A;  4HY6 A;  4EMV A;  1S16 A;  1EA6 A;  1YC3 A;  2JJC A;  4K4O A;  3R4M A;  2WI1 A;  3U2K A;  4KFG A;  3Q5K A;  3TUH A;  2XHR A;  3O0I A;  3R92 A;  3CWV A;  3ZM7 A;  1GKX A;  4BQJ A;  5FWK A;  2O1U A;  4ASB A;  1Y4S A;  1UYF A;  4URM A;  3T0H A;  4BIU A;  2YJX A;  1I5D A;  3VHD A;  4CE2 A;  4E01 A;  4URN A;  4CWT A;  4XIP A;  5FNF A;  5IN9 A;  5IDJ A;  2XDU A;  4YKW A;  1ZXN A;  2YI5 A;  3B26 A;  4YKY A;  1R62 A;  3A0W A;  1Z5C A;  2FXS A;  2QG0 A;  2XHT A;  2YE6 A;  3HZ1 A;  5F5R A;  5D7D A;  3C11 A;  2CCU A;  3K60 A;  4O04 A;  3A0Y A;  1THN A;  4QPK A;  4GGL A;  2UWD A;  5D7R A;  4YKQ A;  3U67 A;  2WI7 A;  2BYH A;  4V25 A;  4E02 A;  4EEH A;  4GEE A;  1AMW A;  2E0A A;  1KIJ A;  4ASF A;  4CWR A;  3K98 A;  1UY9 A;  1TC0 A;  3A0T A;  4YKX A;  3B28 A;  4FCR A;  4PL9 A;  1B63 A;  4PRV A;  4XDM A;  2XDS A;  4AWO A;  3RKZ A;  2XJJ A;  3G7E A;  2Q8H A;  4XKK A;  4LWE A;  1UYE A;  4LP0 A;  2CCT A;  2YEF A;  1ZWH A;  2XAB A;  3VAD A;  1BKN A;  3WHA A;  1GJV A;  3OWB A;  2YGE A;  4WUB A;  3FV5 A;  2YI6 A;  4O07 A;  3HEK A;  3FT5 A;  2XCM A;  2BZ5 A; 
#chains in the Genus database with same CATH topology
 1I5A A;  2WEP A;  2CCS A;  4XE2 A;  3CGZ A;  2YEE A;  4DUH A;  5M4H A;  1UY7 A;  1B62 A;  4GFN A;  1TBW A;  3EHF A;  3C0E A;  5M4E A;  4JQL A;  3T0Z A;  2YEI A;  1AH6 A;  4LWI A;  3ZXQ A;  4XD8 A;  4Q20 A;  1MX0 A;  3IED A;  3D0B A;  3EKR A;  3LPS A;  5M4M A;  1TIL A;  4GCZ A;  3VHC A;  2WI3 A;  4NH8 A;  3A0X A;  4XCL A;  3HZ5 A;  1UYL A;  1MU5 A;  5IDM A;  4XIQ A;  2BU2 A;  3Q5L A;  3A0R A;  5CPH A;  4JAS A;  5D7C A;  3CRK A;  5CF0 A;  1YSR A;  1UYC A;  4ASG A;  3GIG B;  4MP2 A;  4URO A;  2YEB A;  4ZKI A;  3B24 A;  3U2D A;  3EKO A;  4QPJ A;  3RLP A;  2IOR A;  2IOP A;  3OMU A;  4WUC A;  2CH4 A;  2XJG A;  1QZR A;  4XKO A;  5M4P A;  4MBC A;  3G7B A;  2BRC A;  3EHJ A;  2XX5 A;  2IWX A;  2BU6 A;  2YEH A;  2WI4 A;  4B7P A;  2YEC A;  4CWO A;  1ZW9 A;  2ESA A;  5CTY A;  1S14 A;  1TID A;  3R4O A;  4CWN A;  4AS9 A;  4HZ0 A;  2IWS A;  1Y8N A;  4P8O A;  3R4P A;  2YEA A;  4X9L A;  4HYM A;  3CYG A;  4XC0 A;  2VCI A;  2O1V A;  1TH8 A;  4JAU A;  2XJX A;  1YT2 A;  4FCP A;  2PNR A;  2AKP A;  3G75 A;  2CG9 A;  4I3H A;  3B25 A;  4YKU A;  4U7N A;  3HYY A;  3CRL A;  1KZN A;  2YGA A;  4MPC A;  2YKC A;  4DZY A;  4LPB A;  4EFU A;  1NHI A;  2IOQ A;  2GQP A;  2BU5 A;  1BXD A;  4BXI A;  4HY1 A;  4B6C A;  2YED A;  1AM1 A;  4L94 A;  2YKI A;  4O09 A;  3OWD A;  4MOT A;  3K97 A;  3H80 A;  3HYZ A;  5BOC A;  4CWP A;  2H55 A;  1UYG A;  3EHH A;  5L3J A;  2K5B A;  4CE3 A;  4O0B A;  5CTX A;  3BMY A;  1YES A;  2Q8F A;  4HYP A;  2Q8I A;  5BOD A;  1UYK A;  1NHH A;  3QDD A;  1H7U A;  1YSZ A;  2ZKJ A;  2WER A;  4XCJ A;  4KQV A;  1Z59 A;  3B27 A;  2FTK A;  4CWS A;  2WI6 A;  2ZBK B;  1US7 A;  1ZXM A;  5J71 A;  4HXW A;  4L90 A;  1I5C A;  1H7S A;  3WQ9 A;  2BT0 A;  1UYM A;  2WEQ A;  2ZDY A;  4BIZ A;  4L91 A;  5D6Q A;  3D36 A;  3FT8 A;  3QTF A;  2YE4 A;  4URL A;  2YGF A;  2WI5 A;  4H85 A;  4FCQ A;  3T10 A;  2YE7 A;  4NH9 A;  1IXM A;  3EHG A;  1QY8 A;  4EGH A;  2XK2 A;  3ZKD A;  4R3A A;  4R1F A;  4BAE A;  3R4N A;  1A4H A;  4LWH A;  1YS3 A;  3GIF A;  2XX2 A;  4JAV A;  3H4L A;  1YT1 A;  2VCJ A;  2CGF A;  4YKZ A;  5M4N A;  2VWC A;  2ZDX A;  3LNU A;  3TTZ A;  2GFD A;  3GIE A;  4MP7 A;  2YE8 A;  3RLR A;  5FNC A;  3TZ0 A;  3ZKB A;  3TZ2 A;  3CGY A;  4CE1 A;  4XKA A;  2YEJ A;  1YC4 A;  2Q8G A;  1U0Z A;  5F3K A;  1BYQ A;  1YER A;  4WUD A;  2HHI A;  1YET A;  4EM7 A;  2BRE A;  1Y8P A;  4XIT A;  2YEG A;  4HZ5 A;  4HXZ A;  3T2S A;  4AWP A;  2YE2 A;  3O2F A;  5CTU A;  3T1K A;  4KTN A;  2XDK A;  1U2O A;  1AH8 A;  1UY6 A;  2YJW A;  4FMT A;  3D2R A;  1I58 A;  3O6O A;  4P7A A;  3KE6 A;  1B3Q A;  4YKT A;  2C2A A;  4L8Z A;  3TZ4 A;  4KSG A;  2XX4 A;  4GQT A;  4PU9 A;  2HCH A;  2EXL A;  3ZXO A;  2YE3 A;  1JM6 A;  2XHX A;  2YKB A;  4W7T A;  2XD6 A;  1EI1 A;  4R3M A;  2FWZ A;  2YE9 A;  5CTW A;  5J6A A;  4FPP A;  4GT8 A;  1PVG A;  1TC6 A;  4NH7 A;  3K99 A;  4EGI A;  1YC1 A;  3OW6 A;  4H81 A;  4PRX A;  2BSM A;  2YK2 A;  1Z5B A;  2XDL A;  4CWQ A;  4MPE A;  3R91 A;  4MB9 A;  4XTJ A;  4V26 A;  2QG2 A;  5JEN A;  4L93 A;  4LWG A;  3INW A;  2JKI A;  2HG1 A;  2BU8 A;  4I5S A;  1Y4U A;  3HHU A;  1NHJ A;  3INX A;  4XIR A;  3MNR P;  3GIG A;  2YI7 A;  4BQG A;  1I59 A;  4ZVI A;  2C1G A;  2O1W A;  4YKR A;  1AJ6 A;  2IWU A;  2YK9 A;  4EGK A;  3Q5J A;  3BM9 A;  4H7Q A;  3A0Z A;  4U7O A;  2WI2 A;  1F51 A;  2BYI A;  2YI0 A;  4U93 A;  3SL2 A;  2FWY A;  4LWF A;  2QF6 A;  1Z5A A;  5FND A;  1BGQ A;  2YE5 A;  1UYH A;  2YKJ A;  4KP4 A;  2VW5 A;  3RLQ A;  3PEJ A;  5D6P A;  1UYI A;  3PEH A;  3NMQ A;  4AWQ A;  1UYD A;  2Q2E B;  5M4K A;  1QYE A;  2QFO A;  2YKE A;  3OPD A;  4EFT A;  5C93 A;  1GKZ A;  1YT0 A;  4MPN A;  2HKJ A;  1UY8 A;  5GGZ A;  3DGE A;  2FYP A;  4O05 A;  2XDX A;  1L0O A;  4ASA A;  2BU7 A;  1OSF A;  1Y8O A;  2H8M A;  1ID0 A;  4KSH A;  3VHA A;  3TZ5 A;  1I5B A;  2BTZ A;  4CWF A;  4E00 A;  3JZ3 A;  4HY6 A;  4EMV A;  1S16 A;  1EA6 A;  1YC3 A;  2JJC A;  4K4O A;  3R4M A;  2WI1 A;  3U2K A;  4KFG A;  3Q5K A;  3TUH A;  2XHR A;  3O0I A;  3R92 A;  3CWV A;  3ZM7 A;  1GKX A;  4BQJ A;  2C1I A;  5FWK A;  2O1U A;  4ASB A;  1Y4S A;  1UYF A;  4URM A;  3T0H A;  4BIU A;  2YJX A;  1I5D A;  3VHD A;  4CE2 A;  4E01 A;  4URN A;  4CWT A;  4XIP A;  5FNF A;  5IN9 A;  5IDJ A;  2XDU A;  4E72 A;  4YKW A;  1ZXN A;  2YI5 A;  3B26 A;  4YKY A;  1R62 A;  3A0W A;  1Z5C A;  2FXS A;  2QG0 A;  2XHT A;  2YE6 A;  3HZ1 A;  5F5R A;  5D7D A;  3C11 A;  2CCU A;  3K60 A;  4O04 A;  3A0Y A;  1THN A;  4QPK A;  4GGL A;  2UWD A;  5D7R A;  4YKQ A;  3S5T A;  3U67 A;  2WI7 A;  2BYH A;  4V25 A;  3LMM A;  4E02 A;  4EEH A;  4GEE A;  1AMW A;  2E0A A;  1KIJ A;  4ASF A;  4CWR A;  3K98 A;  1UY9 A;  1TC0 A;  3A0T A;  4YKX A;  3B28 A;  4FCR A;  4PL9 A;  1B63 A;  4PRV A;  4XDM A;  2XDS A;  4AWO A;  3RKZ A;  2XJJ A;  3G7E A;  2Q8H A;  4XKK A;  4LWE A;  1UYE A;  4LP0 A;  2CCT A;  2YEF A;  1ZWH A;  2XAB A;  3VAD A;  1BKN A;  3WHA A;  1GJV A;  3OWB A;  2YGE A;  4WUB A;  3FV5 A;  2YI6 A;  4O07 A;  3HEK A;  3FT5 A;  2XCM A;  2BZ5 A; 
#chains in the Genus database with same CATH homology
 1I5A A;  2WEP A;  2CCS A;  4XE2 A;  3CGZ A;  2YEE A;  4DUH A;  5M4H A;  1UY7 A;  1B62 A;  4GFN A;  1TBW A;  3EHF A;  3C0E A;  5M4E A;  4JQL A;  3T0Z A;  2YEI A;  1AH6 A;  4LWI A;  3ZXQ A;  4XD8 A;  4Q20 A;  1MX0 A;  3IED A;  3D0B A;  3EKR A;  3LPS A;  5M4M A;  1TIL A;  4GCZ A;  3VHC A;  2WI3 A;  4NH8 A;  3A0X A;  4XCL A;  3HZ5 A;  1UYL A;  1MU5 A;  5IDM A;  4XIQ A;  2BU2 A;  3Q5L A;  3A0R A;  5CPH A;  4JAS A;  5D7C A;  3CRK A;  5CF0 A;  1YSR A;  1UYC A;  4ASG A;  3GIG B;  4MP2 A;  4URO A;  2YEB A;  4ZKI A;  3B24 A;  3U2D A;  3EKO A;  4QPJ A;  3RLP A;  2IOR A;  2IOP A;  3OMU A;  4WUC A;  2CH4 A;  2XJG A;  1QZR A;  4XKO A;  5M4P A;  4MBC A;  3G7B A;  2BRC A;  3EHJ A;  2XX5 A;  2IWX A;  2BU6 A;  2YEH A;  2WI4 A;  4B7P A;  2YEC A;  4CWO A;  1ZW9 A;  2ESA A;  5CTY A;  1S14 A;  1TID A;  3R4O A;  4CWN A;  4AS9 A;  4HZ0 A;  2IWS A;  1Y8N A;  4P8O A;  3R4P A;  2YEA A;  4X9L A;  4HYM A;  4XC0 A;  2VCI A;  2O1V A;  1TH8 A;  4JAU A;  2XJX A;  1YT2 A;  4FCP A;  2PNR A;  2AKP A;  3G75 A;  2CG9 A;  4I3H A;  3B25 A;  4YKU A;  4U7N A;  3HYY A;  3CRL A;  1KZN A;  2YGA A;  4MPC A;  2YKC A;  4DZY A;  4LPB A;  4EFU A;  1NHI A;  2IOQ A;  2GQP A;  2BU5 A;  1BXD A;  4BXI A;  4HY1 A;  4B6C A;  2YED A;  1AM1 A;  4L94 A;  2YKI A;  4O09 A;  3OWD A;  4MOT A;  3K97 A;  3H80 A;  3HYZ A;  5BOC A;  4CWP A;  2H55 A;  1UYG A;  3EHH A;  5L3J A;  2K5B A;  4CE3 A;  4O0B A;  5CTX A;  3BMY A;  1YES A;  2Q8F A;  4HYP A;  2Q8I A;  5BOD A;  1UYK A;  1NHH A;  3QDD A;  1H7U A;  1YSZ A;  2ZKJ A;  2WER A;  4XCJ A;  4KQV A;  1Z59 A;  3B27 A;  4CWS A;  2WI6 A;  2ZBK B;  1US7 A;  1ZXM A;  5J71 A;  4HXW A;  4L90 A;  1I5C A;  1H7S A;  3WQ9 A;  2BT0 A;  1UYM A;  2WEQ A;  2ZDY A;  4BIZ A;  4L91 A;  5D6Q A;  3D36 A;  3FT8 A;  3QTF A;  2YE4 A;  4URL A;  2YGF A;  2WI5 A;  4H85 A;  4FCQ A;  3T10 A;  2YE7 A;  4NH9 A;  3EHG A;  1QY8 A;  4EGH A;  2XK2 A;  3ZKD A;  4R3A A;  4R1F A;  4BAE A;  3R4N A;  1A4H A;  4LWH A;  1YS3 A;  3GIF A;  2XX2 A;  4JAV A;  3H4L A;  1YT1 A;  2VCJ A;  2CGF A;  4YKZ A;  5M4N A;  2VWC A;  2ZDX A;  3LNU A;  3TTZ A;  2GFD A;  3GIE A;  4MP7 A;  2YE8 A;  3RLR A;  5FNC A;  3TZ0 A;  3ZKB A;  3TZ2 A;  3CGY A;  4CE1 A;  4XKA A;  2YEJ A;  1YC4 A;  2Q8G A;  1U0Z A;  5F3K A;  1BYQ A;  1YER A;  4WUD A;  1YET A;  4EM7 A;  2BRE A;  1Y8P A;  4XIT A;  2YEG A;  4HZ5 A;  4HXZ A;  3T2S A;  4AWP A;  2YE2 A;  3O2F A;  5CTU A;  3T1K A;  4KTN A;  4FMT A;  2XDK A;  1U2O A;  1AH8 A;  1UY6 A;  2YJW A;  3D2R A;  1I58 A;  3O6O A;  4P7A A;  3KE6 A;  1B3Q A;  4YKT A;  2C2A A;  4L8Z A;  3TZ4 A;  4KSG A;  2XX4 A;  4GQT A;  4PU9 A;  2HCH A;  2EXL A;  3ZXO A;  2YE3 A;  1JM6 A;  2XHX A;  2YKB A;  4W7T A;  2XD6 A;  1EI1 A;  4R3M A;  2FWZ A;  2YE9 A;  5CTW A;  5J6A A;  4FPP A;  4GT8 A;  1PVG A;  1TC6 A;  4NH7 A;  3K99 A;  4EGI A;  1YC1 A;  3OW6 A;  4H81 A;  4PRX A;  2BSM A;  2YK2 A;  1Z5B A;  2XDL A;  4CWQ A;  4MPE A;  3R91 A;  4MB9 A;  4XTJ A;  4V26 A;  2QG2 A;  4L93 A;  4LWG A;  3INW A;  2JKI A;  2HG1 A;  2BU8 A;  4I5S A;  1Y4U A;  3HHU A;  1NHJ A;  3INX A;  4XIR A;  3MNR P;  3GIG A;  2YI7 A;  4BQG A;  1I59 A;  4ZVI A;  2O1W A;  4YKR A;  1AJ6 A;  2IWU A;  2YK9 A;  4EGK A;  3Q5J A;  3BM9 A;  4H7Q A;  3A0Z A;  4U7O A;  2WI2 A;  2YI0 A;  2BYI A;  4U93 A;  3SL2 A;  2FWY A;  4LWF A;  2QF6 A;  1Z5A A;  5FND A;  1BGQ A;  2YE5 A;  1UYH A;  2YKJ A;  4KP4 A;  2VW5 A;  3RLQ A;  3PEJ A;  5D6P A;  1UYI A;  3PEH A;  3NMQ A;  4AWQ A;  1UYD A;  2Q2E B;  5M4K A;  1QYE A;  2QFO A;  2YKE A;  3OPD A;  4EFT A;  5C93 A;  1GKZ A;  1YT0 A;  4MPN A;  2HKJ A;  1UY8 A;  5GGZ A;  3DGE A;  2FYP A;  4O05 A;  2XDX A;  1L0O A;  4ASA A;  2BU7 A;  1OSF A;  1Y8O A;  2H8M A;  1ID0 A;  4KSH A;  3VHA A;  3TZ5 A;  1I5B A;  2BTZ A;  4CWF A;  4E00 A;  3JZ3 A;  4HY6 A;  4EMV A;  1S16 A;  1EA6 A;  1YC3 A;  2JJC A;  4K4O A;  3R4M A;  2WI1 A;  3U2K A;  4KFG A;  3Q5K A;  3TUH A;  2XHR A;  3O0I A;  3R92 A;  3CWV A;  3ZM7 A;  1GKX A;  4BQJ A;  5FWK A;  2O1U A;  4ASB A;  1Y4S A;  1UYF A;  4URM A;  3T0H A;  4BIU A;  2YJX A;  1I5D A;  3VHD A;  4CE2 A;  4E01 A;  4URN A;  4CWT A;  4XIP A;  5FNF A;  5IN9 A;  5IDJ A;  2XDU A;  4YKW A;  1ZXN A;  2YI5 A;  3B26 A;  4YKY A;  1R62 A;  3A0W A;  1Z5C A;  2FXS A;  2QG0 A;  2XHT A;  2YE6 A;  3HZ1 A;  5F5R A;  5D7D A;  3C11 A;  2CCU A;  3K60 A;  4O04 A;  3A0Y A;  1THN A;  4QPK A;  4GGL A;  2UWD A;  5D7R A;  4YKQ A;  3U67 A;  2WI7 A;  2BYH A;  4V25 A;  4E02 A;  4EEH A;  4GEE A;  1AMW A;  2E0A A;  1KIJ A;  4ASF A;  4CWR A;  3K98 A;  1UY9 A;  1TC0 A;  3A0T A;  4YKX A;  3B28 A;  4FCR A;  4PL9 A;  1B63 A;  4PRV A;  4XDM A;  2XDS A;  4AWO A;  3RKZ A;  2XJJ A;  3G7E A;  2Q8H A;  4XKK A;  4LWE A;  1UYE A;  4LP0 A;  2CCT A;  2YEF A;  1ZWH A;  2XAB A;  3VAD A;  1BKN A;  3WHA A;  1GJV A;  3OWB A;  2YGE A;  4WUB A;  3FV5 A;  2YI6 A;  4O07 A;  3HEK A;  3FT5 A;  2XCM A;  2BZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...