1BXPA

Solution nmr structure of the complex of alpha-bungarotoxin with a library derived peptide, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN
publication title Three-dimensional solution structure of the complex of alpha-bungarotoxin with a library-derived peptide.
pubmed doi rcsb
molecule tags Complex (toxin/peptide)
total genus 4
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1998-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1bxpA00
1FSSB 2L03A 1H0JA 1ONJA 3EVSC 1IDLA 1ZADA 1L4WA 1TXAA 1IQ9A 1CTXA 2JQPA 1DRSA 2CCXA 1LX5B 2GOOC 4EY8B 2MJYA 2H5FA 2BTXA 3KFDE 3NH7A 2MJ0A 2PJYB 1I02A 1KL8A 1LJZA 1ES7B 1VB0A 1TGXA 3LAQU 1RL5A 1W6BA 1UG4A 1CXOA 2MHYA 2LA1A 1IDIA 1G6MA 1ERAA 2L5SA 2QC1A 2QJAC 2H8UA 3KFDI 3FEVA 1HC9B 2MUOA 2NBTA 2UX2A 2H62C 3QB4B 4BIKB 1KC4A 1IDGA 1BXPA 1FRAA 4FAOE 1F94A 2VLWA 3NDSA 5DO6A 5DU1A 1NYUA 2QJBC 1CDSA 1QM7A 4HQPF 1KS6A 1PLOA 3NEQA 1CB9A 1JE9A 1FFJA 5EBXA 1CDQA 1CREA 2JVEA 4XJJA 5IMTD 1IJCA 1CODA 1REWC 2H7ZA 1B41B 2MJ4A 2QJ9C 1HC9A 1KBTA 4ZQYA 4AEAA 2LCRA 1COEA 1LSIA 2I9BE 1FSCA 3ERAA 1CVOA 1NTNA 1NTXA 1IK8A 1NXBA 2H62D 1HAJA 1IDHA 1NEAA 2GOOB 1CCQA 3HH7A 4P7UA 2ABXA 4OM4A 1KBAA 3EBXA 1NORA 4QTIU 1IKCA 3BT2U 4IYEA 2J8BA 1MR6A 1KXIA 1CXNA 4UY2C 1F8UB 2CTXA 2CRTA 3U73U 1FASA 1BTEA 2N99A 3BT1U 1M9ZA 1CDRA 3PLCA 1CHVS 2HLRA 1RGJA 1HOYA 1QKDA 4RUDA 1ABTA 1KTZB 1KU6B 5IMYC 3VTSA 1MAHF 1FF4A 1HAAA 2ERAA 2K3GA 2UWRA 1JGKA 2HLQA 1V6PA 1YWHA 1JBDA 1QKEA 2CDXA 2BHIA 1LXHA 2H64C 6EBXA 1TXBA 1CDTA 1ERGA 1TFSA 2FD6U 2MFAA 4FAOC 4DO8A 3U74U 1LXGA 2MUPA 2CRSA 4LFTA 4OM5A 1KFHA 1NYSA 4BDTB 1CRFA 1S4YA 2X8BB 5DZ5A 1XT3A 1KBSA 2OFSA 2H7ZB 2H64B 2PJYC
chains in the Genus database with same CATH superfamily
1FSSB 2L03A 1H0JA 1ONJA 3EVSC 1IDLA 1ZADA 1L4WA 4KSNA 1TXAA 1IQ9A 1CTXA 2JQPA 1DRSA 2CCXA 1LX5B 2GOOC 4EY8B 2MJYA 2H5FA 2BTXA 3KFDE 3NH7A 2MJ0A 2PJYB 1I02A 1KL8A 1LJZA 1ES7B 1VB0A 1TGXA 3LAQU 1RL5A 1W6BA 1UG4A 1CXOA 2MHYA 2LA1A 1IDIA 1G6MA 1ERAA 2L5SA 2QC1A 2QJAC 2H8UA 3KFDI 3FEVA 1HC9B 2MUOA 2NBTA 2UX2A 2H62C 3QB4B 4BIKB 1KC4A 1IDGA 1BXPA 1FRAA 4FAOE 1F94A 2VLWA 3NDSA 5DO6A 5DU1A 1NYUA 2QJBC 1CDSA 1QM7A 4HQPF 1KS6A 1PLOA 3NEQA 1CB9A 1JE9A 1FFJA 5EBXA 1CDQA 1CREA 2JVEA 4XJJA 5IMTD 1IJCA 1CODA 1REWC 2H7ZA 1B41B 2MJ4A 2QJ9C 1HC9A 1KBTA 4ZQYA 4AEAA 2LCRA 1COEA 1LSIA 2I9BE 1FSCA 3ERAA 1CVOA 1NTNA 1NTXA 1IK8A 1NXBA 2H62D 1HAJA 1IDHA 1NEAA 2GOOB 1CCQA 3HH7A 4P7UA 2ABXA 4OM4A 1KBAA 3EBXA 1NORA 4QTIU 1IKCA 3BT2U 4IYEA 2J8BA 1MR6A 1KXIA 1CXNA 4UY2C 1F8UB 2CTXA 2CRTA 3U73U 1FASA 1BTEA 2N99A 3BT1U 1M9ZA 1CDRA 3PLCA 1CHVS 2HLRA 1RGJA 1HOYA 1QKDA 4RUDA 1ABTA 1KTZB 1KU6B 5IMYC 3VTSA 1MAHF 1FF4A 1HAAA 2ERAA 2K3GA 2UWRA 1JGKA 2HLQA 1V6PA 1YWHA 1JBDA 1QKEA 2CDXA 2BHIA 1LXHA 2H64C 6EBXA 1TXBA 1CDTA 1ERGA 1TFSA 2FD6U 2MFAA 4FAOC 4DO8A 3U74U 1LXGA 2MUPA 2CRSA 4LFTA 4OM5A 1KFHA 1NYSA 4BDTB 1CRFA 1S4YA 2X8BB 5DZ5A 1XT3A 1KBSA 2OFSA 2H7ZB 2H64B 2PJYC
chains in the Genus database with same CATH topology
1FSSB 2L03A 1H0JA 1ONJA 3EVSC 1IDLA 1ZADA 1L4WA 4KSNA 1TXAA 1IQ9A 1CTXA 2JQPA 1DRSA 2CCXA 1LX5B 2GOOC 4EY8B 2MJYA 2H5FA 2BTXA 3KFDE 3NH7A 2MJ0A 2PJYB 1I02A 1KL8A 1LJZA 1ES7B 1VB0A 1TGXA 3LAQU 1RL5A 1W6BA 1UG4A 1CXOA 2MHYA 2LA1A 1IDIA 1G6MA 1ERAA 2L5SA 2QC1A 2QJAC 2H8UA 3KFDI 3FEVA 1HC9B 2MUOA 2NBTA 2UX2A 2H62C 3QB4B 4BIKB 1KC4A 1IDGA 1BXPA 1FRAA 4FAOE 1F94A 2VLWA 3NDSA 5DO6A 5DU1A 1NYUA 2QJBC 1CDSA 1QM7A 4HQPF 1KS6A 1PLOA 3NEQA 1CB9A 1JE9A 1FFJA 5EBXA 1CDQA 1CREA 2JVEA 4XJJA 5IMTD 1IJCA 1CODA 1REWC 2H7ZA 1B41B 2MJ4A 2QJ9C 1HC9A 1KBTA 4ZQYA 4AEAA 2LCRA 1COEA 1LSIA 2I9BE 1FSCA 3ERAA 1CVOA 1NTNA 1NTXA 1IK8A 1NXBA 2H62D 1HAJA 1IDHA 1NEAA 2GOOB 1CCQA 3HH7A 4P7UA 2ABXA 4OM4A 1KBAA 3EBXA 1NORA 4QTIU 1IKCA 3BT2U 4IYEA 2J8BA 1MR6A 1KXIA 1CXNA 4UY2C 1F8UB 2CTXA 2CRTA 3U73U 1FASA 1BTEA 2N99A 3BT1U 1M9ZA 1CDRA 3PLCA 1CHVS 2HLRA 1RGJA 1HOYA 1QKDA 4RUDA 1ABTA 1KTZB 1KU6B 5IMYC 3VTSA 1MAHF 1FF4A 1HAAA 2ERAA 2K3GA 2UWRA 1JGKA 2HLQA 1V6PA 1YWHA 1JBDA 1QKEA 2CDXA 2BHIA 1LXHA 2H64C 6EBXA 1TXBA 1CDTA 1ERGA 1TFSA 2FD6U 2MFAA 4FAOC 4DO8A 3U74U 1LXGA 2MUPA 2CRSA 4LFTA 4OM5A 1KFHA 1NYSA 4BDTB 1CRFA 1S4YA 2X8BB 5DZ5A 1XT3A 1KBSA 2OFSA 2H7ZB 2H64B 2PJYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSS B;  2L03 A;  1H0J A;  1ONJ A;  3EVS C;  1IDL A;  1ZAD A;  1L4W A;  1TXA A;  1IQ9 A;  1CTX A;  2JQP A;  1DRS A;  2CCX A;  1LX5 B;  2GOO C;  4EY8 B;  2MJY A;  2H5F A;  2BTX A;  3KFD E;  3NH7 A;  2MJ0 A;  2PJY B;  1I02 A;  1KL8 A;  1LJZ A;  1ES7 B;  1VB0 A;  1TGX A;  3LAQ U;  1RL5 A;  1W6B A;  1UG4 A;  1CXO A;  2MHY A;  2LA1 A;  1IDI A;  1G6M A;  1ERA A;  2L5S A;  2QC1 A;  2QJA C;  2H8U A;  3KFD I;  3FEV A;  1HC9 B;  2MUO A;  2NBT A;  2UX2 A;  2H62 C;  3QB4 B;  4BIK B;  1KC4 A;  1IDG A;  1BXP A;  1FRA A;  4FAO E;  1F94 A;  2VLW A;  3NDS A;  5DO6 A;  5DU1 A;  1NYU A;  2QJB C;  1CDS A;  1QM7 A;  4HQP F;  1KS6 A;  1PLO A;  3NEQ A;  1CB9 A;  1JE9 A;  1FFJ A;  5EBX A;  1CDQ A;  1CRE A;  2JVE A;  4XJJ A;  5IMT D;  1IJC A;  1COD A;  1REW C;  2H7Z A;  1B41 B;  2MJ4 A;  2QJ9 C;  1HC9 A;  1KBT A;  4ZQY A;  4AEA A;  2LCR A;  1COE A;  1LSI A;  2I9B E;  1FSC A;  3ERA A;  1CVO A;  1NTN A;  1NTX A;  1IK8 A;  1NXB A;  2H62 D;  1HAJ A;  1IDH A;  1NEA A;  2GOO B;  1CCQ A;  3HH7 A;  4P7U A;  2ABX A;  4OM4 A;  1KBA A;  3EBX A;  1NOR A;  4QTI U;  1IKC A;  3BT2 U;  4IYE A;  2J8B A;  1MR6 A;  1KXI A;  1CXN A;  4UY2 C;  1F8U B;  2CTX A;  2CRT A;  3U73 U;  1FAS A;  1BTE A;  2N99 A;  3BT1 U;  1M9Z A;  1CDR A;  3PLC A;  1CHV S;  2HLR A;  1RGJ A;  1HOY A;  1QKD A;  4RUD A;  1ABT A;  1KTZ B;  1KU6 B;  5IMY C;  3VTS A;  1MAH F;  1FF4 A;  1HAA A;  2ERA A;  2K3G A;  2UWR A;  1JGK A;  2HLQ A;  1V6P A;  1YWH A;  1JBD A;  1QKE A;  2CDX A;  2BHI A;  1LXH A;  2H64 C;  6EBX A;  1TXB A;  1CDT A;  1ERG A;  1TFS A;  2FD6 U;  2MFA A;  4FAO C;  4DO8 A;  3U74 U;  1LXG A;  2MUP A;  2CRS A;  4LFT A;  4OM5 A;  1KFH A;  1NYS A;  4BDT B;  1CRF A;  1S4Y A;  2X8B B;  5DZ5 A;  1XT3 A;  1KBS A;  2OFS A;  2H7Z B;  2H64 B;  2PJY C; 
#chains in the Genus database with same CATH topology
 1FSS B;  2L03 A;  1H0J A;  1ONJ A;  3EVS C;  1IDL A;  1ZAD A;  1L4W A;  4KSN A;  1TXA A;  1IQ9 A;  1CTX A;  2JQP A;  1DRS A;  2CCX A;  1LX5 B;  2GOO C;  4EY8 B;  2MJY A;  2H5F A;  2BTX A;  3KFD E;  3NH7 A;  2MJ0 A;  2PJY B;  1I02 A;  1KL8 A;  1LJZ A;  1ES7 B;  1VB0 A;  1TGX A;  3LAQ U;  1RL5 A;  1W6B A;  1UG4 A;  1CXO A;  2MHY A;  2LA1 A;  1IDI A;  1G6M A;  1ERA A;  2L5S A;  2QC1 A;  2QJA C;  2H8U A;  3KFD I;  3FEV A;  1HC9 B;  2MUO A;  2NBT A;  2UX2 A;  2H62 C;  3QB4 B;  4BIK B;  1KC4 A;  1IDG A;  1BXP A;  1FRA A;  4FAO E;  1F94 A;  2VLW A;  3NDS A;  5DO6 A;  5DU1 A;  1NYU A;  2QJB C;  1CDS A;  1QM7 A;  4HQP F;  1KS6 A;  1PLO A;  3NEQ A;  1CB9 A;  1JE9 A;  1FFJ A;  5EBX A;  1CDQ A;  1CRE A;  2JVE A;  4XJJ A;  5IMT D;  1IJC A;  1COD A;  1REW C;  2H7Z A;  1B41 B;  2MJ4 A;  2QJ9 C;  1HC9 A;  1KBT A;  4ZQY A;  4AEA A;  2LCR A;  1COE A;  1LSI A;  2I9B E;  1FSC A;  3ERA A;  1CVO A;  1NTN A;  1NTX A;  1IK8 A;  1NXB A;  2H62 D;  1HAJ A;  1IDH A;  1NEA A;  2GOO B;  1CCQ A;  3HH7 A;  4P7U A;  2ABX A;  4OM4 A;  1KBA A;  3EBX A;  1NOR A;  4QTI U;  1IKC A;  3BT2 U;  4IYE A;  2J8B A;  1MR6 A;  1KXI A;  1CXN A;  4UY2 C;  1F8U B;  2CTX A;  2CRT A;  3U73 U;  1FAS A;  1BTE A;  2N99 A;  3BT1 U;  1M9Z A;  1CDR A;  3PLC A;  1CHV S;  2HLR A;  1RGJ A;  1HOY A;  1QKD A;  4RUD A;  1ABT A;  1KTZ B;  1KU6 B;  5IMY C;  3VTS A;  1MAH F;  1FF4 A;  1HAA A;  2ERA A;  2K3G A;  2UWR A;  1JGK A;  2HLQ A;  1V6P A;  1YWH A;  1JBD A;  1QKE A;  2CDX A;  2BHI A;  1LXH A;  2H64 C;  6EBX A;  1TXB A;  1CDT A;  1ERG A;  1TFS A;  2FD6 U;  2MFA A;  4FAO C;  4DO8 A;  3U74 U;  1LXG A;  2MUP A;  2CRS A;  4LFT A;  4OM5 A;  1KFH A;  1NYS A;  4BDT B;  1CRF A;  1S4Y A;  2X8B B;  5DZ5 A;  1XT3 A;  1KBS A;  2OFS A;  2H7Z B;  2H64 B;  2PJY C; 
#chains in the Genus database with same CATH homology
 1FSS B;  2L03 A;  1H0J A;  1ONJ A;  3EVS C;  1IDL A;  1ZAD A;  1L4W A;  4KSN A;  1TXA A;  1IQ9 A;  1CTX A;  2JQP A;  1DRS A;  2CCX A;  1LX5 B;  2GOO C;  4EY8 B;  2MJY A;  2H5F A;  2BTX A;  3KFD E;  3NH7 A;  2MJ0 A;  2PJY B;  1I02 A;  1KL8 A;  1LJZ A;  1ES7 B;  1VB0 A;  1TGX A;  3LAQ U;  1RL5 A;  1W6B A;  1UG4 A;  1CXO A;  2MHY A;  2LA1 A;  1IDI A;  1G6M A;  1ERA A;  2L5S A;  2QC1 A;  2QJA C;  2H8U A;  3KFD I;  3FEV A;  1HC9 B;  2MUO A;  2NBT A;  2UX2 A;  2H62 C;  3QB4 B;  4BIK B;  1KC4 A;  1IDG A;  1BXP A;  1FRA A;  4FAO E;  1F94 A;  2VLW A;  3NDS A;  5DO6 A;  5DU1 A;  1NYU A;  2QJB C;  1CDS A;  1QM7 A;  4HQP F;  1KS6 A;  1PLO A;  3NEQ A;  1CB9 A;  1JE9 A;  1FFJ A;  5EBX A;  1CDQ A;  1CRE A;  2JVE A;  4XJJ A;  5IMT D;  1IJC A;  1COD A;  1REW C;  2H7Z A;  1B41 B;  2MJ4 A;  2QJ9 C;  1HC9 A;  1KBT A;  4ZQY A;  4AEA A;  2LCR A;  1COE A;  1LSI A;  2I9B E;  1FSC A;  3ERA A;  1CVO A;  1NTN A;  1NTX A;  1IK8 A;  1NXB A;  2H62 D;  1HAJ A;  1IDH A;  1NEA A;  2GOO B;  1CCQ A;  3HH7 A;  4P7U A;  2ABX A;  4OM4 A;  1KBA A;  3EBX A;  1NOR A;  4QTI U;  1IKC A;  3BT2 U;  4IYE A;  2J8B A;  1MR6 A;  1KXI A;  1CXN A;  4UY2 C;  1F8U B;  2CTX A;  2CRT A;  3U73 U;  1FAS A;  1BTE A;  2N99 A;  3BT1 U;  1M9Z A;  1CDR A;  3PLC A;  1CHV S;  2HLR A;  1RGJ A;  1HOY A;  1QKD A;  4RUD A;  1ABT A;  1KTZ B;  1KU6 B;  5IMY C;  3VTS A;  1MAH F;  1FF4 A;  1HAA A;  2ERA A;  2K3G A;  2UWR A;  1JGK A;  2HLQ A;  1V6P A;  1YWH A;  1JBD A;  1QKE A;  2CDX A;  2BHI A;  1LXH A;  2H64 C;  6EBX A;  1TXB A;  1CDT A;  1ERG A;  1TFS A;  2FD6 U;  2MFA A;  4FAO C;  4DO8 A;  3U74 U;  1LXG A;  2MUP A;  2CRS A;  4LFT A;  4OM5 A;  1KFH A;  1NYS A;  4BDT B;  1CRF A;  1S4Y A;  2X8B B;  5DZ5 A;  1XT3 A;  1KBS A;  2OFS A;  2H7Z B;  2H64 B;  2PJY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...