1BXWA

Outer membrane protein a (ompa) transmembrane domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
172
structure length
172
Chain Sequence
MAPKDNTWYTGAKLGWSQYHDTGLINNNGPTHENKLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the outer membrane protein A transmembrane domain.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Membrane protein
molecule keywords PROTEIN (OUTER MEMBRANE PROTEIN A)
total genus 35
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 1998-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1bxwA00
3QRAA 1BXWA 3QRCA 2F1VA 1Q9GA 2MHLA 1P4TA 3GP6A 2GE4A 2M06A 2MNHA 1ORMA 2X27X 1MM4A 2F1TA 2LHFA 2N2MA 1QJPA 2M07A 4PUXA 2N2LA 4RLCA 1QJ9A 1MM5A 1G90A 1QJ8A 3G7GA 2JMMA 2K0LA 2ERVA 1Q9FA 1THQA 3C5OA
chains in the Genus database with same CATH superfamily
3PRNA 5G38A 3VE2A 4AYID 3PORA 2WJRA 2J1NA 3SY9A 3PGSA 4FMSA 5ADXL 3BRZA 4GCPA 5KAFO 2ZLDA 2PRNA 1BH3A 1ZHXA 5E79O 4B61A 3DWNA 5GTHO 5EE2A 5B66O 2M06A 3AAEA 2R4NA 3POUA 2KZ7A 3AA6B 3VZUX 1MM4A 2LHFA 3UAQA 2QTKA 2F1CX 3A2SX 4QQ1A 3PGRA 5TISO 4AYEC 4LSHA 4FSOA 4C00A 4RLCA 3VE1A 2R88A 2X9KA 1MPFA 5G26A 2Y0LA 1HXTA 4O3YA 4D5UA 4JCHA 4FRTA 4C4VA 2PORA 2ZFGA 2K4TA 4CTDA 4RJXA 1IZNB 1MM5A 2XE2A 5ADXK 5DL7A 1QJ8A 1OPFA 1PHOA 2YPVA 3AAAB 2K0LA 3AA7A 2ERVA 2Y0HA 3PQSA 4E1TA 1OSMA 2XE1A 3FYXA 1Q9FA 4Z3TA 3LK2A 1ZHTA 1GFQA 3HOLA 5IYUA 3LK42 4D65A 3UPGA 4O3WA 1HXXA 4AUIA 2FGQX 2W80C 4GCQA 4O49A 4O3ZA 1GFMA 4FOZA 5DL6A 2KZ7B 3LK3A 3PGUA 2Y7SA 4AZLA 1ORMA 2XTRA 4G75A 3AA0A 4AKRA 5DL5A 3HWBA 3WI4A 1GFPA 2R4LA 1QJPA 2AXTO 2WJQA 3DA4A 2N2LA 2LFUA 3O0EA 4UB6O 3SYSA 3TZGA 3PQUA 4GF4A 4KRAA 4O4UA 3JTYA 4PR7A 3AAEB 3T24A 2ODJA 5H2FO 5D5DA 3UU2A 2FGRA 3AAAA 4UB8O 4FSPA 1G90A 1ZHWA 3A0BO 4RJWA 4AYNA 4FT6A 4FUVA 3LK2B 2Y0KA 3HOEA 3AA1B 6PRNA 2KXPB 3DWOX 3POXA 2O4VA 5FVNA 4F4BA 7PRNA 4IL6O 1E54A 4FZNA 4FZMA 4LSEA 1Q9GA 2MHLA 4N59A 5AFUK 1PRNA 3RBHA 1P4TA 2R4PA 2XE3A 4KR8A 2YNKA 3AA0B 4AFKA 4AKRB 2GE4A 3PF1A 2JQYA 2W81C 4JFBA 5GV0A 2IWWA 3V8UA 2X27X 3A0HO 1GFOA 4PUXA 2M07A 1T1LA 4O3XB 3JCUO 5G3AA 5JDPA 3LK3B 5GTIO 3SZDA 4FESA 4AYDC 1QJ9A 3VZTX 4LSIA 4FRXA 5B5EO 3DZMA 4FQEA 3POQA 5AFUL 3G7GA 2JMMA 2R8AA 3BS0A 3SYBA 1T16A 2R89A 1S5LO 2KXPA 4RLBA 5T5FA 3VY8X 1THQA 3C5OA 2KC0A 2OMFA 2IWVA 2XMXA 3QRAA 1BXWA 1H6S1 3KZIO 3QRCA 4C69X 1ZHYA 2F1VA 4K3BA 4GCSA 4N75A 4N58A 2WVPA 1YS5A 3KVDD 2J4UP 4AKMA 3BRYA 4U9CA 3AA1A 4AYMC 4BUMX 4RL9A 3SY7A 3GP6A 2R4OA 1BT9A 5KAIO 3WU2O 2MNHA 3LK41 4E1SA 3NSGA 4PJ0O 5PRNA 3T0SA 2F1TA 3VZWX 2XE5A 4O4XA 1IZNA 2N2MA 3AA6A 3NJTA 1HXUA 1GFNA 3DA3A 4FZLA 2XG6A 3SZVA 5DL8A 3VY9X 2Y2XA 4K3CA 4G76A 2KDYA 3EMNX 4C4VB 4GHBA 4D64A 8PRNA 3WI5A 4XNLA 5G39A 3HW9A 3T20A 4N74A 3K19A 4KR4A 4XNKA 2XTQA 3AA7B 4LSFA 1ZHZA
chains in the Genus database with same CATH topology
3PRNA 3VE2A 4AYID 3PORA 2J1NA 3SY9A 5ADXL 4FMSA 4GCPA 2ZLDA 2PRNA 1BH3A 1ZHXA 4B61A 5EE2A 2M06A 3AAEA 3POUA 2KZ7A 3AA6B 3VZUX 1MM4A 2LHFA 3UAQA 2QTKA 3A2SX 4QQ1A 4AYEC 4LSHA 4FSOA 4RLCA 3VE1A 1MPFA 5G26A 2Y0LA 1HXTA 4O3YA 4D5UA 4JCHA 4FRTA 2PORA 2ZFGA 2K4TA 4RJXA 1IZNB 1MM5A 2XE2A 5ADXK 5DL7A 1QJ8A 1OPFA 1PHOA 2YPVA 3AAAB 2K0LA 3AA7A 2ERVA 2Y0HA 3PQSA 4E1TA 1OSMA 2XE1A 3FYXA 1Q9FA 4Z3TA 3LK2A 1ZHTA 1GFQA 3HOLA 5IYUA 3LK42 4D65A 3UPGA 4O3WA 1HXXA 4AUIA 2FGQX 2W80C 4GCQA 4O49A 4O3ZA 1GFMA 4FOZA 5DL6A 2KZ7B 3LK3A 2Y7SA 4AZLA 1ORMA 2XTRA 4G75A 3AA0A 4AKRA 5DL5A 3HWBA 3WI4A 1GFPA 1QJPA 3DA4A 3O0EA 3TZGA 2N2LA 2LFUA 3SYSA 3PQUA 4GF4A 4KRAA 4O4UA 3JTYA 3T24A 3AAEB 2ODJA 5D5DA 3UU2A 2FGRA 3AAAA 4FSPA 1G90A 1ZHWA 4RJWA 4AYNA 4FT6A 4FUVA 3LK2B 2Y0KA 3HOEA 3AA1B 6PRNA 2KXPB 3POXA 2O4VA 5FVNA 4F4BA 7PRNA 1E54A 4FZNA 4FZMA 4LSEA 1Q9GA 2MHLA 4N59A 5AFUK 1PRNA 3RBHA 1P4TA 2XE3A 4AFKA 4KR8A 2YNKA 3AA0B 4AKRB 2GE4A 4JFBA 2W81C 3V8UA 2X27X 1GFOA 4PUXA 2M07A 4O3XB 5JDPA 3LK3B 3SZDA 4FESA 4AYDC 1QJ9A 3VZTX 4LSIA 4FRXA 3POQA 5AFUL 3G7GA 2JMMA 3SYBA 2KXPA 4RLBA 5T5FA 3VY8X 1THQA 3C5OA 2KC0A 2OMFA 2XMXA 3QRAA 1BXWA 1H6S1 3QRCA 4C69X 1ZHYA 2F1VA 4GCSA 4N58A 1YS5A 3KVDD 2J4UP 4AKMA 4U9CA 3AA1A 4AYMC 4BUMX 4RL9A 3SY7A 3GP6A 1BT9A 2MNHA 3LK41 4E1SA 3NSGA 5PRNA 3T0SA 2F1TA 3VZWX 2XE5A 4O4XA 1IZNA 2N2MA 3AA6A 1HXUA 1GFNA 3DA3A 4FZLA 2XG6A 3SZVA 5DL8A 3VY9X 2Y2XA 5GV0A 4G76A 2KDYA 3EMNX 4D64A 4GHBA 8PRNA 3WI5A 4XNLA 3HW9A 3T20A 3K19A 4KR4A 4XNKA 2XTQA 3AA7B 4LSFA 1ZHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRA A;  1BXW A;  3QRC A;  2F1V A;  1Q9G A;  2MHL A;  1P4T A;  3GP6 A;  2GE4 A;  2M06 A;  2MNH A;  1ORM A;  2X27 X;  1MM4 A;  2F1T A;  2LHF A;  2N2M A;  1QJP A;  2M07 A;  4PUX A;  2N2L A;  4RLC A;  1QJ9 A;  1MM5 A;  1G90 A;  1QJ8 A;  3G7G A;  2JMM A;  2K0L A;  2ERV A;  1Q9F A;  1THQ A;  3C5O A; 
#chains in the Genus database with same CATH topology
 3PRN A;  5G38 A;  3VE2 A;  4AYI D;  3POR A;  2WJR A;  2J1N A;  3SY9 A;  3PGS A;  4FMS A;  5ADX L;  3BRZ A;  4GCP A;  5KAF O;  2ZLD A;  2PRN A;  1BH3 A;  1ZHX A;  5E79 O;  4B61 A;  3DWN A;  5GTH O;  5EE2 A;  5B66 O;  2M06 A;  3AAE A;  2R4N A;  3POU A;  2KZ7 A;  3AA6 B;  3VZU X;  1MM4 A;  2LHF A;  3UAQ A;  2QTK A;  2F1C X;  3A2S X;  4QQ1 A;  3PGR A;  5TIS O;  4AYE C;  4LSH A;  4FSO A;  4C00 A;  4RLC A;  3VE1 A;  2R88 A;  2X9K A;  1MPF A;  5G26 A;  2Y0L A;  1HXT A;  4O3Y A;  4D5U A;  4JCH A;  4FRT A;  4C4V A;  2POR A;  2ZFG A;  2K4T A;  4CTD A;  4RJX A;  1IZN B;  1MM5 A;  2XE2 A;  5ADX K;  5DL7 A;  1QJ8 A;  1OPF A;  1PHO A;  2YPV A;  3AAA B;  2K0L A;  3AA7 A;  2ERV A;  2Y0H A;  3PQS A;  4E1T A;  1OSM A;  2XE1 A;  3FYX A;  1Q9F A;  4Z3T A;  3LK2 A;  1ZHT A;  1GFQ A;  3HOL A;  5IYU A;  3LK4 2;  4D65 A;  3UPG A;  4O3W A;  1HXX A;  4AUI A;  2FGQ X;  2W80 C;  4GCQ A;  4O49 A;  4O3Z A;  1GFM A;  4FOZ A;  5DL6 A;  2KZ7 B;  3LK3 A;  3PGU A;  2Y7S A;  4AZL A;  1ORM A;  2XTR A;  4G75 A;  3AA0 A;  4AKR A;  5DL5 A;  3HWB A;  3WI4 A;  1GFP A;  2R4L A;  1QJP A;  2AXT O;  2WJQ A;  3DA4 A;  2N2L A;  2LFU A;  3O0E A;  4UB6 O;  3SYS A;  3TZG A;  3PQU A;  4GF4 A;  4KRA A;  4O4U A;  3JTY A;  4PR7 A;  3AAE B;  3T24 A;  2ODJ A;  5H2F O;  5D5D A;  3UU2 A;  2FGR A;  3AAA A;  4UB8 O;  4FSP A;  1G90 A;  1ZHW A;  3A0B O;  4RJW A;  4AYN A;  4FT6 A;  4FUV A;  3LK2 B;  2Y0K A;  3HOE A;  3AA1 B;  6PRN A;  2KXP B;  3DWO X;  3POX A;  2O4V A;  5FVN A;  4F4B A;  7PRN A;  4IL6 O;  1E54 A;  4FZN A;  4FZM A;  4LSE A;  1Q9G A;  2MHL A;  4N59 A;  5AFU K;  1PRN A;  3RBH A;  1P4T A;  2R4P A;  2XE3 A;  4KR8 A;  2YNK A;  3AA0 B;  4AFK A;  4AKR B;  2GE4 A;  3PF1 A;  2JQY A;  2W81 C;  4JFB A;  5GV0 A;  2IWW A;  3V8U A;  2X27 X;  3A0H O;  1GFO A;  4PUX A;  2M07 A;  1T1L A;  4O3X B;  3JCU O;  5G3A A;  5JDP A;  3LK3 B;  5GTI O;  3SZD A;  4FES A;  4AYD C;  1QJ9 A;  3VZT X;  4LSI A;  4FRX A;  5B5E O;  3DZM A;  4FQE A;  3POQ A;  5AFU L;  3G7G A;  2JMM A;  2R8A A;  3BS0 A;  3SYB A;  1T16 A;  2R89 A;  1S5L O;  2KXP A;  4RLB A;  5T5F A;  3VY8 X;  1THQ A;  3C5O A;  2KC0 A;  2OMF A;  2IWV A;  2XMX A;  3QRA A;  1BXW A;  1H6S 1;  3KZI O;  3QRC A;  4C69 X;  1ZHY A;  2F1V A;  4K3B A;  4GCS A;  4N75 A;  4N58 A;  2WVP A;  1YS5 A;  3KVD D;  2J4U P;  4AKM A;  3BRY A;  4U9C A;  3AA1 A;  4AYM C;  4BUM X;  4RL9 A;  3SY7 A;  3GP6 A;  2R4O A;  1BT9 A;  5KAI O;  3WU2 O;  2MNH A;  3LK4 1;  4E1S A;  3NSG A;  4PJ0 O;  5PRN A;  3T0S A;  2F1T A;  3VZW X;  2XE5 A;  4O4X A;  1IZN A;  2N2M A;  3AA6 A;  3NJT A;  1HXU A;  1GFN A;  3DA3 A;  4FZL A;  2XG6 A;  3SZV A;  5DL8 A;  3VY9 X;  2Y2X A;  4K3C A;  4G76 A;  2KDY A;  3EMN X;  4C4V B;  4GHB A;  4D64 A;  8PRN A;  3WI5 A;  4XNL A;  5G39 A;  3HW9 A;  3T20 A;  4N74 A;  3K19 A;  4KR4 A;  4XNK A;  2XTQ A;  3AA7 B;  4LSF A;  1ZHZ A; 
#chains in the Genus database with same CATH homology
 3PRN A;  3VE2 A;  4AYI D;  3POR A;  2J1N A;  3SY9 A;  5ADX L;  4FMS A;  4GCP A;  2ZLD A;  2PRN A;  1BH3 A;  1ZHX A;  4B61 A;  5EE2 A;  2M06 A;  3AAE A;  3POU A;  2KZ7 A;  3AA6 B;  3VZU X;  1MM4 A;  2LHF A;  3UAQ A;  2QTK A;  3A2S X;  4QQ1 A;  4AYE C;  4LSH A;  4FSO A;  4RLC A;  3VE1 A;  1MPF A;  5G26 A;  2Y0L A;  1HXT A;  4O3Y A;  4D5U A;  4JCH A;  4FRT A;  2POR A;  2ZFG A;  2K4T A;  4RJX A;  1IZN B;  1MM5 A;  2XE2 A;  5ADX K;  5DL7 A;  1QJ8 A;  1OPF A;  1PHO A;  2YPV A;  3AAA B;  2K0L A;  3AA7 A;  2ERV A;  2Y0H A;  3PQS A;  4E1T A;  1OSM A;  2XE1 A;  3FYX A;  1Q9F A;  4Z3T A;  3LK2 A;  1ZHT A;  1GFQ A;  3HOL A;  5IYU A;  3LK4 2;  4D65 A;  3UPG A;  4O3W A;  1HXX A;  4AUI A;  2FGQ X;  2W80 C;  4GCQ A;  4O49 A;  4O3Z A;  1GFM A;  4FOZ A;  5DL6 A;  2KZ7 B;  3LK3 A;  2Y7S A;  4AZL A;  1ORM A;  2XTR A;  4G75 A;  3AA0 A;  4AKR A;  5DL5 A;  3HWB A;  3WI4 A;  1GFP A;  1QJP A;  3DA4 A;  3O0E A;  3TZG A;  2N2L A;  2LFU A;  3SYS A;  3PQU A;  4GF4 A;  4KRA A;  4O4U A;  3JTY A;  3T24 A;  3AAE B;  2ODJ A;  5D5D A;  3UU2 A;  2FGR A;  3AAA A;  4FSP A;  1G90 A;  1ZHW A;  4RJW A;  4AYN A;  4FT6 A;  4FUV A;  3LK2 B;  2Y0K A;  3HOE A;  3AA1 B;  6PRN A;  2KXP B;  3POX A;  2O4V A;  5FVN A;  4F4B A;  7PRN A;  1E54 A;  4FZN A;  4FZM A;  4LSE A;  1Q9G A;  2MHL A;  4N59 A;  5AFU K;  1PRN A;  3RBH A;  1P4T A;  2XE3 A;  4AFK A;  4KR8 A;  2YNK A;  3AA0 B;  4AKR B;  2GE4 A;  4JFB A;  2W81 C;  3V8U A;  2X27 X;  1GFO A;  4PUX A;  2M07 A;  4O3X B;  5JDP A;  3LK3 B;  3SZD A;  4FES A;  4AYD C;  1QJ9 A;  3VZT X;  4LSI A;  4FRX A;  3POQ A;  5AFU L;  3G7G A;  2JMM A;  3SYB A;  2KXP A;  4RLB A;  5T5F A;  3VY8 X;  1THQ A;  3C5O A;  2KC0 A;  2OMF A;  2XMX A;  3QRA A;  1BXW A;  1H6S 1;  3QRC A;  4C69 X;  1ZHY A;  2F1V A;  4GCS A;  4N58 A;  1YS5 A;  3KVD D;  2J4U P;  4AKM A;  4U9C A;  3AA1 A;  4AYM C;  4BUM X;  4RL9 A;  3SY7 A;  3GP6 A;  1BT9 A;  2MNH A;  3LK4 1;  4E1S A;  3NSG A;  5PRN A;  3T0S A;  2F1T A;  3VZW X;  2XE5 A;  4O4X A;  1IZN A;  2N2M A;  3AA6 A;  1HXU A;  1GFN A;  3DA3 A;  4FZL A;  2XG6 A;  3SZV A;  5DL8 A;  3VY9 X;  2Y2X A;  5GV0 A;  4G76 A;  2KDY A;  3EMN X;  4D64 A;  4GHB A;  8PRN A;  3WI5 A;  4XNL A;  3HW9 A;  3T20 A;  3K19 A;  4KR4 A;  4XNK A;  2XTQ A;  3AA7 B;  4LSF A;  1ZHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...