1BXWA

Outer membrane protein a (ompa) transmembrane domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
172
structure length
172
Chain Sequence
b'MAPKDNTWYTGAKLGWSQYHDTGLINNNGPTHENKLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (OUTER MEMBRANE PROTEIN A)
publication title Structure of the outer membrane protein A transmembrane domain.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Membrane protein
total genus 35
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 1998-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1bxwA00
4RLCA 1MM5A 2M06A 1BXWA 4PUXA 2MHLA 3GP6A 1MM4A 1Q9FA 1THQA 2F1VA 3G7GA 2F1TA 2ERVA 2LHFA 2M07A 2N2LA 1QJPA 1ORMA 1P4TA 2MNHA 2JMMA 3C5OA 3QRCA 1G90A 1QJ8A 3QRAA 2GE4A 1QJ9A 1Q9GA 2N2MA 2X27X 2K0LA
chains in the Genus database with same CATH superfamily
2K4TA 1E54A 3LK3A 1BH3A 4RLBA 3SYBA 3SZDA 3AAAA 3PRNA 5D5DA 3VZWX 1PRNA 2M06A 2ODJA 1BXWA 3VY8X 1PHOA 1HXTA 4C00A 2F1CX 4FUVA 4U9CA 3PORA 4D64A 4AYNA 4N59A 2X9KA 4LSFA 2Y0KA 4O3XB 4PJ0O 4LSIA 1IZNB 2JQYA 3UAQA 2XE2A 1Q9FA 4K3CA 3SYSA 4Z3TA 1HXUA 2W80C 3T0SA 5EE2A 2F1VA 3G7GA 5FVNA 2J1NA 5B5EO 4O4XA 4AKMA 2F1TA 1ZHZA 2ERVA 4G76A 5IYUA 1GFMA 4FSPA 5G26A 2WJQA 1QJPA 4FOZA 4FSOA 4KR8A 4JFBA 4FT6A 3SY9A 3BS0A 2MNHA 3SY7A 1BT9A 3C5OA 2AXTO 5DL5A 2Y2XA 3JTYA 3LK2B 4FZLA 4FESA 2GE4A 4XNLA 1OPFA 3UU2A 1H6S1 3PGSA 3DA4A 3DA3A 5PRNA 1ZHXA 3AA1A 3KVDD 4FZNA 4D65A 4LSHA 3PQSA 5KAFO 2KXPB 5G38A 5G3AA 2J4UP 3KZIO 4AKRB 4PUXA 2YPVA 3A2SX 4F4BA 3DWNA 4N74A 4AUIA 2R8AA 4E1TA 4C4VA 4E1SA 3LK3B 5GTIO 2PRNA 3AAAB 2WVPA 3T20A 2N2LA 4N75A 1ZHWA 2ZLDA 5B66O 4LSEA 2O4VA 2R4NA 4IL6O 1T16A 3EMNX 5E79O 4PR7A 3SZVA 3JCUO 2XE3A 3HOLA 3AAEA 1GFOA 3PF1A 3AA6A 2Y7SA 3NJTA 3PGRA 3POUA 2FGQX 3A0HO 4O3YA 1QJ8A 4AYMC 7PRNA 4N58A 4XNKA 1GFQA 4GHBA 5G39A 3O0EA 3PQUA 2KZ7A 2K0LA 1ZHTA 4GCPA 4CTDA 3VE2A 2XTRA 4RLCA 5GV0A 1HXXA 1MM5A 3LK42 3HWBA 4AYDC 3DZMA 2R4PA 3AA7A 2XE1A 2R88A 2QTKA 2R89A 6PRNA 3GP6A 3PGUA 4FRTA 4RJXA 4O3WA 5TISO 4AYEC 3AA1B 4GF4A 1THQA 3VE1A 4O49A 3T24A 4UB8O 2LHFA 4FZMA 2R4LA 4FQEA 4G75A 4KR4A 3AA0A 3VZTX 1G90A 4GCSA 4O3ZA 4D5UA 2XE5A 1ZHYA 3UPGA 1ORMA 4K3BA 3RBHA 2YNKA 4FMSA 5T5FA 2XTQA 3BRZA 4JCHA 5DL6A 1P4TA 3VZUX 4C4VB 2OMFA 4UB6O 1QJ9A 1IZNA 1Q9GA 3POQA 2KC0A 3TZGA 5AFUK 5AFUL 1GFPA 3A0BO 3HOEA 4BUMX 3HW9A 3V8UA 2IWWA 3AAEB 4FRXA 3WI5A 3AA6B 3WI4A 5JDPA 2MHLA 8PRNA 3DWOX 5DL8A 3WU2O 2Y0LA 1MM4A 2R4OA 4O4UA 2LFUA 4GCQA 5KAIO 2KZ7B 3LK2A 4C69X 2Y0HA 1S5LO 2W81C 4KRAA 2N2MA 2M07A 2KDYA 3FYXA 3AA7B 3K19A 1T1LA 3LK41 4RJWA 5ADXK 2IWVA 2FGRA 3POXA 5ADXL 5GTHO 1GFNA 1MPFA 1YS5A 2KXPA 4QQ1A 5H2FO 4RL9A 4AKRA 4AYID 4AFKA 2JMMA 3QRCA 4AZLA 4B61A 2XG6A 2WJRA 2PORA 3QRAA 2ZFGA 3VY9X 2XMXA 1OSMA 5DL7A 3AA0B 2X27X 3BRYA 3NSGA
chains in the Genus database with same CATH topology
2K4TA 1E54A 3LK3A 1BH3A 4RLBA 3SYBA 3SZDA 3AAAA 3PRNA 5D5DA 3VZWX 1PRNA 2M06A 2ODJA 1BXWA 3VY8X 1PHOA 1HXTA 4FUVA 3PORA 4D64A 4AYNA 4N59A 4LSFA 2Y0KA 4O3XB 4LSIA 1IZNB 3UAQA 2XE2A 1Q9FA 3SYSA 4Z3TA 1HXUA 2W80C 3T0SA 5EE2A 2F1VA 3G7GA 5FVNA 2J1NA 4O4XA 4AKMA 2F1TA 1ZHZA 2ERVA 4G76A 5IYUA 1GFMA 4FSPA 5G26A 1QJPA 4FOZA 4FSOA 4KR8A 4JFBA 4FT6A 3SY9A 2MNHA 3SY7A 1BT9A 3C5OA 5DL5A 2Y2XA 3JTYA 3LK2B 4FZLA 4FESA 2GE4A 4XNLA 1OPFA 3UU2A 1H6S1 4D65A 3DA4A 3DA3A 5PRNA 1ZHXA 3AA1A 3KVDD 4FZNA 4LSHA 3PQSA 2KXPB 2J4UP 4AKRB 4PUXA 2YPVA 3A2SX 4F4BA 4AUIA 4E1TA 4E1SA 3LK3B 2PRNA 3AAAB 3T20A 2N2LA 1ZHWA 2ZLDA 4LSEA 2O4VA 3EMNX 3SZVA 5JDPA 2XE3A 3HOLA 3AAEA 1GFOA 4U9CA 3AA6A 2Y7SA 3POUA 4O3YA 5T5FA 2FGQX 4AYMC 7PRNA 1QJ8A 1G90A 4N58A 4XNKA 1GFQA 4GHBA 3O0EA 3PQUA 2KZ7A 2K0LA 1ZHTA 4GCPA 3VE2A 2XTRA 4RLCA 5GV0A 1HXXA 1MM5A 3LK42 3HWBA 4AYDC 3AA7A 2XE1A 2QTKA 6PRNA 3GP6A 4FRTA 4RJXA 4O3WA 4AYEC 3AA1B 4GF4A 1THQA 3VE1A 4O49A 3T24A 2LHFA 4FZMA 4KR4A 4G75A 3VZTX 3AA0A 4GCSA 4O3ZA 4D5UA 2XE5A 1ZHYA 3UPGA 1ORMA 3RBHA 2YNKA 4FMSA 2XTQA 4JCHA 5DL6A 1P4TA 3VZUX 2OMFA 1QJ9A 1IZNA 1Q9GA 3TZGA 2KC0A 5AFUK 5AFUL 1GFPA 3HOEA 4BUMX 3HW9A 3V8UA 3AAEB 4FRXA 3WI5A 3AA6B 3WI4A 2MHLA 8PRNA 5DL8A 2Y0LA 1MM4A 4O4UA 2LFUA 4GCQA 2KZ7B 3LK2A 4C69X 2Y0HA 2W81C 4KRAA 2N2MA 2M07A 2KDYA 3FYXA 3AA7B 3K19A 3LK41 4RJWA 5ADXK 2FGRA 3POXA 5ADXL 1GFNA 1MPFA 1YS5A 2KXPA 4QQ1A 4RL9A 4AKRA 4AYID 4AFKA 2JMMA 3QRCA 4AZLA 4B61A 2XG6A 2PORA 3QRAA 2ZFGA 3VY9X 2XMXA 1OSMA 5DL7A 3AA0B 2X27X 3POQA 3NSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RLC A;  1MM5 A;  2M06 A;  1BXW A;  4PUX A;  2MHL A;  3GP6 A;  1MM4 A;  1Q9F A;  1THQ A;  2F1V A;  3G7G A;  2F1T A;  2ERV A;  2LHF A;  2M07 A;  2N2L A;  1QJP A;  1ORM A;  1P4T A;  2MNH A;  2JMM A;  3C5O A;  3QRC A;  1G90 A;  1QJ8 A;  3QRA A;  2GE4 A;  1QJ9 A;  1Q9G A;  2N2M A;  2X27 X;  2K0L A; 
#chains in the Genus database with same CATH topology
 2K4T A;  1E54 A;  3LK3 A;  1BH3 A;  4RLB A;  3SYB A;  3SZD A;  3AAA A;  3PRN A;  5D5D A;  3VZW X;  1PRN A;  2M06 A;  2ODJ A;  1BXW A;  3VY8 X;  1PHO A;  1HXT A;  4C00 A;  2F1C X;  4FUV A;  4U9C A;  3POR A;  4D64 A;  4AYN A;  4N59 A;  2X9K A;  4LSF A;  2Y0K A;  4O3X B;  4PJ0 O;  4LSI A;  1IZN B;  2JQY A;  3UAQ A;  2XE2 A;  1Q9F A;  4K3C A;  3SYS A;  4Z3T A;  1HXU A;  2W80 C;  3T0S A;  5EE2 A;  2F1V A;  3G7G A;  5FVN A;  2J1N A;  5B5E O;  4O4X A;  4AKM A;  2F1T A;  1ZHZ A;  2ERV A;  4G76 A;  5IYU A;  1GFM A;  4FSP A;  5G26 A;  2WJQ A;  1QJP A;  4FOZ A;  4FSO A;  4KR8 A;  4JFB A;  4FT6 A;  3SY9 A;  3BS0 A;  2MNH A;  3SY7 A;  1BT9 A;  3C5O A;  2AXT O;  5DL5 A;  2Y2X A;  3JTY A;  3LK2 B;  4FZL A;  4FES A;  2GE4 A;  4XNL A;  1OPF A;  3UU2 A;  1H6S 1;  3PGS A;  3DA4 A;  3DA3 A;  5PRN A;  1ZHX A;  3AA1 A;  3KVD D;  4FZN A;  4D65 A;  4LSH A;  3PQS A;  5KAF O;  2KXP B;  5G38 A;  5G3A A;  2J4U P;  3KZI O;  4AKR B;  4PUX A;  2YPV A;  3A2S X;  4F4B A;  3DWN A;  4N74 A;  4AUI A;  2R8A A;  4E1T A;  4C4V A;  4E1S A;  3LK3 B;  5GTI O;  2PRN A;  3AAA B;  2WVP A;  3T20 A;  2N2L A;  4N75 A;  1ZHW A;  2ZLD A;  5B66 O;  4LSE A;  2O4V A;  2R4N A;  4IL6 O;  1T16 A;  3EMN X;  5E79 O;  4PR7 A;  3SZV A;  3JCU O;  2XE3 A;  3HOL A;  3AAE A;  1GFO A;  3PF1 A;  3AA6 A;  2Y7S A;  3NJT A;  3PGR A;  3POU A;  2FGQ X;  3A0H O;  4O3Y A;  1QJ8 A;  4AYM C;  7PRN A;  4N58 A;  4XNK A;  1GFQ A;  4GHB A;  5G39 A;  3O0E A;  3PQU A;  2KZ7 A;  2K0L A;  1ZHT A;  4GCP A;  4CTD A;  3VE2 A;  2XTR A;  4RLC A;  5GV0 A;  1HXX A;  1MM5 A;  3LK4 2;  3HWB A;  4AYD C;  3DZM A;  2R4P A;  3AA7 A;  2XE1 A;  2R88 A;  2QTK A;  2R89 A;  6PRN A;  3GP6 A;  3PGU A;  4FRT A;  4RJX A;  4O3W A;  5TIS O;  4AYE C;  3AA1 B;  4GF4 A;  1THQ A;  3VE1 A;  4O49 A;  3T24 A;  4UB8 O;  2LHF A;  4FZM A;  2R4L A;  4FQE A;  4G75 A;  4KR4 A;  3AA0 A;  3VZT X;  1G90 A;  4GCS A;  4O3Z A;  4D5U A;  2XE5 A;  1ZHY A;  3UPG A;  1ORM A;  4K3B A;  3RBH A;  2YNK A;  4FMS A;  5T5F A;  2XTQ A;  3BRZ A;  4JCH A;  5DL6 A;  1P4T A;  3VZU X;  4C4V B;  2OMF A;  4UB6 O;  1QJ9 A;  1IZN A;  1Q9G A;  3POQ A;  2KC0 A;  3TZG A;  5AFU K;  5AFU L;  1GFP A;  3A0B O;  3HOE A;  4BUM X;  3HW9 A;  3V8U A;  2IWW A;  3AAE B;  4FRX A;  3WI5 A;  3AA6 B;  3WI4 A;  5JDP A;  2MHL A;  8PRN A;  3DWO X;  5DL8 A;  3WU2 O;  2Y0L A;  1MM4 A;  2R4O A;  4O4U A;  2LFU A;  4GCQ A;  5KAI O;  2KZ7 B;  3LK2 A;  4C69 X;  2Y0H A;  1S5L O;  2W81 C;  4KRA A;  2N2M A;  2M07 A;  2KDY A;  3FYX A;  3AA7 B;  3K19 A;  1T1L A;  3LK4 1;  4RJW A;  5ADX K;  2IWV A;  2FGR A;  3POX A;  5ADX L;  5GTH O;  1GFN A;  1MPF A;  1YS5 A;  2KXP A;  4QQ1 A;  5H2F O;  4RL9 A;  4AKR A;  4AYI D;  4AFK A;  2JMM A;  3QRC A;  4AZL A;  4B61 A;  2XG6 A;  2WJR A;  2POR A;  3QRA A;  2ZFG A;  3VY9 X;  2XMX A;  1OSM A;  5DL7 A;  3AA0 B;  2X27 X;  3BRY A;  3NSG A; 
#chains in the Genus database with same CATH homology
 2K4T A;  1E54 A;  3LK3 A;  1BH3 A;  4RLB A;  3SYB A;  3SZD A;  3AAA A;  3PRN A;  5D5D A;  3VZW X;  1PRN A;  2M06 A;  2ODJ A;  1BXW A;  3VY8 X;  1PHO A;  1HXT A;  4FUV A;  3POR A;  4D64 A;  4AYN A;  4N59 A;  4LSF A;  2Y0K A;  4O3X B;  4LSI A;  1IZN B;  3UAQ A;  2XE2 A;  1Q9F A;  3SYS A;  4Z3T A;  1HXU A;  2W80 C;  3T0S A;  5EE2 A;  2F1V A;  3G7G A;  5FVN A;  2J1N A;  4O4X A;  4AKM A;  2F1T A;  1ZHZ A;  2ERV A;  4G76 A;  5IYU A;  1GFM A;  4FSP A;  5G26 A;  1QJP A;  4FOZ A;  4FSO A;  4KR8 A;  4JFB A;  4FT6 A;  3SY9 A;  2MNH A;  3SY7 A;  1BT9 A;  3C5O A;  5DL5 A;  2Y2X A;  3JTY A;  3LK2 B;  4FZL A;  4FES A;  2GE4 A;  4XNL A;  1OPF A;  3UU2 A;  1H6S 1;  4D65 A;  3DA4 A;  3DA3 A;  5PRN A;  1ZHX A;  3AA1 A;  3KVD D;  4FZN A;  4LSH A;  3PQS A;  2KXP B;  2J4U P;  4AKR B;  4PUX A;  2YPV A;  3A2S X;  4F4B A;  4AUI A;  4E1T A;  4E1S A;  3LK3 B;  2PRN A;  3AAA B;  3T20 A;  2N2L A;  1ZHW A;  2ZLD A;  4LSE A;  2O4V A;  3EMN X;  3SZV A;  5JDP A;  2XE3 A;  3HOL A;  3AAE A;  1GFO A;  4U9C A;  3AA6 A;  2Y7S A;  3POU A;  4O3Y A;  5T5F A;  2FGQ X;  4AYM C;  7PRN A;  1QJ8 A;  1G90 A;  4N58 A;  4XNK A;  1GFQ A;  4GHB A;  3O0E A;  3PQU A;  2KZ7 A;  2K0L A;  1ZHT A;  4GCP A;  3VE2 A;  2XTR A;  4RLC A;  5GV0 A;  1HXX A;  1MM5 A;  3LK4 2;  3HWB A;  4AYD C;  3AA7 A;  2XE1 A;  2QTK A;  6PRN A;  3GP6 A;  4FRT A;  4RJX A;  4O3W A;  4AYE C;  3AA1 B;  4GF4 A;  1THQ A;  3VE1 A;  4O49 A;  3T24 A;  2LHF A;  4FZM A;  4KR4 A;  4G75 A;  3VZT X;  3AA0 A;  4GCS A;  4O3Z A;  4D5U A;  2XE5 A;  1ZHY A;  3UPG A;  1ORM A;  3RBH A;  2YNK A;  4FMS A;  2XTQ A;  4JCH A;  5DL6 A;  1P4T A;  3VZU X;  2OMF A;  1QJ9 A;  1IZN A;  1Q9G A;  3TZG A;  2KC0 A;  5AFU K;  5AFU L;  1GFP A;  3HOE A;  4BUM X;  3HW9 A;  3V8U A;  3AAE B;  4FRX A;  3WI5 A;  3AA6 B;  3WI4 A;  2MHL A;  8PRN A;  5DL8 A;  2Y0L A;  1MM4 A;  4O4U A;  2LFU A;  4GCQ A;  2KZ7 B;  3LK2 A;  4C69 X;  2Y0H A;  2W81 C;  4KRA A;  2N2M A;  2M07 A;  2KDY A;  3FYX A;  3AA7 B;  3K19 A;  3LK4 1;  4RJW A;  5ADX K;  2FGR A;  3POX A;  5ADX L;  1GFN A;  1MPF A;  1YS5 A;  2KXP A;  4QQ1 A;  4RL9 A;  4AKR A;  4AYI D;  4AFK A;  2JMM A;  3QRC A;  4AZL A;  4B61 A;  2XG6 A;  2POR A;  3QRA A;  2ZFG A;  3VY9 X;  2XMX A;  1OSM A;  5DL7 A;  3AA0 B;  2X27 X;  3POQ A;  3NSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...