1BXWA

Outer membrane protein a (ompa) transmembrane domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
172
structure length
172
Chain Sequence
MAPKDNTWYTGAKLGWSQYHDTGLINNNGPTHENKLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (OUTER MEMBRANE PROTEIN A)
publication title Structure of the outer membrane protein A transmembrane domain.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Membrane protein
total genus 35
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 1998-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1bxwA00
2MHLA 4PUXA 1MM4A 2X27X 4RLCA 2GE4A 1G90A 2K0LA 1QJ9A 1THQA 1BXWA 3C5OA 1MM5A 3QRAA 2N2LA 3GP6A 1Q9GA 3G7GA 2JMMA 1QJ8A 2F1TA 1Q9FA 1QJPA 2F1VA 2M06A 3QRCA 2N2MA 2M07A 2MNHA 1ORMA 1P4TA 2ERVA 2LHFA
chains in the Genus database with same CATH superfamily
3PRNA 5T5FA 3SZDA 1YS5A 2KZ7B 4FZLA 5EE2A 1MM4A 4RLBA 4JCHA 2X27X 1OSMA 1GFOA 4KR8A 4RLCA 1T1LA 4C4VB 2XE5A 4GCSA 4GCPA 4KRAA 3AAAA 2ZLDA 3SY9A 3T0SA 5G38A 4C69X 2KDYA 3KZIO 1ZHTA 1ZHZA 2KXPA 4PR7A 1ZHXA 1T16A 4Z3TA 2JMMA 2Y2XA 3NSGA 2XMXA 3POUA 2JQYA 2R8AA 4N58A 3HOEA 3WI5A 5G39A 2J4UP 4FQEA 5DL8A 2N2MA 4KR4A 2YPVA 4N59A 3SYBA 3A0HO 4O49A 5G3AA 3TZGA 3PQSA 3EMNX 4CTDA 1BH3A 1GFMA 4GCQA 1ORMA 4UB6O 3DA3A 3UPGA 5KAFO 2XE1A 3LK41 3WU2O 3DA4A 3HOLA 2O4VA 3PQUA 2F1CX 3LK2A 5G26A 3AA6A 2XE3A 3AAAB 3JCUO 4AYNA 4F4BA 2R4PA 5H2FO 2XTQA 5B5EO 4O3YA 1G90A 2AXTO 4FZMA 1E54A 3AA7B 1QJ9A 2ZFGA 4JFBA 3T20A 4K3BA 4O3XB 5GV0A 2W81C 3LK3A 4FT6A 4K3CA 4RJWA 3SYSA 3GP6A 5ADXK 2IWWA 1OPFA 2OMFA 2Y7SA 2XG6A 3G7GA 3AAEB 2K4TA 2W80C 3AA1B 5DL6A 2F1TA 2IWVA 2R88A 2R4LA 3SY7A 2M06A 2XE2A 3WI4A 2FGQX 5GTIO 4N74A 1S5LO 4AFKA 4FSPA 1HXXA 3POQA 3BRYA 3RBHA 3LK2B 1IZNA 3AA6B 4LSIA 1GFNA 5JDPA 5E79O 4RL9A 3DZMA 4FUVA 2MHLA 2Y0HA 4LSHA 2WVPA 3AA0A 4RJXA 4U9CA 4C00A 2LFUA 2PORA 4G76A 4AKRA 1ZHWA 3PGUA 2KZ7A 3LK3B 5KAIO 3SZVA 7PRNA 5GTHO 2GE4A 2XTRA 4FOZA 3NJTA 3BS0A 4N75A 5FVNA 3K19A 1BXWA 2KXPB 2YNKA 2R89A 1MM5A 2WJRA 3QRAA 3A0BO 3V8UA 3VE1A 3LK42 4BUMX 4AYDC 1Q9GA 3FYXA 3VZUX 3PF1A 3PGRA 4AZLA 1HXUA 4O4XA 4AYEC 4D5UA 3O0EA 2QTKA 1IZNB 4B61A 4PJ0O 4O3ZA 3VZWX 5IYUA 3VY8X 1MPFA 3UU2A 4IL6O 3UAQA 4AUIA 1GFQA 2FGRA 2MNHA 2Y0KA 4GF4A 4XNLA 4AKRB 4LSFA 3HW9A 5B66O 3BRZA 4AYMC 5AFUL 4O3WA 3PGSA 4FSOA 2WJQA 4G75A 4PUXA 3DWOX 3KVDD 4XNKA 4O4UA 4AYID 3DWNA 3JTYA 4FZNA 5TISO 2X9KA 2K0LA 6PRNA 1THQA 4LSEA 3PORA 2PRNA 3C5OA 4D65A 4FMSA 8PRNA 4E1SA 2N2LA 5PRNA 3AA7A 3VY9X 4E1TA 1GFPA 4C4VA 3VZTX 1H6S1 4FRTA 1HXTA 3T24A 1QJ8A 3A2SX 1PRNA 1ZHYA 2R4OA 2Y0LA 1Q9FA 1QJPA 2F1VA 4FRXA 2KC0A 5D5DA 3VE2A 3AAEA 3HWBA 3POXA 3QRCA 4QQ1A 2R4NA 3AA1A 4UB8O 4D64A 5AFUK 4FESA 1BT9A 2J1NA 2ODJA 5DL7A 5ADXL 2M07A 4AKMA 1PHOA 4GHBA 3AA0B 1P4TA 2ERVA 5DL5A 2LHFA
chains in the Genus database with same CATH topology
3PRNA 5T5FA 3SZDA 1YS5A 2KZ7B 4FZLA 5EE2A 1MM4A 4RLBA 4JCHA 2X27X 1OSMA 1GFOA 4KR8A 4RLCA 2XE5A 4GCSA 4GCPA 4KRAA 3AAAA 2ZLDA 3SY9A 3T0SA 4C69X 2KDYA 1ZHTA 1ZHZA 2KXPA 1ZHXA 4Z3TA 2JMMA 2Y2XA 3NSGA 2XMXA 3POUA 4N58A 3HOEA 3WI5A 2J4UP 5DL8A 2N2MA 4KR4A 2YPVA 4N59A 3SYBA 3TZGA 4O49A 5ADXL 3T20A 3PQSA 3EMNX 1BH3A 1GFMA 4GCQA 1ORMA 3DA3A 3UPGA 2XE1A 3LK41 3DA4A 3HOLA 2O4VA 3PQUA 3LK2A 5G26A 3AA6A 2XE3A 3AAAB 4F4BA 2XTQA 4O3YA 1G90A 4FZMA 4JFBA 1E54A 3AA7B 1QJ9A 2ZFGA 4O3XB 5GV0A 2W81C 3LK3A 4FT6A 4RJWA 3SYSA 3GP6A 5ADXK 1OPFA 2OMFA 2Y7SA 2XG6A 3G7GA 3AAEB 2K4TA 2W80C 3AA1B 5DL6A 2F1TA 3SY7A 2M06A 2XE2A 2FGQX 4AFKA 4FSPA 1HXXA 3POQA 3RBHA 3LK2B 1IZNA 3AA6B 4LSIA 1GFNA 5JDPA 4RL9A 4FUVA 2MHLA 2Y0HA 4LSHA 3AA0A 4RJXA 4U9CA 2LFUA 2PORA 4G76A 4AKRA 1ZHWA 2KZ7A 3LK3B 3SZVA 7PRNA 2GE4A 2XTRA 4FOZA 5FVNA 3K19A 1BXWA 2KXPB 2YNKA 1MM5A 3QRAA 3V8UA 3VE1A 3LK42 4BUMX 4AYDC 1Q9GA 3FYXA 3VZUX 4AZLA 1HXUA 4O4XA 4AYEC 4D5UA 3O0EA 2QTKA 1IZNB 4B61A 4O3ZA 3VZWX 5IYUA 3VY8X 1MPFA 3UU2A 3UAQA 4AUIA 1GFQA 2FGRA 2MNHA 2Y0KA 4GF4A 4XNLA 4AKRB 4LSFA 3HW9A 4AYMC 5AFUL 4O3WA 4FSOA 4G75A 4PUXA 3KVDD 4XNKA 4O4UA 4AYID 3JTYA 4FZNA 2K0LA 6PRNA 1THQA 4LSEA 3PORA 2PRNA 3C5OA 4D65A 4FMSA 8PRNA 4E1SA 2N2LA 5PRNA 3AA7A 3VY9X 4E1TA 1GFPA 3VZTX 1H6S1 4FRTA 1HXTA 3T24A 1QJ8A 3A2SX 1PRNA 1ZHYA 4FRXA 2Y0LA 1Q9FA 1QJPA 2F1VA 5D5DA 2KC0A 3VE2A 3WI4A 3AAEA 3HWBA 3POXA 3QRCA 4QQ1A 4AYNA 3AA1A 4D64A 5AFUK 4FESA 1BT9A 2J1NA 2ODJA 5DL7A 2M07A 4AKMA 1PHOA 4GHBA 3AA0B 1P4TA 2ERVA 5DL5A 2LHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHL A;  4PUX A;  1MM4 A;  2X27 X;  4RLC A;  2GE4 A;  1G90 A;  2K0L A;  1QJ9 A;  1THQ A;  1BXW A;  3C5O A;  1MM5 A;  3QRA A;  2N2L A;  3GP6 A;  1Q9G A;  3G7G A;  2JMM A;  1QJ8 A;  2F1T A;  1Q9F A;  1QJP A;  2F1V A;  2M06 A;  3QRC A;  2N2M A;  2M07 A;  2MNH A;  1ORM A;  1P4T A;  2ERV A;  2LHF A; 
#chains in the Genus database with same CATH topology
 3PRN A;  5T5F A;  3SZD A;  1YS5 A;  2KZ7 B;  4FZL A;  5EE2 A;  1MM4 A;  4RLB A;  4JCH A;  2X27 X;  1OSM A;  1GFO A;  4KR8 A;  4RLC A;  1T1L A;  4C4V B;  2XE5 A;  4GCS A;  4GCP A;  4KRA A;  3AAA A;  2ZLD A;  3SY9 A;  3T0S A;  5G38 A;  4C69 X;  2KDY A;  3KZI O;  1ZHT A;  1ZHZ A;  2KXP A;  4PR7 A;  1ZHX A;  1T16 A;  4Z3T A;  2JMM A;  2Y2X A;  3NSG A;  2XMX A;  3POU A;  2JQY A;  2R8A A;  4N58 A;  3HOE A;  3WI5 A;  5G39 A;  2J4U P;  4FQE A;  5DL8 A;  2N2M A;  4KR4 A;  2YPV A;  4N59 A;  3SYB A;  3A0H O;  4O49 A;  5G3A A;  3TZG A;  3PQS A;  3EMN X;  4CTD A;  1BH3 A;  1GFM A;  4GCQ A;  1ORM A;  4UB6 O;  3DA3 A;  3UPG A;  5KAF O;  2XE1 A;  3LK4 1;  3WU2 O;  3DA4 A;  3HOL A;  2O4V A;  3PQU A;  2F1C X;  3LK2 A;  5G26 A;  3AA6 A;  2XE3 A;  3AAA B;  3JCU O;  4AYN A;  4F4B A;  2R4P A;  5H2F O;  2XTQ A;  5B5E O;  4O3Y A;  1G90 A;  2AXT O;  4FZM A;  1E54 A;  3AA7 B;  1QJ9 A;  2ZFG A;  4JFB A;  3T20 A;  4K3B A;  4O3X B;  5GV0 A;  2W81 C;  3LK3 A;  4FT6 A;  4K3C A;  4RJW A;  3SYS A;  3GP6 A;  5ADX K;  2IWW A;  1OPF A;  2OMF A;  2Y7S A;  2XG6 A;  3G7G A;  3AAE B;  2K4T A;  2W80 C;  3AA1 B;  5DL6 A;  2F1T A;  2IWV A;  2R88 A;  2R4L A;  3SY7 A;  2M06 A;  2XE2 A;  3WI4 A;  2FGQ X;  5GTI O;  4N74 A;  1S5L O;  4AFK A;  4FSP A;  1HXX A;  3POQ A;  3BRY A;  3RBH A;  3LK2 B;  1IZN A;  3AA6 B;  4LSI A;  1GFN A;  5JDP A;  5E79 O;  4RL9 A;  3DZM A;  4FUV A;  2MHL A;  2Y0H A;  4LSH A;  2WVP A;  3AA0 A;  4RJX A;  4U9C A;  4C00 A;  2LFU A;  2POR A;  4G76 A;  4AKR A;  1ZHW A;  3PGU A;  2KZ7 A;  3LK3 B;  5KAI O;  3SZV A;  7PRN A;  5GTH O;  2GE4 A;  2XTR A;  4FOZ A;  3NJT A;  3BS0 A;  4N75 A;  5FVN A;  3K19 A;  1BXW A;  2KXP B;  2YNK A;  2R89 A;  1MM5 A;  2WJR A;  3QRA A;  3A0B O;  3V8U A;  3VE1 A;  3LK4 2;  4BUM X;  4AYD C;  1Q9G A;  3FYX A;  3VZU X;  3PF1 A;  3PGR A;  4AZL A;  1HXU A;  4O4X A;  4AYE C;  4D5U A;  3O0E A;  2QTK A;  1IZN B;  4B61 A;  4PJ0 O;  4O3Z A;  3VZW X;  5IYU A;  3VY8 X;  1MPF A;  3UU2 A;  4IL6 O;  3UAQ A;  4AUI A;  1GFQ A;  2FGR A;  2MNH A;  2Y0K A;  4GF4 A;  4XNL A;  4AKR B;  4LSF A;  3HW9 A;  5B66 O;  3BRZ A;  4AYM C;  5AFU L;  4O3W A;  3PGS A;  4FSO A;  2WJQ A;  4G75 A;  4PUX A;  3DWO X;  3KVD D;  4XNK A;  4O4U A;  4AYI D;  3DWN A;  3JTY A;  4FZN A;  5TIS O;  2X9K A;  2K0L A;  6PRN A;  1THQ A;  4LSE A;  3POR A;  2PRN A;  3C5O A;  4D65 A;  4FMS A;  8PRN A;  4E1S A;  2N2L A;  5PRN A;  3AA7 A;  3VY9 X;  4E1T A;  1GFP A;  4C4V A;  3VZT X;  1H6S 1;  4FRT A;  1HXT A;  3T24 A;  1QJ8 A;  3A2S X;  1PRN A;  1ZHY A;  2R4O A;  2Y0L A;  1Q9F A;  1QJP A;  2F1V A;  4FRX A;  2KC0 A;  5D5D A;  3VE2 A;  3AAE A;  3HWB A;  3POX A;  3QRC A;  4QQ1 A;  2R4N A;  3AA1 A;  4UB8 O;  4D64 A;  5AFU K;  4FES A;  1BT9 A;  2J1N A;  2ODJ A;  5DL7 A;  5ADX L;  2M07 A;  4AKM A;  1PHO A;  4GHB A;  3AA0 B;  1P4T A;  2ERV A;  5DL5 A;  2LHF A; 
#chains in the Genus database with same CATH homology
 3PRN A;  5T5F A;  3SZD A;  1YS5 A;  2KZ7 B;  4FZL A;  5EE2 A;  1MM4 A;  4RLB A;  4JCH A;  2X27 X;  1OSM A;  1GFO A;  4KR8 A;  4RLC A;  2XE5 A;  4GCS A;  4GCP A;  4KRA A;  3AAA A;  2ZLD A;  3SY9 A;  3T0S A;  4C69 X;  2KDY A;  1ZHT A;  1ZHZ A;  2KXP A;  1ZHX A;  4Z3T A;  2JMM A;  2Y2X A;  3NSG A;  2XMX A;  3POU A;  4N58 A;  3HOE A;  3WI5 A;  2J4U P;  5DL8 A;  2N2M A;  4KR4 A;  2YPV A;  4N59 A;  3SYB A;  3TZG A;  4O49 A;  5ADX L;  3T20 A;  3PQS A;  3EMN X;  1BH3 A;  1GFM A;  4GCQ A;  1ORM A;  3DA3 A;  3UPG A;  2XE1 A;  3LK4 1;  3DA4 A;  3HOL A;  2O4V A;  3PQU A;  3LK2 A;  5G26 A;  3AA6 A;  2XE3 A;  3AAA B;  4F4B A;  2XTQ A;  4O3Y A;  1G90 A;  4FZM A;  4JFB A;  1E54 A;  3AA7 B;  1QJ9 A;  2ZFG A;  4O3X B;  5GV0 A;  2W81 C;  3LK3 A;  4FT6 A;  4RJW A;  3SYS A;  3GP6 A;  5ADX K;  1OPF A;  2OMF A;  2Y7S A;  2XG6 A;  3G7G A;  3AAE B;  2K4T A;  2W80 C;  3AA1 B;  5DL6 A;  2F1T A;  3SY7 A;  2M06 A;  2XE2 A;  2FGQ X;  4AFK A;  4FSP A;  1HXX A;  3POQ A;  3RBH A;  3LK2 B;  1IZN A;  3AA6 B;  4LSI A;  1GFN A;  5JDP A;  4RL9 A;  4FUV A;  2MHL A;  2Y0H A;  4LSH A;  3AA0 A;  4RJX A;  4U9C A;  2LFU A;  2POR A;  4G76 A;  4AKR A;  1ZHW A;  2KZ7 A;  3LK3 B;  3SZV A;  7PRN A;  2GE4 A;  2XTR A;  4FOZ A;  5FVN A;  3K19 A;  1BXW A;  2KXP B;  2YNK A;  1MM5 A;  3QRA A;  3V8U A;  3VE1 A;  3LK4 2;  4BUM X;  4AYD C;  1Q9G A;  3FYX A;  3VZU X;  4AZL A;  1HXU A;  4O4X A;  4AYE C;  4D5U A;  3O0E A;  2QTK A;  1IZN B;  4B61 A;  4O3Z A;  3VZW X;  5IYU A;  3VY8 X;  1MPF A;  3UU2 A;  3UAQ A;  4AUI A;  1GFQ A;  2FGR A;  2MNH A;  2Y0K A;  4GF4 A;  4XNL A;  4AKR B;  4LSF A;  3HW9 A;  4AYM C;  5AFU L;  4O3W A;  4FSO A;  4G75 A;  4PUX A;  3KVD D;  4XNK A;  4O4U A;  4AYI D;  3JTY A;  4FZN A;  2K0L A;  6PRN A;  1THQ A;  4LSE A;  3POR A;  2PRN A;  3C5O A;  4D65 A;  4FMS A;  8PRN A;  4E1S A;  2N2L A;  5PRN A;  3AA7 A;  3VY9 X;  4E1T A;  1GFP A;  3VZT X;  1H6S 1;  4FRT A;  1HXT A;  3T24 A;  1QJ8 A;  3A2S X;  1PRN A;  1ZHY A;  4FRX A;  2Y0L A;  1Q9F A;  1QJP A;  2F1V A;  5D5D A;  2KC0 A;  3VE2 A;  3WI4 A;  3AAE A;  3HWB A;  3POX A;  3QRC A;  4QQ1 A;  4AYN A;  3AA1 A;  4D64 A;  5AFU K;  4FES A;  1BT9 A;  2J1N A;  2ODJ A;  5DL7 A;  2M07 A;  4AKM A;  1PHO A;  4GHB A;  3AA0 B;  1P4T A;  2ERV A;  5DL5 A;  2LHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...