1BXWA

Outer membrane protein a (ompa) transmembrane domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
172
structure length
172
Chain Sequence
MAPKDNTWYTGAKLGWSQYHDTGLINNNGPTHENKLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the outer membrane protein A transmembrane domain.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Membrane protein
molecule keywords PROTEIN (OUTER MEMBRANE PROTEIN A)
total genus 35
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 1998-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1bxwA00
2LHFA 1QJ9A 2X27X 1ORMA 3GP6A 2M06A 2N2MA 2N2LA 1Q9FA 1QJ8A 1QJPA 4PUXA 4RLCA 1BXWA 1Q9GA 1THQA 2F1VA 2GE4A 2MHLA 1P4TA 2JMMA 2M07A 2F1TA 3QRCA 2MNHA 3G7GA 1G90A 1MM4A 3C5OA 1MM5A 2K0LA 3QRAA 2ERVA
chains in the Genus database with same CATH superfamily
1IZNB 3VE1A 2Y0HA 2XE2A 3AAAA 3SYBA 1ORMA 1T1LA 4GCQA 4LSFA 3SYSA 2M06A 2N2MA 2W81C 5KAIO 3T20A 2F1CX 4GF4A 1OSMA 4KRAA 3PGRA 3POUA 2R88A 3BRYA 3UAQA 4B61A 5FVNA 4BUMX 4CTDA 3AAAB 4E1SA 4FOZA 4PUXA 2KZ7B 3LK3A 4AKRB 5TISO 3AA6B 4O3YA 3VE2A 3HOEA 1S5LO 4AYNA 3NSGA 1THQA 3PGSA 4FRXA 4FUVA 3UPGA 2M07A 2F1TA 2WVPA 3HW9A 3POXA 4O49A 2YNKA 1GFMA 4C4VA 2Y2XA 3JCUO 4N75A 6PRNA 8PRNA 3K19A 4FSOA 3T0SA 5GV0A 4D64A 3WU2O 3QRAA 3NJTA 3O0EA 1GFPA 1IZNA 4K3BA 5IYUA 5ADXK 2X27X 2XE5A 3GP6A 2KXPA 4O4UA 4O3ZA 3SY7A 2XMXA 4PJ0O 3TZGA 5T5FA 2XE3A 4D65A 3PORA 4JFBA 4AFKA 1ZHTA 2KDYA 4O3XB 2Y0LA 5GTIO 3PF1A 3SZVA 5AFUK 1QJ8A 1QJPA 2R4NA 1PHOA 4GCPA 3A2SX 2R4PA 2KXPB 3HOLA 2PORA 3SY9A 3AA7B 1PRNA 4PR7A 2O4VA 4RLCA 5JDPA 3VZUX 3LK41 4G76A 4U9CA 1T16A 5G38A 1Q9GA 5G26A 4C00A 2W80C 1GFQA 4AYDC 4D5UA 2F1VA 1YS5A 2X9KA 3POQA 4UB6O 5ADXL 3RBHA 3VZWX 3PQUA 3DWOX 1GFNA 3AA0B 4RJXA 7PRNA 1MM4A 1G90A 3C5OA 5E79O 3AA1A 3KVDD 1BT9A 4AYEC 5DL5A 3PQSA 4FQEA 3HWBA 5KAFO 4KR4A 4C4VB 1QJ9A 1ZHZA 4AYMC 5B5EO 3AA6A 3UU2A 4AKRA 2KZ7A 2IWVA 3T24A 4UB8O 4RJWA 4LSEA 2N2LA 2ODJA 5DL6A 2AXTO 2PRNA 3A0HO 3BRZA 3BS0A 2QTKA 4JCHA 5DL7A 1ZHXA 2ZFGA 3DZMA 2J4UP 2ZLDA 4FRTA 5DL8A 3LK3B 4G75A 2KC0A 3DA4A 4LSHA 2R4LA 4RLBA 2Y7SA 5GTHO 2YPVA 3WI4A 3EMNX 3AA0A 1ZHWA 3JTYA 1H6S1 2XTQA 4N74A 4FESA 3DWNA 4AUIA 5PRNA 2MHLA 4QQ1A 2JMMA 2MNHA 2XTRA 2FGRA 2R8AA 5B66O 2WJRA 3AA7A 3AAEA 1MPFA 2FGQX 4FZMA 4GHBA 5AFUL 4O4XA 4N58A 2LFUA 2LHFA 3PGUA 1HXUA 3LK42 4FT6A 4FZLA 2J1NA 3LK2A 5H2FO 3AA1B 1HXTA 5EE2A 5G3AA 1BH3A 2K4TA 4FMSA 1Q9FA 3PRNA 1HXXA 4XNKA 3DA3A 3V8UA 4FSPA 3VZTX 4AZLA 2WJQA 2R89A 4O3WA 2IWWA 1OPFA 4IL6O 1BXWA 4LSIA 4RL9A 3VY8X 2JQYA 4F4BA 3KZIO 3WI5A 3AAEB 2R4OA 4K3CA 3A0BO 2GE4A 4XNLA 1P4TA 1GFOA 2XE1A 3LK2B 5G39A 3SZDA 4AKMA 4AYID 3QRCA 3G7GA 4FZNA 4E1TA 2Y0KA 2XG6A 3FYXA 4KR8A 1ZHYA 4Z3TA 1MM5A 4GCSA 2K0LA 4C69X 4N59A 1E54A 2OMFA 5D5DA 2ERVA 3VY9X
chains in the Genus database with same CATH topology
1IZNB 3VE1A 2Y0HA 2XE2A 3AAAA 3SYBA 1ORMA 4GCQA 4LSFA 3SYSA 2M06A 2N2MA 2W81C 3T20A 4GF4A 1OSMA 4KRAA 3POUA 3UAQA 4B61A 4E1SA 5FVNA 4BUMX 3AAAB 4FOZA 4PUXA 2KZ7B 3LK3A 4AKRB 3AA6B 4O3YA 3VE2A 3HOEA 4AYNA 3NSGA 1THQA 4FRXA 4FUVA 3UPGA 2M07A 2F1TA 3POXA 3HW9A 4O49A 2YNKA 1GFMA 2Y2XA 6PRNA 8PRNA 3K19A 4FSOA 3T0SA 5GV0A 1E54A 4D64A 3QRAA 3O0EA 1GFPA 1IZNA 5IYUA 5ADXK 2X27X 2XE5A 3GP6A 2KXPA 4O4UA 4O3ZA 3SY7A 2XMXA 3TZGA 4D65A 5T5FA 2XE3A 3PORA 4JFBA 4AFKA 1ZHTA 2KDYA 4O3XB 2Y0LA 3SZVA 5AFUK 1QJ8A 1QJPA 1PHOA 4GCPA 3A2SX 3SY9A 2KXPB 3HOLA 2PORA 5JDPA 3AA7B 1PRNA 4RLCA 2O4VA 3VZUX 3LK41 4G76A 4U9CA 1Q9GA 5G26A 2W80C 1GFQA 4AYDC 2F1VA 1YS5A 3POQA 3RBHA 3VZWX 3PQUA 4RJXA 1GFNA 3AA0B 1G90A 7PRNA 1MM4A 3C5OA 3AA1A 3KVDD 1BT9A 4AYEC 5DL5A 3PQSA 3HWBA 4KR4A 1QJ9A 1ZHZA 4AYMC 3AA6A 4AKRA 2KZ7A 3T24A 4RJWA 4LSEA 2N2LA 2ODJA 5DL6A 5DL7A 2PRNA 4JCHA 2QTKA 1ZHXA 2ZFGA 2J4UP 2ZLDA 4FRTA 5DL8A 3LK3B 4G75A 2KC0A 3DA4A 4LSHA 4RLBA 2Y7SA 2YPVA 3WI4A 3EMNX 3AA0A 1ZHWA 3JTYA 1H6S1 2XTQA 4AUIA 4FESA 5PRNA 2MHLA 4QQ1A 2JMMA 2MNHA 2FGRA 3AA7A 3AAEA 1MPFA 2FGQX 4FZMA 4GHBA 5AFUL 4O4XA 4N58A 2LFUA 2LHFA 1HXUA 3LK42 4FT6A 4FZLA 2J1NA 3LK2A 3AA1B 1HXTA 5EE2A 1BH3A 2K4TA 4FMSA 1Q9FA 3PRNA 1HXXA 4XNKA 3DA3A 3V8UA 4FSPA 3VZTX 4AZLA 4O3WA 1OPFA 1BXWA 4LSIA 4RL9A 3VY8X 4F4BA 3WI5A 3AAEB 4XNLA 3UU2A 5ADXL 2GE4A 4D5UA 1P4TA 1GFOA 2XE1A 3LK2B 3SZDA 4AYID 4AKMA 3QRCA 3G7GA 4FZNA 4E1TA 2Y0KA 2XG6A 3FYXA 4KR8A 1ZHYA 4Z3TA 1MM5A 4GCSA 2K0LA 4C69X 4N59A 2XTRA 2OMFA 5D5DA 2ERVA 3VY9X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHF A;  1QJ9 A;  2X27 X;  1ORM A;  3GP6 A;  2M06 A;  2N2M A;  2N2L A;  1Q9F A;  1QJ8 A;  1QJP A;  4PUX A;  4RLC A;  1BXW A;  1Q9G A;  1THQ A;  2F1V A;  2GE4 A;  2MHL A;  1P4T A;  2JMM A;  2M07 A;  2F1T A;  3QRC A;  2MNH A;  3G7G A;  1G90 A;  1MM4 A;  3C5O A;  1MM5 A;  2K0L A;  3QRA A;  2ERV A; 
#chains in the Genus database with same CATH topology
 1IZN B;  3VE1 A;  2Y0H A;  2XE2 A;  3AAA A;  3SYB A;  1ORM A;  1T1L A;  4GCQ A;  4LSF A;  3SYS A;  2M06 A;  2N2M A;  2W81 C;  5KAI O;  3T20 A;  2F1C X;  4GF4 A;  1OSM A;  4KRA A;  3PGR A;  3POU A;  2R88 A;  3BRY A;  3UAQ A;  4B61 A;  5FVN A;  4BUM X;  4CTD A;  3AAA B;  4E1S A;  4FOZ A;  4PUX A;  2KZ7 B;  3LK3 A;  4AKR B;  5TIS O;  3AA6 B;  4O3Y A;  3VE2 A;  3HOE A;  1S5L O;  4AYN A;  3NSG A;  1THQ A;  3PGS A;  4FRX A;  4FUV A;  3UPG A;  2M07 A;  2F1T A;  2WVP A;  3HW9 A;  3POX A;  4O49 A;  2YNK A;  1GFM A;  4C4V A;  2Y2X A;  3JCU O;  4N75 A;  6PRN A;  8PRN A;  3K19 A;  4FSO A;  3T0S A;  5GV0 A;  4D64 A;  3WU2 O;  3QRA A;  3NJT A;  3O0E A;  1GFP A;  1IZN A;  4K3B A;  5IYU A;  5ADX K;  2X27 X;  2XE5 A;  3GP6 A;  2KXP A;  4O4U A;  4O3Z A;  3SY7 A;  2XMX A;  4PJ0 O;  3TZG A;  5T5F A;  2XE3 A;  4D65 A;  3POR A;  4JFB A;  4AFK A;  1ZHT A;  2KDY A;  4O3X B;  2Y0L A;  5GTI O;  3PF1 A;  3SZV A;  5AFU K;  1QJ8 A;  1QJP A;  2R4N A;  1PHO A;  4GCP A;  3A2S X;  2R4P A;  2KXP B;  3HOL A;  2POR A;  3SY9 A;  3AA7 B;  1PRN A;  4PR7 A;  2O4V A;  4RLC A;  5JDP A;  3VZU X;  3LK4 1;  4G76 A;  4U9C A;  1T16 A;  5G38 A;  1Q9G A;  5G26 A;  4C00 A;  2W80 C;  1GFQ A;  4AYD C;  4D5U A;  2F1V A;  1YS5 A;  2X9K A;  3POQ A;  4UB6 O;  5ADX L;  3RBH A;  3VZW X;  3PQU A;  3DWO X;  1GFN A;  3AA0 B;  4RJX A;  7PRN A;  1MM4 A;  1G90 A;  3C5O A;  5E79 O;  3AA1 A;  3KVD D;  1BT9 A;  4AYE C;  5DL5 A;  3PQS A;  4FQE A;  3HWB A;  5KAF O;  4KR4 A;  4C4V B;  1QJ9 A;  1ZHZ A;  4AYM C;  5B5E O;  3AA6 A;  3UU2 A;  4AKR A;  2KZ7 A;  2IWV A;  3T24 A;  4UB8 O;  4RJW A;  4LSE A;  2N2L A;  2ODJ A;  5DL6 A;  2AXT O;  2PRN A;  3A0H O;  3BRZ A;  3BS0 A;  2QTK A;  4JCH A;  5DL7 A;  1ZHX A;  2ZFG A;  3DZM A;  2J4U P;  2ZLD A;  4FRT A;  5DL8 A;  3LK3 B;  4G75 A;  2KC0 A;  3DA4 A;  4LSH A;  2R4L A;  4RLB A;  2Y7S A;  5GTH O;  2YPV A;  3WI4 A;  3EMN X;  3AA0 A;  1ZHW A;  3JTY A;  1H6S 1;  2XTQ A;  4N74 A;  4FES A;  3DWN A;  4AUI A;  5PRN A;  2MHL A;  4QQ1 A;  2JMM A;  2MNH A;  2XTR A;  2FGR A;  2R8A A;  5B66 O;  2WJR A;  3AA7 A;  3AAE A;  1MPF A;  2FGQ X;  4FZM A;  4GHB A;  5AFU L;  4O4X A;  4N58 A;  2LFU A;  2LHF A;  3PGU A;  1HXU A;  3LK4 2;  4FT6 A;  4FZL A;  2J1N A;  3LK2 A;  5H2F O;  3AA1 B;  1HXT A;  5EE2 A;  5G3A A;  1BH3 A;  2K4T A;  4FMS A;  1Q9F A;  3PRN A;  1HXX A;  4XNK A;  3DA3 A;  3V8U A;  4FSP A;  3VZT X;  4AZL A;  2WJQ A;  2R89 A;  4O3W A;  2IWW A;  1OPF A;  4IL6 O;  1BXW A;  4LSI A;  4RL9 A;  3VY8 X;  2JQY A;  4F4B A;  3KZI O;  3WI5 A;  3AAE B;  2R4O A;  4K3C A;  3A0B O;  2GE4 A;  4XNL A;  1P4T A;  1GFO A;  2XE1 A;  3LK2 B;  5G39 A;  3SZD A;  4AKM A;  4AYI D;  3QRC A;  3G7G A;  4FZN A;  4E1T A;  2Y0K A;  2XG6 A;  3FYX A;  4KR8 A;  1ZHY A;  4Z3T A;  1MM5 A;  4GCS A;  2K0L A;  4C69 X;  4N59 A;  1E54 A;  2OMF A;  5D5D A;  2ERV A;  3VY9 X; 
#chains in the Genus database with same CATH homology
 1IZN B;  3VE1 A;  2Y0H A;  2XE2 A;  3AAA A;  3SYB A;  1ORM A;  4GCQ A;  4LSF A;  3SYS A;  2M06 A;  2N2M A;  2W81 C;  3T20 A;  4GF4 A;  1OSM A;  4KRA A;  3POU A;  3UAQ A;  4B61 A;  4E1S A;  5FVN A;  4BUM X;  3AAA B;  4FOZ A;  4PUX A;  2KZ7 B;  3LK3 A;  4AKR B;  3AA6 B;  4O3Y A;  3VE2 A;  3HOE A;  4AYN A;  3NSG A;  1THQ A;  4FRX A;  4FUV A;  3UPG A;  2M07 A;  2F1T A;  3POX A;  3HW9 A;  4O49 A;  2YNK A;  1GFM A;  2Y2X A;  6PRN A;  8PRN A;  3K19 A;  4FSO A;  3T0S A;  5GV0 A;  1E54 A;  4D64 A;  3QRA A;  3O0E A;  1GFP A;  1IZN A;  5IYU A;  5ADX K;  2X27 X;  2XE5 A;  3GP6 A;  2KXP A;  4O4U A;  4O3Z A;  3SY7 A;  2XMX A;  3TZG A;  4D65 A;  5T5F A;  2XE3 A;  3POR A;  4JFB A;  4AFK A;  1ZHT A;  2KDY A;  4O3X B;  2Y0L A;  3SZV A;  5AFU K;  1QJ8 A;  1QJP A;  1PHO A;  4GCP A;  3A2S X;  3SY9 A;  2KXP B;  3HOL A;  2POR A;  5JDP A;  3AA7 B;  1PRN A;  4RLC A;  2O4V A;  3VZU X;  3LK4 1;  4G76 A;  4U9C A;  1Q9G A;  5G26 A;  2W80 C;  1GFQ A;  4AYD C;  2F1V A;  1YS5 A;  3POQ A;  3RBH A;  3VZW X;  3PQU A;  4RJX A;  1GFN A;  3AA0 B;  1G90 A;  7PRN A;  1MM4 A;  3C5O A;  3AA1 A;  3KVD D;  1BT9 A;  4AYE C;  5DL5 A;  3PQS A;  3HWB A;  4KR4 A;  1QJ9 A;  1ZHZ A;  4AYM C;  3AA6 A;  4AKR A;  2KZ7 A;  3T24 A;  4RJW A;  4LSE A;  2N2L A;  2ODJ A;  5DL6 A;  5DL7 A;  2PRN A;  4JCH A;  2QTK A;  1ZHX A;  2ZFG A;  2J4U P;  2ZLD A;  4FRT A;  5DL8 A;  3LK3 B;  4G75 A;  2KC0 A;  3DA4 A;  4LSH A;  4RLB A;  2Y7S A;  2YPV A;  3WI4 A;  3EMN X;  3AA0 A;  1ZHW A;  3JTY A;  1H6S 1;  2XTQ A;  4AUI A;  4FES A;  5PRN A;  2MHL A;  4QQ1 A;  2JMM A;  2MNH A;  2FGR A;  3AA7 A;  3AAE A;  1MPF A;  2FGQ X;  4FZM A;  4GHB A;  5AFU L;  4O4X A;  4N58 A;  2LFU A;  2LHF A;  1HXU A;  3LK4 2;  4FT6 A;  4FZL A;  2J1N A;  3LK2 A;  3AA1 B;  1HXT A;  5EE2 A;  1BH3 A;  2K4T A;  4FMS A;  1Q9F A;  3PRN A;  1HXX A;  4XNK A;  3DA3 A;  3V8U A;  4FSP A;  3VZT X;  4AZL A;  4O3W A;  1OPF A;  1BXW A;  4LSI A;  4RL9 A;  3VY8 X;  4F4B A;  3WI5 A;  3AAE B;  4XNL A;  3UU2 A;  5ADX L;  2GE4 A;  4D5U A;  1P4T A;  1GFO A;  2XE1 A;  3LK2 B;  3SZD A;  4AYI D;  4AKM A;  3QRC A;  3G7G A;  4FZN A;  4E1T A;  2Y0K A;  2XG6 A;  3FYX A;  4KR8 A;  1ZHY A;  4Z3T A;  1MM5 A;  4GCS A;  2K0L A;  4C69 X;  4N59 A;  2XTR A;  2OMF A;  5D5D A;  2ERV A;  3VY9 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...