1BY1A

Dbl homology domain from beta-pix
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
209
structure length
209
Chain Sequence
MKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PIX)
publication title Structure and Mutagenesis of the Dbl Homology Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 48
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 1998-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1by1A00
5FI1A 2NZ8B 1DBHA 2VRWB 3ODXA 3KSYA 1FOEA 2KR9A 1F5XA 2Z0QA 3ODOA 1KZGA 3T06A 5JHHA 1XD4A 3ODWA 3GF9A 1KI1B 3MPXA 3P6AA 1KZ7A 4MT7A 1RJ2A 1NTYA 5FI0A 4YONA 2PZ1A 2DFKA 2RGNB 4GYVA 3JV3A 3KY9A 3KZ1A 3QBVB 5JHGA 1BY1A 1TXDA 4GOUA 1X86A 3BJIA 3EO2A 4GZUA 4D0OA 1XCGA 1LB1A 2DX1A 4D0NB
chains in the Genus database with same CATH superfamily
5FI1A 2NZ8B 1DBHA 2VRWB 3ODXA 3KSYA 1FOEA 2KR9A 1F5XA 2Z0QA 3ODOA 1KZGA 3T06A 5JHHA 1XD4A 3ODWA 3GF9A 1KI1B 3MPXA 3P6AA 1KZ7A 4MT7A 1RJ2A 1NTYA 5FI0A 4YONA 2PZ1A 2DFKA 2RGNB 4GYVA 3JV3A 3KY9A 3KZ1A 3QBVB 5JHGA 1BY1A 1TXDA 4GOUA 1X86A 3BJIA 3EO2A 4GZUA 4D0OA 1XCGA 1LB1A 2DX1A 4D0NB
chains in the Genus database with same CATH topology
5FI1A 2NZ8B 1DBHA 2VRWB 3ODXA 3KSYA 1FOEA 2KR9A 1F5XA 2Z0QA 3ODOA 1KZGA 3T06A 5JHHA 1XD4A 3ODWA 3GF9A 1KI1B 3MPXA 3P6AA 1KZ7A 4MT7A 1RJ2A 1NTYA 5FI0A 4YONA 2PZ1A 2DFKA 2RGNB 4GYVA 3JV3A 3KY9A 3KZ1A 3QBVB 5JHGA 1BY1A 1TXDA 4GOUA 1X86A 3BJIA 3EO2A 4GZUA 4D0OA 1XCGA 1LB1A 2DX1A 4D0NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FI1 A;  2NZ8 B;  1DBH A;  2VRW B;  3ODX A;  3KSY A;  1FOE A;  2KR9 A;  1F5X A;  2Z0Q A;  3ODO A;  1KZG A;  3T06 A;  5JHH A;  1XD4 A;  3ODW A;  3GF9 A;  1KI1 B;  3MPX A;  3P6A A;  1KZ7 A;  4MT7 A;  1RJ2 A;  1NTY A;  5FI0 A;  4YON A;  2PZ1 A;  2DFK A;  2RGN B;  4GYV A;  3JV3 A;  3KY9 A;  3KZ1 A;  3QBV B;  5JHG A;  1BY1 A;  1TXD A;  4GOU A;  1X86 A;  3BJI A;  3EO2 A;  4GZU A;  4D0O A;  1XCG A;  1LB1 A;  2DX1 A;  4D0N B; 
#chains in the Genus database with same CATH topology
 5FI1 A;  2NZ8 B;  1DBH A;  2VRW B;  3ODX A;  3KSY A;  1FOE A;  2KR9 A;  1F5X A;  2Z0Q A;  3ODO A;  1KZG A;  3T06 A;  5JHH A;  1XD4 A;  3ODW A;  3GF9 A;  1KI1 B;  3MPX A;  3P6A A;  1KZ7 A;  4MT7 A;  1RJ2 A;  1NTY A;  5FI0 A;  4YON A;  2PZ1 A;  2DFK A;  2RGN B;  4GYV A;  3JV3 A;  3KY9 A;  3KZ1 A;  3QBV B;  5JHG A;  1BY1 A;  1TXD A;  4GOU A;  1X86 A;  3BJI A;  3EO2 A;  4GZU A;  4D0O A;  1XCG A;  1LB1 A;  2DX1 A;  4D0N B; 
#chains in the Genus database with same CATH homology
 5FI1 A;  2NZ8 B;  1DBH A;  2VRW B;  3ODX A;  3KSY A;  1FOE A;  2KR9 A;  1F5X A;  2Z0Q A;  3ODO A;  1KZG A;  3T06 A;  5JHH A;  1XD4 A;  3ODW A;  3GF9 A;  1KI1 B;  3MPX A;  3P6A A;  1KZ7 A;  4MT7 A;  1RJ2 A;  1NTY A;  5FI0 A;  4YON A;  2PZ1 A;  2DFK A;  2RGN B;  4GYV A;  3JV3 A;  3KY9 A;  3KZ1 A;  3QBV B;  5JHG A;  1BY1 A;  1TXD A;  4GOU A;  1X86 A;  3BJI A;  3EO2 A;  4GZU A;  4D0O A;  1XCG A;  1LB1 A;  2DX1 A;  4D0N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...