1BY1A

Dbl homology domain from beta-pix
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
209
structure length
209
Chain Sequence
b'MKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PIX)
publication title Structure and Mutagenesis of the Dbl Homology Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 48
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 1998-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1by1A00
4MT7A 2PZ1A 1KI1B 1RJ2A 2NZ8B 5FI1A 1LB1A 3KSYA 2DFKA 1KZ7A 1NTYA 3ODOA 3T06A 3QBVB 1DBHA 4GYVA 3GF9A 3KZ1A 3JV3A 4GZUA 1F5XA 5FI0A 2RGNB 1XD4A 3ODXA 1X86A 3ODWA 3P6AA 4D0OA 2VRWB 2KR9A 5JHHA 1FOEA 3BJIA 4YONA 2Z0QA 1TXDA 3KY9A 3EO2A 3MPXA 4GOUA 1BY1A 5JHGA 1XCGA 2DX1A 1KZGA 4D0NB
chains in the Genus database with same CATH superfamily
4MT7A 2PZ1A 1KI1B 1RJ2A 2NZ8B 5FI1A 1LB1A 3KSYA 2DFKA 1KZ7A 1NTYA 3ODOA 3T06A 3QBVB 1DBHA 4GYVA 3GF9A 3KZ1A 3JV3A 4GZUA 1F5XA 5FI0A 2RGNB 1XD4A 3ODXA 1X86A 3ODWA 3P6AA 4D0OA 2VRWB 2KR9A 5JHHA 1FOEA 3BJIA 4YONA 2Z0QA 1TXDA 3KY9A 3EO2A 3MPXA 4GOUA 1BY1A 5JHGA 1XCGA 2DX1A 1KZGA 4D0NB
chains in the Genus database with same CATH topology
4MT7A 2PZ1A 1KI1B 1RJ2A 2NZ8B 5FI1A 1LB1A 3KSYA 2DFKA 1KZ7A 1NTYA 3ODOA 3T06A 3QBVB 1DBHA 4GYVA 3GF9A 3KZ1A 3JV3A 4GZUA 1F5XA 5FI0A 2RGNB 1XD4A 3ODXA 1X86A 3ODWA 3P6AA 4D0OA 2VRWB 2KR9A 5JHHA 1FOEA 3BJIA 4YONA 2Z0QA 1TXDA 3KY9A 3EO2A 3MPXA 4GOUA 1BY1A 5JHGA 1XCGA 2DX1A 1KZGA 4D0NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MT7 A;  2PZ1 A;  1KI1 B;  1RJ2 A;  2NZ8 B;  5FI1 A;  1LB1 A;  3KSY A;  2DFK A;  1KZ7 A;  1NTY A;  3ODO A;  3T06 A;  3QBV B;  1DBH A;  4GYV A;  3GF9 A;  3KZ1 A;  3JV3 A;  4GZU A;  1F5X A;  5FI0 A;  2RGN B;  1XD4 A;  3ODX A;  1X86 A;  3ODW A;  3P6A A;  4D0O A;  2VRW B;  2KR9 A;  5JHH A;  1FOE A;  3BJI A;  4YON A;  2Z0Q A;  1TXD A;  3KY9 A;  3EO2 A;  3MPX A;  4GOU A;  1BY1 A;  5JHG A;  1XCG A;  2DX1 A;  1KZG A;  4D0N B; 
#chains in the Genus database with same CATH topology
 4MT7 A;  2PZ1 A;  1KI1 B;  1RJ2 A;  2NZ8 B;  5FI1 A;  1LB1 A;  3KSY A;  2DFK A;  1KZ7 A;  1NTY A;  3ODO A;  3T06 A;  3QBV B;  1DBH A;  4GYV A;  3GF9 A;  3KZ1 A;  3JV3 A;  4GZU A;  1F5X A;  5FI0 A;  2RGN B;  1XD4 A;  3ODX A;  1X86 A;  3ODW A;  3P6A A;  4D0O A;  2VRW B;  2KR9 A;  5JHH A;  1FOE A;  3BJI A;  4YON A;  2Z0Q A;  1TXD A;  3KY9 A;  3EO2 A;  3MPX A;  4GOU A;  1BY1 A;  5JHG A;  1XCG A;  2DX1 A;  1KZG A;  4D0N B; 
#chains in the Genus database with same CATH homology
 4MT7 A;  2PZ1 A;  1KI1 B;  1RJ2 A;  2NZ8 B;  5FI1 A;  1LB1 A;  3KSY A;  2DFK A;  1KZ7 A;  1NTY A;  3ODO A;  3T06 A;  3QBV B;  1DBH A;  4GYV A;  3GF9 A;  3KZ1 A;  3JV3 A;  4GZU A;  1F5X A;  5FI0 A;  2RGN B;  1XD4 A;  3ODX A;  1X86 A;  3ODW A;  3P6A A;  4D0O A;  2VRW B;  2KR9 A;  5JHH A;  1FOE A;  3BJI A;  4YON A;  2Z0Q A;  1TXD A;  3KY9 A;  3EO2 A;  3MPX A;  4GOU A;  1BY1 A;  5JHG A;  1XCG A;  2DX1 A;  1KZG A;  4D0N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...