1BYIA

Structure of apo-dethiobiotin synthase at 0.97 angstroms resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHASE
publication title Structure of dethiobiotin synthetase at 0.97 A resolution.
pubmed doi rcsb
molecule tags Ligase
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1byiA00
4P33A 4LY6A 1VYVA 3GJ6A 5EP2A 4EIWA 3IQWA 4QGAA 3GLIB 1PV4A 2XTZA 3CPEA 4WAUA 1W4AA 4Q9LA 3A37A 4P0TA 3GPLA 3EC1A 1XEWY 2ZQ5A 4FCVA 5LD2B 3THWA 3TK1A 4HZUA 3PUZA 3DZDA 3QE0A 3RDPA 1CBUA 2NPFA 1WA5A 5HR5A 1JB1A 3TH5A 3GD7A 1U90A 2Q21A 2ZTSA 4DSUA 1N25A 1KOFA 2G6BA 3AH8A 3NH6A 4D4LA 1HA3A 3CLVA 2TMKA 2IK8A 4UJ5A 4JLNA 1HQCA 5BXQC 2W0MA 5FPSA 2BV3A 1E1RD 4US0R 5LDDC 5JJIA 2P6UA 4AC9A 2GXSA 2IC5A 3NG1A 3E5HA 2CE7A 3G0HA 3CRQA 2IW3A 2V6IA 2Q9BA 1P2UA 1G3MA 1GOTA 4FCWA 5LB2A 1Q1ZA 3MFYA 2BEKA 4Z8XA 5KOYA 1KI9A 4FI3C 3LNCA 2VHCA 4CIDA 2AK2A 3K70D 2J87A 1SVLA 4ASUD 1SXJC 4RFSB 2FPMA 3X1YA 5FUXA 1II9A 1YJ5A 4Q4AA 5IDVA 1OLOA 3IILA 1F6BA 4P32A 3UG7A 1K6MA 5JZVA 3LAWA 3L0OA 3UK6A 3TAUA 1OF1A 4BRWA 2HDNB 3MWKA 3SJAA 3E1SA 5HZHA 1NNEA 1KJZA 3VR4A 3NIBA 1QVAA 4P4SB 3HR7A 2XXAA 1NJFA 2IXEA 5HE9A 4EPXA 2Q3FA 3T61A 1N0UA 2GWHA 2WSMA 4HB0A 4YC7A 3CZPA 1CR0A 4L8GA 3EPHA 1DAHA 1MABB 5F98A 1JXMA 2VO1A 1LF5A 2WJJA 1G3UA 1NN5A 2XNDD 2QU8A 2E87A 4IOKA 3B2EA 4URWR 1JEDA 3CKLA 1T3HA 1GSIA 3LLUA 1SXJA 5CK4A 4U00A 4I81A 1XPUA 4OQXA 3SI7A 3AF2A 1Y63A 1C1YA 2JGNA 3TUJC 2HT6A 3SJCA 4DLWA 4Q7KA 2IBMA 2RGEA 1OH8A 2G1KA 2WTUA 4KBFA 1O87A 1Z83A 1J90A 2QTFA 1OXTA 3KL4A 4RZUA 3WRYC 4B3CA 1L2TA 3OAAD 3QXCA 1EK0A 2C04A 2FZLA 2UVQA 4B43A 3I5XA 1KI6B 2P65A 1XTKA 1R0ZA 2GJKA 4Q1DA 5BWMA 5K8TA 2FG5A 4QBFA 2ZXUA 1X8LA 3U2QA 5KTYA 5EP3A 1M2OB 1OYWA 4DLVA 3CNOA 3QBVA 1IN4A 2G3YA 3VR6A 2CHGA 4M1OA 4BFVA 1ZCAA 4KI0A 2OCPA 4PZYA 5TY0A 4CDGA 5JJLA 2DBYA 4CRWB 4O3MA 5KU1A 1BO6A 2Q3HA 5FBRB 1DAFA 4TQ9A 4PHHA 2IYVA 3CNNA 2D3WA 4KFSA 3L2OB 1WP9A 1P3JA 1YR9A 2WWXA 4M9XA 5EZ6B 2CMKA 1JAHA 5J4HA 3SHFA 2NO6A 3ASZA 2F9LA 1FX0B 1AGPA 1MH1A 4BFWA 4IOLA 2ZS9A 5DHAA 1TU4A 2WWHA 3K0SA 3L8YA 2OZEA 4MGYR 1E98A 4KFRA 1CJUC 1FTSA 1G18A 1Q44A 5SZKB 3HR8A 3QKRB 4YLGA 3WHLA 3CPJB 3SBEA 1J2JA 1KK0A 1EFHA 3K0FA 2NPIA 2AFHE 3GJ7A 4RJLA 5D3QA 1YE8A 2BM1A 3ADKA 3FGNA 3TQCA 2GZHA 2BMEA 4FMDB 2C9YA 2VHQA 4BEJA 1DO2A 2H1LA 4HLUC 3RANA 4ARZA 1NLYA 4Q47A 3TVTA 4JIMA 3PEVA 1UBFA 3FMIA 2OBNA 3ZH9B 3ICEA 2IS4A 4WW0A 1AQUA 2VLIA 1G8GA 2DFLA 2H57A 3SYKA 2IWHA 2KSQA 1TF2A 3Q9LA 2PH1A 1AGRA 1IHUA 2QT0A 2ZRDA 1Q22A 4D0LB 2OXCA 3CRVA 5CYOA 4ZCLA 2GEUA 3OHMA 4JKIA 3ZD6A 2VYFA 2BKEA 2C2HA 1Z47A 4WZ6A 3LFUA 2J1LA 4AI6A 1NLFA 2G88A 5GADl 4PO9A 1VCNA 4US1R 3LBHA 4LGMA 2VF7A 2QI9C 4S2EA 2ZROA 3DM9B 5D3MA 1ZM9A 2GRJA 4DEYA 1N3BA 4OHVA 3ZLJA 2DB3A 5FPHA 2B6HA 2QORA 3VU9A 2GJ9A 1W0KA 4HZIA 2YJTD 3C4JA 4NCHA 2F7SA 1R5OA 2ZRJA 3LDAA 3TW4A 4GOKA 1LB1B 3CRW1 4HLUA 1ELOA 2EVWX 3DDCA 1YU9A 3QJYA 2NZ8A 2O8CB 4OKSA 2ZSAA 1AA9A 1KKLA 5ANRB 3SU8A 1CTQA 4YQFA 2YHSA 2KBEA 2ZRKA 3WY9A 2ZU0C 1A2KC 2QP4A 3ZIAA 1IXSB 3IBGA 3QKUA 4UNNA 4JS0A 1U94A 3DPUA 3AVYA 2A78A 1RJ9A 2FU5C 4YXWA 3AKYA 1EFUA 3TMKA 2WWGA 2YKGA 2VP5A 5GJWC 3D31A 3AGQA 3QVVA 2XB4A 1D5CA 3WYAA 3R9WA 3T1VA 3SFZA 5BYKA 1PJRA 2Z6VA 1N0VC 1AIPA 1G20E 1XX6A 3GLFE 1ZAKA 3UPUA 2JAQA 1YZTA 4RD4A 1DOAA 2ZREA 2G1JA 4JSYA 4A2PA 1W36D 1S9DA 2BWJA 3OE7D 4GZMA 4HB4A 4PQFA 4BFXA 4D0GA 4OYHA 4DDWA 5BN4A 1FUUA 1KJWA 2IYQA 3FHTA 2VHTA 3THOA 2BEJA 2O0KA 2Z4RA 2OLKA 4UNPA 4JYCA 1S4QA 1TQ4A 2QN6A 1KY2A 3RLFA 2G9NA 4Q00A 3RAPR 2QAGC 4DIDA 2RGDA 3PENA 4DEXA 3PCRB 3K70B 4B35A 1P62B 1ZM3A 1S1MA 1VYUA 1KDPA 3N2EA 5ELXA 1CJMA 5B57C 5FR1A 1H8EA 2CVFA 3DM5A 5FI0B 3BBPA 3NC1C 3TSWA 4Q21A 4D81A 2O8BA 3KKNA 4HEJA 1EX7A 4JKYA 3RHFA 2ZRCA 1Z6TA 1G8FA 3VKWA 1YZLA 1IJFA 1ZRHA 2J9RA 2WWFA 1G7RA 2H17A 5J4KA 4B2LA 5AJZA 2D7CA 3IEVA 1FMJA 1T8UA 4LBWA 4M22A 3B13B 3R7WA 1WDTA 3T5DA 4EPTA 2BBSA 4ZDJA 4GNKA 1KI2A 4M1MA 1ZC4A 4A0FA 1COWA 3NTUA 3KJGA 4IRUB 1LY1A 3T35A 2JJ2D 1NIJA 821PA 3GEIA 5KSOA 4NYIR 4W5HA 2B7CA 4LHXA 2XOKA 1V43A 4C0AC 4A6XA 1E0SA 3H4MA 2NQ2C 3N2IA 1Q0UA 4Q4HA 5JFGA 5L3SB 4R9UC 4KYIB 3A4LA 2JLYA 3W3AA 4URZR 3VR3A 3FHCB 1OB2A 1F2TA 5JCZA 1NMXA 4NDZA 1L7VC 2XB2A 2A5JA 2W83A 2HCBA 1SKYE 2HLDA 5EUQB 2PCLA 4EPWA 3KKOA 2GTPA 1Z0JA 3IIMA 4LI0A 2ZUDA 3K8YA 3LW7A 3EA0A 2ZRLA 2GCPA 1G7TA 3U6BA 4BFTA 3Q5DA 4DDUA 4JLMA 2FSGA 4NYJQ 4MRNA 3SC3A 4C0SA 1N5LA 2O8EB 4XD7A 4Y0VA 2OE2A 3FB4A 5H1YA 3ZYCA 1QHYA 3K9HA 4P4UA 2VSFA 3GLHE 3UXMA 1XMJA 3REFA 1FPMA 2O8FA 3FKSD 3B5JA 4XVRA 2KI5A 5L3VA 4YDSA 3QPWA 5AJYA 5B58C 2OCYC 3GJ5A 1CRQA 5B30A 4BLTA 1W0JD 3U3KA 2O5VA 4Q1AA 4UNRA 4QXAA 4CYMA 1EWQA 4C7OB 2O8DA 3PQCA 4PHGA 3C41J 3CX7A 4PR0A 4TMWA 5AJVB 3HWSA 3AVTA 2G77B 1DS6A 3RRMA 2Z83A 2ECKA 3CH5A 3VFDA 2EU8A 1TF7A 4YMSA 1E4VA 3U7EB 1QHHA 2EFCB 1PLLA 3HU1A 2GXQA 3B1ZA 4IHQA 3ZD7A 2MSCB 1XTJA 2J3EA 3AEZA 1P2VA 4Z8YA 4ZI3A 3DKPA 4PAMA 1SHKA 1J99A 3AF4A 4DBLC 3G82C 5DI9A 2E9SA 2GZAA 2AKYA 3P27A 2VP9A 5CLLA 3RS0A 2R44A 1SVWA 4S35A 3IEUA 1MABA 3GLHA 4FCTA 4EPYA 2JLRA 1VG0B 2AXNA 5KNBA 4LUCA 4TYQA 3HYRA 2FGJA 1XJ0A 4JLBA 1GL9B 2ZANA 4MRPA 4D82A 4ZI2A 2H18A 2YOHA 4HI0E 4OHYA 4KVAA 1Z6YA 4MGIR 521PA 2PLRA 2R65A 1ZM2A 1JI0A 2OFXA 3L0IB 1BOFA 2RGAA 2ODWA 3VX3A 1Z0AA 3QQ5A 1MV5A 4B32A 2R6CA 2GBLC 3H0KA 2JDID 3HP1A 3DEFA 3HPQA 1XEXB 1UBGA 3CF2A 2OSBA 1EX6A 4D4MA 2BKUA 1Q3TA 2B92A 1QHGA 4TTQA 4QC2A 2FPKA 4AKGA 2WZQA 1Z5ZA 5JWOA 1GNQA 2A5GA 4LJ5A 2N46A 1OHHA 4A6PA 1Z08A 2CBZA 1Z6XA 4ESHA 4OQNA 1ZNZA 2B21A 5DYIA 1GUAA 2ZYTX 3M0EA 1Z07A 2WIBA 1XTSA 4PPQA 1N6IA 1DO0A 4DLUA 4A92A 3LWNA 3KKMA 3PEWA 1B23P 1KDRA 1NRJB 1QDEA 1T3SA 3P26A 4V0ME 5KUTA 3VHXA 2CXXA 4Q4JA 2GJSA 4M1SA 1FX0A 1DELA 3EXAA 1KSGA 2GF9A 3A58B 1EFCA 5SZHB 1BMFD 2V9PA 1VKJA 1NVVR 1OV4A 3GJ3A 3OIYA 1W36B 2GBLA 1S9HA 3SJZA 5JMTA 2FFQA 3W5JA 2ZJBA 3P1JA 4P3YA 1OB5A 2JJ1D 1ZU5A 2I1QA 2PZGA 1KAOA 3K1JA 3L0PA 5HKKA 2C5LA 1TQ6A 2YYZA 1EFTA 1HTWA 4CF7A 1G3QA 4MGKR 5DI3B 4Z1MA 3AUXA 4JBWA 2SHKA 4K81B 4GBMA 1UFQA 4DLZA 1N6KA 1W1WA 3EIQA 3I3SR 4G3XA 1ZUIA 2DWQA 3PUWA 4KLZA 4PO1A 3MAAC 3C5CA 4IOMA 4DDTA 2PEZA 4N0EA 1Z8FA 3C16C 2F6RA 3NH9A 4C0QC 5G3YA 3KXLA 1XPRA 1J8YF 2Q9AA 2PX3A 4B73A 2HT1A 5E3HA 2GJAA 2PMDA 4DHEA 5IHPA 1SHZA 4D25A 1TEVA 2DWOA 1IN6A 4BPBA 4QM7A 4OI1A 1DAKA 2J0UA 1X3SA 1HE1C 2ZI5A 4I4LA 4C30A 4W5JA 2BCGY 3K0CC 5F2EA 5KDDA 3AP2A 1GNPA 3B1VA 4LJ4A 2WJGA 1JBKA 3S1AA 4QL3A 3V9PA 3OFND 3A4MA 1R0YA 1ZUHA 2FNAA 1UF9A 4GMXA 2PT7A 4GDFA 5IK2D 2IS1A 2O8CA 2XZOA 4OL0A 4HLCA 1G4UR 5H70A 2GK7A 2QE7A 5KDLA 4XTCS 3AVVA 2J7KA 1E2GA 3W90A 2RAPA 2WICA 2ORVA 3FKQA 2FPLA 3GJXC 1SQ5A 2FZ4A 1PUJA 3U3MA 3AVWA 1X8KA 4K8OA 1IN8A 3LQQA 4DWJA 4ZCMA 3SNHA 1U9IC 2AR7A 1K8RA 1KDOA 2V4ZA 3B6EA 4MQBA 4MUAA 1XD9A 2WKRA 1FW6A 3EPJA 5EUMA 3DKVA 3K0CA 3W8NA 5FOSA 4Q02A 3MUFA 4Q19A 1TX4B 1XXHA 3V00A 2ZRPA 3X1DA 3CO5A 3QXJA 1GDDA 1E1RA 1JR3E 1S2MA 4I1VA 1D2EA 1XU4A 3NXSA 5H68A 3T15A 4TMXA 4TMTA 2ZPTX 1JQLB 4A8JC 1QZXA 5L3RA 8OHMA 3CONA 2PZEA 4A0RA 4PC3A 3VR1A 3EG5A 3LO5A 4MKGA 2XGJA 1JQJC 1KMHB 4R98A 2RKOA 3RC3A 3THXB 1XPOA 5FOUA 1UAAA 1CU1A 4D80A 2ZYUX 3KDSE 2RH5A 2FJUA 5L3QA 3GCGA 3I61A 1XJQA 1G17A 4ESVA 2IYSA 2HXSA 2KJQA 4RY2A 3UATA 4ASUA 2JLXA 1QG2A 2XSZA 4A0GA 3W3ZB 4IVQA 3KTAA 1V5WA 3W34A 2WWYA 1U9IA 2XJ4A 4Q7JB 3AM1A 3QVUA 2ZI7A 1WF3A 4B3XA 4ZIRA 1I4DD 2IYWA 2FFAA 4CEHB 1IM2A 3RNLA 1U8YA 4C0BA 1W4BA 4XWKA 1G21E 3N70A 4BFSA 3GEEA 3PFIA 1K5DA 4IJMA 3AKCA 5HCIA 4D0NA 3Q7QA 4RSGA 3SYNA 4A8JA 5A0FA 1ZNXA 2F3RA 4TQUS 3TVDA 1WBDA 3BGWA 3TKLA 3UKDA 3EZ6A 4EQ6B 3TSZA 4KLNA 1T8TA 2PLFA 4TYPA 4QHTA 2XNDA 3GEHA 4RD0A 3LVRE 5JHGB 4LHZA 4I1UA 2ZRIA 3RABA 2DWPA 5FUWA 621PA 2MMGA 1VECA 2QP9X 5L3SA 2OV2A 4MYUA 4HUQB 5SZJA 1QHSA 2R6DA 3L82B 1KO8A 2W2TA 3SZRA 3JZAA 3BWDD 4ABYA 1I4LD 1R6BX 1ZW6A 1G3IA 3OAAA 3RSLA 2X77A 4HB3A 4TSFD 4IEEA 1U81A 4KXFB 4CT4B 3Q3JB 3THYB 2CNWD 1RVDA 4LSGA 3U60B 4ZDKA 4DSTA 1M8PA 4YONB 4DCSA 1N6HA 2X2EA 3AP1A 5J40A 4IDQA 3U3OA 4RD6A 2R6GA 2CK3D 4BRUA 2G0NA 1KAGA 2QUZA 1GKIA 4DLYA 2WIAA 4M1WA 1BH2A 3ZGXA 2RMKA 4HLDA 1XP8A 1YRAA 1TEXA 1P4SA 2DCUA 1GILA 2ZETA 1VPLA 3OEEA 3PIRA 4I99A 3F5FA 2F55A 2FGKA 4MKIA 2E1RA 2P6NA 2V7QD 3GFTA 2ZAMA 4UKDA 4G1UC 3RS3A 4AG5A 4B75A 4PSAA 1SXJE 2OXRA 4NYMR 2J0QA 2R6AA 1GG2A 2IHYA 4HYYA 4URUR 2EYQA 3D7MA 5JSZA 1RRFA 3K9LA 2OAP1 5DNYB 3MD0A 4M2LA 1Z3IX 2J0VA 1DPFA 3ZQ6A 5FTKA 3A1UA 5EE3A 2J7PD 1T9HA 1DEKA 1RYHA 2D4HA 4BQSA 5JWRA 1NKTA 4DLXA 3C8UA 3FHOA 5C4GB 2YWFA 4KFTA 4DT1B 4NH0A 1IAQA 3L0SA 4PTLA 4ZPXA 4Q01A 3AUYA 2OBLA 3O8RA 2EFDB 1WB9A 3KZ1E 5F9HA 2IF0A 3HJNA 2ZSBA 1C9KA 3OZXA 3LH5A 5FPTA 4TZ0A 4Q9KA 3O8DA 421PA 3U6KA 4PXAA 5CM8B 2GEDA 1HT1E 5KDOA 5F3WB 4BECA 1D9XA 1SKYB 2A30A 3GLGB 3U7HB 3KQKA 4QOSA 1E0JA 1JAIA 4KITB 1T0JB 1LFDB 3QUSA 1Z29A 3TLXA 1CP2A 4URVR 3BH6A 3NDBB 4FMCF 1II8B 4DCUA 1G64A 3B8HA 3BRWD 5CJ2A 5FBVB 1W2HA 1FQKA 1Z28A 4A82A 5L8VA 4RCYA 1L4UA 2EW1A 1JR3D 1KZGB 1YZGA 2NOAA 5J5CA 2C95A 1XEXA 2FV8A 1J7KA 2ZJ2A 2VF8A 3A36A 3EPLA 1LW7A 2GESA 5EZ5A 1IONA 5KNCA 5M04A 2XITA 1S3SA 1QVRA 4B3BA 2IEYA 4GT1A 1XCMA 2GJ8A 1HT2E 2I3BA 3PUXA 1FFHA 1G9XA 1Z6AA 3C5HA 1U0HC 2ERYA 4WVFA 1I4TD 1E0KA 2IT1A 3DMDA 5AK0A 5JBQA 1G41A 1KKMA 2VP6A 4C0KA 3LXRA 4NHOA 3RRNA 4OQLA 2R8RA 3ADBA 5DISB 3K0AB 1ESMA 5J47A 4Q03A 4MRRA 3RVBA 2F43A 1TL7C 1YR8A 3DOFA 5E95A 5CDFA 3B1YA 3OE7A 2ZI4A 1X6VA 4ZKDA 4AKEA 2OT3B 1VCOA 4NZYA 4TN1A 3W5IA 5AR1A 4GOXA 3BK7A 4C4PA 2QA5A 1P7CA 3ZZUA 4ACAA 3TBKA 1UKYA 5CLQA 1KTVA 1Z0KA 4OJQA 2IXGA 4LV5B 1N5IA 3IUYA 1R8SA 4TL6A 2IS6A 1HEIA 3VNVA 2D06A 2CHVA 3T1TA 5TXGA 2GETA 4OHXA 2G83A 5BN3A 1P2TA 1R0XA 1US8B 1NY6A 4WBSA 1Z2CA 3LX8A 1N0WA 2QRNA 1EFRA 5IRCD 3GJ0A 3BH7A 2BM0A 3HDTA 4A2WA 1OXUA 4XWAA 2FFHA 1KIMA 4A0HA 1OKKD 4DZZA 1RFLA 4RD1A 5TMPA 2WAYA 2WPDA 4N0DA 3PEUA 4MKHA 3SHWA 2BMJA 3U5ZB 2GKSA 1T6NA 2ZI6A 4DJTA 2I4IA 3HPRA 1XDBA 3Q8XB 5CK5A 4DUGA 1XZQA 2QSZA 3QY0A 4PPNA 1AS2A 1QBKC 2MSEB 4HAVA 4CVNA 3U7FB 2H7VA 3B9QA 4MITA 3KJHA 2JJ2A 2ANBA 2HF8A 1BKDR 1II0A 4MH0R 4V0OA 5FUYA 1VG1A 1BS1A 1G3RA 1P9RA 3LXXA 4QHSA 1R8QA 3ECCA 4URYR 4UXHA 3AVXA 2QM7A 4Y0AA 4GSYA 4BUJA 4BWYA 4JLKA 3R8CA 5HZKA 4IDHA 4V0KA 1H8HA 2NO7A 4JLVA 1KZ7B 1S3GA 3NC0C 4QJ5A 4LC0A 2IYTA 4WXPA 2VTKA 5EE5B 5JEEA 2ZI3A 3IO3A 1LVGA 4TL8A 1Z0IA 3BB3A 5KSYA 4QGFA 1HYQA 4QBGB 2W2VA 4AWXA 2AWNA 4F4IA 4RD2A 5GJBA 2QGZA 3E70C 2R9VA 3FPAA 4QFMA 1NKSA 5JS8A 4MDEA 4Q18A 3DVLA 2LKDA 4M9ZA 1KK3A 3UWKA 1IXZA 1LV7A 4C0JA 1KDTA 3BFVA 2F1RA 4I1SA 4LJ7A 5DN6D 1GNRA 3FMFA 3FKSA 4IDPA 2ONKA 1UKZA 1G1MA 1KMHA 1N6LA 1P9WA 1E2NA 2ZU6A 4KCGA 1H65A 2ZJOA 1D9ZA 4G5RA 1W7AA 1WRBA 1SVMA 3QXSA 1OH7A 2ZM5A 3V4RA 3AVUA 2A7QA 1M34E 4KHZA 3NBYC 1FOEB 4IFBA 2VHUA 4B6EA 1GL7A 1KYIA 2J46A 4HDQB 1JECA 1GRRA 4BZQA 4HDCA 2AKAB 3WBKA 4E09A 2P3SA 4EFLA 3W6OA 4JVSB 2HV8A 3AF3A 1DE0A 1R4AA 1F5NA 1KMQA 2WSSD 3L43A 4A2QA 5CB6A 1IJEA 2C9OA 2XAUA 3BJIC 1IY2A 3KX2A 1TUEA 2WV9A 5LD2C 3TR0A 3KKPA 4M8NE 1OXVA 2ORWA 2D62A 1NMZA 2JIZA 4YMUA 2QROA 5K8UA 3H86A 3NBFA 2X2FA 2WAXA 4OHWA 4CW7A 4OK3A 1F48A 3REGA 1P61B 3U44B 1E2KA 3LX5A 2JLVA 4OK6A 4UQOA 3VKHA 4B48A 5K8IA 4D26A 3AP3A 3NBZC 2W58A 1XMIA 4XSHA 3TUIC 1A5TA 1OYYA 3PXGA 1DARA 3T34A 4G0NA 3KQNA 2GCOA 4LHWA 1J8MF 1E2LA 4EAQA 4TYWA 1G8PA 4CEJA 1D8TA 4JJKA 2FSFA 4MYCA 1W49A 4WIAA 2ZR9A 3D3QA 5FTLA 4RZ3A 4CEIB 3GLIA 1XBTA 2REXB 4LHVA 4JLJA 2IA5A 2IYLD 3CRRA 3BORA 1CKEA 2JDIA 4EFMA 3ZVMA 1NY5A 3QKTA 3QSYA 3EZ9A 2HCJB 2VSOA 3NBXX 3GP8A 1OH6A 3AQ4A 4LV6A 1W0KD 2JCSA 4HAYA 4ILEA 4ZO4A 1R0WA 1KI4A 5DH9A 2A3RA 1T4GA 3B9PA 1NN3A 1S1CA 3QXXA 2Q0HA 3EASA 3TUZC 1OSNA 2QBYB 2QPOA 1RIFA 4Q9IA 3ZDQA 1UBCA 3SDZA 3A6PC 3WP0A 1UKEA 1NVVQ 1QF9A 3AV0B 4GP7A 2YNMA 4RZXA 5EXTA 2RGCA 3NDPA 4GPTA 3VQTA 2WWIA 3THWB 2IF2A 4HZUB 1E1QD 3ZVRA 1D2MA 2PX0A 1ZM7A 3CF0A 1XCGB 3UMRA 1BMFA 2PT5A 4OBEA 3QI2A 1YQTA 1IXRC 1ZIOA 4RFSA 2CL0X 4BE7B 3EIHA 1J70A 5EE9A 4JLDA 1G4AE 2VP2A 3I72A 4D6PA 1GZSA 3BAFA 4DSNA 3CB4A 3IHLA 2GXUA 1YZNA 4TTRA 4OI0A 5BQ5A 2IXFA 2UZIR 4ZKEA 1SVIA 1E2JA 4TLDA 1HE8B 2QT1A 1AM4D 2GDJA 4YMVA 1ZC3A 4UNSA 4B76A 4DCNA 4P4SA 3BC1A 1NG1A 3GJ4A 3SN6A 4KSBA 3EW9A 1UJ2A 3QF4B 2ANCA 2CL7X 2BMFA 2IYRA 3CF6R 1E9BA 2MMCA 5LB4A 4BFZA 1GTVA 2QMOA 2ZAOA 4IVPA 4JYBA 2XEXA 4IFEA 2OLJA 1UEJA 4LV8B 2QPTA 2C99A 1A2BA 2BDTA 2PMKA 4MYHA 3OEHA 1W48A 1VTKA 1XMSA 4Q4AB 1PLKA 2CE2X 1QHXA 2J59A 4DLSA 1DG3A 1VIAA 1YVDA 1KO5A 2JEOA 3LA6A 4LYJA 1E2FA 5DGXA 5E7IA 1G6OA 3BD9A 3TAHA 1II8A 4QBHA 2AK3A 4A1FA 3B7GA 1DAMA 2PJZA 2XXAB 1W5TA 4QG7A 1I2DA 3OFNA 4AYTA 1KO1A 3H84A 4LJ6A 4MYTA 3KQUA 1KI6A 2WM9B 5GJVC 5BN5A 3B82A 4BASA 2GCNA 3X2SA 3PITA 1HUQA 1YR6A 3VAAA 2OHFA 1DADA 1NF3A 2P5TB 1Z0FA 4XTRA 4QJ3A 1E69A 3KFXA 1T91A 2D74A 3A8TA 1Q21A 4TMKA 1FQJA 3RYTC 3AKDA 3MGCA 5IF9A 1NSFA 1GRQA 3QF7A 2GHIA 5GVSA 4MDFA 2RB4A 1NBMA 4X8HA 2HLDD 4NU0A 1E2PA 4XIGS 3O47A 4KAXA 3C14C 1E9AA 3SE0A 2LCFA 2BBTA 3U7GA 4KJZA 1D6JA 4BLPA 4BFYA 1N6NA 3L8ZA 3J81k 3I62A 3QKRA 2VP0A 4TL9A 5JI2E 2AL7A 4R7ZA 2XX3A 4XD7D 5E4FA 1W4RA 5C18A 1CRPA 3K0EA 2FX3A 3AVOA 3FFAA 5EP1A 4O25A 1G5PA 5FL7A 4TZ6A 1HURA 3SJBA 2JASA 2ODNA 3B1WA 3TNFA 1GAJA 2B8WA 3CR7A 4NYJR 1G8YA 2DFTA 2FF7A 4QHYA 4JLAA 2X8AA 2CDNA 2CL6X 3G5UA 1US8A 3KFVA 2Q9CA 2REBA 5JECA 1Q1BA 1W46A 2HXYA 3I32A 2O0HA 4W9MC 4NCKA 4OQFA 5EXPA 3QNUA 2KB0A 5FL3A 1ZIPA 4HAXA 1SVKA 2GA8A 3RS4A 4LJ9A 2N42A 2OFWA 1E0AA 4QJ4A 1ZJ6A 2O52A 2ZVPX 2FDCA 1XFAA 3RWOA 2FSIA 4G01B 5DIFA 3VMFA 1BYUA 1X86B 1P5ZB 1Q1QA 2ORIA 4OI4A 1XXHE 3F0TA 4P31A 3RS2A 3PUVA 2LWIA 2VEDA 4ARZB 5C1BA 1E99A 4POAA 3AVPA 1M7HA 4JVNA 2N1BA 3ZS8A 1R7RA 2W6JA 1KK1A 4HAUA 2Q6TA 2ZE5A 1WCV1 3IPXA 4OK5A 2NZJA 1BIFA 1XTQA 1Q12A 4N3NA 1KHTA 3FMPB 1XD2B 4FMDF 4DKXA 4DB2A 3ICQB 2RGXA 2PBRA 2OAQ1 3GFPA 1M1YE 3LY5A 3FMOB 4FIDA 4NE2A 4GMDA 4O2RA 1N2CE 5KNDA 5FTMA 3EWAA 4W5WA 1E79A 2OG2A 1O3YA 4AYWA 1G7SA 3F3YA 1IQPA 2AFIE 5UKDA 3SEAA 4B3DA 1YZKA 1GVNB 2WWWA 4KU4A 4LHYA 1EESA 3Q85A 5TARA 3K70C 1CJKC 3UWOA 5EQTA 2ZITA 5FH9A 1G6HA 2CNWA 1XRJA 3OF5A 4TLEA 3R9XA 1S8FA 3SOPA 1RYFA 4PQYA 3EZ7A 4QGGA 2CLSA 4WZAE 3OIWA 2ATXA 2A5DA 2C98A 3UG6A 2XNSA 2ZRMA 1YHNA 1NN0A 1E9FA 4KO8A 3ZQJA 1N6PA 4U5XA 4LC1A 3TJZA 3ZVLA 4DIEA 4W7SA 2OCBA 4C2UA 1OHHD 5CM9C 1NVUQ 3O8CA 1JNYA 4IKEA 4M53A 3U4QB 1EWRA 1F60A 1ZMXA 1RJ9B 3CWQA 3BOSA 1U99A 4DCTA 1TAGA 4JL6A 1DAEA 2ZS8A 3CR8A 2EFHB 5FBQB 2GILA 121PA 2ZE8A 3Q72A 4IXNA 1RPZA 3NWJA 3Q7PA 4JL5A 2JATA 5FOXA 2ERXA 1C4OA 1S96A 1IOZA 2OFOA 1NI3A 2QQEA 1JALA 4NKRA 2UKDA 3WMEA 1OH5A 1UADA 5J4LA 3RRZA 4CT5A 3CM0A 2R6FA 2ZE6A 3DL0A 5BW8A 2OUKA 2QTHA 3DZ8A 3K53A 2J7PA 2OCAA 3SQXA 4OI2A 4FWIB 4G5QA 1ZP6A 2FEMA 4BFUA 2WMOB 4HAWA 5HKKD 4AG6A 1U98A 4LYFA 2QAJA 3EC2A 4X8LA 5AUOB 3FWYA 4JT4A 4Z1MD 2BVNA 5FFMA 3O8BA 1CULC 1VDZA 3I8XA 4FWTA 1NMYA 4F91B 3UIEA 4QBIA 2BOVA 1FTNA 2MSDB 4H1VA 1T0HB 1HQYE 2YV5A 2JJ8A 1RZ3A 2BIFA 5A4JA 4QM6A 1FL9A 2IYUA 2HEIA 5A5GA 4GZLA 1HV8A 2I1VB 2WOJA 6Q21A 2GNOA 3WP1B 3ASYA 4IVRA 4EJSB 3C7KA 2F1JA 2H92A 4HB2A 4TYNA 4BLSA 5AWFC 2CEAA 1FP6A 4QNMA 1E4YA 4Q1EA 1R2QA 1KGDA 3GLFB 3R7WB 1E96A 2KE5A 2D2EA 2ZVQX 4RVCA 2YZ2A 3SYLA 5IT5A 3QENA 2VSXA 5CJPA 2FH5B 3W6NA 1UDXA 2DFNA 4LJAA 5JLJA 2ZJAA 2IL1A 1RE0A 3A1VA 1LS6A 3UANA 2QAGB 1FMLA 1UDWA 2ZRHA 2UZ3A 3LRPA 4PX9A 4R2HA 1OIVA 1XTIA 2W6ID 2GVZC 2QTVB 1SVSA 3W6PA 4TL7A 3AGPA 4Q4HB 2BBOA 3ND9A 2O8EA 3ETLA 1R5NA 5KPJA 3X1XA 1E2MA 1NVXQ 3CZQA 1F2TB 4TLBA 2QRZA 4MRSA 4WOPA 4HAZA 1TADA 2Q3MA 4E5UA 3FOZA 4KBGA 4L15A 1ZD8A 2R2AA 4BZXA 3VR5A 4AY2A 5FOWA 3B78A 4C7OA 2F3TA 4DLTA 1M7BA 1XD8A 3EARA 2CJWB 3BFXA 1BYIA 3CPHA 4LBYA 2ZRNA 3IBYA 5HCNA 1OIWA 2EWWA 3DMNA 2EWVA 4B2PA 2QEQA 5K8LA 2XZLA 3VR2A 1OE0A 3AF1A 3CUEF 1AJEA 5HE8A 2O8FB 2QM8A 4DCVA 2ONJA 4DB4A 3CH4B 2QMEA 4M0LA 4L4UA 5AUPB 5DSZA 3X1WA 3QF4A 1FZQA 2ZR7A 1DG1G 3CRMA 3IIJA 1T5IA 2VPPA 2R62A 2OILA 2O8DB 721PA 1X1RA 2IEZA 2XSZD 1MO4A 4DDVA 1KNQA 2VL7A 5JS7A 2B8TA 1PVOA 1TTTA 3ADCA 1OKKA 1ZINA 2QSYA 4LBVA 1NG9A 1Z0DA 3CWZA 1SGWA 2DHRA 3BB4A 1YRBA 1QHHB 2BMDA 1YKSA 1RC8A 1N6OA 3P4XA 4KYUA 4M1TA 3WBJA 4CZ2A 2H5EA 4EFNA 5CDFE 3QKSB 1TMKA 2CCJA 3M4YA 4Q1BA 1XTRA 1W5SA 2NGRA 1Q57A 2C9CA 2QZ4A 4PPGA 4XOIA 1HY3A 1G19A 4NL4H 3SBDA 1W36C 4MRVA 4E03A 3RWMB 4TT3D 4B71A 5JI3E 5G40A 3GLHB 1R10A 5G41A 1ODFA 5KHOC 1M74A 2YWHA 3C15C 3NVAA 1JPNA 1NN1A 1AZSC 4TLAA 5HTKA 2HYIC 2H8KA 2C8VA 4U7DA 3EZFA 3MSXA 1P60A 2HYDA 2QG6A 2WJIA 4RCZA 5DE3A 4XVQA 4U02A 3KB2A 5CB8A 1Q20A 3PV0A 1ZYUA 2EQBA 1XF9A 4LDJA 4L9SA 2PEYA 1ESNA 4LPKA 4EPRA 2AD5A 2H16A 5GVRA 4D2IA 5CYPA 1AKYA 3WNCA 1OFUX 3IIKA 3AVQA 1MOZA 2GAAA 2HJVA 4IXMA 4JLOA 3QEOA 1LF0A 2NO0A 3K9GA 4TTPA 5DN6A 2RGBA 3T12A 2JLWA 2VH5R 2FFBA 5G3ZA 3RS5A 1SVOA 1QHIA 4WZBE 1CLUA 3TGPA 1TQDA 4QNRA 4JJZA 1KI3A 2YOFA 5AUNB 4YMWA 4NP6A 2A5YB 1GKUB 1QRAA 4BZPA 1YR7A 4K46A 3OEED 4Q7MB 5DI3A 4YMTA 3LLMA 1CJTC 4LZZA 2J45A 2VIIA 3EA5A 3R9IA 1UBEA 4Q4JB 4A9AA 1Z06A 4I1OA 1VG9B 1U0LA 1G5RA 1E2DA 3BH0A 3I92A 5B2ZA 1P2SA 1OFHA 3X1ZA 1AZTA 1XZPA 2WSSA 5DO9A 4HUTA 2JLUA 5E7JA 1E9SA 1JJVA 4AURA 1E94E 1SULA 2Z5FA 3K9NA 3KXKA 3R20A 4N1AA 3KJIA 4EDHA 5KSZA 4GFDA 3KJEA 3PVSA 2BCJQ 2G0TA 3TQFA 4TMZA 4ACBA 5JEDA 4NYIQ 3VNUA 3LV8A 4PC7A 4HSEA 1KSHA 1RKBA 3P20A 4HATA 1N6RA 2NG1A 1NSTA 2W00A 1FP7A 1RRPA 3CW2A 3QPVA 4PAOA 4AK9A 1GM5A 2ZSEA 3B60A 2C96A 5HPYB 3CX8A 1WQ1R 4IEIA 2YWEA 4XJXA 1VMAA 4NPHA 3WYFA 5EXSA 2BJWA 5EXXA 5JWHA 1XD2A 1F2UB 2BHRA 4Q9HA 3JZMA 2O0JA 2P67A 4LYAA 4G5GA 3MMPA 1ZCBA 2J0UB 4IOJA 1SXJD 5EE0A 3LD9A 4BLOA 1G8HA 2KBFA 2WKPA 3E2IA 3IKJA 1GRNA 5G53C 5FI1B 1JJ7A 1UPTA 1KY3A 1S0UA 4Q9JA 4J0QA 4PC2A 3ZJYA 5CIQA 1P73A 5FUVA 1NL3A 3GFOA 3ND8A 1GP2A 3S1AB 4Q5IA 2CVHA 2LKCA 5TDHA 1T5LA 2ZI9A 3EZ2A 3M1IA 2IWRA 2GAOA 5TB5A 2V1XA 1Z6GA 3LQRA 2A9KA 2QP3A 2F1HA 4BEBA 2OO7A 5FPYA 2VP4A 3EIEA 1ZU4A 3EWSA 1P6XA 3QBTA 4TQAA 2REOA 1P9NA 3QPUA 3WYGA 4BLQA 1A82A 1WXQA 1Y3AA 1KO7A 3U4QA 3OIUA 3AKEA 1XMVA 3TSOA 4GL2A 1OIXA 2D2FA 4AYXA 3NHBA 5C4MA 1JXOA 2OBMA 5KSPA 3THXA 1E1QA 1W0JA 2FOLA 1CS4C 2JA1A 1VHTA 2DPXA 2ZYVX 5EE1A 5TV2A 3EX7C 3SQWA 3MG9A 3K09C 4JZKA 4M4SA 4B47A 2Z4SA 2ZS7A 2AXPA 4PHTA 3VTKA 3QIAA 2IHBA 1Z2AA 2WJVA 1KSJA 2RHMA 3HU2A 4KSCA 1WMSA 5FBLB 3NKVA 4ON9A 5AJWA 4DLRA 1XXHB 4EJSC 3UMSA 2C78A 3GLIE 1ZD1A 4V02A 4US2R 1FNMA 3I8SA 1E9DA 1OXSC 4CEHA 1E2HA 4IW3B 2VRWA 1P72A 4ITRC 3Q5EA 2PJRA 2AX4A 5C46F 3PJRA 3I5YA 3WXMA 1WE2A 3A1TA 2P5SA 2WJYA 3HYTA 3T1QA 3W8RA 1GFIA 4B3FX 4C9BA 3ZS9A 1G16A 3KB1A 3ONWA 4QKQA 5L3QB 4D4KA 1JR6A 1M6NA 2ZJYA 3CIOA 4BLRA 2KWIA 5JRZA 3QOFA 4TYYA 4PC6A 1AQYA 3KTAB 5FR2A 1AS0A 1JPJA 2HJGA 1IY1A 4EQ6A 2IUSA 2AWOA 5F9FA 4JVLA 3U3JA 1OJLA 5LBIA 4WA7A 1EFRD 3K09A 2IYYA 4KVGA 2WOOA 1E9EA 4ZIRB 1NLZA 1MO5A 4AKHA 1E3MA 1E9CA 2K5UA 2ZIAA 1GKYA 2ZJ8A 4RD3A 2YC4C 1MRSA 2EFGA 3UMFA 4EJSA 4HUQA 2WPDD 1XEFA 3F8TA 4PO8A 2GVDC 1Q3HA 5KPDA 2ATVA 3GLFA 3NEYA 5BYJA 4A8JB 2HF9A 3BE4A 1RW4A 3B1XA 1TQ2A 3T06B 4M1KA 4DUGD 1NIPA 3THYA 2NMVA 1OXXK 2RGNC 1I2MA 3LW8A 1VG8A 3I1FA 1ZD9A 2J41A 2QQ0A 4JVMA 1KI7A 4EKDA 3W9YA 2FSHA 2QAGA 3BERA 4O0MA 1IY0A 5KO2A 3P32A 2CLDX 3KXIA 2WKQA 2ZRGA 4L9WA 2P6RA 4C2TA 1Z22A 4MA4A 1CXZA 1WBBA 2WVJA 3NEJA 4M21A 4JBXA 4LWZA 4WXRA 1G5TA 4Q48A 1ONBA 1SKQA 1PUIA 1ETUA 1DAGA 3FE2A 4Q1CA 4E22A 1H8HD 1TF5A 4A4DA 2ZEJA 3ZIAD 4RZ2A 2W0SA 2F1IA 1W2GA 3TE6A 3GLGE 3GQBA 2GEVA 1NJGA 4YXWD 1CF4A 2J0SA 4NTZA 4B44A 2WHXA 3OIVA 2ZRBA 1KNXA 3CNLA 3V4FA 1A1VA 5P21A 4XVUA 1LTQA 3RRYA 2EFEB 2P0EA 2PZFA 4ERNA 2CJWA 3QG5A 1XNJA 2W2XA 3QEJA 3A1SA 3FTQA 1KI1A 2RGNA 3JVVA 1W44A 2Z0MA 1T3LA 1GITA 1XEWX 2CLCX 4H9GA 2QMHA 2JJ1A 2IYZA 1DVRA 5GJCA 1E2IA 2ZSDA 3T1OA 1AS3A 4FMBB 2QNRA 4X8OA 2CCGA 4B33A 1TPZA 4OJKA 1K5GA 4G5OA 3SFVA 4DT1A 1DTSA 3MLEA 1OFIA 1RRCA 3ADDA 1CEEA 2WJHA 2IUTA 3M6AA 4FMCB 4YDHB 4NBSA 3BB1A 3WNBA 2NO1A 1W47A 2AD1A 2X19A 1OT3A 4JMPA 5JSZB 4V0LA 2P2LA 4M9SA 3JVUA 1DAIA 2A2ZA 4ZCIA 2RHDA 1H8ED 1MO6A 1XWIA 3FYHA 4RKFA 4F4CA 5FOTA 1G291 4Z51A 1NBME 2QMUA 2FWRA 1UKVY 3GLGA 4BGDA 1KK2A 1TNDA 2XTNA 4FINA 2DYKA 2OEPA 3RS7A 5E7MA 2C77A 3IGFA 3MWYW 3QG1A 4EPVA 1E6CA 5B64A 1KO4A 3MJHA 3QKSA 3SR0A 2JIZD 2BBWA 4OQMA 2OESA 2QY9A 2F9MA 3NHAA 4UXIA 1U8AA 3I73A 4LX0A 1FUKA 3OESA 4ZDWA 4DXAA 1E32A 1EG7A 4LCBA 4UNQA 4PC1A 5AJXA 1VIYA 3TW8B 1COWD 1ZBDA 5IK2A 3MWLA 4RFVA 3VX4A 4PANA 1A4RA 4OHZA 1PZNA 2VA8A 4LK2A 1Q1EA 4H1UA 1EGAA 1LS1A 2QPAA 1LNZA 1MO3A 1SXJB 4UJ3A 2XOKD 2GXAA 2IYXA 3FDIA 2IS2A 2ZUBA 3H2YA 3RC8A 3IO5A 1NP6A 2WMNB 2QENA 1UM8A 3CX6A 1HH4A 4Q4LA 4TLCA 3RSOA 4F93B 1DBSA 4EUNA 2V55B 4QGHA 1XJCA 1GL6A 1VCMA 1RRGA 2JLSA 3MRSA 4F4JA 3VHLB 3WHKA 5FBWB 3FFBA 4PZZA 4LOAA 3D6TB 2FMXA 3K0AA 3ZZ0A 2GK6A 2RGGA 1IN7A 4C0LA 1OPXA 2ZYWX 2ZRAA 4GRAA 4URXR 4DRZA 1MRNA 2ZUCA 2JLQA 3B85A 3LBIA 1B0UA 1E2EA 2DFKB 3VKGA 1UEIA 4KV9A 1N5KA 3BIFA 3PR1A 4TMVA 4C3ZA 2YVUA 4V0NA 2FN4A 4Q66C 3IDQA 3DO6A 1XCPA 4GI7A 1QHNA 5AUQA 4AD8A 4DSOA 4V03A 4Z54A 4QRHA 2NIPA 2QGNA 4JL8A 4A36A 4II7A 5DLQC 5J4YA 3GJ8A 1E2QA 4HDOB 1SZPA 3KKQA 2F43B 221PA 3KQHA 3DHWC 4KODA 1CJVC 2ZR0A 4PAQA 4C0HA 1CR1A 1MR3F 3QXHA 1ANKA 4B6FA 1G7CA 1CR2A 4TWZA 3TIFA 3K0FB 3BXZA 3IHWA 4E07A 4XWOA 5JHHB 3DOEA 3EPKA 2V8OA 4PSVA 2QL6A 2ODEA 2L0XA 3EAQA 3WMGA 3WRXC 4M1YA 4PHFA 1PLJA 4FXPA 1AK2A 4XH9B 4JT2A 1ZM4A 3N5CA 4MKFA 1IN5A 2V6JA 3GMTA 3IPYA 1NVWQ 2X1VA 1D2NA 2VHJA 5TVKA 4MGZR 2ODBA 3A1WA 1F2UA 5FOVA 1TUIA 3OEHD 1L4YA 4LRWA 4AKIA 4V0MA 4DVGA 2IX3A 2XJ9A 4L5BA 2V1UA 1ZNYA 4P4TA 2NO9A 4TSFA 5D3MB 1MKYA 3SS8A 1KI8A 2C03A 2ASEA 3VU9B 2V3CC 4B3GA 3PG5A 2XTMA 2FE4A 5H8WA 4NCIA 3LBNA 2BJVA 2YOGA 5CIWA 3A4NA 4M9QA 5FPKA 2W6IA 1AKEA 5JRJA 1P75A 2CK3A 3KUDA 1ZNWA 2RCNA 2AN9A 2Z43A 1N5JA 4NYMQ 2YC2C 2J5XA 3R8FA 5LPNA 3LVQE 2CHQA 5EP4A 4HLQB 4GP6A 4LJYA 3CBQA 1X1SA 4JBYA 5FTNA 3MJRA 5DYGA 4ZDIA 5C2JB 2ZRFA 4DC9A 2ZSFA 4F7WA 2DY1A 3MWJA 3H1TA 2VQSA 2V7QA 4G5SA 4MUBA 4NONA 4LBZA 4F38A 1QG4A 1NBMD 1AN0A 5CITA 4ZV4A 3PEYA 2HUPA 1VHLA 2ZE7A 2EYUA 1EXMA 2IUUA 3I4LA 2ZJ5A 2JLZA 3HU3A 3ZZTA 5JCPA 1KSFX 1GWNA 1ZVQA 2AHOA 2NTYC 1R5BA 2B7BA 3PUYA 4LJ8A 3T5GA 4KFUA 1W4CA 2FA9A 4RKEA 3TR5A 1Z63A 4PQRA 3U3RA 4CGZA 4PZLA 4Q7LA 1U0JA 4R2IA 5FL7D 2YWGA 1VCIA 1GIAA 4LPSA 1VYTA 2GZDA 2Y8EA 2FEOA 5SZIA 1TU3A 1U2RA 4NCJA 4L16A 3ZVNA 3FVQA 3U44A 4PFSA 5JJKA 2XZPA 4FN5A 4IDNA 1X8JA 1U8ZA 1CIPA 2WBLC 4XSGA 4A15A 4GOJA 2OM2A 2YINC 4JLPA 2BC9A 2CCKA 4Q1FA 2O8BB 1L8QA 3BS4A 4FD2A 3P4YA 3IQXA 5KYKA 3AF0A 2PL3A 5J4VA 2V54A 3TRFA 1ZUNB 2A5FA 4B34A 1A7JA 2GF0A 4IDOA 1CR4A 1M7GA 1FNNA 1MT0A 4AIIA 3D8BA 4PPFA 3AB3A 4CEIA 3WMFA 1OW3B 2VBCA 1JR3A 4O2LA 3U61B 3BFKA 5EJEA 4TT3A 4LYHA 1F3OA 4NMMA 4X8MA 3KUCA 4F92B 1XB2A 2W6JD 4B2IA 4UXJA 3WNDA 4PSKA 2QBYA 1E9RA 3KQLA 2GCOB 1OFTA 1JEEA 4FW9A 2ZJZA 1IBRA 1YZQA 4NCNA 1YZUA 3MCAA 5DHFA 2D7DA 2DR3A 4CEJB 2QE7D 5FTJA 1KJYA 4R71A 4JSTA 2PCJA 1E79D 4B74A 4D4JA
chains in the Genus database with same CATH superfamily
4P33A 3GUZA 4AY6A 3L07A 1RJGA 1VYVA 1Q19A 2VK2A 1V11A 3EEYA 3UK1A 4QGAA 3GLIB 1T9DA 1MZPA 3EODA 3L8CA 2FR1A 3ER9A 4Q9LA 4A3SA 1W4AA 4BJ3A 4HWSA 4ES6A 3EC1A 1XZGA 1E3JA 1MXHA 3THWA 3USES 2Y1WA 4HZUA 1G0OA 4MW7A 4RACA 3I2HA 5BW6B 1WA5A 4GI1A 3DTNA 3MPUA 1G21A 1Z5GA 3QWAA 4OATA 1RNLA 3NH6A 1KOFA 5AVKA 3B7PA 1MEJA 2ES4A 3I2JA 2EOAA 3FR8A 1TEHA 4RHUA 4D4LA 4LVOA 6ABPA 2IK8A 5J23A 4UJ5A 3I37X 4JLNA 4JT8A 1B8PA 1JW9B 4ZO9A 1STOA 1FYWA 4UTNA 5K0CA 1RLJA 2I71A 2YX1A 3CFYA 3BHMA 4DR2B 3IUBA 5JJIA 2FMUA 1VMEA 2GXSA 3NG1A 4KIJA 3I0ZA 2PUAA 1MD9A 2CE7A 1F0YA 1YSCA 4RVFA 4DLSA 4LN1A 1FS6A 4X62B 1BDHA 4ER7A 3QU9A 3LPMA 4QTXA 1Q7RA 4Z8XA 1GTSA 1N2JA 1IUOA 1KI9A 3C3BA 4LF6B 1ZL2A 4ZAGA 1T29A 4KPFC 1LPBB 2VG8A 4H08A 2BKAA 4R16A 5JANA 1M2NA 3JTEA 1Z2PX 5BVGB 1SXJC 1Q0ZA 1SCUA 3H0CA 2BRUA 2PRZA 1II9A 2LD4A 3RTAA 1YJ5A 4IMIB 1LLQA 4Q4AA 5IDVA 2VP3A 1F6BA 1YAHA 2VHEA 4P32A 2PUCA 2AI1A 1M33A 3L0OA 4YQYA 1PO7A 2E2WA 1OF1A 3R9KA 1GPWB 3TAUA 4EG6A 4C08A 3SJAA 4KQ1A 5L40A 1Q7GA 5HZHA 4WCDA 4MUNA 4DUZB 3DB2A 3VR4A 4P4SB 4AN0A 1ZEJA 3TRDA 4DCJA 4DHWA 2EJBA 1RLIA 1SXHA 2DPYA 4EPXA 1JMYA 2Q3FA 3DT9A 2WSMA 4YT4A 1EK2A 5KJ6A 5BV1A 4PX2A 2AR0A 1XDWA 1CR0A 4L8GA 4PGFA 4PXSA 3WFZA 4AQ7A 4BXOB 3PNQA 3PC7A 2NP7A 3PLRA 4W5RA 2OQVA 3SBXA 5CPBA 4HGOA 2J8ZA 2AI2A 3B2EA 3GBSA 4URWR 5AW4A 3HGMA 3P2EA 4G0QA 1XNHA 2R1VB 1X0XA 1KE2A 1V7PC 5JCJA 1DJQA 5B4UA 5CDYA 4J0HA 5KYYA 3CVUA 1QP8A 1Y63A 2Z08A 3G79A 3PK0A 4FEAA 1E66A 3EIWA 5KKAA 2HT6A 3TUJC 4BJ1A 4DLWA 1I6LA 1YRHA 2JS7A 1JG2A 1W34A 1VZ2A 1Z83A 1MP0A 4RTPA 3EPKA 3WRYC 1L2TA 3OCYA 3JALA 2OWDA 1KY4A 3QXCA 3G89A 1EK0A 2FZLA 4YT5A 2H2GA 2VQ3A 4B8YA 3I5XA 1Y34E 2HSEA 4BKOA 5H59A 2OFPA 2CXTA 5BN5B 4Q1DA 4YVFA 7ABPA 4PLZA 3GUVA 3G02A 1AZWA 4NY1A 1W0CA 2WF7A 4W1PA 3UA3A 1QFZA 3CY6A 2OWEA 2YW2A 3FB1A 3U2QA 5EP3A 3TKAA 4BP3A 1OYWA 4DLVA 1D2AA 3TPFA 4K6FA 1YULA 2ID4A 1ZCAA 4B5KA 4JU9A 4RHYA 1R27A 1Z2EA 1AG9A 3QJGA 3VOBA 5JALA 2QN8A 1T4DA 4QUGA 4CRWB 1A9SA 2JAOA 2P2SA 2MT9A 2Q3HA 3GG2A 4XLZA 1HEUA 2LUOA 4N5DA 3ZWMA 4KSYA 5LYYA 2BUCA 4WXEA 3L2OB 2WWXA 1YR9A 1KZ1A 3ABOB 1JAHA 3IEPA 3MWDA 4ZGBA 5J4HA 2FCAA 2NO6A 4WPGA 3INNA 2QYOA 2NNWB 1POXA 2XUQA 3BK1A 3ID6C 4M9UA 1H94A 1MH1A 1EUZA 3L0YA 4Z9XA 4IOLA 4MUJA 5DHAA 1UR5A 4FPXA 3EUEA 1XCBA 1E98A 4KFRA 1CQWA 1CJUC 1G18A 1ETHA 1QGED 3WLMA 1J25A 1MX3A 1KS9A 1YACA 3CPJB 3OM0A 5D6OA 4F3CA 3G88A 1KK0A 2OZLB 2WY2D 2HHAA 3EUAA 5DFAA 1N2OA 3AB7A 2HU5A 3PU6A 3EXEA 1T9KA 3AETB 4RJLA 5D3QA 3S8YA 1JFSA 3R76A 3MM4A 1DIAA 2D1YA 3PDUA 4JMLA 3TQCA 2IU4A 1ZOLA 3FTEA 4BEJA 1DO2A 1V16B 3RANA 3IT3A 4PYRA 1FP1D 1GXSB 1NLYA 3AR8A 4Q47A 5ALRA 3TVTA 2YHIB 4D79A 4F96A 5BNTA 5BNZA 4QDZA 2IS4A 3ICEA 2LP4Y 2O50A 5F51A 2IOFA 3D7KA 3SYKA 2IWHA 1T9GS 2P1DA 4CMCA 4IWNA 5IASA 2PH1A 3R5HA 1OR8A 4BO3A 4D0LB 3O8NA 1XNQB 4WDQA 4L02A 3S29A 4P2BA 1S02A 2CB9A 4JKIA 4X84A 5KVVA 4MVJI 4WZ6A 3WNVA 2Q28A 4OF4A 1CDZA 3C6XA 4YJ2A 5EMHA 3A10A 2ZBGA 4FK8A 2G7MC 2Q5QA 1Y3HA 1UBJS 1PL0A 5GADl 3ANLA 5FV4A 4F2HA 1NI4A 5T64A 4US1R 3LBHA 2VAMA 4ZQIA 2VF7A 2QI9C 4DEYA 3T1HB 5HP4A 1ZM9A 3D3EA 3TLEA 2RHWA 2WZBA 1J4AA 5FPHA 5B1SA 3NOQA 2ZT7A 3FSJX 1S7CA 1R74A 3LUCA 4N8SA 2B4KA 3HB4X 4L3WA 3CRW1 3PQ7A 1TYZA 2OY0A 3ZWBA 3CTMA 5JCOC 3AYZB 4MKZA 3R6TA 1YU9A 3N6RA 4TTTS 3Q6NA 2GTHA 2NZ8A 4P7GA 1O2DA 2CFIA 5ANRB 5FWDA 2E5LB 1CTQA 4YQFA 3MEQA 3ACBA 3M34A 5DULA 2XUJA 4AMYA 4DQUA 1R50A 1YT5A 2ZU0C 4XD2A 2QP4A 1Q0RA 4RTOA 3MTAA 1IXSB 3IBGA 3CVOA 2X5KO 3FRJA 3LX6A 4UNNA 5MHTA 2FZGA 1O4WA 1U94A 3DPUA 3AVYA 1H66A 3RIHA 1EFVA 2ZOSA 1RJFA 1F3LA 2WWGA 4L5IA 4AY3A 4D8VA 3IV6A 3TZQA 3MIIA 3D31A 2P62A 1F06A 3M4NA 5EMLA 2CVQA 4DQ0A 2XHZA 2XB4A 3IOCA 5JXJA 1EMDA 4MULA 5K3AA 1MJGM 2A0YA 3E5NA 3KSUA 4G4SO 5IVHA 3R9WA 1F9AA 5BYKA 4BWFB 1PJRA 3B1KA 2HMYB 3RSCA 2Z6VA 4EKGA 5B55A 1AIPA 5IXYA 2VJOA 1ML4A 1XX6A 1CF9A 1DB3A 2VKTA 1ZD4A 3IR5A 4D5GA 4RD4A 5E6RA 1GPJA 4O3FA 3A28A 1M2VA 1EHCA 3DXYA 1Q50A 4TKMA 1ZOOA 5DTMA 1KZ6A 4BQRA 5K4AA 3ISVA 4HB4A 4V0QA 1YBAA 3TOXA 2ZK7A 3TWOA 4DDWA 1WHSA 1FUUA 2VOJA 1ZGHA 4C4OA 3K9QO 1E1CA 1BRTA 2RC5A 2FHSA 2O05A 3NFRA 3DL4A 1EP9A 3GXOA 4GBJA 1S4QA 4JYCA 5J9FA 5KYUA 1Z7WA 4C4YA 3DULA 1ZAYA 1KOJA 5KVCA 1NNSA 1CZKA 4GRDA 4JC4A 3EGVA 4GOLD 2VUUA 3R4VA 4ZQHA 1ZM3A 1S1MA 2YVKA 4QYIB 4YASA 2G08A 3STYA 5B57C 3R75A 3DE1X 2D3TA 3HDVA 1Q16A 5DN9A 1XROA 2O3RA 3HVHA 4Q21A 4NZPA 4QPCA 2ISCA 1MFZA 1UBLS 1JLMA 5T6BA 3UPDA 3KKNA 4HEJA 4JKYA 1PVVA 4AJ2A 2BEUB 1MVNA 1ZRHA 3D8TA 4FFBB 3PFWO 2FWMX 3IFSA 2RJOA 5ADUS 4U8HA 3EW7A 4WZAB 1PZMA 2GZMA 2QI9F 2XCSB 4OLHA 4B2LA 5CCBA 1QHEA 4KXNA 1B00A 4U7WA 3RUPA 1T8UA 3WIVA 5CA1B 3BMQB 4Q82A 5JFTA 3EYAA 1C7JA 5IKEA 3NRJA 4X20B 3TOZA 2XUDA 4GSLA 2BBSA 3SZ3A 1V26A 3VZDA 1GQYA 2UZ1B 3R5XA 1ZC4A 2DFVA 3AF6A 3BTSA 4KK4A 4QULA 4WH0A 2XXBA 4RW0A 1H69A 2P9JA 2IU0A 3UH1A 3W2GA 2VF5X 2O2GA 3EGCA 3GEIA 3V1UA 4BKRA 3SE7A 2GASA 4LHXA 1HDXA 5EJ4A 1APBA 1V43A 3GJYA 4C0AC 3H4MA 1ZXXA 3KHUA 4RPKA 4IIJB 4R9UC 3A4LA 4UFPA 4URZR 1J5XA 3PE4A 3FHCB 1OB2A 1ND5A 2PT9A 5G0SA 5JCZA 1ESCA 4RA6B 1NMXA 4NDZA 1E1MA 4MMXB 2VOEA 3VPAA 4CM6A 2HCBA 2VPWA 2HLDA 1TCCA 2PCLA 4WUVA 5EUQB 4Q93A 4OFXA 5MN6A 2BI8A 2DG2A 1Z0JA 2BMAA 3PYLA 5HZGA 1Q5PA 4RORA 5K8VA 3I6IA 3K8YA 3E53A 1DLIA 3PXCX 1V4NA 3VYWA 4CHGA 1TQHA 5G0VA 4ZU6X 3R09A 3Q88A 1YJBA 3OWXA 5EUBA 1IWBB 4NYJQ 4MRNA 1IAVA 2XF2A 4C0SA 5TQ2A 2F8SA 3JZDA 3L46A 5C5CA 2XYGA 4G41A 2D1RA 5FNVB 3EQ7A 3ADOA 1O97C 3THSA 2EBUA 4TGLA 1G98A 3H05A 3K4QA 2Q99A 3R3JA 3FKSD 2KI5A 5L3VA 4YDSA 1NWCA 3FKJA 3U0VA 4QLAA 3GJ5A 1QLWA 1W0JD 3U3KA 1ZUWA 2VZ8A 2B78A 4L78A 4UNRA 2MWMA 1OYOA 2C84A 4PR0A 1FYDA 3QVXA 5PNTA 4J9VA 5B1DA 3U7JA 2VKQA 4M1QA 4ONEA 1OV6A 1P4JA 3B3FA 2HF2A 4FHZA 1ISIA 1XT6A 3EN0A 4YUXA 4ZALA 3RRMA 3EISA 2OHXA 2C94A 4WKNA 4UCQA 1EB8A 1GUDA 4ZD6A 5EWLB 3OQ6A 1EVEA 3N59A 3LRXA 1WDLA 3EF0A 2JVIA 4Y6RA 1PJ8A 1B0ZA 4YRSA 1OASA 4UEKA 5DBHX 1SHKA 4GXRA 3AF4A 3NTLA 2BPOA 5DI9A 3GJZA 2WT9A 4GVLA 5BURA 3B9RA 3IIIA 1P0PA 4LXUA 4BMCA 1T2VA 3BBLA 4QUHA 1R4NB 1NAHA 3ESBA 4FQ8A 1KMNA 4O33A 4R2WA 4GPAA 1OLXA 1DQYA 1JXAA 4MV0A 1CJBA 1GN9A 1SOVA 1T2AA 2JLRA 4KZKA 2UUOA 3ZY6A 2RBEA 4TYQA 3VI3B 3PNKA 4JLBA 4PPYA 3FCYA 2YL2A 3HH8A 4W99A 4EX7A 5K4GA 4D82A 4ZI2A 4RX1A 4IYRA 1WO8A 4RL4A 5KBYA 4HI0E 1D4FA 4UE2A 3NRCA 2DUNA 5JVDB 2C97A 3B3AA 4KHPB 4LDAA 2V58A 3EG9A 2BTQB 3Q40A 4EUFA 4P4NA 3SIXA 4YDQA 3FVTA 4QWWA 1T26A 1Z2OX 4URHA 3L0IB 1BOFA 2ODWA 5C9ZA 2P11A 4C14A 6REQB 1MV5A 1QRRA 1UC4B 4C4RA 3O93A 3DEFA 1UBGA 2W6MA 2Q5HA 2OSBA 4G97A 1HKHA 4JC0A 1Q3TA 5TT1A 2IUFA 2UUBB 1X1BA 2RJNA 1U3TA 4AKGA 5AM2A 1Z5ZA 3HBLA 3RJTA 3DWIA 4HZGA 2ZIFA 3ND6A 3PHCA 3AUUA 5KYWA 3NYWA 3QVOA 4DYDA 1W9MA 2B21A 4ZK6A 4XEHA 1GUAA 1H2BA 3BILA 2DWCA 3AJ8A 2J3DA 3V4SA 2PLWA 3M0EA 2YNMD 1VL1A 4GDMA 5I9TA 1U63A 4HRVA 3A3NA 4YA6A 3NO4A 5JV5A 2CY0A 1RACA 3P26A 1L3IA 5WRFA 2PNFA 4MICA 4WTOA 4D57A 4EUHA 2GJSA 5ALVA 3MCUA 2W9XA 4Y9DA 4ESOA 3PQ6A 1YOBA 4MR7B 4TYMA 3MMXA 5JD5A 1EFCA 3H16A 3PX7A 2V0GA 1UXJA 2V9PA 1VKJA 1NVVR 4AZWA 5H82A 5I7RA 1N9GA 2XUGA 3ODPA 3EGOA 2ABWA 2OZLA 2WHPB 1Q11A 1XR3A 3PBKA 4OQ4A 2CXRA 4H60A 3SJZA 5TRTA 4DV2B 2NXWA 4EEKA 3JAWB 4FHGA 1TM5E 4P3YA 2GD6A 3HA3A 2UU9B 3K1JA 4EHHA 4MGEA 1ABFA 3OLYA 2IOYA 3PHLA 2QF7A 1G3QA 2HFJA 4K81B 1NU6A 5IAJA 1GXSA 3IAEA 4L4RA 4QX6A 1JWBB 3EJ6A 2YHIA 4X1YA 4ZOLA 4DLZA 4CMAA 3EIQA 4J1QA 4G3XA 5EOVA 1E6KA 2YYSA 3VR5H 1V4VA 3EGDA 3PUWA 3WZMA 1U7ZA 2E4ZA 4EI8A 3C5CA 1HTTA 2W4MA 3OCUA 2PEZA 4BU1A 1EGQA 3MPOA 2PK3A 4O4IA 1TIPA 3HADA 1OVGA 4WNYA 5G3YA 5J1TB 3RNOA 2HBZA 2WLSA 4C0QC 2PX3A 4CKXA 4R5HA 2DCMA 3ND7A 4XYLA 3L6BA 1O77A 4M7WA 5BUCA 4BPBA 4IJVA 4OI1A 1DAKA 1J6UA 1H2XA 1X3SA 2ZI5A 2VSQA 4HMQA 4W5JA 2BCGY 2G5GX 3K0CC 1V3VA 3OZ7A 3WWZA 2R00C 1JEOA 9MHTA 4PAGA 2KQUA 2PANA 5F2EA 5KDDA 3E9QA 1RM4A 3AP2A 3TZEA 2D5BA 1B43A 4LJ4A 2CSUA 4NAVA 2Q3LA 1JBKA 2WJGA 3FN4A 3EFOB 4Z9BA 4K9MA 4OB6A 3PQ2A 4QFCA 4QL3A 1H93A 4KH0A 4PICA 4WZBB 4QRIA 4CL0A 4RNDB 3TRIA 1P1JA 1O6FA 2K7FA 4UZFA 1M72A 1QGZA 4DM3A 4HN4B 5IJ9A 1INLA 1WPXA 2DKNA 1AB5A 2QE7A 3AERB 4H6WA 3RU7A 2EQ5A 4G1VA 1THTA 1AOXA 4MUXA 4OD0A 2NO5A 4XTCS 5AVQA 2J7KA 1PS0A 2WICA 2BZ0A 4QVKA 4IGEA 2C8KA 1EK5A 5DOVA 4AJPA 4K8OA 4WN9B 3FCSB 3PJEA 4YO8A 3ZDAA 4DPKA 2V4ZA 16PKA 3FTNA 4R2LA 1RCFA 1O5OA 1QV6A 5EUMA 2W70A 2JJMA 1GGMA 1AURA 4QNNA 4RC9A 5FOSA 3UAXA 4Q02A 4AMZA 1FVFA 3BZBA 5I4KA 3MUFA 4XXHA 3GAFA 1PGJA 1WABA 1X2BA 4HR7A 3G6WA 4EGJA 2PUBA 3WRWA 2NTNA 4EK9A 1S2MA 4N39A 3DL7A 4KBYA 3W8DA 4B8WA 4W5OA 1QIJA 1QZXA 3HYNA 4ATNA 3JR3A 3EEFA 3DZJA 3EG5A 1C9MA 3LO5A 4CL3A 5EPOA 1JQJC 1GNTA 4WZZA 2FJUA 4P38A 5L3QA 1FSZA 1G17A 5HKAA 4UTPA 1AD2A 2EKQA 2GMWA 4NXMB 2EGUA 1KYQA 5CVCA 1N7GA 3W3ZB 4A0GA 4P83A 1QIKA 1U9IA 4BCBA 2XJ4A 4H18A 4Q7JB 5CW1A 1I7NA 1ECGA 3MJDA 5KAPA 2DT8A 5AP9A 3RYFA 4F5EA 2LZ0A 3PPYA 1DUSA 2D0OB 1QYIA 3KHSA 2NLOA 1CJSA 3T4UA 4IXDA 2CBXA 4ZIRA 4MV7A 2BEUA 1IM2A 1M2FA 1VJRA 4QIHA 2O6HA 4QOGA 5AFSA 3Q98A 4FFBA 4Y3UA 1U8YA 1J8VA 4C0BA 2PUEA 5COQA 4ZREA 1ODKA 2V6FA 3CWCA 4L5AA 1LLUA 1RPAA 1Z7EA 3PVZA 4WZAA 1P19A 4ZOAA 3VNBA 4BATA 3CG4A 3JQPA 5C80A 2H06A 1V8BA 3BMQA 2B8JA 3AB8A 4RSGA 1E6WA 3BFPA 3SYNA 4X20A 3UK0A 4IQ4A 4TQUS 4JC8A 3TVDA 2R8YA 3BGWA 3W7BA 4NZ9A 1A7UA 2W4QA 1VPWA 2VBGA 3U16A 4S1OA 5KOHB 1YDEA 1XPRA 3B8EA 3EZ6A 1BFKA 2NUPA 3MJFA 2ZTHA 4KLNA 5K3CA 1T8TA 1K7YA 2BGWA 1GRVA 3GEHA 4DNQA 5KCMA 1PTJC 3KUKA 2XVMA 5JHGB 2HI0A 3RT7A 2VC2B 3C3MA 4MQUA 3SC4A 1LK0A 2OMEA 3VZCA 2JLAA 2R7KA 3K96A 5FUWA 5L3ZA 2MMGA 4TS1A 3RT9A 2OP0A 4R9VA 5D6NA 1MZVA 5TR9A 4Q16A 2R6DA 2ZZKA 3L82B 3TOVA 3V80A 4CDMA 2AVNA 1Y9JA 3BJEA 3E9NA 2J3IA 4RA6A 5T7BA 1BCRB 5EJ2A 5YASA 3IP8A 1AKNA 3R6DA 1U81A 4E2FA 2OECA 4U4AA 4CT4B 4L0MA 2HWKA 3N7UA 5CRIA 3DTVD 2N75A 3QZUA 2YMPA 1DZIA 4YRBA 5LZ8A 3UB3A 4CT0A 1N6HA 5DYWA 4Z4QA 1VB5A 3O91A 4NLLA 2WEKA 3R3HA 2GPYA 1Z5VA 4I8XA 4TSRA 4JR1A 2BZSA 2PY6A 3STVA 1O0BA 1TI7A 1JIUA 1IH8A 3EEIA 1KAGA 2Q3CA 4XZ3A 2QUZA 2W11A 1GKIA 3TCXB 5EVCA 2I34A 5K2MA 3MBIA 3S5JA 5I8ZA 1N4DA 3ZGXA 3UYKA 3RIXA 2H4JA 2IHZA 1YRAA 1K4YA 1TEXA 5FOTA 3R24A 1U3FA 1VPLA 1D2HA 1V96A 3DP9A 3GQBB 1VE9A 3HJGA 3NOXA 3PIRA 3T7TA 2V7QD 2EP5A 1FTWA 4I4TB 4EG7A 4LAFA 2OHIA 4G1UC 4UKDA 1QPBA 1KRXA 1HL3A 3SXUA 4NU6A 4EATA 3I2KA 2IYOA 5C8ZA 3VC7A 1N33B 4NG5A 1PWEA 2FI1A 3WFJA 4AB1A 3P9YA 5F2OA 3OX2A 1JB9A 1UOEA 1GQSA 1GNSA 1OZAA 1FFCA 1RRFA 2VDRB 4K40A 1C7RA 4E5VA 5JSZA 2BSQA 2MSKA 1RAIA 3EY9A 5LKRA 3LF2A 4RK0A 2WD7B 5DNYB 1FLNA 4DR1B 3OKCA 1WSWA 4UBMA 1MAUA 1UT5A 4M2LA 4XM1A 2XA2A 5FPQA 2PKWA 2EC5A 4NBKA 2XIQA 2Q0XA 3ZQ6A 5EE3A 1RYHA 2D4HA 3O1IC 3UB4A 2NXJA 1ESDA 2QRVA 1WF6A 1WZUA 1TAHA 2X41A 3C8UA 3EUWA 3L0CA 2PMBA 3FHOA 4PSUA 1F7VA 5DX8A 4NH0A 1IAQA 3V8VA 4NBTA 1T5SA 4GP9A 5IH3A 3VPFA 4RHCA 2XH8A 3I5MA 2A1TS 1WPQA 4RGBA 2ZSBA 3FBTA 1C9KA 3KG2A 3LH5A 3OZXA 4LW8A 4Q9KA 1YUBA 3E35A 4XVCA 5KJ1A 2WJPA 3E58A 3DD5A 1X7GA 4Q9NA 1HT1E 3L5KA 3EIFA 4YUWA 3VZQA 1MAVA 2A30A 3JQBC 3K4PA 2Z2YA 1Q7CA 3OQ1A 3TVYA 5A6VA 4B6SA 4QOSA 1R18A 4GPD1 1JAIA 4J76A 1KEWA 4NZNA 5DT9A 4L27A 4KITB 1BH6A 4U5QA 1D7AA 1FSPA 3QUSA 3TLXA 1PJAA 3BH6A 3FPSA 3DFZA 2OTCA 1E5LA 4GGPA 5ECDA 4DCUA 5B1EA 5JVDA 1EDOA 1Y8RA 3CCBA 3IS3A 4J16C 3ZHRA 2G06A 4IG4A 1P1IA 1GUZA 1MAWA 1W2HA 1PGOA 3V3KA 4NX2A 1ICIA 1L4UA 1PFUA 4JEMA 3T7SA 1I5RA 5CG1A 1JR3D 1YR1A 3QEAZ 3DQPA 5E6UB 5J5CA 2C95A 3HVKA 3GC6A 3PICA 4MCJA 4X63A 4DRXA 1B1CA 1QCZA 4HNUA 3DAPA 2KW5A 4YFYA 1BVHA 3ZWOA 3CNQS 3GFRA 2QRHA 2YWCA 1QVRA 4G8DA 4B3BA 3S1SA 2VCHA 2FZEA 4FFNA 2WM8A 3HVJA 1FFHA 3AUTA 1ABEA 1SB9A 2IHJA 1SELA 1YL7A 2O2DA 3HI6A 4NHEA 4IGKA 3RHZA 3Q8MA 1ULHA 3I53A 1C7ZA 5H3HA 3SSNA 1EM6A 2G5PA 3QEMB 1U9CA 3DMDA 3U3XA 3FIUA 1G41A 3G2OA 1GQOA 4HJXA 3P71T 1Y7PA 3F6EX 2OK8A 1CS0B 2R8RA 1R0SA 3FOFC 1U5BB 2FLVA 2X5OA 3D8NA 1WCWA 3LSTA 3UGTA 3VR5D 4F8EA 3DOUA 2CLLB 2DTDA 5T4HA 2WT4A 5KREA 4BO7A 3HA7A 1GT6A 1SHUX 1W25A 3L1UA 4EMSA 3RYCB 4DUYB 3ZBQA 2FPUA 3B1YA 2ZTUA 3QV1A 3FVRA 1U1EA 1PK9A 2GAFA 3JAWA 3HKEB 4AKEA 1VHQA 4NZYA 4ZQFA 1T9CA 3W5IA 4GOXA 2QTZA 3OEWA 2ZIUB 2YXDA 2AG6A 5K3DA 2BONA 4LQ4A 3ABIA 3ZZUA 4ACAA 4AX4A 2AEFA 4G85A 5CLQA 1HQDA 2VQ6A 3ESYA 3IUYA 2VPXA 3KD3A 5ALIA 4TL6A 4H1HA 3L6DA 4OP1A 5TXGA 1LBIA 3BSYA 4OHXA 3RVRA 2G82A 1R0XA 1US8B 3GJ0A 3BH7A 3HDTA 1YS4A 1TIKA 2R6HA 4R8KA 2QL5A 5EQFA 3O4FA 2ZXUA 1I13A 1L3CA 1L7MA 1QNFA 2HLHA 1BCSB 2VXBA 2WAYA 2WPDA 1C5KA 3TTWA 4N0DA 1GA1A 3PEUA 1QYCA 1XZAA 1I6WA 2A88A 3O9MA 3PHIA 2CWWA 3SHWA 1D3AA 2BMJA 3T5AA 1T8WA 3FJOA 3JPWA 3CH7A 4OCZA 4MV4A 5CW2A 4ISCA 1L8OA 4LZLA 5AXDA 1SNYA 1ZD2P 2WE8A 3Q8XB 1R00A 1UWKA 4QT0A 2ZSIA 1AS2A 2IEIA 4CVNA 4HAVA 3EC7A 2XQVA 3QLEA 4KLRA 1DRWA 3QXGA 5SY9A 1BS2A 1MJNA 2FTKE 3AHIA 1BKDR 3KLOA 3QMVA 4V0OA 4M9RA 5FUYA 2J6IA 2H1OA 3E4DA 1QBGA 1VSVA 2KS6A 5LA6A 3GFVA 4CMBA 1E5DA 1DJOA 2W8BB 4BGIA 2BTEA 3M5CA 1R8QA 1UJCA 4Z4FA 4MUFA 2ZBUA 5EVJA 4LOLA 1U7PA 2HF7A 4ZVMA 2AH5A 5LIPA 4P58A 1X15A 2H1VA 1PL8A 1FQWA 3GZNB 4FS8A 4OJMX 4B80A 3D02A 4DIBA 4HSGA 2FWBA 1HNXB 1GUYA 3PSHA 4HEA6 1A8IA 3NC0C 1P4GA 5H0IA 2C0CA 2IYTA 3D8UA 3RC1A 3DTVB 1HLFA 1YFKA 3IO3A 4KUHA 3N05A 4QGFA 1NJSA 3L7KA 4AWBA 1LK7A 2IKQA 5CEFA 4BV3A 3ZCVA 4QGSA 3H18A 1JAXA 3HM2A 5AM0A 4QBGB 1E6UA 2K4MA 2W2VA 3MXTA 2VJMB 4O4HB 3SSMA 4AWXA 4F4IA 1R64A 4BJ5A 2E48A 4M55A 3OQHA 3E70C 3COPA 3HGTA 4QFMA 2DRIA 1NKSA 5KNBH 2YJZA 1GAXA 3SZGA 3ZJ4A 1VL2A 4BX3A 4RF2A 1JL3A 4I1IA 4C4XA 4E2WA 1LV7A 5DN6D 3BFVA 4BQNA 3FWZA 4QXMA 4FFPA 3FKSA 3GEBA 4IDPA 3R5JA 4CG2A 5ICMA 4H31A 2DT5A 1MJFA 5EERA 2ATCA 4N5HX 2YY5A 1E3SA 1N6LA 1JMKC 3AR4A 3WDKA 4AP5A 4UQPA 4XDYA 1J0DA 1H65A 1D9ZA 1T8SA 1NMEA 1WRBA 2ZJOA 3FG9A 3R5KA 5CX1A 5CXSA 3ZXYA 1I6KA 4BQQA 5A2QA 2B4AA 4JP5A 3C6YA 5ENVA 1FFEA 3AVUA 4KHZA 1A8PA 2LRHA 3EUFA 3NBYC 1FP4B 1RWOA 4IFBA 3ONFA 2ZT6A 1VA5A 3LPNA 2NU6A 3ZX4A 1LK5A 4NH4A 2IH4A 3AQIA 1OWLA 1O08A 2G9VA 3HRHA 4JUFA 2E4VA 4X9XA 1R88A 5BSMA 3R7SA 1QRSA 4MI9A 4IX9A 1ECLA 2YXNA 3N2NA 3T41A 2JFGA 2PDAA 4ENTA 2A8YA 2X23A 3EK2A 4CTKA 1F5NA 1N1DA 3SP1A 1G1AA 4CR7A 3JASB 5LD2C 2X58A 1PT5A 5CD1A 5IAOA 4M8NE 2DWUA 1OXVA 2FPPA 2I22A 1NMZA 4YMUA 3F74A 2UYQA 1T4MA 4G63A 1SIBE 3ICCA 3BL5A 3P2KA 4OK3A 1FE8A 3FYCA 4MDYA 4RS3A 5DK4A 3ZU6A 3A3YA 1PWXA 1VE1A 1X3LA 4OK6A 4UQOA 3VNAA 1TKAA 2OB1A 1E3QA 1CUAA 2OYSA 1YE3A 1BQ3A 3E2PA 3P9IA 4DLNA 4D26A 3I6MA 1OYYA 2YUTA 2AT1A 3WICA 4P7KA 2COEA 2ONCA 4G0NA 5HJ5A 3O8OA 3ZPXA 3WV4A 2PR2A 1D8TA 3ROZA 1PW7A 4ENUA 2FSFA 4Z4EA 4HNHA 4ZQBA 5CFQA 2GM5A 2I6UA 5H7XA 3JATB 3Q3IA 4ZI5A 2ZR9A 5BSRA 3W2IA 3LMKA 3WGTA 5FTLA 3AO0B 5DNEA 3DNMA 5KC9A 1N2BA 4QE3A 1JV2B 5KS2A 1QP4A 4JLJA 3BEDA 4EFMA 3BORA 1CKEA 4RHTA 4TTSA 2W90A 1OH6A 1OT5A 2WNSA 4ENVA 3VNUA 2NPFA 4LV6A 1W0KD 4HAYA 4JELA 5KQPA 1R0WA 2FN7A 5DH9A 1IOVA 4KLAA 4P3NA 4DIFA 4ZFNA 1EZ4A 3EASA 2JCBA 3PA6A 2XUAA 3TIGA 3ZCTA 3JWPA 4BP1A 3TUZC 2GSWA 1SUIA 1BX3A 4UUNA 4B45A 1RIFA 2GPTA 1QS0B 2PLAA 1ZGZA 4C89A 3D6HA 1ZXLA 4HYEA 3I64A 1D6SA 3IMKA 3QGMA 1GPKA 3TCNA 2AJ8A 5D5HA 5LN1A 2I2BA 4O02B 1NM5C 3C45A 3LTNC 3H4TA 1BVRA 1LRLA 4B1FA 2PGOA 2YNMA 1FY2A 4RZXA 5EXTA 5JRDS 2X7XA 4QUBA 2OBXA 5L7YA 1JEYA 2GERA 3WYEA 1VSBA 2B20A 2WWIA 4AX8A 5H3CA 1W19A 3HKDB 4DM7A 3OMLA 1WXXA 1RQXA 4N03A 4QODA 1ZM7A 1ZY2A 5ICSA 4B79A 3BULA 4P22A 1XCGB 3T9AA 3UMRA 5JIBA 3BZWA 3RADC 1CQPA 2X1HA 3F73A 1RT9A 4R40A 1VIMA 1GQQA 5HUQA 3QI2A 1YQTA 2NWQA 4BE7B 4RFSA 3EIHA 1HDGO 1DWPA 4YRDA 5EE9A 2EX1A 3WRXA 4ND6A 2V7XA 3OF2A 4G24A 2CMHA 4B0OA 2E7ZA 1JXQA 5AI6A 4H6XA 4TTRA 1M6YA 5ALUA 3TTXA 1EZZA 1SURA 4LXTA 1IOLA 3CH6A 1JEQA 4OI0A 3RCBA 3BYZA 3WYDA 1ZJZA 3HDHA 4DBLE 4EKIA 5DTRA 2QT1A 1OQAA 2PD3A 1P44A 2NM0A 2RC6A 2FW8A 4FYHA 4C06A 4X7MA 2AW5A 4LGYA 3EEBA 3JSXA 1OGJA 2Y1GA 4UM7A 4UOQA 1I01A 3R41A 4ZU1X 1A9TA 1S89A 3SZMA 2CL7X 2IYRA 3SKXA 1NUHA 1SD2A 5TF0A 4YAIA 1AQ6A 2IU6A 3KQYA 3AUAA 2OXEA 1RADA 2PMFA 4IFEA 5HDBB 4DMLA 5JXHA 1KJ9A 3S2YA 5A4KA 1KTIA 2JCGA 4C78A 4LCJA 1A2BA 3ONDA 5TJ9A 3OEHA 4BRSA 4D43A 1VTKA 2Q5CA 1Z68A 3MQ4A 1PLKA 4B82A 3ROXA 2FRVA 5EGSA 5BQPA 1DG3A 1VIAA 2JEOA 4TRJA 4WK2B 3V3TA 4K2HA 1TT5A 3GI1A 3I23A 2F3QA 1G6OA 3BD9A 3TAHA 1VQ1A 1C80A 2AK3A 2HIGA 2PMEA 1C1HA 1NRWA 4B0PA 4JGIA 4EI9A 4KNYA 3CR3C 1DX4A 1UBNA 4KG7A 4IZOA 1GL3A 1Y7HA 3N5KA 2WB2A 1VLLA 1I2DA 4J75A 1KU6A 4AYTA 1YB6A 2QL7A 3BIOA 2PSFA 4QU9A 4RA9B 5E6UA 4CMJA 3H84A 2Z95A 3F6YA 3JAKA 4K05A 3UV3A 1VDMA 2WM9B 3F3MA 2AX3A 2XT9A 2PTGA 4LZPA 4NEGA 4G4GA 2Q6IA 4K0RA 3UEOA 3DZFA 1V9CA 1NUAA 4UPVA 3TQRA 4DZRA 2GCNA 2C2WA 3UWSA 3PITA 3KAQA 3GNTA 1JDSA 1U2EA 3G1TA 5KSWB 4ZXPA 5LZ7A 3NOOA 4O2AF 4R7GA 3DOJA 5C8VA 1Z0FA 2PXXA 4EO7A 1E69A 4UPDA 3RC2A 3VKFA 3KFXA 1RHQA 2NT3A 3A8TA 4TMKA 1GGJA 5KVAA 1G2IA 5IF9A 2GPBA 4OO3A 3VSEA 1R12A 2F67A 3QF7A 3HXKA 3W5BA 1XRNA 3G1WA 3DV0B 2E6KA 4HMOA 3D6JA 4O59O 3NJ8A 4Q4DA 3FYTA 2E1PA 2GCGA 3FZNA 4XPZA 3UBMA 4N5IX 1M73E 3GL9A 1E2PA 4XIGS 3ZBUA 1CETA 1I3KA 1VPDA 3A6JA 5DM2A 3QYAA 3FRHA 3C14C 1U2DA 1E9AA 2Q5EA 1I3OA 3INYA 3L6RA 3SE0A 1XLTA 5FFFA 3WJAA 2NP6A 3LDFA 5I7OA 3OE4A 3RYCA 4LY3A 1USIA 2ZW9A 2R68A 4OFZA 1WLYA 1WTCA 4GMHA 1FLVA 2OUIA 2X7HA 5E4YA 4RPJA 4FR0A 2Y0BA 4GU5A 1DQPA 3HKEA 3EHDA 4R7ZA 4TL9A 3DFIA 3EMBA 4U9HS 3Q87B 1K7SN 4EL5A 5IDXA 5CFMA 5JUWA 2QTGA 1ST2A 1Z16A 3E9DA 4JWKA 4DANA 1FJXA 4QAQA 1CRPA 4EFDA 3FFAA 1U1DA 4O25A 1G5PA 5K0TA 1RLTA 2Z9BA 3VJLA 3LUBA 1GTL1 3U31A 1VI6A 3VPCA 1Q95A 2Q1XA 3SJBA 5DEOA 5EMMA 1FRZA 2ODNA 2H3HA 3AI2A 1ADBA 1GAJA 3A6LA 2B8WA 3WKBA 4BEVA 5FUQA 4M37A 5HIKA 1G8YA 5JPDA 3HUEA 4JLAA 4CNBA 3HB7A 2TMDA 4K26A 4Y2TA 4CMIB 1US8A 1ENOA 2HJ9A 3M81A 2Q9CA 2MSWA 2REBA 2WW8A 5DKFA 2HXYA 2NAFA 3ZJ5A 2H9YA 3ZKWB 3ABZA 5EXPA 2X4DA 2WMYA 3QNUA 2KB0A 3LOUA 5FL3A 4DBZA 3OZDA 5E38A 3F8SA 3MTDA 2H59A 2EP7A 4XIIA 4OREX 4QJ4A 2ZVPX 2O52A 2QQFA 4QQNA 2P8JA 4Y8VA 4G01B 1QK3A 1X7DA 1L5VA 3K4HA 2YIJA 2HNKA 1T5BA 4LVCA 3NONA 2GPNA 2P90A 3PUVA 1NVGA 2RCYA 4CCYA 5C1BA 1U4NA 4NZZA 3M6WA 4L9AA 4POAA 2YQ4A 4RV9A 4BMYA 4F9GA 4EJMA 1M7HA 2IP4