1BYIA

Structure of apo-dethiobiotin synthase at 0.97 angstroms resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of dethiobiotin synthetase at 0.97 A resolution.
pubmed doi rcsb
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHASE
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1byiA00
3OEEA 4GMXA 3GLIA 1QDEA 3K09A 2XEXA 2HCJB 4JLMA 2CE2X 3VKHA 3TQCA 2F9MA 4V0OA 4Q7JB 4Z1MD 2CL6X 3FHCB 4LDJA 4C0QC 1YJ5A 2FZLA 2IT1A 1COWD 2AFHE 4BE7B 1RZ3A 2ZJOA 4L8GA 1S2MA 4P4SB 1OXVA 2G0NA 3BWDD 1QF9A 5KSPA 2CE7A 4MRNA 3HP1A 1KI8A 2CJWA 5TARA 4BFYA 2MMGA 3LBIA 3K09C 4IFEA 1OH7A 3DVLA 1DVRA 1I4DD 1S96A 2HLDD 5EE3A 2AKAB 4O0MA 5JCZA 2VHUA 2R8RA 4PQFA 4OK3A 3GLIB 2JATA 5GJWC 4DVGA 2NIPA 1R2QA 2UZ3A 3IIJA 1X3SA 4JZKA 4V03A 4CEJB 2WVJA 2QY9A 2NO0A 4ZV4A 2GRJA 1U2RA 4HDQB 1D8TA 3TBKA 4A92A 3BGWA 1D9ZA 1QHYA 2AHOA 4IHQA 2IXGA 2Q21A 5TMPA 1L4YA 1E9CA 2ZI5A 3B60A 2JIZD 4BFVA 2OFXA 4XIGS 1DAIA 3NDPA 1ZM2A 2V9PA 1WRBA 4EQ6A 4RD1A 5F98A 2PT7A 5EE9A 3GFTA 4LHYA 2ZRBA 2W0SA 3PR1A 4QJ5A 4ZIRB 2HT1A 3QPVA 1GNQA 1T3SA 1KMHB 2CVHA 2ZRKA 2JIZA 2VEDA 1IM2A 3L8ZA 3QXJA 3A4LA 1XPRA 1VCOA 4US1R 1BOFA 4EPWA 4OK6A 4B2LA 3I62A 4WZ6A 2L0XA 4FMCF 3WBJA 3C16C 2JEOA 3GLGE 3K9HA 3THXA 1E0SA 4HB4A 4M2LA 1WBDA 3AM1A 1VPLA 4N0EA 2O52A 4B75A 4X8OA 4Q1EA 1G8GA 2QQEA 2XNDD 3RS2A 3UMSA 1XTSA 4E09A 5DN6D 5EP1A 4QJ3A 1Z6XA 1SVIA 1KK1A 1EESA 1G4UR 1T0HB 4JT2A 5C18A 5EP4A 1ETUA 4NCJA 4OI4A 1AS0A 1E2PA 2PCJA 1H65A 1QRAA 1AZSC 4OQLA 5JWOA 3FTQA 1NBMD 4IRUB 3B1ZA 2DCUA 1L8QA 1OE0A 4JYBA 1GOTA 4M9SA 2RB4A 1UEIA 4LJ7A 2REBA 3Q72A 1OW3B 1P2TA 1VYVA 5P21A 1QG4A 2QAJA 3NDBB 3TK1A 3SU8A 1Q1BA 1OYWA 3CRQA 5HCNA 5K8IA 3B13B 1TAGA 2KSQA 3FFAA 4PQYA 2KWIA 5KSOA 1RE0A 3RDPA 1H8HA 4Q01A 1H8EA 3EWSA 2DYKA 1AKYA 3K0AA 4PANA 2GXAA 3MD0A 2BMEA 3EIHA 4FMBB 4V0LA 1YZTA 2QAGC 1KJZA 1OXSC 4NDZA 1NVWQ 3C41J 4Q47A 1ZM4A 2AXPA 1IAQA 2EWWA 2XJ4A 4R7ZA 3VQTA 4XWKA 1A2KC 1RRPA 2GVZC 2ZRLA 3PFIA 4ERNA 4AURA 4M9XA 4IEIA 3VFDA 2DFTA 2JASA 3FMPB 1OH8A 4DLYA 2O5VA 3CR7A 1S3GA 2FOLA 2O8EB 2GJSA 4XWAA 1W0KD 4D0GA 4NYIR 1MABA 2BJVA 2GEUA 2WJHA 3QKUA 3O8DA 4RZ3A 2VH5R 1CR2A 4JVSB 4KYIB 1VYUA 2XB4A 5IK2D 1XXHB 3VU9B 2NMVA 3EZ6A 2IS1A 3AVWA 3QENA 2Q3HA 4TT3D 4YMTA 1SHKA 4DSOA 2ZRDA 4M1SA 1KO4A 4HDOB 4HUQB 2H16A 2C9CA 4QM7A 2X77A 3KQHA 2VP9A 2YWHA 1Z47A 3OIYA 2PZFA 1JALA 3V9PA 4Q1AA 4L16A 3LW7A 3AP2A 3NC0C 3ECCA 2FFBA 1LTQA 3FGNA 4KU4A 4AC9A 5AWFC 4PHHA 2PCLA 3TLXA 1QVAA 2J0VA 2J0UB 1VCIA 3DZDA 4PAQA 1KO8A 2DR3A 5JS8A 2FJUA 5KSYA 2O0HA 3HR7A 3SQXA 1P2UA 1TEXA 2ZS8A 4Q18A 1HURA 5GJBA 4FMDF 1P73A 3EZ7A 4RCZA 4TL6A 5CDFA 3ZIAA 3DOEA 1DOAA 2J7KA 3TUJC 1NF3A 2ZE8A 4QKQA 5JHHB 2HCBA 3TW8B 5IHPA 5G3YA 1KSGA 3K53A 5KYKA 2GK6A 4TQ9A 2ZI6A 3OFND 4JT4A 5L8VA 4PZLA 1XJQA 2XTMA 3RYTC 2OT3B 3NC1C 2Q3MA 3DKPA 3BK7A 3HU3A 1OPXA 1Z2CA 1ZC3A 3A4MA 4QBFA 5JI3E 1XXHA 3EPKA 1C4OA 1N6LA 2C8VA 3GLHE 3K9NA 2W2XA 1E2LA 3ZVLA 5JI2E 2WJJA 1P4SA 1LF5A 2OBLA 3AP3A 3PQCA 3SYNA 1CP2A 1W4BA 2AK2A 3L0PA 3KZ1E 5J4YA 3B1VA 4EJSC 1E2QA 2BMJA 1RYHA 1UBFA 3CRRA 1EFHA 1LFDB 1SULA 2FSIA 3W5JA 2YWEA 2Z5FA 5FBQB 2BEKA 1F3OA 2ZRHA 3BB1A 4BPBA 1Z8FA 3CIOA 1G8YA 1N5JA 1LV7A 2FFHA 2B6HA 4ZKEA 2BV3A 3SC3A 4PZZA 1XEXB 5J4LA 3ZDQA 2AD5A 2ZSFA 1CRPA 4I1SA 3LWNA 1KDTA 4OHZA 1KMHA 4L15A 4LK2A 5JECA 1E1RA 3GJ4A 3AGQA 4H1VA 4YXWA 4BFUA 1GILA 2H1LA 3KFVA 4UXJA 2OEPA 1W4RA 3AV0B 3RS3A 3QKTA 4BZQA 3H2YA 1KJWA 2ZU0C 1ZNWA 1ZYUA 3SFZA 4XD7A 2OCYC 2IYZA 5CJ2A 3HJNA 5KUTA 2B21A 4RD3A 3VR5A 2E1RA 4RKFA 4QC2A 5EE0A 2CCGA 3MJHA 2ZYTX 4PXAA 1YR9A 1DPFA 3UWOA 3R20A 2Z4SA 3O8BA 4WVFA 4DEXA 1HT2E 1OIXA 1A82A 1N6PA 1NMZA 4MRVA 2GETA 2CNWD 1KHTA 4O3MA 2EFDB 2IYXA 4QGHA 3WP0A 1E4YA 3QY0A 1NN5A 3EZ2A 4LJ4A 5DI3B 3T61A 4E03A 4BLRA 1ZUIA 2ERYA 3TAHA 1G3UA 1YRAA 5A5GA 1Z6GA 1M7GA 3IPYA 2XZPA 4Q9HA 4WAUA 4YMWA 4CW7A 3M4YA 2WSSD 3RLFA 3RVBA 2B8TA 2OZEA 3U7HB 1XTKA 4Q4JA 1Q0UA 1DELA 1N5KA 4PAOA 1VCMA 1K6MA 1ZD8A 1E98A 2WJVA 1PLJA 2DFNA 2GBLC 2QU8A 3CNLA 4M4SA 4HAWA 2VP0A 4MGZR 1RRGA 3G0HA 2GJ8A 4L9WA 2QTVB 1XB2A 3N2IA 2F6RA 4NYMQ 2OFOA 3D6TB 1X8LA 4LC1A 2V55B 1AQUA 1R0XA 2OFWA 3CBQA 3P1JA 8OHMA 5JEDA 3B78A 4QFMA 1E2DA 4JVNA 4DSTA 1II8B 2GBLA 4K46A 4IDQA 3W8NA 1G3IA 3VAAA 2XNSA 3J81k 1HE1C 4AG5A 4WXPA 3UXMA 1GL7A 2IHBA 1TF7A 3UATA 2MSEB 4KV9A 4ZKDA 4A2PA 2G1KA 4BFXA 4MGIR 1NVVR 1IXSB 1U9IA 2G88A 2YWFA 4G5SA 4F91B 4A8JA 1UAAA 1SXJD 4BECA 2PL3A 1KZGB 2IYVA 5E3HA 3IQWA 4F7WA 1G16A 1NL3A 4W5JA 2XZLA 3KJGA 3B9PA 2VPPA 1NNEA 2IXEA 3CONA 3F0TA 3TMKA 2N42A 3SYKA 1NN1A 4R9UC 4LCBA 4TYPA 3K9GA 1IJEA 3TSOA 2OG2A 1XEFA 2XJ9A 2FGJA 4Q4AB 3U2QA 4NH0A 2FH5B 2W6JD 2A5FA 1Z0FA 1SXJE 1IXRC 5JCPA 4YQFA 3H1TA 3ZD6A 2PBRA 1MO4A 2HLDA 4N1AA 2QMEA 1LNZA 1XEXA 1ZBDA 5AJVB 4BFTA 4BZPA 2ZSDA 2GJ9A 4OQXA 2WBLC 3TIFA 3U44B 2QP3A 3BB4A 1KTVA 5FUWA 2JLYA 2ZRMA 4OHVA 1GKYA 4ARZA 1P9NA 1R8QA 4OKSA 3W6PA 2CNWA 5FH9A 1GNRA 1GAJA 3R7WB 1IY0A 4R2IA 2GK7A 121PA 1XP8A 3VR1A 3EASA 2WTUA 1VG8A 4MGKR 3NIBA 3O8CA 4ZCMA 1W36D 2E87A 4MQBA 3RWOA 3ADCA 1EFRD 4NYJR 1CS4C 5FUVA 4LBZA 4DCTA 2QMOA 2WZQA 3NKVA 4U00A 5KNDA 4MKFA 1EXMA 1E1QD 3AVPA 2DWOA 1G291 3WNCA 3D7MA 3AKCA 1Q44A 1HA3A 2VLIA 4XJXA 2YKGA 4G01B 4Q1FA 2IS4A 3EC1A 3NHAA 5JBQA 2FA9A 4KAXA 3CRMA 2H7VA 2EFEB 1F5NA 3IBYA 1W5SA 4JMPA 3EARA 4JLVA 1NBME 3C7KA 5LB4A 1E69A 3CRVA 1I4LD 421PA 3LX5A 4S35A 4U02A 1IN7A 1RW4A 5FBWB 4DWJA 2O8BA 1BMFD 2PT5A 1AS2A 2FN4A 1PV4A 4MYHA 4P4TA 1DS6A 1B0UA 2A9KA 1JNYA 5JMTA 4EAQA 4NZYA 3VX4A 1ESMA 5F2EA 1Q57A 3IHWA 3W6NA 2R2AA 2ZJ5A 2VYFA 1BH2A 2FEOA 5EXXA 4LV8B 1S9DA 3FHTA 3W5IA 2GJKA 2IL1A 4HEJA 4JKYA 5DN6A 4DCSA 2QMUA 1T3LA 5FBRB 1MOZA 1NLZA 1YR7A 1AJEA 3IEVA 4BRWA 1TU3A 1E2MA 3PUWA 5CK5A 5CB6A 1XMSA 4ZCLA 5AUPB 2BWJA 4LJ9A 3VR3A 4NMMA 4GNKA 2J59A 1Q12A 2G83A 3AKEA 5BW8A 3PJRA 1R6BX 1DAGA 3THWA 3P4XA 2JDID 1FQJA 1X1RA 5B57C 4Y0AA 3T15A 4PZYA 2FE4A 2ZJ8A 2ANBA 2QP4A 4TLCA 3FWYA 1KI6A 2CK3D 4KITB 3BH7A 1CJTC 1U81A 4LHWA 2Q3FA 4Q4HB 4IVPA 2ODWA 3RWMB 3CNNA 2XGJA 1AA9A 1ZAKA 2KBFA 1XTRA 1KMQA 4BEBA 2O8BB 2I1QA 4DDUA 1XMVA 221PA 1Y3AA 1YZKA 1CRQA 1M74A 4GOXA 4AG6A 4W5WA 3FOZA 1G5TA 1WE2A 4AI6A 4PR0A 4AIIA 4OQFA 1T8UA 3V00A 4TL7A 4KHZA 3L2OB 1E9EA 3SBDA 2CBZA 2YV5A 2IK8A 2IS6A 4GZMA 4DRZA 3WMEA 3QG1A 2NPIA 2ZR0A 3AF3A 3P32A 1Q1ZA 3QF4B 2QSYA 2ZROA 5JHGB 2B7CA 1EX7A 5G53C 1R10A 5JRJA 3OAAA 4NP6A 2J41A 1E4VA 1JJ7A 4QGFA 3TQFA 3UKDA 1KOFA 3HYTA 1G7SA 2GZAA 2QT0A 5FL7D 4A2WA 5KDOA 1NVVQ 5L3SB 5FTNA 2EVWX 3K70C 2IUSA 3I3SR 3U4QB 3BRWD 1UEJA 3WYAA 2ORIA 4FCWA 2QA5A 3PCRB 4V0NA 3R8CA 1J7KA 5SZJA 2A5GA 4HLDA 5KHOC 1KJYA 3T5DA 1E0AA 1GVNB 1AKEA 4N0DA 5BQ5A 3ZZUA 1Z07A 2RKOA 4ITRC 3CF0A 3N2EA 3R7WA 1Q21A 3EAQA 2GCNA 2VP5A 3THXB 3BE4A 4OI2A 4R98A 3ZJYA 2XNDA 4GSYA 1GRQA 2CVFA 4MITA 3ADKA 4OI0A 3OHMA 1KIMA 1OHHA 2ZE7A 3AH8A 2EYQA 3GJ3A 4D4LA 2FPKA 5C46F 1SHZA 3T35A 1CXZA 2IYSA 3SHWA 4OQMA 3AF1A 1T0JB 4EQ6B 3SQWA 2WWYA 3TAUA 1Z3IX 1DAFA 1F6BA 4WXRA 3WYFA 2WIBA 1T3HA 3QPWA 4M53A 4A1FA 4GRAA 4QNRA 2YYZA 4HAVA 3BD9A 1DEKA 1TQDA 1YE8A 2BEJA 1QHXA 1XCPA 3FMFA 1DAMA 3FYHA 1WP9A 1VYTA 4RFVA 3QI2A 1VDZA 2GTPA 4G5OA 2YOHA 4LBYA 2D74A 1IONA 2C9OA 3K1JA 1P7CA 1VIAA 3FPAA 3E1SA 3AP1A 2REOA 3PV0A 2GA8A 1GRNA 5FPYA 4XOIA 4EPRA 3MCAA 5EJEA 1AGRA 5AK0A 1ZD1A 3GEHA 4BZXA 2F3RA 2ZEJA 4C0JA 5AUOB 3WBKA 4B47A 2TMKA 4XVRA 1W2GA 4A8JB 3PEWA 2QT1A 4RZXA 4DBLC 2VSXA 4YDSA 1AIPA 2HYDA 1UDXA 2VP6A 1FNNA 2J5XA 2WHXA 2H8KA 1AZTA 4I1UA 4MKGA 3W34A 4EUNA 4ASUA 3IPXA 1W46A 1VKJA 1KAGA 2FFQA 5CIQA 2DB3A 4PPGA 3C8UA 3QXSA 4UKDA 1FX0A 2ZYVX 1SKYE 3BH6A 4IXMA 2XITA 3A4NA 1JR3D 1JEDA 1XCMA 3A1VA 1G6OA 1G8FA 4MUAA 1XD2A 4U5XA 4F92B 2O8CB 1KK3A 4DCVA 2IEYA 5D3MB 3DDCA 3SEAA 1ZD9A 3AUXA 4Q00A 5AJXA 2ZVQX 4PHGA 3CZQA 1R8SA 2AN9A 1E2NA 2O8DB 1C1YA 4D6PA 4XVQA 1R5NA 1ZIPA 4NE2A 3QIAA 4A0RA 5JSZA 3GLFB 3GFPA 4CEIA 1OSNA 1WXQA 3LO5A 4YONB 5HR5A 3DEFA 2GJAA 1AM4D 4NTZA 4AY2A 3MG9A 4JVMA 2Q9BA 4LYFA 1AK2A 2CL0X 1A2BA 1KI2A 4HUQA 2PH1A 1FTSA 2HDNB 4DLUA 1N3BA 2ZI7A 4UNQA 2IHYA 4AYTA 4QG7A 4QM6A 1Q22A 3NBYC 4N3NA 3WRYC 1B23P 4UXHA 3THOA 2BKUA 5FOWA 1JPNA 1UFQA 3MLEA 4LYAA 2JLXA 3Q7QA 1NIJA 2VRWA 3EW9A 2GCOA 3NVAA 2DBYA 3OF5A 2QRZA 2CK3A 2QPOA 1E79A 2A30A 1CBUA 3P20A 2N1BA 3PVSA 4ACBA 1NMXA 2WWWA 3CH4B 4HAZA 2QROA 2G6BA 1HEIA 1T5IA 3GJ8A 4W7SA 5HCIA 1KI1A 1J8MF 5C1BA 4HLUA 2ZXUA 3GMTA 1VG1A 2CDNA 2R6GA 2GXUA 2GZHA 4UNRA 2XTNA 4A6PA 2QBYA 4M1MA 2I1VB 4AD8A 4OHYA 1L4UA 1D2MA 2J45A 4CT4B 1N6OA 4IXNA 4KO8A 3EX7C 1G17A 4P32A 3WNBA 1BS1A 5CIWA 2C04A 3T34A 1X6VA 1F48A 3DHWC 4C0HA 1GKIA 5JRZA 1E96A 4PPNA 2IYQA 1A4RA 2ZUDA 4JVLA 1XTQA 3FHOA 4A4DA 5HE9A 2ZR9A 5F9HA 2GHIA 3H0KA 4A6XA 4PC3A 4POAA 3EA0A 1OH6A 3VKWA 1CULC 2NGRA 1GL9B 2ONKA 4KJZA 2H57A 1E2EA 2ERXA 5CM8B 4HAUA 4QHTA 1IN4A 1ZUHA 1G3QA 1I4TD 4B34A 4RZ2A 1CJKC 1ZNXA 1I2DA 1E94E 3AUYA 3PEYA 1D2NA 2NZ8A 2CL7X 2I3BA 1HUQA 3U3JA 5C2JB 4JIMA 5KPJA 2DFKB 1SVMA 3BERA 2O8DA 2AR7A 1JEEA 4HZIA 1EG7A 2RHDA 1NJGA 3M6AA 4KODA 1XEWY 1E9FA 2WV9A 2A78A 4CF7A 3R8FA 1EWQA 2FX3A 2J9RA 3AKDA 5UKDA 4X8HA 5FTKA 2NPFA 1KNXA 3PG5A 4TYYA 4WIAA 1NRJB 1Q3TA 3EWAA 3E70C 1E2JA 3U7EB 5HKKA 2FFAA 2GCPA 3CZPA 4B35A 1U0LA 1FX0B 4LJYA 1D9XA 2KJQA 4FCVA 3U3OA 1F2TB 1F60A 1A1VA 4QOSA 4MRRA 4D81A 3IO3A 2RGNC 3K0CA 1KYIA 4HB2A 5FR2A 5DO9A 4BLTA 3LD9A 5LDDC 3DL0A 5JFGA 3PUXA 1YR6A 2C2HA 2IYLD 2H5EA 4M9ZA 3HU1A 4H9GA 2AWOA 2P6RA 3Q5DA 1G64A 4JBWA 3B82A 4WBSA 1G41A 3LRPA 3I8XA 3LLMA 3ZVRA 3Q3JB 3VKGA 3SBEA 1G7RA 1KI9A 2IYRA 3GP8A 5KDDA 3AF4A 1U98A 1Z06A 3RS5A 4B48A 4I1VA 1W0JD 4FW9A 1NG1A 2QGNA 3SS8A 5CM9C 2FWRA 5BYJA 4E07A 1ZC4A 1NN3A 2RGDA 2WICA 1MABB 2JLZA 1UKZA 4GPTA 2ZIAA 3OIVA 1XRJA 2HF8A 1XXHE 2X2FA 1IN8A 1LY1A 821PA 3KQNA 4X8LA 2QBYB 1XFAA 5DHAA 1IQPA 2HUPA 2VSFA 1XTIA 3I4LA 4ESVA 4EPTA 1XU4A 1XEWX 4B3CA 2ZPTX 1CTQA 2WJGA 1WBBA 4TMTA 5BWMA 1KI7A 3VNVA 2H18A 3FDIA 2HXYA 2R6AA 4I1OA 2IWRA 1V43A 3L0SA 1EFUA 2C95A 4L4UA 4QHSA 4D4KA 1GKUB 1N0VC 2WWHA 3K8YA 3AEZA 2W0MA 1P75A 3B2EA 2ZJYA 4MGYR 1T91A 1EFCA 3CB4A 1A5TA 4MRSA 4M1TA 3QF7A 1FTNA 1OKKA 1ZU5A 4TL8A 4AWXA 3UPUA 1E3MA 1US8B 4GT1A 4HB0A 1ZJ6A 2OXCA 4PQRA 4B73A 4DLZA 2BKEA 4JSYA 4PSKA 1W7AA 1JR6A 1KI4A 1QG2A 2PJZA 3KB1A 3H86A 4TSFA 4UNPA 1J70A 3RANA 4ZDKA 3A36A 3DM9B 2F43A 3DO6A 3RSLA 3P26A 4CEHB 4LPSA 4DT1A 2F1RA 1JAIA 4B33A 5CJPA 4LBWA 3AGPA 4K8OA 4LHXA 2D7DA 4PSAA 1NN0A 2FSGA 4US0R 5DSZA 5EE1A 4DUGA 1VECA 1US8A 1GTVA 3PUZA 2FPMA 3BFKA 1YU9A 3RC3A 2JLVA 2OM2A 3KB2A 3REFA 2W00A 3CF2A 3CUEF 3EA5A 3R9WA 1RPZA 1S0UA 1KY3A 2ZYUX 4A2QA 1SXJB 1QHNA 2OO7A 2HXSA 3BH0A 4HB3A 2AKYA 2ZVPX 4RFSA 5J4HA 1DO0A 4LOAA 4OL0A 4EPXA 5F9FA 4IOMA 2WWXA 2C9YA 3CM0A 3QOFA 3QVUA 2JGNA 3OEHD 3GLFE 1CR0A 1COWA 2GAAA 3BJIC 4M8NE 3SDZA 4HLQB 3MUFA 3TW4A 1P60A 3RRMA 1E2FA 3QSYA 1TU4A 3TSWA 2GXSA 4TZ6A 3I1FA 4DSUA 4HZUB 2KI5A 3ZYCA 1WF3A 4RJLA 2QG6A 3ND8A 5TVKA 1G7TA 3NH6A 2IYWA 4MYUA 3UG7A 1MT0A 1VG9B 2OAQ1 3R9XA 2Q9CA 2JLWA 2WOOA 3O47A 2P5SA 4RZUA 1CEEA 2RGNA 3KJEA 2CJWB 3D3QA 3NBZC 1XCGB 1JXMA 3LX8A 1II8A 4QBHA 3T1VA 1FP7A 2PZEA 1U8YA 3T06B 5J4KA 4DEYA 3WMGA 4JL5A 3I32A 4S2EA 4ABYA 1PUJA 4F4IA 4DCNA 5BN5A 2DY1A 3A58B 4Q48A 1FNMA 2DWPA 2WSSA 1U8AA 2Q0HA 2J0UA 3M0EA 4MA4A 3CX8A 4TTQA 2ASEA 2V4ZA 4DUGD 5EXSA 1N6HA 1E9BA 4II7A 2D4HA 2D2FA 1NIPA 3LBHA 4UJ5A 3LFUA 3N70A 4EFMA 1L7VC 1JQJC 2P5TB 3QEOA 4LUCA 3GLHA 1YHNA 2QAGA 2VL7A 4TMXA 5E7MA 4GBMA 2F43B 2NO7A 2J1LA 3I8SA 4LHZA 1MRNA 1DG1G 2QZ4A 4BFZA 1KAOA 3OEHA 3THYB 4ACAA 2ZE6A 2OLKA 2FSFA 1W36B 2R6FA 2WWGA 5DIFA 1CJMA 1U0JA 4LZZA 4ON9A 1HH4A 4QXAA 4YDHB 1QHHB 1HV8A 2AFIE 3GJXC 2NG1A 1KO7A 3WY9A 3RS7A 4PO9A 2R6DA 1NSTA 2NO1A 2EYUA 4DIEA 2F9LA 1X8JA 1DAKA 2EFCB 3IILA 1R0YA 2RMKA 3NTUA 3SJCA 4QNMA 2WOJA 5FOXA 3LBNA 5FFMA 3GLGA 3NEYA 2IYTA 3SYLA 1YR8A 1CF4A 2QP9X 4LJ6A 2QSZA 1TX4B 5CLLA 5FI0B 1E9SA 3SI7A 1Q3HA 1SVLA 3EPHA 4CIDA 4TQUS 2JA1A 2R9VA 2GXQA 2BBTA 4PPQA 2XXAA 1HE8B 2OV2A 3IEUA 4BLSA 1G3MA 2IA5A 3L8YA 3SFVA 3RSOA 1GDDA 1ZP6A 5KPDA 4PFSA 2YOGA 3QVVA 4KVGA 5ANRB 3TRFA 3VX3A 2I4IA 4Q66C 3X1WA 3KJHA 3ZS8A 1QHHA 2MSCB 5CYOA 2ZRCA 1IOZA 4BLPA 4ZI2A 1ESNA 4RKEA 3GFOA 3NBXX 3NEJA 3AVQA 4KBGA 1M34E 4KI0A 2IBMA 1RRCA 1NG9A 2VBCA 1NMYA 4IVRA 5FI1B 3THWB 2CHGA 4NCHA 1XMIA 1M8PA 1OXTA 4M1OA 1GUAA 1OLOA 2W6IA 1BKDR 2CLDX 1ZU4A 3Q9LA 4TSFD 4A15A 3A6PC 1P9RA 4Z8YA 1JBKA 1W4CA 2JLQA 2PX3A 4TLAA 3MSXA 1GRRA 2XZOA 2Z43A 3LVRE 4TT3A 4DCUA 2CCJA 1AQYA 4QRHA 3HWSA 1IY1A 4JL6A 5DYGA 2ORVA 1LS6A 4Q9JA 1TF2A 2VQSA 3EPLA 3HR8A 3K0CC 4KVAA 2YNMA 3GLHB 4DDWA 4GDFA 4RD4A 3P4YA 3ZQ6A 5TB5A 4A9AA 2FV8A 1NKSA 1NLFA 3A1SA 3HU2A 4XSGA 1P3JA 5AUQA 4EIWA 4PO1A 2VP2A 1SVOA 1OHHD 1YKSA 1BMFA 3RAPR 1YZUA 2HJGA 5TY0A 5G3ZA 3BXZA 4Q4JB 1XD8A 2BIFA 3V4RA 4LRWA 2Z83A 2ZRGA 4IDNA 3A1TA 3ZS9A 4HAXA 1OIWA 1FL9A 1R0WA 3AB3A 1OFHA 2GNOA 4TTPA 2VO1A 2F1JA 2P65A 3KKOA 3T12A 2JJ1A 3KXIA 4P4SA 5FTLA 3ZZ0A 4LPKA 1BYUA 2CLSA 1MO6A 5EE5B 5CB8A 4CGZA 1RYFA 1Z0KA 3CPEA 4EPYA 1VTKA 2V7QA 1Z2AA 1VG0B 4FXPA 2GAOA 3CH5A 2WM9B 3HDTA 5GJVC 3SE0A 1UJ2A 2JLSA 3KUCA 4KLNA 5M04A 4FD2A 4KXFB 5FOTA 5LD2C 1TUIA 2OLJA 2G77B 4TLEA 5JJLA 2D62A 1ZMXA 1W48A 4YMVA 3BBPA 2VTKA 1DBSA 5E7JA 2QM8A 2CCKA 1M7BA 4GOKA 5FPHA 1KO5A 3KFXA 2OCBA 4O2LA 3ADDA 4Q4LA 2LKDA 3JVUA 3KKPA 5J5CA 3GD7A 1ZRHA 1TQ4A 3RABA 1Y63A 2BCGY 4LI0A 2WKQA 4Q1CA 4A82A 5FPSA 3E5HA 3TH5A 1EWRA 3H4MA 4D2IA 4L5BA 2JJ2A 1EK0A 4XTCS 2WSMA 3F8TA 5CITA 1LF0A 1QHGA 1RFLA 3SJBA 2FEMA 4LX0A 4DT1B 4CYMA 2W6ID 4OBEA 3WYGA 1MR3F 4Q7LA 3PIRA 2V3CC 2CMKA 2NZJA 4WZBE 3IO5A 5AR1A 5FOSA 4NBSA 1YZGA 3B1WA 4MYCA 2AL7A 1F2UA 4EPVA 1F2UB 3D31A 1RJ9B 4URZR 2XOKA 3KX2A 3QF4A 1J8YF 3QBTA 4WZAE 3GLFA 3QQ5A 4TYWA 2H17A 1ZINA 1W49A 3W9YA 1ZCBA 3FE2A 2YC2C 3KJIA 2B8WA 4B6FA 1KO1A 2AK3A 3LQQA 4JJZA 3ZH9B 2JJ1D 2ZI9A 4ZO4A 4E5UA 4Q21A 4D4MA 5JWRA 5KSZA 1P72A 2R6CA 1CU1A 3KL4A 3MWYW 3QBVA 4D0NA 4ZIRA 1XMJA 2YZ2A 3BAFA 4B44A 4DC9A 4FINA 3OEED 3K0EA 1VMAA 1Z6AA 1XBTA 1KK2A 2GDJA 2P2LA 3PITA 4EJSB 3P27A 2OCPA 1E1QA 3A8TA 1G19A 1VIYA 1Q20A 1G6HA 4Q4HA 5AJWA 2CHQA 4UNNA 1XDBA 2XAUA 3A1UA 2R62A 1E2GA 3TJZA 2FF7A 1Z28A 3Q8XB 4NL4H 3L0OA 3ETLA 4JKIA 2A2ZA 2ODNA 3IUYA 4L9SA 2OILA 4V02A 1IN6A 3NBFA 1MO5A 3D8BA 1HY3A 4PC2A 1N0WA 2VF8A 1GG2A 4UXIA 4CZ2A 3B85A 3FKSA 3AVOA 1IBRA 2C5LA 1M6NA 2IYYA 5KOYA 4O2RA 2J87A 1N5IA 2ZRAA 3MMPA 2V1UA 5HZKA 4OJKA 6Q21A 1WA5A 3IHLA 1G5PA 2J3EA 1G21E 1TF5A 2W6JA 4Q19A 3LH5A 1SVSA 2EFGA 2EW1A 3QUSA 3IIKA 1RVDA 4JL8A 3V4FA 2O8FA 3TVDA 3KXKA 2QRNA 1WQ1R 2YC4C 3I5XA 4DLWA 1N6NA 1OV4A 3EXAA 5TXGA 2O8EA 4WOPA 4V0MA 1NSFA 2J0QA 1GL6A 1ONBA 2JJ2D 2OESA 2G1JA 4G1UC 1YQTA 2BVNA 1EGAA 2ZJBA 3C5CA 3CPJB 3QPUA 4OHWA 5GVRA 1S4QA 4RY2A 2VHQA 3OE7D 3U60B 1NP6A 2IEZA 1E32A 2O0JA 1KI3A 2KE5A 3F5FA 4HYYA 4Z8XA 5L3QB 1ZIOA 4LJ5A 2ZM5A 1J2JA 1X8KA 1N2CE 1XWIA 1XZQA 3Q7PA 4C4PA 1JXOA 1O87A 4UQOA 2WAYA 2WPDD 1KSJA 2RH5A 4QGGA 4R2HA 3AF0A 5JWHA 2FPLA 3K0FB 4FMDB 3L82B 2W2VA 3GLGB 1N6RA 2QL6A 4KYUA 4M21A 3ZLJA 1ODFA 5B64A 3CPHA 4URXR 2HV8A 4DIDA 2XX3A 3BIFA 2G9NA 3EIEA 2LKCA 4TN1A 3VHXA 5AUNB 3FB4A 2J0SA 2QN6A 2O0KA 1G4AE 2A5DA 1RC8A 2HT6A 3DKVA 3DPUA 4DSNA 1T6NA 3JZAA 2DWQA 1Z5ZA 2H92A 3QE0A 5FUYA 5KDLA 2Q9AA 4ESHA 1UM8A 5KTYA 4DB4A 3I92A 1XJCA 3T1OA 1Z0IA 4XSHA 4P0TA 1NVXQ 5AJZA 3NHBA 4HDCA 1K5DA 4TMWA 3VR4A 1X1SA 5KO2A 4KFSA 4A8JC 4IFBA 4C30A 3U5ZB 2D06A 3U44A 1T9HA 5HE8A 2QE7A 2UVQA 2ZRPA 4IDPA 1WDTA 1NJFA 3X1DA 2WWFA 2QAGB 4B71A 1W1WA 3ADBA 2RCNA 1XPOA 2FZ4A 1DADA 3TVTA 4LV5B 4M1WA 1QZXA 5DH9A 1P9WA 2QENA 1PVOA 3CRW1 1UADA 1Z0AA 5BYKA 1SVWA 3T1QA 5IT5A 3KUDA 5JJIA 1ZW6A 4B3DA 4IKEA 4Q5IA 4JLAA 5LB2A 1N6KA 2VHJA 2F1HA 2JLRA 1P62B 1KSHA 1R5BA 3ZVMA 1U8ZA 4C0SA 2ZAOA 4JLPA 4KSBA 1AGPA 5H8WA 1G8PA 2HEIA 5FUXA 1CJVC 3UG6A 4XH9B 2O8FB 3EG5A 4IOLA 1D2EA 1U90A 3QKSB 4QGAA 1DO2A 2QM7A 2ZSBA 4BUJA 1Z22A 3ASZA 2IYUA 3CKLA 5H68A 2FU5C 4LBVA 5J47A 2FG5A 4HATA 5B58C 3VU9A 1GM5A 2V54A 2QPAA 1OT3A 4W5HA 5FR1A 4XVUA 2ZRNA 5B30A 5HZHA 3AVYA 4P31A 4Z54A 1MO3A 4LSGA 4CEIB 1XD2B 1JB1A 1K5GA 4BQSA 2YINC 5FTMA 4BWYA 1KZ7B 3HPQA 2AD1A 1OJLA 1XD9A 3FKQA 3TR0A 3VTKA 2C03A 4D0LB 1FMJA 2QMHA 2Y8EA 1PJRA 4GP6A 1G5RA 5AJYA 1N5LA 4URWR 5E7IA 2ECKA 4OK5A 4D25A 4D80A 1OKKD 4OJQA 4RFSB 3LY5A 1R4AA 2VHTA 2X2EA 4B43A 4XWOA 1Z08A 4Q7MB 3K0AB 4E22A 3TUIC 4LY6A 2IS2A 1G3RA 1SVKA 5DGXA 2CHVA 3AQ4A 3KKMA 3OESA 3FVQA 4LHVA 4LC0A 1E6CA 5FL7A 4B2IA 3CO5A 4BEJA 2MMCA 2ZYWX 5C4MA 2P0EA 3GJ7A 1SKYB 4F38A 2EQBA 4JBYA 3REGA 2CEAA 1EX6A 4HLUC 5EXPA 1U0HC 2GEDA 4JYCA 2V6JA 4A36A 1RRFA 2YJTD 4ZDJA 1AS3A 2QUZA 2P3SA 4GZLA 1PUIA 2ATVA 3B5JA 1UDWA 3B9QA 1XZPA 4NYJQ 2IX3A 5KU1A 3I5YA 4AKHA 3SJAA 1OH5A 2DFLA 3QKRA 4TLDA 4Z1MA 2JLUA 4FMCB 4B2PA 2PMKA 2WJIA 2BOVA 1E2KA 3NXSA 1GNPA 1SGWA 4OYHA 1W4AA 2BMFA 2VSOA 3N5CA 3RRNA 2WJYA 2ZANA 4PO8A 4RD6A 5CLQA 2WKPA 4US2R 2P6NA 2WMOB 4KLZA 5DHFA 3T1TA 4M9QA 4TMVA 4DXAA 2EWVA 2FDCA 4ZI3A 4MDFA 1ANKA 2GVDC 3MWJA 3SHFA 3VHLB 2NO6A 1II0A 2ZJAA 4M22A 3FMIA 3MRSA 4JLDA 4JJKA 3ZZTA 2ZS7A 3K70B 4R71A 5FPTA 1PLLA 4WW0A 3GLIE 3KDSE 4DLXA 1NY5A 3CX6A 1WMSA 4MKHA 3X2SA 1E2IA 1FZQA 4OI1A 1T5LA 1P61B 4CT5A 1TL7C 3LLUA 3W3AA 3IDQA 2MSDB 1CJUC 4AYWA 4LWZA 3SNHA 2V7QD 3RRZA 1R0ZA 2C99A 5J40A 3X1YA 1U9IC 1IXZA 4B74A 1UKEA 2GKSA 1N25A 1TADA 1G1MA 2X8AA 2ORWA 1JR3E 3U3KA 5LPNA 1II9A 3EZFA 1JPJA 5L3SA 2AX4A 1E99A 3U3RA 521PA 4DB2A 2ODEA 2X19A 1Z0JA 4TTRA 2ZR7A 3GEEA 4TL9A 5BXQC 1RIFA 5EUMA 1D5CA 4G3XA 1OXXK 4RVCA 1M1YE 2ZTSA 2QTFA 2A7QA 1HQYE 5HPYB 3OIWA 1XX6A 1JR3A 3EZ9A 4NYIQ 2ZRFA 3KTAA 4URYR 3K0FA 5K8TA 1UKYA 2NO9A 5DLQC 1DAHA 2QTHA 3CX7A 2XSZA 2FNAA 3HYRA 1OB5A 4EFNA 4M0LA 3KQUA 2BC9A 3OFNA 4PX9A 4URVR 3TGPA 4XTRA 2IW3A 2BBWA 1ZVQA 2P67A 2J7PA 5DI3A 1KKLA 4H1UA 1ELOA 4MUBA 3QKSA 3LXRA 2D2EA 1MV5A 2DPXA 4G0NA 4HAYA 4DZZA 1E9DA 2BM1A 4B3BA 3IQXA 4BLOA 3IGFA 4NKRA 1ZM7A 3W3ZB 1GWNA 4IOJA 3PEVA 4LJ8A 4B3XA 3QXXA 3W90A 4IOKA 4B32A 5FPKA 3G82C 2BHRA 3SJZA 2BBSA 1P2SA 1S3SA 5IDVA 1Z29A 4IDOA 2JDIA 1GZSA 4TWZA 5DI9A 4GI7A 2AWNA 3UMFA 4JBXA 4UNSA 1ZM9A 1T4GA 3FMOB 3CW2A 3B6EA 4FWIB 2ODBA 5DYIA 2ONJA 2GZDA 3A37A 3GEIA 1OYYA 2GILA 2RGCA 1WB9A 2P6UA 3C15C 3S1AB 2PJRA 3VNUA 3I72A 5EXTA 1YZNA 2C98A 4EKDA 3AKYA 2VF7A 2D3WA 4YMUA 4TZ0A 3DM5A 5BN4A 2AXNA 4V0KA 2F7SA 4Q9LA 5JLJA 1W0KA 3C14C 3CNOA 4BGDA 3E2IA 3QG5A 5EP3A 3ZQJA 2ZI4A 4PSVA 4JS0A 2W83A 2RHMA 4LV6A 4C2UA 5IK2A 1HQCA 2IUTA 3GJ6A 1ZNYA 3BC1A 4I99A 2RGGA 1QHIA 5H70A 5HTKA 4B3FX 4EJSA 1LS1A 3SN6A 1FUUA 4GL2A 1XPUA 3CWQA 4M1YA 3RS0A 2V6IA 2G0TA 1TTTA 1OIVA 4MDEA 4ZCIA 1DE0A 4GMDA 5SZIA 3UMRA 4P3YA 2ZJZA 4IJMA 4EFLA 5FL3A 3PUVA 2WKRA 2ZITA 4XD7D 1K8RA 2D7CA 2WWIA 1XTJA 3G5UA 2WPDA 2ATXA 4PHFA 5DE3A 2RGEA 5GADl 2YHSA 4Q9KA 1BIFA 5E4FA 3RC8A 3O8RA 2QI9C 4ASUD 1CLUA 3LXXA 4I81A 4W9MC 3U61B 1ZUNB 1GP2A 4Q7KA 3THYA 1DTSA 2PMDA 1RJ9A 2HF9A 1Z0DA 1OFIA 1J99A 2K5UA 2NTYC 1Z6YA 5FBVB 5L3VA 5LD2B 4ARZB 3MWLA 1XNJA 2ZRJA 4AK9A 4DLVA 3QEJA 4X8MA 3W8RA 5HKKD 3U6BA 5D3MA 4K81B 3WHKA 1NBMA 3BFVA 1W2HA 2ANCA 2KBEA 1P2VA 2PEYA 5FOUA 3UK6A 3VMFA 4M1KA 4PHTA 3KKNA 3WRXC 1E2HA 4B6EA 4DDVA 2XB2A 1Q1QA 3KXLA 3L43A 4HSEA 2ZUCA 3K9LA 2QPTA 1NVUQ 2C78A 4BFSA 3B1YA 2VIIA 3QXCA 1HTWA 4D4JA 3PXGA 1FP6A 4FN5A 1Z6TA 2JCSA 4RD0A 1U99A 5A0FA 1IJFA 3CWZA 3QKRB 2QEQA 2REXB 1YZQA 1KKMA 4KFRA 3TNFA 4C7OA 1GITA 4G5QA 4Q4AA 1EFTA 1P6XA 2A5YB 1KK0A 1M2OB 5ELXA 3EC2A 5D3QA 1LVGA 1HT1E 4CEJA 721PA 3L0IB 4B76A 4DHEA 3OIUA 3PUYA 3X1ZA 1DAEA 4IEEA 4IVQA 4NCIA 2YVUA 2YWGA 2PZGA 2RGXA 1M7HA 2RGAA 4QBIA 3T5GA 2OBNA 3ZD7A 4DJTA 2DHRA 1D6JA 5TDHA 1KY2A 3LVQE 1E1RD 2QGZA 4Q9IA 3WMFA 2ZE5A 4C7OB 4UJ3A 3BB3A 1P5ZB 1E0JA 1G9XA 1SXJA 1TEVA 2HJVA 4PPFA 4C0KA 3LNCA 4IDHA 2B7BA 2BMDA 2VHCA 5CYPA 5L3RA 3AVXA 1JI0A 5C4GB 3BORA 1HYQA 1FFHA 1TQ2A 4YLGA 1QVRA 3GJ5A 2PLFA 5TV2A 1FPMA 1NY6A 2QNRA 2YOFA 3UIEA 5KNBA 4RD2A 4FIDA 4URUR 2ZREA 1NI3A 3LA6A 4A0FA 5IRCD 2FMXA 2VA8A 4KFUA 1H8ED 1MKYA 1OFTA 4F93B 1UBEA 3Q85A 4LYHA 3TSZA 4CDGA 4D82A 2B92A 2BM0A 1SKQA 2EU8A 4AKEA 4AKGA 5K8LA 2OUKA 3DMDA 5GJCA 1LB1B 4J0QA 4RCYA 4FCTA 4EDHA 5F3WB 5KNCA 4NCNA 4C0AC 1S9HA 1Q1EA 2IF2A 2OAP1 2SHKA 3QXHA 2WIAA 4YMSA 4IW3B 1FUKA 1MRSA 1J90A 1YRBA 2ZAMA 3MAAC 4Y0VA 3DZ8A 3GJ0A 2A5JA 3K70D 1X86B 2ZUBA 1DARA 3WHLA 1H8HD 3RRYA 1O3YA 1JJVA 4C0LA 3I73A 5JEEA 3LDAA 3F3YA 1CKEA 2NQ2C 3KQLA 3LW8A 3PEUA 4TYQA 4KFTA 2V1XA 3TKLA 4B3GA 2J46A 3IBGA 3C5HA 3ICQB 4OQNA 1W44A 2EFHB 2Z6VA 2XTZA 3AF2A 1WCV1 4C3ZA 1W0JA 5JZVA 1V5WA 4QL3A 1KDPA 4P4UA 4NONA 2ZQ5A 5FBLB 2XXAB 1PZNA 1KDRA 5B2ZA 1N6IA 1JECA 1IN5A 621PA 2OCAA 3ZGXA 2C96A 3KKQA 1E79D 4NYMR 3S1AA 3AVUA 4LYJA 1NKTA 4WA7A 1UKVY 3JZMA 2LWIA 4RSGA 3IKJA 4YXWD 4ILEA 4DLTA 1L2TA 5GVSA 3SOPA 2PLRA 4U7DA 1NLYA 3ZIAD 4BFWA 1JQLB 2QORA 2ZETA 1KSFX 4ZPXA 2WAXA 5E95A 4CRWB 4TYNA 1PLKA 1W36C 2IWHA 1KI6B 2GESA 1DG3A 3EIQA 1GSIA 3U4QA 2BCJQ 4V0ME 1FW6A 2BDTA 2N46A 1R5OA 4DLSA 2KB0A 1KNQA 3BFXA 1RKBA 2RGBA 2WMNB 1FOEB 3U7GA 3H84A 3VR6A 4O25A 3HPRA 2XOKD 2GEVA 4Q1BA 1KGDA 5EP2A 2F55A 4JLOA 5IF9A 1VHLA 3OZXA 3LV8A 1C9KA 4LJAA 4TLBA 4TQAA 1OB2A 4JLJA 4JLNA 2F3TA 1Z83A 2GF0A 3NG1A 1U94A 4G5RA 2JJ8A 3WXMA 4I4LA 4MRPA 3TE6A 4DLRA 4PTLA 5EZ6B 3B7GA 5BN3A 2LCFA 2IXFA 1I2MA 1G7CA 2OSBA 4F4CA 1F2TA 3DOFA 5SZHB 5G41A 1CIPA 4MKIA 2Z0MA 1G8HA 3M1IA 1CR4A 3MJRA 1QBKC 1ZM3A 2BBOA 1TUEA 4GOJA 1E9RA 2R44A 5EZ5A 1VCNA 4OHXA 4MH0R 1E9AA 3FKSD 4HI0E 2PX0A 3KTAB 4YC7A 3U7FB 1TQ6A 3GPLA 2VP4A 3OAAD 1AN0A 2GWHA 5JJKA 3B1XA 2RAPA 3X1XA 4HUTA 1LW7A 1OF1A 3NWJA 3TR5A 3BS4A 4FWTA 4AKIA 1FMLA 2NOAA 4C2TA 1E0KA 4C9BA 3RS4A 4TMZA 4JLKA 4G5GA 3EPJA 2QE7D 3B8HA 2J7PD 1S1CA 3BOSA 4CVNA 2BJWA 1S1MA 5SZKB 3ZVNA 4PC6A 3W6OA 1KDOA 4Q02A 4GFDA 2W58A 1ZCAA 2ZS9A 3OE7A 4MYTA 3ONWA 1W5TA 2ZSEA 4HZUA 3UWKA 3AVTA 1UBCA 1G18A 3ND9A 2CXXA 3MWKA 2HYIC 1YVDA 3FFBA 3SR0A 4D26A 3CLVA 1XF9A 2ZI3A 2Q6TA 3C4JA 1A7JA 1QHSA 2R65A 1CR1A 2FGKA 2IF0A 2JAQA 2ZJ2A 1BYIA 2OBMA 4QJ4A 2OHFA 2ZU6A 1R7RA 3QJYA 5G40A 4AYXA 4P33A 3RHFA 1OFUX 5FTJA 4NCKA 4PC1A 3DMNA 2GCOB 3PENA 5EUQB 3NH9A 5K8UA 1Z63A 3RNLA 5LBIA 3IIMA 1XJ0A 5CK4A 3WP1B 2CLCX 1SQ5A 1ZNZA 4ZDWA 4KSCA 4TMKA 4Z51A 2ZRIA 1UPTA 4BLQA 3QNUA 5H1YA 4BASA 4JLBA 4QHYA 2G3YA 2X1VA 1IY2A 3GCGA 4C0BA 4KCGA 2OXRA 5A4JA 3ASYA 1G20E 4Q1DA 2UKDA 1TMKA 3VR2A 1JAHA 4FI3C 3AVVA 1W47A 2OE2A 1BO6A 3Q5EA 4GP7A 1SZPA 5JSZB 4CEHA 2FSHA 2V8OA 1OXUA 3KQKA 1GIAA 1UF9A 4Q03A 1UBGA 2W2TA 2A3RA 1EFRA 3A1WA 3LAWA 1VHTA 1FQKA 4NU0A 4A0HA 2ZSAA 4F4JA 3U6KA 3K0SA 4HLCA 2UZIR 5FOVA 1YZLA 4JSTA 4NPHA 4PC7A 2GF9A 2F1IA 1GFIA 2XSZD 1T8TA 5JS7A 4BRUA 4DKXA 3R9IA 3MGCA 4A0GA 4ZDIA 5J4VA 4DDTA 3MFYA 3CR8A 2IUUA 5L3QA 3SZRA 1MH1A 3CF6R 5DNYB 2O8CA 2IC5A 3TUZC 4LGMA 5DISB 3UANA 3I61A 1S8FA 1SXJC 2QQ0A 2E9SA 4KBFA 5EQTA 1N0UA 3WNDA 3ICEA 4NHOA 3GQBA 3JVVA 2C77A 1TNDA 4PAMA 4QBGB 3LQRA 5CDFE 2Z4RA 2PEZA 3U3MA 1IHUA 1TPZA
chains in the Genus database with same CATH superfamily
2FEWB 4BNLA 4BU1A 2FPGA 3OEEA 4DDMA 4M83A 2OO5A 3R9XB 4GMXA 3GLIA 2HCJB 1LRJA 3OMWA 2J9XB 4UHEA 9ABPA 1QH1B 2OTCA 1UH5A 5KQSA 1Y5NA 3O9ZA 4CLRA 4TN5A 3SXPA 2AMYA 4C0QC 2AFHE 2OXTA 4EWLA 1Y3DE 2ZJOA 4K6OA 3IQGX 2GZ3A 3TTUA 3HGTA 1QF9A 1B6GA 1QYCA 3OSZA 6REQA 3FLMA 3HP1A 3EJ6A 5DNDA 1Y33E 4F9EA 2DLNA 3EQ6A 1T8RA 5TARA 4CTMA 5EEHA 5IHXA 4KUGA 1OH7A 1S96A 5C8YF 1K66A 5FADA 2C5GA 3JAWB 4O0MA 2I67A 4YLYA 2VHUA 3HZZA 3GFFA 2R8RA 4M0MA 4NZZA 2PUEA 1WABA 2JATA 5GJWC 3BHMA 5H83A 2F64A 2FPGB 3IIJA 4LY9A 4FFOA 3NT5A 2I1LA 2GH1A 4MGHA 5AKZA 1BD4A 5ICGA 2NO0A 2NV0A 4UUPA 4ZV4A 3N76A 1EUDA 2R8PA 3O75A 3FWHA 1K7FB 2CB0A 2GRJA 4GEKA 3FLAA 1PS8A 3MMSA 3TBKA 2YWDA 1RVV1 4IHQA 2DPLA 2FHSA 3G02A 4HV4A 1L4YA 1OBHA 1D2CA 3B6MA 1UWCA 3CUVA 3GLKA 3LQ1A 4R8KA 2A84A 3U1VA 3ZVKA 2JIZD 4BFVA 2I2DA 5TJHA 1DAIA 2XKBA 1H6BA 2PKQO 2V9PA 3FJ1A 3ZDBA 1WRBA 3LVFO 5IZ4A 3ZDZB 5EE9A 3Q7SA 3A9CA 4LHYA 2X9NA 5AH0A 5DSXA 4K9QA 1NFQA 1QXSA 2ZT7A 4I2VA 5FA6A 4ZIRB 1I1OA 1GNQA 4EGAA 1FXWA 2Q4RA 4LTDA 3W5HA 1TMGE 1N75A 1YIOA 2I2WA 2VEDA 3CVJA 1GG5A 2JI6A 2DQZA 4JCOA 3TVYA 3LPDA 4CCYA 1BOFA 2Z1NA 5FNVA 4WZ6A 3ONEA 4BB6A 3FPBA 3TLAA 1JGTA 2JGRA 2JEOA 1PJSA 3C16C 3I5MA 3NI2A 1P1FA 4INZA 4M2LA 4NH4A 4PGHA 3WYCA 5EIEA 1G5FA 3ZWQA 1IEQA 2O8FA 4WN9A 1T4DA 3MS7A 3UICA 6AT1A 3FUCA 2QQEA 2V0NA 4N8DA 4B6QA 3I05A 4QJ3A 1SVIA 1ZK2A 2GOYA 1Z2EA 5FI5A 3V97A 4DMKA 1ETUA 1AT1A 3E6AA 1HDIA 4JOBA 1E2PA 1E20A 1H2AS 1ULHA 3VC2A 1T13A 1H65A 2PCJA 1AUOA 3VI4B 4EYSA 4OQLA 3FTQA 3P9XA 4IRUB 1CUBA 1L8QA 2YHIB 5TT1A 1EZ1A 1QK4A 1IEVA 4K6FA 3KSZO 1UEIA 1A9PA 4L9AA 4UHCA 5JBNA 2V8BA 3NDBB 1RXIA 1JXQA 5A9TA 4ZC8A 2WNHA 2G1PA 1Q1BA 2CJFA 2CVZA 3CRQA 1TAGA 2V59A 3O3OB 1XU9A 2KWIA 4LI3X 1RE0A 3ANXA 3CKKA 3EWSA 2DYKA 4J91A 1UODA 1OWPA 2IKSA 2D5AA 1DXYA 2WM3A 3F5SA 1RZRA 3RRJA 3EBPA 3MD0A 3FPLA 1TC1A 5CLHA 4E11A 1UOOA 3H8SA 4NBLA 2A0UA 2WG2A 3TKAA 4RTLA 1KJZA 1NMEA 4CIVA 2QRGA 3C41J 1QO7A 2XJ4A 2HNBA 3LP6A 3LUGA 4R7ZA 4UZFA 5ARCA 3W5CA 1A2KC 1ZK4A 4ERNA 1LDNA 2BFWA 4M9XA 3K4QA 4KMRA 1CV2A 3II6X 3LWDA 4HDRB 4YI3A 2O5VA 5D5PA 4BX3A 3CR7A 3SVTA 2YWCA 2GD0A 2C2GA 3DZGA 1OLXA 2A0XA 3Q5GA 5F73A 1QM5A 4QE3A 2IPAB 3K1AB 2BJVA 3QKUA 4QXMA 2VAVA 2VH5R 2DH5A 3EC7A 5LZ8A 1VYUA 4MRMB 3RSGA 1HSZA 5IK2D 2IS1A 3EZ6A 3QENA 3Q0IA 4TT3D 3EUFA 1FDTA 1X9IA 2BFNA 5HCUA 3KAKA 3STUA 3ZCUA 2HQRA 4M1SA 2VJPA 2H16A 2JLAA 3QEBZ 2ES4A 3VDNB 4TPKA 4EP1A 2YWHA 4BOYA 2P2NA 2EIXA 3TG2A 5JPDA 5JE8A 2O3SA 3UB2A 1S7GA 3GAFA 4TQGA 3KSDO 3V3TA 3AP2A 4HPWA 4Y7CA 1THZA 2IHZA 1MX9A 3OPXA 1ZZEA 1ZIYA 2H63A 3BWMA 1J9GA 3NO4A 4RMJA 3FVVA 1QCCA 2FZVA 3D8TA 1JMYA 4Z9BA 4YIKA 3BMQB 3X2EA 5T8KC 4G0PA 2DR3A 5CAEA 1O96B 4MICA 4UUNA 3GZJA 2AR0A 1L4NA 1TEXA 4KKXB 3ROZA 3GJSA 1Y0BA 4BAZA 4H77A 1TMYA 1HURA 2CJYA 1DC5A 4OUDB 4TL6A 2JFFA 4BKQA 1PFWA 1H2HA 2D2VA 4RDXA 3DOEA 2XKAA 4IHJB 4QA9A 2C8JA 5JHHB 3NB0A 3TW8B 3ANYB 5G3YA 1Z0SA 2YXBA 2GK6A 3DMRA 2VRNA 4P0QB 2I2CA 4G8BA 4JUIA 3EGDB 1XJQA 2VDKB 5LN1A 2OT3B 2ADOA 1X7ZB 3HP7A 3CH6A 1GYRA 2OZVA 2P79A 5KREA 4LDQA 3BK7A 2IHJA 3T0GA 3KYJB 4QU9A 2X0FA 2BSAA 3RS8A 3RVSA 1T2FA 4DTCA 1XDZA 3NWOA 3K9NA 3ZVLA 3M34A 1P4SA 1P7PA 1RQ7A 2FF5A 2OBLA 5DM70 1IWBB 3JQ8B 3B1FA 1W4BA 3D2AA 4DREA 2AK2A 1G9TA 2D00A 1MB4A 1AF4A 3JZDA 3ROXA 4DMCA 1CT9A 1WIWA 2BT4A 2P6OA 4ECAA 1YB6A 4U2CA 1EFHA 2FUG1 1SULA 2FSIA 2XDAA 1U6JA 1WDLA 2YWEA 4HQ0A 4PF1A 3B3QA 5E9WA 2JFBA 3DLAA 5GONB 2ZRHA 3BREA 3ZHQA 4P86A 1OTXA 1GQSA 1USWA 1XTPA 5A03A 3IT2A 4NAHA 3HY6A 5KNDD 5C1OA 1LV7A 3STXA 3L7BA 4A6DA 1V2GA 4ZKEA 1CRPA 2XF8A 2H2DA 3D81A 1HFJA 1E3LA 1F0KA 2AD5A 2FQ1A 1CB0A 1P0PA 2ZSFA 3NYQA 3ZDQA 1KMHA 3VPAA 5A5EA 2P4SA 4LK2A 2A4MA 2Y93A 3SZUA 1Q0HA 3H4VA 5EPOA 3GJ4A 4H1VA 3ZHRA 1Z0ZA 3F8SA 1J23A 1GILA 2YFQA 4UTOA 4AS2A 2I7DA 4GRDA 1SBQA 2A1UA 4QOHA 1KZ6A 5IWAB 1HMYA 1TW3A 2HPAA 3RS3A 3QKTA 1H42A 1FJHA 1GEGA 1NBAA 3H2YA 3HKCB 5DCWA 2ZU0C 4YWHA 3SFZA 2G0AA 1KEPA 4DBZA 4KRYA 1CDOA 2IYZA 1NQVA 4XD7A 4X62B 3H04A 4WCDA 2AEEA 4RACA 1M5RA 4RMHA 3F6PA 2DFDA 1XK7A 2JIQA 4RKFA 3ODPA 3VR0A 2CDBA 1TB4A 2A9FA 4LAFA 1OCEA 4FE3A 4K6MA 5CLGA 5CB4A 1DPFA 2QLTA 4AY4A 2Z4SA 3FVWA 1P7YA 2RGUA 4BXOA 1CR6A 1PJ3A 3MINA 2VSNA 1NMZA 4MRVA 4HEQA 1DV1A 5HIIA 3HMQA 4EYGA 3FTCA 2EFDB 1QR2A 3WP0A 4QGHA 3DDOA 2EATA 5YASA 4D97A 2H4WA 3W6UA 1Z3CA 2NWQA 4LJ4A 1Z6QA 5DI3B 4BJ5A 5LBTA 1QPZA 4CFZA 4M36A 4BLRA 1ISIA 1NULA 1ZUIA 3QVXA 4DQ0A 5A5GA 1NVEA 3URKA 2XZPA 1FLNA 3BCSA 3D6VA 2Q99A 3WL6A 5IVKA 5EMLA 3RVBA 2XQFA 1VPWA 4RLQA 1J39A 3AJ8A 3U7HB 4RK1A 1XTKA 1Z4KA 1DC3A 1Q0UA 1DDOA 1UBOS 4PAOA 1P6UA 2DFNA 2VF4X 1FMFA 4E5KA 2PZKA 4KO2S 5TE9A 4DA0A 4MGZR 1RRGA 1KAEA 1SCJA 5K0GA 1FA9A 4L9WA 1YBVA 2X8LA 1XB2A 4RVDA 4YY3B 1YJQA 1U80A 1D6MA 1IBLB 3V7YA 3NHZA 2L69A 2YIMA 3NIFB 1U9YA 2OFWA 2WSYB 3SOZA 3ZYZA 7REQB 1Z4JA 3P1JA 4YCSA 1RAFA 1RI3A 1XVVA 4J6FA 4ZVLA 4ZVMA 4O3FA 2QRVA 3ECSA 3VOTA 1O95A 4JVNA 3DT6A 3H5WA 2GBLA 4K46A 3WA6A 4FIZA 1WEKA 4BDTA 4F4HA 3FJYA 4HGNA 2OD9A 3LXMA 3B5EA 1DBQA 3CZRA 4FFMA 2Q7OE 2NZ2A 5IUKC 4IHJF 2IHBA 3AHIA 4JB0A 2OO3A 4KXMA 3UATA 4MS3B 4FSXA 4KV9A 1VLHA 3EOZA 4DV6B 4RKYA 1JLRA 3SBOA 4J2TA 4M1ZA 3AIIA 4RAQA 3L8GA 1IXSB 1U9IA 3LQ4A 1B8VA 4RPHA 2XIJA 3MW8A 4GS5A 2Q41A 3CVXA 4MK4A 4CLXA 3DFUA 1T2AA 1KZGB 3AEUA 4F7WA 3GLVA 1EM8B 4Q6BA 1NL3A 1J4AA 5AHWA 4U7GA 2JKVA 1PJ2A 2QXTA 3V4LA 1XI2A 3VSAA 2F00A 1K1EA 3L4BC 2R84A 4OHCA 4AMUA 1Y8ZA 2IXEA 1UMBA 3F0TA 3TMKA 5FI3A 1PL0A 3KSAC 1NN1A 4LCBA 3DA8A 3K9GA 1IJEA 1WR8A 4TMYA 1PJAA 2FGJA 4Q4AB 3SJ7A 4FB4A 2AH5A 3E7FA 4YP6A 1N8KA 1MG5A 4CUJA 4QPDA 1MO4A 2GRUA 3FAKA 4KXXA 4EJ0A 1DBPA 2VUSA 3QU2A 2DHEA 2XDQB 1XEXA 2BGRA 4BFTA 1A8IA 4GRIA 1U8EA 2WBLC 3L6UA 5LC1A 3T6KA 5IASA 3U44B 2P1DA 2JLYA 1WLYA 4OHVA 4PHCA 2VDOB 1GKYA 1QGUA 3ZU3A 4Z49A 5HUHA 3OOEA 5FQNA 3NJ4A 3W6PA 4ARZA 4EB6A 5FH9A 2PVPA 3PR3A 3A6HA 3WLHA 1LSSA 2GK7A 4GP9A 4RLSA 2XVXA 121PA 1S8NA 5JS2A 3OZTA 4MCJA 7GPBA 3RAEC 2F8SA 2FXVA 3DOOA 2WTUA 1P7VA 1ST2A 5DYNA 4BLVA 4E2FA 4NULA 2O1SA 2QX7A 4ZCMA 2YV2A 1W36D 2E87A 5ISMA 2VXCA 3PYLA 2SBTA 3L6RA 3G7UA 1ECLA 4NYJR 5FUVA 3VJMA 1ZH4A 5SV2A 4K5QA 5E9AA 3Q3IA 1NT2A 4AXXA 2WZQA 3PVCA 1H1LB 3CG4A 3NETA 4K86A 2BI7A 3D6JA 1LDGA 1HA3A 1Q44A 5ECYA 1ZWKA 1ZISA 5JSYA 4MLDA 3UXHA 4Q1FA 4ZEXA 3EC1A 3R1IA 5DK6A 3K9FC 2GHTA 3WQQA 3GEBA 4QEDA 2IS4A 1AURA 1FEZA 1TJ5A 1U1FA 3IDFA 3WBBA 1VKOA 1QX3A 3SC2A 1Q7GA 3KUKA 1V26A 2EGHA 5LQDA 1E69A 1QSGA 2WABA 3B2NA 4L3VA 1V47A 2Z5GA 421PA 3SIPA 4INJA 1ZHHA 1IN7A 1RW4A 1QKKA 1DWUA 5AI0A 3QVGA 4JENA 5EIFA 3FLEA 5FBWB 1ZS9A 1JEYB 3T38A 3S2SA 2FN4A 3QHAA 2WD9A 4MYHA 5IP5A 1NW9B 2HSZA 2NSDA 4BVLA 2PUAA 2Q1TA 2AVDA 3O1HB 3HCWA 1HFEL 3UOAB 3SF0A 2O20A 1JNYA 3FNEA 3QLEA 4KACA 4NZYA 1I3OA 3VX4A 5KS2A 3EGEA 1GA6A 3IHWA 3OUZA 4QUBA 3RSZA 4BP9A 2R2AA 2ZJ5A 2VYFA 3ENNA 3QEMA 1EYZA 4QD3A 1UBNA 3ZLBA 1ZCZA 4HCJA 3NWBA 3U4QB 4MRAA 4R1PA 3LKDA 2A9RA 1G8KA 5SY4A 4JELA 3KDAA 3NEPX 2FKNA 1VXRA 1T3LA 5ED0A 1MOZA 5A2GA 5BWBA 1YR7A 1Z5NA 3N28A 4H0FA 4KH0A 3U39A 5CFMA 2FZGA 1YIDA 5IULC 3MK31 4LS3A 1DBRA 4UREA 5DGIA 2HF7A 3IEVA 3ENVA 4CUKA 5I8ZA 3BBLA 1TKAA 5CB6A 1XMSA 2YJ5A 4Y1FA 3OOWA 3S70A 3CZAA 3K1AA 2PANA 4LJ9A 1YACA 1OWMA 3A9VA 1G2OA 1EM8A 5D1HA 5CNMA 2YJ6A 2ZSKA 1DAGA 1I6LA 2L2QA 2I71A 3PWZA 4W7HA 5HJEA 3JQBC 3N0TA 3T7AA 2ISCA 1ZW1A 3BIOA 4PZYA 3U49A 1K3FA 1SQFA 2AF3C 1ULTA 3TTWA 3CCFA 3OJ0A 1NQOA 1LLFA 1Q0TA 1KI6A 4NNOA 3BH7A 2P2GA 2PZ8A 2W6NA 5FORA 1U81A 4BRZA 3IAFA 1U6IA 3K6JA 3AESB 2GLTA 2IIBA 2YIJA 4LECA 4NBRA 1O5OA 4TV9F 1ORTA 3B38A 1Y3AA 4REQA 1YZKA 4M0KA 4RYDA 3MVEA 1WXFA 1M74A 3ORFA 3V8EA 3JD2A 3OC0A 1E3WA 1WE2A 3H3XA 2YVLA 2ZYAA 2EC5A 4OQFA 4Q9NA 3BXPA 3V00A 3MTAA 2XRFA 3RSFA 1U3FA 1E9EA 3W5BA 2ORYA 2Q5QA 3U3JA 2GSDA 3EVEA 4IMIB 1EP3B 2YHUA 4KAAA 1EHIA 1CQIA 4PZ0A 4QU5A 5FV7A 4EEZA 5JY1A 4E5YA 1XQXA 4O59O 3WMEA 2EP5A 4MV5A 4XFKA 1OYOA 1U2EA 2A0WA 2BY4A 3P32A 4D6XA 5ITWA 1U8XX 4GOLD 3VYWA 1J8VA 4G0MA 3SZMA 3KXDA 3HCNA 1R0CA 4NP6A 5JMPA 3RAFC 3IAM1 1DRVA 1KOFA 2DUNA 2GNPA 1D4AA 2V6BA 3HYTA 5L3SB 1ZAYA 1YK1A 3DTVD 4WFJA 3WB2A 2IUSA 1LWOA 1ZJYA 2XUZA 3I3SR 3BRWD 1SU4A 4FCCA 4MIYA 4FCWA 2QA5A 4MV1A 5EWMB 4V0NA 3R8CA 3VNSA 1J7KA 4K03A 5EJ8A 4HLDA 2F3UA 5KHOC 3T5DA 3SP1A 1RE1A 1Z07A 2IKQA 4OGWA 7ADHA 3CF0A 5LQRA 4OAOA 4R1NA 5HQ3A 1Q21A 2MSWA 2GCNA 3OTWA 4YAFA 3THXB 2ONZA 3PD7A 4OI2A 2GZRA 4QFDA 1USVA 3ZJYA 2Q0XA 3U80A 4EJ2A 4GSYA 2CVFA 3PQ6A 3ADKA 3FRIA 1X7WA 5DRTA 3NRBA 4PBSA 2W2QA 2DOKA 4G1FA 2AG5A 1OHHA 3AH8A 3IFSA 3EVFA 3COSA 3GDGA 3T35A 1AE1A 1CXZA 1DC6A 1UXIA 1LQUA 1VIMA 2E49A 2WYWA 4OQMA 1AK9A 2BRUA 1U0RA 2H3HA 3H05A 4J0JA 3W3AD 2Q4EA 2BP7A 2ISSD 4BKMA 1KRHA 3E53A 9MHTA 1VE6A 2CFRA 3SQWA 2HD4A 3R0XA 1Z13A 4HNSA 2D5CA 1Z3IX 1F4PA 1F6BA 2P9GA 2G40A 3AI2A 1MNQA 2FDRA 4WXRA 5D01A 4Z5XA 1U65A 2I33A 1GCGA 4WKGA 3QPWA 4M53A 1JKIA 1UJMA 1RLIA 3VGJA 3AUUA 2BEJA 1QHXA 1XCPA 3B5IA 2A35A 3PBKA 4FGKA 4JEMA 3KR9A 3HL4A 4JVOA 1WP9A 1TA0A 5IVPA 1ZOIA 3AEUB 4JOSA 2GTPA 2GPTA 3SAJA 1TI7A 3E82A 4IXDA 1KQNA 2WUEA 1IONA 2C9OA 3OPYA 4ADSG 1UOEA 4TGLA 3RARA 1T36B 2ABWA 2CUTA 2I2AA 3ASVA 3E18A 2REOA 4YK7A 3DWFA 2ZATA 1VDMA 3CVUA 4P58A 2BFMA 5CA0F 5G4KA 1ZOOA 1GTL1 1HDOA 1DMSA 3KBBA 4RH3A 5FPYA 3WR5A 3GT3A 4EPRA 3M49A 4ENRA 1JVNA 2MU1A 3OQBA 1YJXA 3JQ8A 4BZXA 1P2DA 2GGSA 1RMTA 3PGLA 2AOWA 2CXPA 3AR7A 1Q6YA 4YQYA 2ZDHA 4XVRA 5KJFA 2OQ2A 4DBLC 2QUJA 3PEWA 2VSXA 2WFLB 4A0QA 2BE7A 3DPSA 7REQA 3EZXA 2AMLA 5JFTA 1FNNA 1Q84A 2I6XA 4J7AA 6NULA 2WHXA 3ABSB 1Z18A 4CU2A 2H8KA 1LC3A 4I1UA 4G0OA 4NZMA 4BVFA 1C8VB 5HJ5A 1VKJA 5HF5A 1WUJS 3ANNA 3KEOA 2A9VA 3BRCA 4PPGA 2NPOA 3W2HA 5LA6A 5IAAA 1C3JA 1FX0A 3ZLUA 4PNHA 1N2ZA 4W9NA 1SKYE 1ARZA 4QUEA 3TB4A 5A2QA 4O4IB 1NVKA 1KQOA 2GPSA 4QQFA 1ZG3A 2AFIB 1E3QA 4RFVA 1JILA 1SQGA 2OGTA 1WCWA 2DQKA 1PN3A 4TV9B 2ZB8A 3DTVA 4MUAA 2O8CB 1HOTA 3H2BA 1KK3A 4TSRA 2IEYA 5TMDA 1ID8A 2I78A 3DDCA 4PRLA 4PIVA 3SEAA 4PYKA 1EUYA 3CZQA 1W9HA 2AN9A 3BDAA 2JIBA 3GGGA 4PNPA 5TEVA 4C04A 4CM7A 1UFVA 4D6PA 4EYQA 1BRTA 3AUJB 3O0TA 1IFXA 1ZIPA 4A0RA 1BX1A 3GLFB 3Q8WA 2GD1O 4CEIA 1R9JA 4M8SA 4FQ5A 1WCIA 2B0CA 4YACA 3VAYA 4ARAA 1AM4D 4EG4A 3H0EA 4AY2A 1OFGA 4H1HA 2QV7A 4Y6QA 1X0XA 4OTZA 1MZVA 4BCCA 3MYYA 3G0CA 1MEJA 2I4RA 4DLUA 5FWNA 1IPEA 1YV9A 2ZI7A 4AYTA 5FV4A 1Y6QA 4N3NA 1QFJA 2XNJA 3E9EA 4NS1A 2JFNA 2NO5A 1E1YA 4DC9A 3QU5A 5C1PA 5FKJA 5I4IA 1F8YA 1YRYE 3GFSA 3H99A 3MLEA 5AXCA 1AMOA 4LF8B 4AS1A 1Y7IA 4BQRA 2O8NA 1MTOA 3IQEA 1R74A 3V32A 4LFBB 1CK4A 1NIJA 3EW9A 5E2AA 2JAWA 1K08A 4HFMA 2G28A 2QRZA 3D3WB 2CK3A 3I0NA 4ONEA 3RYHB 3PPXA 3P20A 3PVSA 3EIWA 2WWWA 2UDPA 4HDKA 4WK2B 4B40A 2QROA 4FGLA 2QY6A 3BRSA 3EXIA 5EHQA 2UUCB 3F1KA 4C06A 5HCIA 4W7SA 2HOQA 1KI1A 1J8MF 2WFAA 1GY8A 3A1NA 4LZJA 4I6EA 4YUVA 3WO1A 5C1BA 4AMZA 5JC8A 1IY9A 3K1ZA 1GGEA 2R6GA 1U1EA 3UJHA 1G98A 4UNRA 5CCXA 4F86A 3PC3A 4GH5A 5IM4A 3N8IA 2QBYA 2CXQA 4AD8A 2HBZA 4OHYA 2J45A 2DE0X 4NFLA 3AW8A 2V6MA 5EHZA 1W0CA 3AFNA 2FW6A 3H65A 4MVJE 4P32A 1BKYA 3W8DA 1ZMOA 2DPYA 2C04A 3T34A 1ACMA 2NTVA 1F48A 3E23A 4BNIA 5JRZA 2UYCA 1MJ5A 1P44A 5LLDA 4JVLA 2D1FA 4ARSA 1UIMA 5INTA 1ZGBA 2ACEA 4ZVKA 1LGYA 4GBGA 4GD3Q 2DUJA 4HQKA 3O4RA 3KYBA 3FB1A 1H2ZA 1V8FA 1JP7A 1ZGHA 2YR0A 4WZBB 3G85A 3PHCA 1OH6A 3VKWA 1YUBA 1GL9B 2WQZA 4KQ6A 4KJZA 4AROA 5LZ4A 3KWMA 4FZVA 4R6XA 5DXJA 4BQQA 5AESA 2C92A 2OCKA 3HSKA 2BLLA 4HAUA 4HK4A 1IN4A 2ATEA 3DL2A 2IHUA 1SVNA 2B9EA 3IDOA 4IHJA 4B34A 1TW2A 1OT5A 4RS4A 5ILOA 4BB0A 3PEYA 2HEGA 3I2IA 4HDNA 1C1XB 2VCHA 1HUQA 1PHPA 1FNCA 2W2MA 3PK0A 3R3UA 4N4AA 4OUDA 1LC0A 3DW3X 4KN9S 3UJ6A 5IUNC 2O8DA 2YMMA 1N3YA 5HKBA 3F6YA 1EG7A 1E62A 1ZI9A 3NDRA 5BT9A 4KODA 3L6BA 1X2EA 1E9FA 3M4NA 3DD5A 3F4LA 2P9FA 4X8HA 1KNXA 1JMKC 1EP9A 4L3OA 3RVKA 3H5IA 1P0FA 4WIAA 1KQPA 3P71T 3RE1A 4EYKA 3MHPA 3DV0A 4CTNA 3FUVA 5K0BA 1PTJA 2I6QA 3FI0A 2FFAA 3CZPA 4NJMA 4B35A 1U0LA 5A06A 1D9XA 4N0PA 2AYXA 4FCVA 4A73A 1NQ5A 3U3OA 5IEJA 1Y7HA 3K94A 4O6VA 9ATCA 1E1LA 3O1IC 5HIKA 2ZIVB 2V03A 2R2GA 2PA0A 2RGNC 1KYIA 3BFPA 1RAIA 3HCEA 3NX4A 3QXGA 2VP3A 4HB2A 1PJTA 5DO9A 4BB9A 1GTZA 3E8MA 3F2VA 1SIBE 3VV3A 3L18A 3NQ41 1CRWG 1M6YA 1TVKA 2C2HA 4J16A 4LCEA 4S1WA 3C70A 1YR2A 4EG5A 3P96A 2JF0A 5TS2A 4ZT4A 3RFFA 1JQ5A 2BKVA 2X8JA 4HF7A 2TECE 2ZWPA 4WKOA 1JG7A 3Q3JB 2QHXA 4FR0A 3GP8A 2IYRA 4LZNA 2NQTA 4FDTA 1SVUA 4HVLA 5KDDA 3WMXA 6REQB 3NBAA 2HQ1A 1W0JD 1JYSA 4FW9A 4DCGA 2POCA 1ZD5A 2PWPA 1ZN8A 2XGMA 3VR5H 5EL0A 1VI6A 3U7QA 5BYJA 5C8YA 2DY0A 4MI1A 1ZC4A 3OOSA 1IQ0A 2RGDA 3I09A 2IH2A 2M9MA 2XOEA 4Y67A 4Q3DA 1XRJA 4MGEA 1L4BA 2X2FA 1IN8A 1LY1A 2BF4A 3GH3A 3OA0A 4LVUA 3KQNA 4X8LA 3K7EA 4B81A 1ADBA 2GM9A 1S01A 2J67A 4B6PA 5J1SB 2VSFA 4ESVA 1WUKS 2VR1A 2H0AA 1QNLA 3AYZB 3GPDG 4ZRMA 2F3QA 1PK7A 1XEWX 4B3CA 3A26A 4EPTA 2HQSA 2ZPTX 1CTQA 3BM5A 3L02A 4FEAA 4FK8A 1WBBA 3VNVA 4QDZA 5BWMA 4L28A 3K6SA 4EATA 1JWAB 1YGPA 2X6RA 1V43A 5L3ZA 4L4UA 3C2QA 3DDWA 2J5KA 2VJYA 4QHSA 2BKLA 1N0VC 5FUBA 3C6YA 1G20B 1LPAB 2JBAB 1WNTA 3CB4A 1EFCA 3HBFA 4MUHA 4M1TA 1D1QA 4TL8A 1ZU5A 1E3MA 4AWXA 5LUAA 3UPUA 1ZI8A 3KKKA 4XWYA 1RKUA 2JK1A 3VV2A 5CT9A 2XRZA 5G40A 3TXXA 1SXGA 1WBJB 2PO7A 3QVWA 1SNYA 4YBZA 4Y2SA 2CFCA 4PLGA 4A3SA 3TS1A 4AJJA 1O77A 1YB2A 3AYXB 1TM5E 1J70A 3LGAA 4A5SA 3RANA 4DCJA 4D9EA 1KH2A 3A36A 3IT3A 3I52A 1ZCJA 2YUIA 3DO6A 1O54A 2W11A 3TTYA 2OC4A 3BRQA 2XBMA 2F1RA 4ZHQF 1JAIA 1ZK3A 5CJPA 1MZPA 3N8HA 2F8TA 2E37A 1JE1A 4GYJA 3IXLA 2ODPA 4P3KA 3KG2A 4OV6B 4US0R 5EE1A 3TGWA 4BQFA 5C7LO 5EKDA 4E1BA 3PUZA 3TQRA 3P9ZA 1HEYA 4DABA 2F67A 1YU9A 1M2JA 2GPYA 4RKRA 4EMUA 4MXDA 5EN4A 2JGDB 2JH3A 3WI7A 4DUPA 3CF2A 2CV2A 3CUEF 2HWUA 5T3YA 3W9UA 2PXAA 4B4DA 1RPZA 1YNOA 2WM8A 2ZYUX 1PV1A 3IP7A 4U9UA 2DT8A 4F9FA 4UPEA 3MOGA 2HXSA 2JBHA 3BH0A 1AX9A 3FWNA 3IJEB 4OLBA 2XUQA 2G9VA 3EZGA 2GPAA 4OL0A 4EPXA 1U7XA 3AM1A 1XIVA 2WWXA 4IGKA 3ORRA 3B7PA 1P0CA 3Q88A 4B83A 3GOQA 4BE4A 4PEVA 5COAA 3GAZA 4RJTA 3GUVA 3SKYA 1B93A 1H94A 5EMJA 3SDZA 1FSGA 4CMBA 1NP7A 1P60A 1GYPA 3PNQA 3DDNA 4X93A 1WDKA 5IAGA 1P91A 1KFEB 2GR9A 4DOMA 4QNNA 1XZDA 3W1EA 4RMGA 2GLUA 3TNYA 3TSWA 2W2LD 2GXSA 3H13A 4OAQA 3CNEA 3U7QB 1MO2A 4DSUA 4TZ6A 3IPAA 4EA8A 3PHHA 4D99A 3N6XA 1A7AA 4KPUA 3GR6A 4FD3A 3FA2A 4MCHA 3NH6A 5FHRA 1KEVA 4O29A 3BTUA 5IKOA 1CUSA 1Y4DE 3TL3A 4ALJA 1MT0A 1VG9B 1XL0A 2J9FB 4AF6A 4Z6KA 2Q9CA 5U4XA 4COOA 2P5SA 2YVAA 3OY7A 3KJEA 3VO1A 1J6UA 4U7TB 3D3QA 3FRJA 5KVQA 4NZOA 1JXMA 3M6XA 3U4AA 1PZFA 1GZ4A 1V48A 3VZRA 3TZQA 4J16C 3UMGA 2VK1A 3TX2A 2Q1UA 5JNLA 1HLDA 2GMWA 3R7FA 1C1DB 3NBKA 3OPVA 1F2VA 5J4KA 5ETJA 4PS1A 1G38A 4JL5A 1Y9EA 1J0AA 4TTAA 3K05A 3VI3B 1H4QA 2EW2A 4XI9A 4X3CA 2DY1A 2I34A 5B36A 2XUOA 1RYBA 4Q48A 1EGMB 1T4CA 2Y6VA 5HF9A 2J0UA 3FSJX 3PUKA 2RK6A 3CX8A 5BOVA 3ZJ5A 3FTEA 4W1RA 5EXSA 1E9BA 5DHSA 5BQ3A 5ALNA 3PFKA 1JIVA 3VU1A 3D4NA 4JB8A 4KH1A 4ENTA 1LBTA 2DPMA 1A9TA 1P77A 1ZFNA 3LDFA 3L1JA 3AL0C 2ZIFA 2XY4A 1DINA 3RJZA 4ZHQB 4RNCA 2ETVA 3PPYA 5JRDS 3WB0A 3DEKA 3RPEA 1W8DA 3GLHA 3IDAA 4EF4A 2QAGA 4Q3NA 1QB7A 2VL7A 5E7MA 1VIVA 5B1YA 4F6CA 3M6IA 3I8SA 3CLRD 3LHIA 4Z0PA 4JUAA 1IHXA 1QH9A 4O2AB 3RFCA 1WZ2A 3DAGA 1JG3A 1KAOA 3H9EO 4KTTE 5FRDA 3BCHA 5AFSA 4QTYA 3THYB 4YRDA 1RXSA 2ZE6A 3R3VA 3HXOA 4GPIB 1T5TA 3UJCA 3QA3E 4P38A 1NZFA 1W36B 1B1CA 1FSFA 4YIHA 1L4MA 3BZWA 3ZU5A 2Q7XA 1ZRMA 3AR8A 4N9QA 5IJAA 4YDHB 5IXJA 4LCJA 1QHHB 2AFIE 1QYDA 2DP4E 2PR7A 3L79A 3PQ8A 3TKYA 3VKFA 4S1OA 3FG9A 4UHKA 4L85A 4N0MA 5DK4A 3UAYA 1VHQA 2DG2A 1ZQ9A 2NO1A 4WACA 2G70A 5HS6A 4NDAA 1TC2A 4P1ZA 5ALUA 1M1ZA 1OY1A 3AIMA 3THWB 2F9LA 4R1LA 4HLNA 4PYMA 1R0YA 1FLAA 2RMKA 4UCFA 4GDFA 1J1UA 5FOXA 5K3OA 3NEYA 2IYTA 3V2HA 4LXQA 1R9NA 1WMDA 4X3OA 1MBZA 3EGXB 5JAIA 1CF4A 1OV6A 4H6PA 4LJ6A 3HO6A 2QSZA 3GRVA 1E9SA 4JA0A 5I45A 2O4UX 4E3ZA 2X6TA 3H2GA 1UZAA 4J4HA 4U6QA 1AB6A 3W4JA 4PS0A 3DTNA 4TQUS 3AF5A 5I4CA 2FPPA 1GPH1 1VPVA 3DVAB 4XVHA 1P1BA 5IDWA 2XXAA 1HE8B 1XROA 3D0KA 1NXVA 3B48A 5E6RB 3L8YA 3SFVA 3RSOA 1IHYA 3WRYA 1M72A 1GDDA 3C4VA 3QVVA 5ANRB 3TRFA 4ER3A 1TGVA 4DPLA 4D1YA 5AW6A 2ZOSA 4ZZ2A 2IPLA 1DX9A 3S2ZA 2JIDA 3KJHA 2IBSA 4U39A 3T7TA 1JSZA 3OT5A 3QNMA 4GXNA 4V2UA 1ZIDA 3U7IA 1R88A 1KA9H 3DCIA 2WILA 4KXWA 4OO3A 4CN9A 3PQ4A 4KBGA 4ED9A 3IESA 3OM1A 2VWGA 2IBMA 1UK8A 4XB6B 1NMYA 5FI1B 4X20B 3WAJA 4FT4A 3KOYA 4OFBA 4C6HA 2NUPA 4GPAA 1YS1X 5IN5A 3DNFA 2RIRA 3GRUA 2W6IA 3VVLA 1OQAA 2P78A 3EA4A 5F7XA 5K2OA 1ZU4A 2EJVA 2X6QA 1P9RA 4XPIA 4AY3A 1YDFA 2JLQA 4KVFA 1W29A 2JC3A 3MSXA 2A9QA 2MSKA 1GRRA 1OWNA 1XVUA 1YL5A 2VK4A 2H52A 2O2EA 2AMJA 3HLYA 4NR0A 4CF3A 1V7ZA 1AQYA 4RH1A 3HWSA 1IY1A 4JL6A 4EA7A 3OLQA 5DGTA 3FWZA 2DQ4A 4KXQA 4FHDA 2WQ7A 2Y27A 1MAWA 3K0CC 4KVAA 3GLHB 1XA4A 3EVGA 3ZGOA 3PF8A 2ALJA 1E1MA 2XMRA 1IUKA 3DEYX 4R1SA 5FO1A 2CB9A 3B36A 4A9AA 1LPSA 1NKSA 4M6WB 3WIDA 1RZUA 1TJNA 1SVOA 3RS9A 3I83A 2IEBA 2AFIA 3DMPA 1CDZA 2E3JA 4DMHA 4Z2AA 5BW5A 3SEQA 1ZMRA 1Z12A 5G3ZA 1NOKA 5TPZA 4PE5B 4UU1A 2LV8A 3DNPA 4QT4A 5A3SA 3K4HA 5AW9A 1NUAA 5LA6B 1MFPA 4KQXA 3BEDA 3TBHA 1V41E 4IDNA 5I9BA 3O8NA 4DS3A 2H7CA 4TRJA 2SECE 8MHTA 1FL9A 1R0WA 3G3EA 4D3XA 4N3CA 4A8PA 4N41A 3UMYA 1V71A 4EG0A 2ECQA 3F90A 3I9MA 1ZXXA 1T1EA 3KXIA 1U2DC 2KS6A 4NK5A 1BYUA 1M1NB 1LQ2A 1SG0A 2ZBDA 3E5RA 3GIDA 3N7AA 4N7MA 4PLVA 4R2LA 1Z0KA 5IM4F 1YD7A 4EPYA 1PWXA 3VDMA 3V1LA 1YVEI 1VG0B 3L4JA 4RK4A 3SE0A 1UJ2A 2DETA 1UXKA 4KPUB 1T5SA 3LBFA 5M04A 4FD2A 2QLMA 1SHTX 4KXFB 3L0DA 2GX6A 2OLJA 2WU4A 4MR9A 1XMXA 1XZ8A 3N87A 4FHGA 4TLEA 1KC1A 3FDXA 4YV0A 4YMVA 3BBPA 3FFTA 3GP5A 3DV2A 5ADVA 2CCKA 4W6ZA 2IZ7A 5DTQA 3GMDA 2P2SA 4F5EA 1SM4A 4PTZA 3CTPA 4JI1B 2Q2OA 3Q41A 1U5AA 3H97A 5B1EA 2FW0A 1BC5A 1TYDE 2Q1SA 5KSWB 5DB4A 3RABA 4RDCA 3DCJA 4YRFA 4L8YA 1JLSA 4Q12A 5NULA 4E32A 3JAKB 1YI0A 2CF6A 2DBQA 4JI4B 1JIKA 1ZH8A 4L5BA 4D2IA 1EUZA 4GX0A 4MQMA 4XTCS 1L7QA 1RMYA 4OF4A 4Z4CA 1SCBA 1N5DA 1QHGA 1T8SA 2BH9A 2K6GA 1C1HA 3COPA 1JI3A 3LX4A 2YXLA 1XKLA 3ANSA 3OJXA 1JE0A 1ZOPA 4HZGA 4K1LA 4CYMA 1P8JA 2E2WA 4Y7DA 3QYJA 2WMDA 3CRZA 3WQBA 3ZWCA 2CMKA 2VUHB 4EG3A 5AR1A 3IO5A 2I6FA