1BYIA

Structure of apo-dethiobiotin synthase at 0.97 angstroms resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
b'SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHASE
publication title Structure of dethiobiotin synthetase at 0.97 A resolution.
pubmed doi rcsb
molecule tags Ligase
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1byiA00
1NP6A 3CRMA 3DZ8A 2KE5A 4Q4LA 2ZRJA 1B23P 4FN5A 1UM8A 3WXMA 2AR7A 4Z1MD 2X19A 1R5OA 1NY5A 2BCJQ 1XZPA 3GJ3A 2QAGC 5EE9A 4OK5A 4DZZA 3GLFB 3W6PA 3HR7A 1WRBA 4M9SA 4D82A 3VQTA 4KLZA 1NVVR 4QHSA 4O0MA 2I3BA 1SKYB 1SQ5A 4QM7A 1YZGA 2ZE6A 1BOFA 2Q9CA 4IOLA 1OHHA 3EXAA 4PHFA 3VKGA 5LPNA 3E5HA 4JLMA 1Q1EA 1XEWY 1QHYA 1GAJA 2YOHA 1ZC3A 5DH9A 1TADA 3P27A 4PANA 4DSUA 5B30A 4AKHA 2ODNA 4IVPA 2OSBA 3IUYA 2YWFA 1Q44A 2ZSEA 1GVNB 2YC2C 4F92B 5L3VA 4KSCA 5SZJA 4BLRA 4KCGA 4BWYA 1VCNA 4RD6A 2PLRA 2QP4A 1NLYA 3PQCA 3QF4B 3C16C 2Q0HA 4WZ6A 3PEVA 3LW7A 4AD8A 5EZ5A 2N42A 2IS1A 1KZGB 2VLIA 1A5TA 1ZM3A 1WA5A 2WWXA 4Q4AB 4TLCA 3MG9A 1T3LA 4QGFA 3FGNA 3I72A 4R9UC 4YDHB 1N25A 1FTSA 4URZR 4M1YA 5FUYA 3NHAA 4TZ6A 2C03A 1CJKC 3F0TA 2QA5A 1FZQA 3GQBA 1IY0A 1AKEA 3BK7A 3KL4A 4PSAA 4C4PA 1OFTA 2XAUA 1FMLA 2A5GA 2FE4A 4HAVA 1II8A 4WIAA 5CLLA 3RRNA 1H65A 3RDPA 1M2OB 4OK6A 4YMVA 3T1VA 4OYHA 4B2PA 4IOKA 3CX6A 4LBZA 1TU3A 2ASEA 3UXMA 3IO5A 4MYHA 5FR2A 1P5ZB 2ZJ5A 1OXUA 1J8YF 1JEEA 2DYKA 2W6IA 3IEVA 1UFQA 2QRNA 4IDNA 4DCNA 2NZJA 4JKIA 4PPGA 2ZSDA 4HAWA 2F1JA 1PLKA 2QG6A 3A1VA 1JR3D 4WZBE 4DSNA 4GFDA 4TMXA 1MO6A 2GCOA 1O87A 1Z8FA 4H1VA 4B3CA 4EKDA 2FEMA 2F43B 4Q4JA 3W8NA 3CH4B 2W83A 4FMDB 4HEJA 4AK9A 2QAGA 2H8KA 3CRVA 4PPNA 5K8LA 3ZGXA 3E2IA 5JJKA 2ODBA 4GZLA 4BRWA 1KMQA 1XXHA 4U02A 1DAMA 1XMJA 4V02A 3K09C 2F7SA 3SI7A 4IOMA 1UEIA 2IF0A 4LYAA 4C3ZA 5FUXA 4P32A 4NL4H 2BVNA 2W0SA 1NBMA 3PUXA 5EXTA 3QIAA 1KDTA 3B78A 2HJVA 2D62A 3R20A 4M9ZA 2J0QA 5JI3E 4EFMA 1NSTA 2V6JA 3N2IA 5FR1A 2IA5A 1TU4A 1E99A 4DC9A 3EIHA 3LQRA 3WBJA 5FPTA 1OH6A 3P4XA 3QEJA 1ONBA 4EIWA 2ZYUX 1XPOA 3G82C 1CJUC 4FMCF 4LJAA 3AM1A 1U94A 1CRPA 5HE8A 2FPKA 1R0YA 3PUYA 2XZLA 3U3RA 3CZQA 3N5CA 2O8BA 3EC2A 3PJRA 3AVUA 2IEZA 5DN6A 4NU0A 1HA3A 1ZIPA 5EE1A 3W90A 4BE7B 1NF3A 4FMCB 3EIQA 4W7SA 2NMVA 3IHWA 2AK2A 2JATA 3SOPA 1G7RA 3HYTA 1JB1A 3CNLA 4QFMA 2O0HA 1ZU4A 1PUJA 4EJSA 2H7VA 1SXJC 4S2EA 3NKVA 4I1OA 3KFVA 4JS0A 5GVSA 4CZ2A 2V1XA 2V6IA 1KI1A 2RHDA 3IHLA 3NTUA 2G0TA 4URYR 3TVDA 2ZRHA 2OV2A 4DIEA 3VNVA 3ZD6A 1E79D 4BFXA 3H86A 1E9EA 4I1UA 2YINC 1E1QD 4HAUA 4A92A 3A6PC 3EPHA 3B85A 2VP5A 3FKQA 2HT1A 1VG1A 3X2SA 3QG1A 4DB2A 2VHJA 2FJUA 3HYRA 3PUWA 4IHQA 4F91B 3N70A 4TZ0A 4TL7A 5EJEA 4GNKA 4Q7KA 4RKFA 5KDOA 2BKUA 4WAUA 1W1WA 1EFCA 3U44B 1DVRA 5DI9A 4TYWA 5FOVA 1RRCA 4M53A 1OXSC 2BMEA 2EFEB 4ACAA 4PC2A 1X3SA 3EWSA 1LF0A 1P75A 1UJ2A 3WHLA 1SVIA 3IBGA 4F4JA 5L3QB 2WWFA 2JEOA 4PHHA 4ZCIA 1KKMA 4RFVA 4PC3A 3HDTA 4DIDA 1WF3A 1DS6A 1KO5A 3SJAA 4IDOA 5KSOA 2O8EB 1RW4A 5C4MA 5KSZA 3TUZC 1BO6A 1GRRA 2BM0A 1G6HA 2IL1A 5EE0A 4NZYA 2GVDC 2LKCA 3AGQA 5F2EA 3KQUA 3W6OA 1OLOA 1KO4A 3LBNA 4YDSA 3U7HB 5CIQA 1AN0A 2TMKA 1ZM2A 5EP3A 1KY2A 2J7KA 3TW4A 4DT1B 2QL6A 2C2HA 1LW7A 3K09A 4S35A 5DLQC 2ZJOA 1U0HC 2ORWA 1XBTA 1HYQA 2C9OA 2OFWA 4C7OA 2RGGA 1TL7C 4DUGD 1NNEA 5EUQB 1P62B 2ZE7A 4LGMA 3R8FA 4KODA 2PCLA 2DY1A 2ZPTX 3TGPA 3QXCA 4L16A 1GL6A 4M1SA 2WKRA 2JLZA 2OCAA 4CEJB 4M21A 1KAGA 4ERNA 4DEYA 4LWZA 2VP2A 2D74A 3NXSA 3TMKA 4JL6A 3NBFA 2REOA 1PUIA 3A4NA 3C7KA 2ZS8A 5CDFE 4C0QC 2Z43A 1DAEA 3NBZC 1XTRA 2IEYA 2FN4A 1OXVA 3QXXA 4P31A 1AZTA 1NRJB 3AB3A 2VQSA 4LV8B 4TLAA 4B47A 4BASA 4B2LA 2V7QD 1F6BA 1L4UA 2WPDA 3C15C 3HWSA 4W5JA 1NL3A 5JI2E 4TYYA 4OHZA 1GNPA 4FWIB 4B6EA 4R71A 1N0UA 1SXJA 4RY2A 2CXXA 2JJ2A 5F9FA 2MSDB 5E4FA 2Q3FA 2OG2A 2HYDA 1W7AA 2FSHA 4Q4HA 3W8RA 1L2TA 3AVXA 1LY1A 2F1HA 4Z51A 3IPXA 4CRWB 4D0NA 4E22A 4M8NE 1T8TA 4TTQA 4AURA 1MABB 2IXEA 5AUNB 2CL0X 4LRWA 4U5XA 5JSZA 5K8UA 2IS6A 4V03A 4FCTA 2Z4RA 4OHXA 3AKDA 4TMVA 521PA 4MRVA 1XP8A 2WTUA 4IKEA 5FL3A 2IYTA 4TN1A 3RS0A 1MR3F 3CRQA 4OL0A 4C0AC 2IYZA 3T5GA 1A1VA 1NN1A 4WW0A 3RLFA 1JR6A 4Q21A 1FFHA 4QKQA 2VF8A 3THYB 3RSLA 3FKSD 4JJZA 5GJVC 3SFVA 4B3FX 1PVOA 4PZZA 5JWRA 1Z0KA 1IN7A 4Q18A 2JLUA 2WWHA 5CYOA 4B73A 4DLWA 4EPTA 3BC1A 5KOYA 2HF9A 4BLPA 3IKJA 3ZS8A 3IIMA 1AGRA 1C4OA 1CU1A 2GZDA 1KGDA 1K6MA 1TQ4A 2GXSA 3Q9LA 5JJLA 3LFUA 1GSIA 5IK2A 1GWNA 1T9HA 2ZS9A 2ODWA 2G83A 2OLKA 4G0NA 5BW8A 4D26A 1W0JD 1SGWA 2VA8A 4PPQA 5L3RA 5KUTA 4NBSA 3X1YA 2YV5A 1E9AA 2OILA 3Q5EA 3BIFA 4LCBA 4P4UA 2BC9A 3T1QA 3ND8A 3OFND 2WKQA 1SKQA 4HUQA 3EZ9A 3QJYA 3QXSA 3H0KA 3OEHD 1R0ZA 4C0LA 1ZAKA 1CXZA 3ONWA 4HDQB 5DE3A 2BEKA 5LB2A 5JS7A 4MKGA 4RVCA 4TL6A 5KNBA 3ZZTA 4HB4A 2Q3MA 1WP9A 2GF0A 3Q7PA 4B6FA 1U9IC 2QUZA 2KJQA 4JLKA 5EZ6B 2O8DA 2BV3A 2QSYA 1DO0A 1JALA 4Q1BA 5TVKA 3U6KA 3OIUA 4UXJA 1D6JA 4TMTA 3GJ4A 4KXFB 3IILA 1PLLA 4NTZA 3KKQA 1JXMA 2RHMA 4J0QA 1G4AE 1QHHB 5JS8A 1NMZA 4URXR 4QBGB 5FL7D 4LBYA 1XNJA 1DG3A 2HEIA 2CCJA 5ELXA 1ZD1A 4IRUB 4AYTA 3NVAA 1S9DA 3WHKA 1F3OA 1XRJA 4L5BA 3KJIA 3DOEA 1K8RA 121PA 4KFUA 4CT5A 1KDRA 4JLDA 1Z07A 3NG1A 5CJ2A 5CM9C 1V5WA 2QU8A 1XCGB 2VEDA 5BYJA 3KZ1E 4ZCLA 1OFIA 1ZYUA 4JBXA 5LB4A 2OBMA 1LS1A 5AK0A 2BJWA 2R8RA 2BBOA 2W58A 3OESA 5KPDA 2AK3A 2VP9A 4F93B 3AKEA 1FMJA 4MUBA 5EXSA 1ELOA 3WYFA 4PSKA 4M1KA 4DLSA 3UG6A 2VP4A 1E0SA 2IYYA 1JBKA 4PAOA 3UMRA 1E6CA 1N6KA 3JVUA 3K0EA 1ZD9A 2ZROA 1Z2AA 1KYIA 2LKDA 4LV6A 1AZSC 1OV4A 5DISB 2GHIA 1FL9A 4QRHA 3NEYA 3GJ6A 3SJZA 3QY0A 1LS6A 4DJTA 2J41A 5FBWB 5B2ZA 1OYYA 2HF8A 2QGNA 3VR4A 2A3RA 4N0DA 5FOUA 2WJGA 4I1SA 1OB2A 1CIPA 2RGNC 4URVR 5AJXA 3VU9A 2CCGA 1W5SA 4BLQA 4LY6A 3WMGA 4B48A 2UVQA 4Q9KA 2H17A 5CB8A 3VR2A 5JEDA 1UKEA 2WSSD 4C0HA 3E1SA 1N5KA 5D3MA 3TQCA 3B9PA 4GP6A 1W44A 1G3QA 1XMIA 4Q66C 3BFXA 2CVHA 5HE9A 3TSWA 3W5IA 1NKSA 4OQMA 1YJ5A 1IAQA 4PHGA 1XMVA 3CPEA 2W2XA 1HQCA 2VF7A 3UIEA 1U9IA 1E96A 4KBFA 2G9NA 2WWYA 2Q6TA 1DADA 3MRSA 4I99A 3CR7A 1OXXK 1ZD8A 3FE2A 4D4JA 1CLUA 2AL7A 1KSJA 1Z0AA 4RKEA 4MUAA 4Y0AA 4O25A 5FFMA 4PTLA 1DOAA 3KXIA 4TQAA 5JZVA 2ZRNA 3B60A 4K81B 1IXSB 5AJWA 4A15A 2OEPA 2PZGA 3JZMA 3FTQA 5IF9A 2A9KA 2OFOA 4X8HA 2F1IA 4Q00A 4IVQA 2GZAA 2W2TA 2R62A 5DIFA 1UADA 2GETA 2ONKA 4G5QA 3WYGA 3V4RA 4IEIA 4RD1A 1NN3A 2J5XA 5IDVA 3NIBA 2O52A 4HAZA 3QVVA 2XGJA 1JAIA 4MKHA 4GL2A 1M6NA 1P3JA 4TYNA 3SE0A 2QTFA 2ZUBA 1GITA 5G40A 1E2JA 4JKYA 2ZVPX 5J4LA 1YU9A 4DRZA 1KK3A 1VYVA 4BRUA 1QRAA 2IBMA 2PX0A 3OE7D 1NN5A 1KTVA 1KO1A 5E7MA 3RS7A 2WSMA 2WWIA 4RZUA 1AS3A 1KNXA 1NSFA 2HLDA 2GXAA 1T3SA 2QP9X 3K70C 1S2MA 3BBPA 3H2YA 3JVVA 5C4GB 5B64A 2ZSBA 5E7IA 2ZRGA 1YZTA 4MRSA 3GJ8A 2B8WA 4F4IA 2WV9A 3VKHA 5C2JB 1RE0A 4GDFA 1SULA 1XDBA 3OZXA 4IXMA 6Q21A 4PXAA 5EUMA 4JBWA 4LBVA 3O8CA 1MV5A 3P20A 4BLOA 3AVPA 2XXAA 4V0OA 2PEYA 2FPLA 4A8JB 2RGNA 1P2TA 4XTRA 3QF7A 4HB3A 4A6XA 4HSEA 3RS2A 3EZ7A 3RS5A 3D7MA 1RZ3A 4RFSA 3MD0A 1DAKA 4RD4A 5CDFA 4OKSA 4NCKA 5EXPA 1SHZA 1E1RA 2NZ8A 2CDNA 1E4YA 4A9AA 5E7JA 5FOWA 4E09A 4X8OA 4AC9A 1WBBA 1CKEA 5TB5A 3RANA 1FNNA 4JT4A 3NEJA 4BZPA 2DWOA 1NI3A 1P7CA 4Q5IA 2DBYA 1YR7A 3MWYW 4DDWA 2EWVA 2AWNA 2GRJA 1XTJA 4IDPA 1RIFA 2ZUDA 4UNSA 1IQPA 4GT1A 1ETUA 2ZI4A 3WRXC 1W0KD 2OBNA 4BECA 3K9HA 4JSYA 4MDEA 3B1ZA 2H18A 2XB2A 2A7QA 3LRPA 4LSGA 5HCNA 3RAPR 1K5GA 3B1YA 2BJVA 1VCOA 1KAOA 3B1WA 1G8GA 2REXB 3GLHE 3IGFA 1UBGA 2C77A 3ZS9A 3FYHA 4MKIA 1CRQA 5GJCA 3KQNA 4TTRA 1II8B 1WE2A 1R2QA 4MH0R 2BKEA 2NG1A 1XWIA 4P0TA 3TSOA 4TYQA 1TPZA 3ADKA 3TE6A 4Q1AA 2ZANA 3K0FA 3MJHA 4D4LA 3RC8A 3MWJA 2OUKA 4Q7LA 1Y63A 5HKKD 2O8CA 4PAQA 1LNZA 1N6RA 2BMFA 2CNWD 4AG5A 5A5GA 5FH9A 2IUTA 1M34E 5AUQA 4L8GA 3BERA 3I61A 1TF5A 3X1WA 4EPRA 3DEFA 1CP2A 4MGYR 1CULC 3BH0A 3LLUA 4AKEA 2EU8A 3ZD7A 4L4UA 3SHWA 2WJIA 5AWFC 1VG0B 4DUGA 5DHAA 3A8TA 4NDZA 2F9MA 1UEJA 3GLGB 4Q4JB 3IDQA 721PA 2QAGB 1AIPA 3CWZA 4RSGA 2P6NA 1KI7A 2ZJZA 1U99A 1GL7A 1OFUX 3OAAA 1J7KA 4JMPA 4TMZA 2CL7X 1OH8A 3K0SA 3L0SA 3VX3A 4L9SA 2C98A 5KU1A 1DTSA 5GADl 2F3TA 2IHYA 2OBLA 5FTNA 4C30A 1TF2A 2PH1A 3MFYA 4DLYA 5P21A 2FNAA 3EC1A 1Q1QA 1MH1A 4UNPA 5H68A 1GZSA 3EIEA 4M1WA 3RRZA 2LWIA 5DYIA 4FCVA 1COWD 1PZNA 1X6VA 2A5FA 3C5CA 2V7QA 3EPLA 1G3MA 4Q1CA 4GMXA 2ZETA 4PAMA 2CMKA 3EAQA 1XZQA 3CONA 4KSBA 5CIWA 1J70A 4TL8A 3K0AA 1GTVA 2EW1A 3D6TB 1KK2A 3O8BA 3VR5A 3HPQA 2ZI9A 1CBUA 3UG7A 1BS1A 5FBRB 3B2EA 4Q7MB 1OE0A 2RGXA 5TARA 1YZKA 2OZEA 4NHOA 3AVWA 5KNDA 3B6EA 3QG5A 4KYIB 1D8TA 4UXIA 5CJPA 5FPHA 3AH8A 3QKUA 2GJ9A 1Q3HA 2WJHA 1MO5A 1UBEA 1BKDR 2R6AA 3MLEA 3ZYCA 1UF9A 4MRNA 3AVYA 1KJYA 1LVGA 2QTVB 2FX3A 3UANA 1N6LA 3GJ0A 4PSVA 4EJSC 5FUWA 2CHVA 3UK6A 4ZCMA 1GILA 1T91A 4F7WA 2QPAA 3X1XA 3AKYA 4IOJA 2WAXA 3QE0A 3T61A 1ZJ6A 1DAIA 1YR6A 1OW3B 3GJ5A 2W6JD 3MJRA 4PQRA 5HZKA 2VSFA 4F38A 1T8UA 3FKSA 4UQOA 1P9WA 4UXHA 3AGPA 3OIWA 3GMTA 4NCIA 4MYTA 1KDOA 2HCBA 2GCPA 2PLFA 3PVSA 1WQ1R 3VR6A 1ZNXA 2HUPA 2FZLA 2QMOA 2VHCA 4NYJQ 4RD2A 4JIMA 4XH9B 3KQKA 5BN3A 2PX3A 4Q1FA 2Q3HA 4GRAA 2QM8A 3Q72A 4WA7A 4G5SA 2QNRA 3CH5A 1QHXA 3MCAA 1HT2E 1W0JA 2YOFA 4OQFA 1KI2A 1I2MA 1Z2CA 2J0UB 2L0XA 4HDOB 1KK1A 2GTPA 1JAHA 1NY6A 4UNNA 3OEHA 4Z8XA 5G3ZA 1R7RA 1NLFA 2FF7A 1EESA 5BWMA 5L8VA 4QHTA 4A36A 2EFHB 1E9SA 4XJXA 4QHYA 4URWR 1LFDB 3OEED 3SDZA 1KOFA 4A0FA 3HU3A 1JJVA 2QAJA 4QGAA 3RC3A 3LQQA 1Z0JA 1YZUA 4B43A 5BYKA 3CPJB 2ZRAA 1E2HA 4AWXA 3R7WA 1EX6A 1MO3A 1GUAA 4C7OB 3RWMB 4JYBA 4LV5B 1N3BA 2ZR9A 1UKVY 221PA 2ZTSA 4NYMQ 4V0LA 3V00A 3L0IB 2VBCA 1YZNA 2ZAMA 3R9IA 4V0MA 1MOZA 5TXGA 5KYKA 1CEEA 5FL7A 2R65A 2XOKA 2FOLA 1U8AA 5SZKB 4JT2A 4Q48A 5DNYB 5BQ5A 3NDPA 2QP3A 2I4IA 1HTWA 5E95A 4XVRA 2D06A 2RAPA 2GILA 4JLAA 4KI0A 1KJZA 4M1OA 3EA0A 4AKIA 2BHRA 3OHMA 3IIKA 2C9CA 3TLXA 4U7DA 3A36A 4C9BA 4NMMA 1TUEA 1EFTA 1XTIA 3NH6A 3RRMA 2KBEA 4QXAA 2ZRBA 1H8ED 3GD7A 3BB1A 1E9CA 1W2GA 3KTAA 2QI9C 1OKKD 1SXJB 1SHKA 5CYPA 5FUVA 2ZJ2A 4V0NA 2A5JA 5JFGA 3FB4A 4ZDKA 1KZ7B 1Z22A 2JLQA 3O8RA 3I8SA 2AKAB 3S1AA 5EP4A 4D25A 4KFRA 4XD7D 2CHQA 4BUJA 3NC0C 4RCZA 3QF4A 2PMDA 2ATXA 3GFOA 3A4LA 1TQ2A 5JSZB 2ZR7A 3TW8B 1Z0DA 3GPLA 2Z83A 4XIGS 1QBKC 2RGCA 2FGKA 2WWGA 1EFHA 3KKOA 4HI0E 3SYLA 1JI0A 1ZMXA 2JLWA 2P0EA 2IS4A 1VCMA 3DDCA 5FTLA 1II9A 4LYFA 1JPJA 3LVQE 1CJTC 2ZSFA 4DXAA 2QENA 1JR3E 2HXSA 3M4YA 5AR1A 2XNDD 2GK7A 2P2LA 5G41A 3RABA 1Q22A 3EW9A 4KVGA 4I4LA 2CJWA 3DKVA 4GOXA 1N0WA 3PFIA 4QM6A 3QUSA 2CE2X 3EX7C 3KXKA 1S3SA 2MSEB 4TSFD 5TDHA 2XX3A 1N6OA 2R6FA 1HH4A 1FUKA 2HV8A 4PFSA 3SYNA 3B8HA 3FMIA 2PT5A 2OFXA 3I73A 3AF3A 4JJKA 3IQXA 3TBKA 3CRRA 2GK6A 2PL3A 2ZRKA 1Z29A 3CO5A 2QY9A 2ZRPA 2P5SA 2Z4SA 1OH5A 1N5IA 3T5DA 2CLCX 2GJAA 2OT3B 4HLUC 4TT3A 1OIWA 2OAP1 2SHKA 4HLQB 3BJIC 2ANBA 1C1YA 2B7CA 3W6NA 1TQDA 3ADBA 1OJLA 5J4KA 1E98A 2D3WA 2R6GA 4IEEA 4UKDA 5DSZA 5C46F 4LK2A 1J99A 3KQLA 1Z6XA 4IXNA 1D2MA 3T06B 3KFXA 1BMFD 2H1LA 4C2UA 2ZIAA 4KBGA 1YQTA 4ITRC 4CVNA 2O8DB 3GLHA 1UDWA 4LHYA 4TMWA 1EWQA 3SYKA 3K9GA 1D9XA 2AWOA 5KPJA 3Q85A 2NIPA 4AY2A 4G1UC 4YC7A 2ORIA 3THXA 2O8FB 2BCGY 3GFTA 4JLJA 4NE2A 2JAQA 3F8TA 4LHZA 1OB5A 3A4MA 1GM5A 2CCKA 4PZYA 4GMDA 4WZAE 1E2QA 3I5XA 1TX4B 2WWWA 4ZV4A 2J59A 3BS4A 2ZRMA 2XZOA 4P4SB 4QBHA 1G3UA 4JLPA 4OHVA 5H70A 4LX0A 4ACBA 1JQJC 1ESNA 1OHHD 1R0XA 4BPBA 3TUJC 3C14C 1W4CA 4PO1A 1IHUA 3L82B 1G19A 3ECCA 2PJRA 4ESHA 4CEHA 4BFYA 3FPAA 3P26A 2V4ZA 4FINA 4TL9A 3RS3A 4BFVA 4QBFA 4AI6A 1ZU5A 4E07A 3THOA 4LZZA 4WOPA 1FP6A 1XCMA 5JRJA 1U98A 2OCBA 4HZUA 4OQNA 1KMHA 1G7SA 1Z06A 1FUUA 2ZVQX 2ZJYA 2ZAOA 1XCPA 4NYIR 2BIFA 1DO2A 4Q47A 2ZUCA 3LBHA 2NGRA 4B3XA 1WB9A 2V3CC 4D0GA 1NVVQ 1X1RA 3UPUA 1D9ZA 1R4AA 3BGWA 1XJCA 1FQJA 4BFTA 3RVBA 4ZDJA 1G64A 4RD3A 2GEDA 5DYGA 1A2KC 3WP1B 1G4UR 4OQLA 3LH5A 1VG9B 5H8WA 3I3SR 3SC3A 1KI9A 3FVQA 4K46A 2WHXA 1DAHA 2GKSA 3GJ7A 1MT0A 3BRWD 3QOFA 4D2IA 4M22A 1NMXA 1S8FA 3VU9B 1CR1A 3AKCA 1R6BX 4DLZA 4CEIA 5JLJA 1OSNA 3WMFA 2V1UA 2XJ9A 4HLUA 2YKGA 1VMAA 1XTSA 3WNDA 4BZXA 2J0SA 1YR9A 2XITA 5KTYA 3CX8A 3QKSA 5D3MB 3FMOB 4JVMA 1FOEB 3CUEF 1W36D 4QOSA 3KQHA 3Q5DA 1GKYA 4LPKA 5HCIA 2AHOA 1UPTA 2W6ID 4AYWA 4US0R 3BH6A 2EYUA 4FIDA 2VPPA 2WBLC 3CF0A 1EXMA 2GEVA 3VR3A 2GDJA 5JCPA 1E9BA 2ZYVX 1CF4A 1NJFA 2GBLA 1OT3A 2FU5C 2AXPA 4YMSA 1EFUA 1JQLB 1QVAA 1XEWX 1XTKA 2NTYC 4HATA 2OCPA 2IYVA 3ZIAD 3B82A 1ZCBA 1KI3A 1DELA 1ZUHA 4A0GA 3AP1A 1US8A 2YHSA 4FWTA 3ICEA 4TLBA 4Y0VA 4AIIA 5FOXA 1Z6YA 2CNWA 4II7A 2ZITA 3U3OA 2XNSA 4Q7JB 1E9DA 4XWAA 4O2LA 2RGBA 3AF4A 2ZXUA 4ILEA 2JASA 2JCSA 4OI2A 3NC1C 1F48A 1UBFA 4A6PA 3PEYA 2D7DA 1XD2B 2P6RA 2IHBA 2UZ3A 4NKRA 1I4TD 5H1YA 4Z1MA 3V9PA 4EFLA 3IQWA 4B76A 1IM2A 5L3SA 5SZIA 4N1AA 4M4SA 4QNMA 3WRYC 3IEUA 2GVZC 3RS4A 2G0NA 3CM0A 3R9XA 3U6BA 2WICA 5A4JA 2FZ4A 3SZRA 3DZDA 1F2UA 1E0AA 2HJGA 4HDCA 1AK2A 2G6BA 2IX3A 2ANCA 1U8ZA 4JLNA 4BFSA 3X1ZA 4US2R 2HDNB 3UWKA 5FI0B 3TVTA 2QMUA 3MMPA 2C78A 1QG4A 2J7PD 1J2JA 1MABA 3W34A 3QVUA 1IXZA 3A37A 1COWA 3SNHA 2VO1A 2QBYA 2BM1A 2KSQA 1ZUIA 2Z0MA 5AJVB 2JLVA 4EPXA 2QGZA 3Q3JB 4ZKEA 5DO9A 2NOAA 4B34A 5J4HA 4ZDIA 2ZEJA 5FTMA 3LY5A 3GLIB 1GP2A 4KFTA 3VKWA 3LNCA 4B71A 4DSOA 2ZU6A 4PPFA 4ABYA 2BBSA 4NCHA 4RFSB 2ZRCA 3B9QA 4OI0A 3P32A 4TYPA 3U3MA 4EFNA 2FFAA 4RZ3A 2QMHA 3BE4A 1T4GA 1NVXQ 1EG7A 4LHXA 5A0FA 3LA6A 2J9RA 1G3RA 1WBDA 2BBTA 3PEWA 2NO6A 3SBDA 2ZJ8A 1XJQA 2PZFA 1G5TA 4FCWA 2AD5A 2P5TB 4MQBA 1NG1A 4A2PA 4A2QA 2EYQA 2W0MA 1RRGA 4Q9HA 1IOZA 1E0JA 3D8BA 1X8LA 2ZQ5A 4V0ME 4A4DA 1HQYE 5CK4A 3GLFE 1EGAA 4M1TA 2JLRA 2CL6X 3PCRB 4Q1DA 4RJLA 2FSFA 1E2GA 1CS4C 2ZM5A 1GFIA 3ASZA 4FXPA 4DKXA 3NDBB 1IY1A 2ZS7A 4A82A 1SKYE 1RYFA 2ATVA 3AF0A 1G20E 1Z3IX 1QHIA 2GCNA 2WVJA 4M9XA 2G1KA 3EZ6A 2J87A 3LXRA 4ON9A 2OESA 3U7FB 2WOOA 1I4DD 3FFAA 3VAAA 4OK3A 3T1TA 4DLVA 4O3MA 2XZPA 1JR3A 1KHTA 2PZEA 2NPFA 3VX4A 2B92A 2PCJA 2RGDA 3UKDA 3G0HA 1G17A 1BIFA 2HXYA 4AG6A 2NO7A 3K0FB 3FOZA 1P2UA 3LAWA 2BWJA 3QBTA 4K8OA 3THWB 2O8CB 1XD9A 4OJKA 5JRZA 1ZM9A 1Q12A 2JIZD 3CF6R 3U4QB 3LXXA 3UATA 1H8HD 3OEEA 2RGAA 1C9KA 1J8MF 1W4AA 3FHTA 1TF7A 1AGPA 2GA8A 4NP6A 1ZVQA 4CGZA 1TNDA 3X1DA 1D2EA 2WJYA 4Q19A 1IJFA 1X1SA 2VSOA 1PJRA 2HYIC 1VDZA 4JL8A 3K70B 3ADDA 4W5WA 2QPOA 3ND9A 1G8PA 1V43A 3RWOA 3KKMA 2OXRA 2IS2A 3CZPA 3NH9A 4A1FA 1KY3A 1JXOA 3KB1A 5J4VA 4POAA 5JHHB 3ZQJA 2NO0A 2QM7A 1OIVA 4EDHA 4JL5A 4W5HA 3LDAA 1T6NA 1BYUA 1YRAA 4DDTA 1E2FA 3OIYA 3TKLA 1NIPA 3EARA 4OJQA 1X8JA 1RJ9A 3REFA 3P1JA 3K1JA 3LLMA 4LJ5A 3SN6A 2FGJA 1S0UA 2B8TA 4WVFA 5K8IA 2P3SA 5JECA 3NHBA 4H9GA 1G5RA 1W5TA 1K5DA 4N3NA 1KKLA 4PC6A 2HT6A 3W9YA 2WJJA 4B32A 1KDPA 1B0UA 2R9VA 5AUOB 3K0AB 1FW6A 2IYRA 4HAYA 3GFPA 1IY2A 2QPTA 3C8UA 1Z83A 1Z6AA 1FNMA 4UJ3A 4B3BA 1E32A 5M04A 5AJYA 4C0KA 2K5UA 1GRQA 2F1RA 5GVRA 3AUYA 5EE3A 2FSGA 4UNRA 3VTKA 1E79A 3GP8A 3TUIC 1ZRHA 2YNMA 1E1QA 1N6IA 4YXWD 4XD7A 3UWOA 2DFKB 5IT5A 2GEUA 3QKRA 5BN4A 1XEXA 1EK0A 3HP1A 2ZRIA 4KHZA 1U8YA 2GESA 5EP2A 2ZJBA 2JLYA 4MDFA 3EZ2A 3UMSA 3BFVA 3PUZA 4F4CA 5KNCA 1AA9A 4LOAA 5IK2D 2YZ2A 3CNNA 3RRYA 4Q01A 2ZSAA 4PC1A 4ESVA 4KU4A 1GG2A 4KJZA 5G53C 1CJMA 1Q57A 5JWHA 2AN9A 3DM9B 1IN6A 2GJKA 2ZRFA 1AKYA 5HR5A 2IYXA 4BLTA 5F9HA 3RSOA 4B3DA 4L9WA 4TSFA 1KJWA 1W49A 1Z47A 1SVWA 3WYAA 2OO7A 2E87A 5LD2C 2WKPA 2CK3D 2IYUA 4QBIA 3PIRA 1G7TA 3EASA 4U00A 3MAAC 4JYCA 1D2NA 1DAFA 3KDSE 3ZZUA 1RRPA 1DE0A 3QXHA 4ASUD 2Z6VA 2DFNA 2QQ0A 2FA9A 3QPUA 2WMOB 4L15A 4QJ5A 1FX0A 2QROA 3KJHA 3LO5A 3PR1A 2XEXA 4QJ3A 2F55A 2XJ4A 3U60B 1W36C 1XFAA 1HE8B 2G1JA 2QRZA 1IN4A 3LV8A 1A4RA 2GCOB 4G01B 4GSYA 1HURA 1VIYA 3KUDA 4DVGA 1Z6TA 3L8ZA 2DCUA 4QNRA 3EPJA 1S1CA 2C5LA 5FTJA 1W4RA 2WIAA 3BB3A 4FD2A 4CYMA 1BMFA 1A2BA 1G5PA 1XXHB 2XSZD 4G3XA 3KX2A 1KI8A 5F3WB 1M7GA 1G16A 4ARZA 4EPYA 3N2EA 4LHWA 2YJTD 3R7WB 2VHUA 2C04A 2OLJA 1G7CA 2KWIA 2N46A 1AQUA 3A1TA 3CWQA 4NCNA 4R2IA 1NMYA 2ZI7A 5DI3A 2CLSA 1ZNWA 2CVFA 1F2TA 3OF5A 3CRW1 2QE7D 2IUSA 3KKNA 1P6XA 5TY0A 4RCYA 1UDXA 1NIJA 4XTCS 2XTZA 3AQ4A 2QQEA 1MKYA 4TQ9A 1XX6A 3QPVA 4A8JA 1VYUA 2AD1A 2C8VA 2CLDX 2V54A 4PQYA 2B6HA 1I4LD 2O8BB 2V55B 4ZIRA 4UNQA 3SQWA 2ZI3A 4PX9A 4MKFA 2D2FA 2EFDB 2PEZA 2RGEA 2B21A 3A1WA 5CK5A 4JSTA 4TLEA 1ZUNB 1ZCAA 3GEIA 2NQ2C 2ZE5A 3LVRE 1FP7A 1E2EA 1GNRA 1VHTA 4JBYA 4BZQA 4EJSB 3KTAB 4CDGA 3EWAA 3VNUA 4KVAA 3BWDD 4FI3C 4LDJA 1P60A 2H5EA 3CNOA 3BOSA 1XF9A 3ZJYA 5FPKA 1SVOA 3CBQA 2RMKA 3MUFA 4PO8A 4X8LA 4BFZA 3EPKA 3E70C 3S1AB 1KI6A 2AX4A 2FFQA 1U90A 4EQ6A 2BDTA 3SR0A 1FPMA 1KIMA 2NO9A 5TV2A 2IYQA 4WXPA 2W2VA 1DEKA 4TQUS 3SS8A 4Z8YA 4HAXA 4JVSB 1R5BA 1ZC4A 2I1VB 2OE2A 2VP0A 3PITA 1G8HA 1YKSA 2J45A 5JMTA 1JPNA 2GJ8A 2N1BA 3EZFA 4QJ4A 1Z63A 4D6PA 2FV8A 1AM4D 1IXRC 1CR0A 2J46A 1N6PA 1QDEA 1RRFA 4ZKDA 5CITA 4NPHA 5KDDA 2XB4A 3AVOA 1G9XA 3TJZA 1AJEA 4FW9A 4GPTA 3P4YA 1R10A 3U3KA 3FDIA 3T12A 4FMBB 2CJWB 4KITB 3M0EA 3L0PA 4BLSA 4B3GA 1IJEA 1G41A 4ZDWA 3TRFA 3OFNA 1YRBA 5LDDC 2Q9AA 5FOSA 2FH5B 3TR5A 1QZXA 1QVRA 4D4MA 1S4QA 5KDLA 1Q0UA 2EVWX 2P67A 3AV0B 3QENA 4YQFA 1SVMA 3B1XA 2A5DA 1ESMA 1G6OA 2A5YB 4TMKA 4QC2A 4FMDF 2AXNA 2G88A 3D3QA 3ZVRA 1YR8A 2FDCA 1S9HA 2RB4A 4JLVA 1TEXA 2Z5FA 3TSZA 3GLGA 3TR0A 1I2DA 3OIVA 4PZLA 3GLFA 2JDID 3Q7QA 4XSHA 2CEAA 3ZIAA 1L8QA 2BBWA 4CIDA 2CBZA 3IO3A 5EE5B 4G5OA 1MO4A 1GDDA 2ORVA 2IXGA 2AFIE 3GLHB 3T15A 2HLDD 3NBXX 5KSPA 1YVDA 4MGIR 4B2IA 3NWJA 3FMFA 1Q3TA 3A58B 4US1R 2DFTA 1UKYA 3DL0A 4JVLA 1E69A 3THXB 4C2TA 2JJ1D 3MSXA 3G5UA 5GJBA 3KJEA 4NONA 1AS2A 4W9MC 1LB1B 2ZRLA 1GL9B 1DPFA 1QHGA 1Z6GA 3VMFA 4DDUA 1PLJA 1ZP6A 1CR2A 2V9PA 1BYIA 1U81A 4XWKA 1Q20A 4GP7A 4B33A 1E4VA 1GRNA 2ZJAA 4M0LA 3B1VA 4DHEA 5J47A 4XVQA 2BMDA 2MMGA 3ZLJA 3AEZA 1FQKA 1E2MA 3O8DA 3ZQ6A 4EAQA 4Q4HB 1P61B 3ZDQA 5SZHB 1Z0IA 2XTNA 4CT4B 3LW8A 1D5CA 4B44A 1RC8A 2PBRA 1E1RD 1ZM7A 3CKLA 2J7PA 4CEHB 3JZAA 3KXLA 4Q4AA 4LYHA 3MWLA 2OXCA 1GOTA 3VHLB 3CX7A 3V4FA 2DPXA 3DVLA 4D0LB 2IWHA 4YLGA 2YVUA 4HZUB 1F60A 3DKPA 1KMHB 2FFBA 3HPRA 5JJIA 2QZ4A 1UBCA 2D7CA 4XWOA 4EUNA 2AFHE 5C1BA 4IVRA 1OF1A 3I62A 1YHNA 1W46A 5GJWC 2ERYA 3D31A 5IHPA 3LD9A 1KK0A 3QXJA 1TAGA 4RZXA 3FHOA 3TK1A 1E2DA 2WAYA 1E2IA 2WSSA 4KFSA 2LCFA 2GAOA 1EFRD 4IFBA 3RYTC 3SEAA 4LJ9A 2YWHA 1M74A 2EQBA 2FPMA 2A30A 4NH0A 3BD9A 2WZQA 1II0A 1O3YA 4MRPA 2REBA 1GIAA 4C0SA 1E0KA 1W4BA 4CEIB 3GCGA 2ZYWX 1RVDA 4RD0A 2GXUA 2J0UA 3DO6A 1R8SA 2X2FA 3QKSB 5B58C 4EPVA 3VHXA 1P2VA 5JEEA 1NVUQ 1W2HA 3HU1A 4IFEA 4HUQB 2IYSA 2D4HA 2F43A 1N5LA 4GOKA 2C9YA 4YMWA 3QI2A 4LI0A 4Q9IA 4B75A 4HB0A 2ERXA 1P73A 2IF2A 2QMEA 4DWJA 1XPRA 3M6AA 1JEDA 1TTTA 1VPLA 2QT1A 3I92A 3I4LA 5HZHA 2Y8EA 5TMPA 2P6UA 1IN5A 1IONA 2GBLC 4KO8A 1RKBA 1W47A 3TAHA 1T0JB 2AKYA 3K70D 2KBFA 1E2KA 5J40A 2I1QA 2GF9A 2R2AA 2F3RA 1RPZA 4TLDA 2DHRA 3RNLA 1T5IA 3QQ5A 3HJNA 1AS0A 3FMPB 4YMUA 1S1MA 1US8B 1Q1BA 1CJVC 3OAAD 2ZR0A 3R8CA 3GLIE 1XTQA 2JIZA 2X1VA 2OAQ1 3K0CC 3WY9A 3T35A 3OE7A 3U61B 1H8HA 4LPSA 1W48A 3UMFA 1CTQA 1DG1G 1X86B 3I1FA 1ZNZA 3I32A 3DPUA 3DM5A 3QPWA 5IRCD 3FHCB 2A78A 2ZI6A 2DFLA 2DR3A 4PR0A 5L3SB 3J81k 1SVKA 2P65A 5FOTA 1WXQA 4HB2A 2ONJA 2JJ8A 2VHTA 4TTPA 3TNFA 3VR1A 1N0VC 3KUCA 1FTNA 1F2UB 2W00A 3MWKA 4TWZA 1VTKA 2QEQA 2OCYC 3WNBA 2KI5A 1JNYA 1R5NA 4YONB 1Z28A 3REGA 3M1IA 5E3HA 1TMKA 1L4YA 1T0HB 3TIFA 1NLZA 1A82A 1S96A 1VKJA 4A0HA 5J5CA 1G291 2WM9B 4XSGA 1KO7A 4P3YA 4ZI2A 3PEUA 2QBYB 2X8AA 5FPYA 4Q03A 2ZREA 821PA 3CW2A 2B7BA 3U44A 4P4TA 3SFZA 5ANRB 3AVTA 3PV0A 4LUCA 3K9LA 1XU4A 2JLSA 3U7GA 4GBMA 3FWYA 5EQTA 2EFGA 1GNQA 5HPYB 5L3QA 2WOJA 3CIOA 2VH5R 3SBEA 4BQSA 2XTMA 2F6RA 2PT7A 4MYCA 4WBSA 1XD8A 2FSIA 1WCV1 4YXWA 5D3QA 4DB4A 1ZBDA 3C41J 1W0KA 2R6DA 1QG2A 5FBLB 2IYWA 4LHVA 2GAAA 4M1MA 3B5JA 4ZO4A 2O8EA 3EG5A 3GEHA 2QN6A 1G3IA 4E03A 4LC1A 1DBSA 1HY3A 4PHTA 2FFHA 3AP3A 4Q9LA 5FPSA 1IBRA 4EPWA 3ADCA 2MMCA 4E5UA 3LX8A 4DT1A 2IT1A 2O5VA 3QSYA 1VG8A 4GZMA 2X77A 1EX7A 2YWEA 4Q1EA 3H4MA 3SQXA 2IUUA 1U2RA 3K8YA 2VP6A 3K9NA 3BFKA 3F3YA 3ASYA 1N2CE 4N0EA 3EA5A 2ZU0C 2GWHA 3FFBA 3KKPA 2IC5A 1XB2A 2Q9BA 3C5HA 2F9LA 1YZLA 3L43A 4C0JA 4YMTA 8OHMA 5FBVB 1VIAA 3BORA 3KJGA 4GOJA 4HLCA 4CEJA 2CK3A 5HKKA 5JWOA 3AF2A 2ECKA 4LJ6A 3TQFA 4NCJA 1NG9A 1T5LA 1XJ0A 2NO1A 3K0CA 4LBWA 1U0JA 2QSZA 3GEEA 2GNOA 3T1OA 4ASUA 4AKGA 1NBMD 1ZNYA 1HT1E 1E2PA 4HZIA 4ZI3A 3VFDA 3QKTA 2DB3A 5BN5A 2O8FA 1YE8A 1OYWA 1Z08A 3L0OA 3Q8XB 1LTQA 3C4JA 5B57C 621PA 2XOKD 2QT0A 4LJ8A 4P33A 3SJBA 5FBQB 3W3ZB 4MYUA 3MGCA 4DDVA 3AP2A 1BH2A 2V8OA 4BGDA 1PV4A 2XSZA 4DLRA 4P4SA 4DLXA 1R0WA 4QL3A 2IK8A 2ZI5A 2IWRA 3H1TA 4R98A 4OHWA 4QGHA 1U0LA 1OIXA 5FI1B 2G77B 1M1YE 3LWNA 1A7JA 4QGGA 2J0VA 2EWWA 5DN6D 3NBYC 5K8TA 2RCNA 2CHGA 2DWQA 4DSTA 4Z54A 1HE1C 5CM8B 4DEXA 2BEJA 2QE7A 4M2LA 3CB4A 2X2EA 4DCSA 2JA1A 1MRNA 2JLXA 4KLNA 2VSXA 4IJMA 4PC7A 4QG7A 3WP0A 5LBIA 2XXAB 1KO8A 4BEBA 1AQYA 4DCVA 3THYA 2CE7A 2KB0A 1SZPA 5FTKA 4NYJR 1RJ9B 1VHLA 1JJ7A 3ZVMA 2ZYTX 2A2ZA 4G5RA 4D4KA 3O47A 4HYYA 4HUTA 4LC0A 5F98A 1LF5A 2OHFA 3L2OB 1P4SA 1N6NA 1HV8A 5EP1A 3U5ZB 4B74A 4LJ4A 1WDTA 3PXGA 4PQFA 1HUQA 2QTHA 2ODEA 2PMKA 2W6JA 1XEFA 3CPHA 4OI1A 4MRRA 1SVLA 4GI7A 3TAUA 2E9SA 3B7GA 4MA4A 3WBKA 1NKTA 4A2WA 2PJZA 4CF7A 3GLGE 3QKRB 1KNQA 2H16A 1E2NA 1XEXB 2D2EA 4R2HA 1G8FA 3WNCA 2JGNA 4M9QA 2FG5A 1XXHE 3U3JA 1M7BA 3SU8A 5KHOC 2FWRA 4Q02A 5CB6A 2UZIR 4I81A 1NBME 3PG5A 4NYMR 2VL7A 2J1LA 4OBEA 3R9WA 5BXQC 1XPUA 4TT3D 4AYXA 1MRSA 1RYHA 2C99A 1TEVA 3BH7A 3QEOA 3KB2A 4JLBA 4KAXA 3U2QA 4I1VA 1R8QA 3W3AA 1CR4A 1KSFX 1VYTA 4LJYA 1QF9A 1VECA 1P2SA 2GXQA 4CW7A 5KSYA 2G3YA 1QHHA 2ZE8A 1KSGA 3PUVA 3K53A 3F5FA 1G8YA 3B13B 1G18A 2E1RA 1LV7A 2NPIA 1XMSA 1ZW6A 2HCJB 2H57A 3DHWC 2O0KA 4MITA 1HEIA 1P9NA 4B35A 4HLDA 4R7ZA 3H84A 3A1SA 4OI4A 2H92A 1J90A 1FX0B 4D80A 2GZHA 1XD2A 1WMSA 3ICQB 1M7HA 1OFHA 1G21E 4MGZR 2R44A 1QHNA 4BFWA 1NJGA 1GKIA 1DAGA 2VRWA 3CLVA 4PO9A 4BFUA 5J4YA 4DBLC 1OPXA 2WPDD 1Z5ZA 1JECA 2JDIA 3LBIA 5DGXA 4V0KA 5EXXA 1SXJD 1OH7A 2JJ2D 3IPYA 4Q9JA 1UAAA 1QHSA 1P72A 1TUIA 2YYZA 4ARZB 4DCUA 1M8PA 5JHGB 2EFCB 4DLTA 2FEOA 4G5GA 3ZVNA 1N6HA 1NN0A 1X8KA 1F5NA 4LYJA 4KV9A 1YZQA 2JJ1A 1Y3AA 5DI3B 2C96A 3DOFA 4C0BA 1F2TB 1E2LA 1TQ6A 2YC4C 3BB4A 1S3GA 3SJCA 4IW3B 4A0RA 1H8EA 2IYLD 1E3MA 5HTKA 3I5YA 1E9FA 2UKDA 4XVUA 1OXTA 4OHYA 1OKKA 2VYFA 3ZZ0A 4A8JC 1E94E 2VHQA 3GLIA 5KO2A 2RKOA 3PENA 1ODFA 3DMNA 4IDHA 4RZ2A 4UJ5A 421PA 4ZIRB 4IDQA 1EWRA 3BAFA 3GJXC 3I8XA 3W5JA 3ZH9B 2Q21A 1T3HA 3IBYA 3DMDA 4O2RA 3HR8A 4BEJA 1GKUB 2FMXA 4JVNA 2BOVA 2VIIA 1KSHA 5UKDA 3BXZA 3L8YA 3ZVLA 2OM2A 2QORA 1VCIA 1KI6B 3IIJA 2XNDA 4EQ6B 1Z0FA 2BMJA 5C18A 1P9RA 4WXRA 1UKZA 3WMEA 4JLOA 2R6CA 1N5JA 1Q1ZA 3AVQA 3AF1A 2WIBA 4NYIQ 2VTKA 2IXFA 4OQXA 1Q21A 2C95A 2DWPA 5CLQA 5G3YA 5DHFA 4D81A 5LD2B 3HU2A 1L7VC 1EFRA 3CR8A 2WMNB 2YWGA 3AUXA 4H1UA 4MGKR 2ZRDA 3A1UA 4KYUA 5JCZA 1ZM4A 1NVWQ 5JBQA 3SHFA 4ZPXA 5AJZA 1DARA 1RFLA 1E9RA 1G1MA 2RH5A 2YOGA 1KI4A 3LX5A 3AVVA 3CF2A 4JZKA 1ZINA 3T34A 1SVSA 1ANKA 1W36B 5AUPB 1IN8A 4DCTA 1SXJE 1ZIOA 4DLUA 3QNUA 3QBVA 3THWA 3RHFA 2GJSA 2J3EA 2WJVA 4XOIA 3U7EB 2IW3A 3TH5A 4X8MA 2MSCB 3U4QA 4LJ7A 4URUR 3ETLA 2O0JA
chains in the Genus database with same CATH superfamily
1NP6A 5IDWA 1V7CA 4Q4LA 3WR5A 1KMCA 1SU4A 4Z9FA 4MTLA 1UM8A 3RUAA 4RPKA 2AR7A 1TTHA 4MYSA 4Y2TA 4BP9A 1R5OA 1UJ5A 3DLIA 4G8CA 4NICA 4YMLA 3LYUA 1H5UA 4IEFB 4ZV7A 2OCIA 3TTYA 1XZPA 3OBIA 4QX6A 1N2CA 1Z4MA 5AVOA 1CX9B 3ZBPA 3HCWA 4CTMA 5GZ6A 3OWOA 3W6PA 3GLFB 4YB8A 1WRBA 1IQ0A 3KUUA 4M9SA 2BR4A 2Q5EA 1PI3A 3WLQA 3LBYA 4ADSG 3KV3O 5HTOA 3BXHA 3I0ZA 4TSKA 3CS3A 3KYDA 4QHSA 1NVVR 3PGVA 1USUA 5CTJA 4ED9A 1ECCA 3R0ZA 4O0MA 3FETA 4UZFA 5LBTA 2QQGA 1JH8A 2EDAA 4N41A 3VKGA 4PHFA 2Q07A 1QQ5A 4RV4A 3CEPB 2J3HA 3W77A 1XEWY 4IGIA 6YASA 4B7CA 2CVZA 5AVXA 1KEZA 2XVMA 1QHYA 1RBQA 3KZXA 3MXOA 1TADA 3T9EA 1LUAA 4PANA 1SC4A 4ZFNA 2VDPB 2IIPA 3KOZA 3DVRX 1VE3A 4BCDA 1YR3A 2JGRA 3C7TA 3WI7A 2FF5A 1CE8A 3V2HA 2FE1A 2R4QA 2XUZA 3G9XA 2YJ4A 3CCBA 3IAM6 4QZVA 1Q44A 1Z2EA 2PVCA 1NDUA 1QC5B 1I9GA 2WSIA 1GVNB 1Z3CA 2IXDA 4XQ0A 3G7NA 1WCYA 4D9FA 1GNSA 1DO8A 2D1TA 4ZOEA 4E2ZA 2Y6VA 1XDSA 3UOGA 3VR2D 1MZVA 1NLYA 3MEQA 5EJ7A 5FWYB 3VTAA 3C16C 1JSXA 2Q0HA 4DRXB 2XKBA 1FFXA 1JRLA 1LDBA 2X1HA 4INPA 1KZGB 1VPTA 3IQZA 1ZM3A 4Q4AB 3DBRB 1PVDA 3F74A 2Q7DA 3MG9A 4X24A 4QGFA 3FGNA 5C35A 4YRBA 1LK0A 4HGNA 1N77A 3OPYI 2Y0DA 3QWAA 5LLSA 2NNWB 3IQDB 2BY4A 1O2DA 4JIGA 4Q0MA 3NHPA 1JKFA 5AIBA 2VJCA 1JBEA 3GQBA 3H0EA 4B3MB 1TO6A 1UMBA 3ORSA 1FDVA 4XCXA 5C32A 3KSBC 4PSAA 1CVIA 3LYAA 3M7IA 5LQCA 3L93A 2BD0A 2A5GA 2W4IA 4QATA 2GPTA 4HAVA 4O2AA 4TWRA 4F5WA 4PLYA 5JT1A 5CLLA 2JW5A 1M2OB 4AF8A 3FR8A 4OYHA 1SIUA 4NZZA 2GUGA 3EOZA 3V8NA 2BMWA 5DXAA 5AESA 2VJAA 4H7KA 4RTKA 3IDZA 4LBZA 4BNZA 3BJMA 4CKZA 1TU3A 3C1OA 1J9GA 3IO5A 1KH1A 4MYHA 2TMDA 4QDKA 3L7KA 4KXVA 1OXUA 1YD7A 1J8YF 1M0TA 1JEEA 3FCYA 1UJBA 4LZLA 3IEVA 2OP1A 1KAEA 2CLEB 3L4SO 1YK0A 2F1JA 5FUBA 1JLSA 5IG2A 4HDSA 1PLKA 4ZT2A 5TPZA 4XXHA 1D8AA 1M72A 2VJMB 2HK9A 1Q0SA 1O87A 4H1VA 3P0HA 1LZLA 4V3CA 5ER6A 4KR9A 2DUMA 1JILA 2W83A 2FSPA 3AINA 4HEJA 3RSGA 3KWLA 1FP1D 4TTSA 4BN5A 4PPNA 5K8LA 4WLOA 3BE8A 2BP7B 3Q3IA 2EW8A 2ODBA 4NFHA 4I19A 2J4DA 4I66A 2VDLB 4BNLA 3GF4A 4GZLA 4C4ZA 4H7FA 3PHCA 1XMJA 5IANA 3EXFB 1C9MA 1LBHA 1IHOA 1UEIA 2OYSA 2PV7A 3GWGA 3CA8A 3AONB 4IOMA 3WAKA 4C3ZA 4JB2A 2W0SA 4KMSA 4MQEB 2PN1A 3DB1A 4BAZA 1KDTA 3L8EA 4IQ0A 3RVRA 3UUFA 1H2YA 2CNOA 2HGZA 1PGJA 1X19A 2IA5A 4OGWA 3EVDA 4UTXA 1T26A 1UBLS 2C07A 1E99A 2TRSB 4GYWA 2C0QA 1ZHHA 2R47A 2OZLB 2UVPB 2I4OA 3PGJA 3P4XA 3QEJA 1YL6A 3CSSA 3D59A 1YOVA 3HCEA 5HFJA 3DFMA 4L3OA 2FDRA 4EIWA 4JI8B 4FMCF 1JAYA 3VA7A 1U6JA 2CJPA 2RFLA 2YDYA 1EHYA 1R0YA 2X6QA 1JEQB 5GIOE 2O2IA 3PUYA 4GEGA 4A3SA 7REQA 2GASA 5MN6A 3RRFA 1E58A 5F4ZA 1H3FA 2IEZA 5DM4A 3AR2A 5DN6A 1MC5A 4FN4A 3ISTA 4ZD6A 3EUFA 1Y7LA 3TI9A 4E2FA 1NF3A 4FMCB 5JQGF 5JMPA 2NMVA 3IHWA 1Q0PA 1TJ5A 4OM8A 5K99A 1G21A 2C1EA 2FCRA 3NOXA 2QE6A 4RLHA 3KT3A 1SCAA 2JAPA 2O0HA 1E3EA 1SBZA 1SR8A 2D59A 3PGKA 7MDHA 1SXJC 4J0JA 3G2NA 4S2EA 3UB2A 3OFKA 4JS0A 2V0CA 3OPQA 4NE9A 3V8RA 4F3YA 4TWAA 5IM5A 5JQGB 2FWJA 1VXOA 4HYEA 1JNXX 2G0TA 1H5NA 3BIWA 1MD9A 5FNZA 2OV2A 4HNAA 2QL5A 4Z4GA 1QONA 2IODA 4XVCA 2HWKA 2WYVA 3ZD6A 1E79D 1LDNA 1XZFA 3H86A 4JP2A 2YINC 4O29A 1JJAA 2ZDGA 4P7GA 2WHRA 3ROKA 3EFEA 3VU1A 5DP2A 1AB5A 4CN9A 1S7GA 3X2SA 5LP1A 1G8MA 1HORA 1KJ8A 2FJUA 3GA5A 4JJ6A 4L28A 5CFQA 3HYRA 4F91B 3ZCTA 1GYPA 3N70A 2CN1A 4MUNA 1A4IA 1OLXB 1Q15A 2ZTHA 3O73A 2ES4A 3HMKA 4J0FA 5ALFA 1OLSA 1QYRA 2ISQA 1ZPDA 3HB9A 4TYWA 1ODSA 3U44B 5DI9A 1Z16A 5EWLB 3KCNA 2Z2IA 3T9FA 1T10A 2B8JA 2ZJ1A 3UMCA 2CD9A 4LJLA 4M53A 1PF7E 2BMEA 2EFEB 3FPCA 4LNUA 1G98A 3G0IA 4PC2A 4QDJA 3EWSA 5CYFA 1P75A 2H5JA 4RVDA 4LJSA 4HJRA 4MAAA 4QIHA 1JKIA 2WWFA 1ZESA 2JFNA 5DV9A 1IDOA 2ZYHA 3PNSA 3UGTA 4ZCIA 4BO6A 1GUBA 2FN9A 4PGAA 2CT8A 4B82A 4C6HA 4PC3A 2IU0A 4JC8A 1AU9A 4DIDA 5KTKA 4INAA 3LUBA 3Q7RA 4DDKA 4IDOA 1XO1A 2IOYA 3BN3A 4X71A 5B5SA 2O8EB 1E1NA 2POQX 1N8SA 3GZNA 3TUIC 3VR5H 3AYXB 5I8WA 1BO6A 2BM0A 2BEUA 1G6HA 4RABA 5EE0A 4DIEA 2GVDC 1Q6YA 1C1DB 1RQ2A 2A1TR 3LBNA 1DFHA 3AUJB 1B0ZA 2BI8A 3LOPA 4IZIA 1KY2A 1E6KA 2I6FA 2I87A 1GQYA 2QL6A 1LW7A 5U1PA 2CZGA 1COZA 3SX0A 2O1WA 2WV7A 1XBTA 3DL7A 3IXLA 1HE3A 3GZTB 4M8LA 1MN6A 6ADHA 1Z17A 1TIBA 2GCEA 2ARKA 2XXBA 3H7IA 4LGMA 3PTZA 4RQBA 4ENRA 4L9AA 1TZBA 2DY1A 2MTBA 2ZB7A 3A6HA 3H5LA 1GAXA 1GL6A 5LZ2A 1IU9A 4N8EA 2NQ8A 4OAQA 2JLZA 2QTBA 2PRSA 3E61A 1KAGA 1BVUA 4Q1VA 4DEYA 5AVVA 2Y93A 3GDFA 4LWZA 5K3EA 2D74A 2YWCA 1Y5IA 1U0GA 4Y9UA 1EFLA 5IH7A 4JL6A 4Y9RA 3CVXA 3A4NA 3KQSA 4NCBA 5CDFE 1TIKA 1X87A 3W2TA 1V6SA 3WGIA 4R6WA 2DX7A 2FN4A 3ZW8A 5DBGA 4NZMA 2YFQA 2L2QA 4P31A 2RG7A 2YWJA 3D0RA 4AQ7A 3HMQA 1WMAA 4FDTA 4TLAA 2RG1A 3WDLA 2CUZA 2V7QD 4U7GA 1L4UA 3FCOA 3HWSA 2XH8A 3M3PA 4N4AA 4W5JA 5DHTA 2EFJA 2V03A 1GNPA 3QMVA 4FWIB 4I8XA 4GX2A 4R71A 4UBNA 4RY2A 3VYTB 4FILA 2JIRA 4CHTA 2MSDB 4DG9A 2OG2A 4PNPA 3HRKA 1QKJA 2RONA 1KPHA 3OZWA 3TKYA 3FWKA 2FTKE 4L0QA 4M8NE 4J8PA 1T8TA 4PRZA 4S2UA 2WWVD 2COUA 4BX2A 1MEJA 4GKJB 5AUNB 3C3DA 4XZ3A 2CL0X 3O8OB 4LRWA 5K8UA 3FPBA 3AKDA 2WYUA 3WIDA 2WTUA 9MHTA 3ETEA 1U3WA 3AKZA 3PC8C 4XA8A 1X1BA 3RS0A 3CRQA 2Q5HA 3V5NA 1A1VA 1JR6A 4BVHA 1JEYB 4HVLA 4QKQA 4XW2A 4AJNA 2GKOA 3ESDA 4CIVA 3TLMA 1N3YA 3UF0A 1MGPA 2BLNA 5GJVC 3IFSA 4B3FX 2R1TB 3KU1A 4KAFA 1UANA 1UOPA 2NZYA 1CS0B 3GFBA 1CVLA 3W2GA 5I5GA 1I7PA 1G9SA 1U2EA 2G80A 2YHIB 3ME5A 5G0UA 4EPTA 4EYQA 3IKJA 2GB4A 3RYIA 4DBVO 3A6KA 4KLAA 2JIDA 1CU1A 4YFVA 4WK2B 3RKUA 1LPAB 1SOWA 5ALLA 2GZDA 4WFJA 1K88A 1AK1A 1K6MA 2AFRA 4C7XA 3MJFA 4M7RA 1GUDA 5TMBA 4ZOQI 3ILXA 1GWNA 4PLVA 2FJPA 1S2DA 2N9UA 2OLKA 1U7PA 3KFLA 4G0NA 3EVGA 4QG3A 1OGJA 1W0JD 3PX7A 1SGWA 3S44A 4QGSA 4U9UA 1I1QB 1SC9A 1EIZA 2VNJA 1XLVA 3E0XA 2ATIA 4L6CA 4PSUA 1XZEA 5KYVA 2H54A 1Z0UA 2BC9A 2WFLB 4U2FA 4MI6A 3C45A 1SKQA 5JD3A 3VNBA 4EI2A 3EZ9A 3DJFA 5KC9A 1R0ZA 3UAWA 2IE0A 4HXGA 3MRXA 1NFRA 5T3UA 4OKIA 5IC4A 5JR3A 2NN3C 5DE3A 3O8LA 3H3XA 4CV0A 4RA6A 3NNNA 2EZTA 1U9IC 1VJCA 2KJQA 4QODA 5EZ6B 1U0TA 4RF2A 3ADPA 1RIIA 1JALA 4K40A 2ZIXA 4H3SA 1OXBB 2R8OA 4HMOA 4UXJA 1UP6A 1UIRA 1Q6ZA 3PGMA 3O2QB 3W78A 3O7MA 2KLHA 3G8YA 4NTZA 3JYLA 3K20A 4EUFA 2R3SA 4FK8A 1ACJA 3AT1A 5JQWA 4HUJA 4HTFB 1MU0A 1QHHB 4FB4A 3TGWA 4UBJA 2PUTA 4YJHA 5K6AC 1XNJA 1DG3A 1V16A 3EXIA 1FYWA 1OI3A 4I50F 5ELXA 1UCFA 3KPJA 4TWIA 1J25A 4DBZA 1G5IA 4O1HA 1PZGA 1S9DA 2VA9A 4YHBA 5AM1A 1CRZA 1F3OA 2HA3A 4EBFA 2R8EA 3F71A 4KFUA 4CT5A 1KDRA 4M86A 3A06A 3NG1A 4I50B 5CJ2A 1GPNA 3HRIA 5BYJA 1ZYUA 4MPPA 4LFCB 2OBMA 3CEHA 3UM9A 4DCCA 4RLFA 1Z18A 3DL2A 1K8QA 1EM8A 1OUMA 1U65A 2HRBA 1PZMA 2VP9A 2YWDA 3OESA 4J90A 5KPDA 3O82A 3RT7A 2H6EA 5GGYA 4KRXA 4CV3A 4TVBA 4M1KA 3UG6A 2Q45A 2A4MA 3MINB 3TS1A 1E0SA 3WHIA 1JBKA 2JLAA 3I30X 3JQFA 2P9HA 2XD9A 4MKXA 4QT0A 1UBMS 3LP5A 5K51A 3DP9A 3NHYA 3TZKA 4LFBB 3B48A 3ZYZA 2P27A 3KR2A 2GHIA 1I7SB 3AYZB 3NEYA 3P2OA 1KEVA 2H65A 4HEA6 4DJTA 1QOPB 4V24A 1XDWA 1OYYA 3BF8A 1RJGA 2A7XA 1N2IA 4OFWA 2YXLA 2A3RA 4F46A 5JDCA 4N0DA 3HB1A 1FF9A 4I1SA 4PAWA 2GAFA 3GLQA 1P29A 1CIPA 2E6KA 4NMXB 2PZJA 4HXFB 4BLQA 2REQB 3BPSA 1L3IA 2QZJA 3VZRA 2OGWA 5A4DA 3PTAA 3MTEA 2P9BA 4C07A 4K0RA 1Z36A 1H4SA 4P35A 1UKEA 2X0FA 4C0HA 5J2TA 3P2IA 3V4LA 2YHUA 3SCZA 4NBKA 4UHDA 1G3QA 5HE9A 3O31A 3BFXA 3WHPA 2QN2A 5KMGA 3T5AA 2AOUA 1NKSA 3L4JA 2V7XA 1IAQA 1F6DA 3SHQA 5F1KA 3PRHA 1XMVA 4J9VA 3TD6A 4LXXA 1SCNE 1H6CA 1IG0A 2VF7A 4W5TA 4NY1A 1YNOA 4B40A 2I78A 3OD5A 4I36A 2RH9B 4KBFA 1LW6E 2VTEA 4TTTS 3VXKA 2B78A 2XQGA 2E5WA 3KIPA 1DADA 2F4VB 3NJ4A 3M9LA 1V6CA 1UZAA 3ZCUA 3F46A 5D5QA 3H6HA 4K6MA 1N4AA 1A69A 2C7RA 1Z0AA 1P2FA 5A7HA 3Q8WA 4KJXA 4ZVUA 5FX2A 3RADC 2FG6C 3OWXA 4YTEA 4HD8A 1Z5PA 3B60A 5BOVA 1IXSB 1ZMBA 5BWBA 3EQZA 3Q40A 2MINB 4LRUA 3VO9A 4BU0A 4DWOA 4UCFA 5BSGA 1JHQA 2PZGA 1E1LA 3JZMA 2WVGA 2BHTA 5IF9A 4UVIA 2YRWA 4KQHA 1IEWA 2R62A 5DIFA 4CUZA 1ICEA 1KFEB 4NRDA 2QUAA 3H8JA 3HA3A 3JQ9A 2WRZA 4L2IB 4TS9A 3ZWKA 1UOEA 1NN3A 4F6LA 4HAZA 5I7FA 3B6KA 3QVVA 4GDMA 1JAIA 3JRNA 2WE8A 4XQEA 5T64A 4NBUA 5K03A 2VYND 3S7ZA 1LJUA 3M6WA 3ZWYA 5G40A 2C4WA 4GLFA 1IZ9A 2BGIA 3KAQA 4KE9A 2ZVPX 5AVTA 1KK3A 2FUG6 4D4IA 2FLKA 4WCVA 2PSJA 4DV4B 1NULA 1FXSA 4BRUA 4JXXA 3P5SA 3C24A 2ZWOA 4CJXA 3B3GA 1NN5A 1TKBA 4S0ZA 5IM4A 3LDGA 3LPMA 2ZRQA 2RJ3A 2WR8A 3BWCA 2J0EA 2FPRA 2WSMA 3AIKA 3UW1A 1ZL0A 2VG8A 3T8YA 4OD0A 2VN8A 1EX1A 2GXAA 4RXTA 3I9MA 1DZIA 2H11A 4BUCA 5GOTA 5BVHB 1Y3BE 3EEIA 3IOCA 1S2MA 2JFOA 3H2YA 3JVVA 4REQB 3UYLA 4CM9D 1L6RA 2A9JA 5E7IA 5L4NA 1YZTA 5MF6A 3MMZA 3I9OA 1M2HA 3VKHA 1ECFA 1RE0A 1T0PA 4GDFA 4Z4IA 1SULA 1UBNA 4PXAA 5EUMA 5HZMA 1EVLA 1MV5A 3P20A 5GV7A 5MN5A 1PGNA 2PGDA 4BWVA 4DMRA 2JL1A 4XX0B 2ODAA 4UTVA 2R79A 4JFRA 1T2UA 1AKMA 1GSHA 1XJWA 1Q0TA 2OPHA 3JD0A 4XTRA 3QF7A 2P7HA 3PFWO 4UW9A 3W6UA 1OPRA 4XCQA 4D44A 2XAAA 4J0EA 1CUSA 3C97A 3EZ7A 3FWHA 3A9RA 3MD0A 4H4DA 4RFSA 4DARA 5CDFA 4Y6SA 5HEKA 1I32A 1E1RA 4UTOA 1FRNA 2PU5A 4RK1A 2FWIA 3WL3A 1BQ3A 3DVSX 1CKEA 1CK4A 5HS4A 1FNNA 5I9LA 1CR6A 7ADHA 3CEJA 3ST7A 1J0CA 2X9VA 2I8LA 4U63A 4BZPA 1QFJA 4Q5IA 3ZJ5A 3CCCA 5ENVA 1VXRA 3FZQA 4IHJF 1RWWA 2B2CA 1KEWA 3MWYW 4KDFA 4DDWA 4FS3A 4UQLA 4EENA 1LRLA 3HLYA 4W6QA 2EWVA 4XB2A 3SDBA 1TC1A 1NBEA 1L4HA 1RIFA 1Y80A 4UNSA 4MQFB 1CUFA 2GM4A 5KWVA 4P9NA 1Z33A 3KS9A 3G2IA 4UMEA 3WRXC 3IPAA 4PS0A 4PG4A 4BECA 3HXQA 1DC3A 4KK4A 4KXQA 2QM3A 1M1YB 1BU8A 1C9YA 2XWBF 3V8PA 1GQOA 3MCWA 3PPVA 3ZZMA 1MB9A 3DTYA 3OP4A 4N82A 4UVHA 5K3CA 3RAPR 1ILEA 2NAFA 3OOWA 3ZOKA 4UMDA 2PKWA 2Q1SA 3SLKA 5IXYA 2QTLA 3KLPX 2A1IA 3IGFA 1GVHA 1UBGA 5IMSA 3K4HA 1YOBA 2C9ZA 1MXFA 2XMZA 4AZ3A 4WFQA 3C2QA 2D2VA 4KEAA 3GIDA 5BMVF 3S2UA 1R50A 3Q87B 5GJCA 4PLWA 1WHSA 2BKEA 2NG1A 1XWIA 4WK6A 1A98A 4O2BA 1CUZA 1U1GA 4H7PA 2PZMA 1ARZA 1BEZA 3ADKA 1U3GA 2ZANA 3NP9A 3OQPA 1XNRB 2VZEA 2ID8A 2QTTA 3DMGA 3UQYS 1CNEA 2DWUA 5BMVB 5CG1A 3NT2A 4YMGA 3BEOA 1LSUA 3JD4A 3VOSA 4E7OA 2CNWD 2W2KB 1Z7EA 3CF4G 2IUTA 2P9GA 3R3SA 1EVQA 3BERA 5A5GA 5FH9A 1TF5A 1ZVVA 4L4YA 3P94A 1APBA 1O6FA 2CKMA 4G2NA 1VHWA 4TXNA 4MV0A 1CULC 1AHHA 5BNZA 5KYWB 2K7FA 3LLUA 5GONA 4AKEA 3IJEB 3ZD7A 1VSBA 2CYAA 1RM0A 4L4UA 1XGKA 4E13A 4I9HA 5AWFC 4GQBA 4M0CA 3RO7A 3PQ8A 4N01A 5BRAA 4M89A 1FZTA 1DKLA 4WNIA 1C4WA 3Q7EA 1YB1A 1DRKA 3KBOA 1L5HA 4Q4JB 1W0CA 3DQQA 2KW5A 1ZI9A 3IX7A 2P6NA 3L7BA 1FP4B 5E4TA 2VUIB 4UVDA 3F5MA 2XRZA 3DFIA 1JI3A 4ZPJA 2CHEA 2CL7X 4GPBA 5SYMA 2I33A 1MJHA 1CJBA 3L0SA 4IFIA 2C98A 4RJ2A 4D6YA 5KU1A 5EESA 1EFVA 2F3TA 3RFFA 1QP0A 4EEXA 3RVLA 1U8UA 1HYEA 1SO8A 3OA0A 3SE7A 5AW4A 2O3RA 3DMTC 3EIEA 3KAJA 4TKZA 1ULAA 4XE5A 4FCVA 5E1DA 2LBPA 2W2LA 5K4GA 3UK1A 1QU3A 1HRKA 2CBGA 5DX1A 1G3MA 5DXJA 2AXEA 2C0PA 1L5MA 2GBFA 1U9ZA 2P5YA 1YL5A 3CONA 3HJRA 4KSBA 1J70A 4O8CA 5ALIA 2EW1A 1I30A 4S1NA 1CBUA 4Q15A 3UG7A 4OJNA 1BS1A 3DXXA 4EZEA 2PXXA 3B2EA 10MHA 4Q7MB 2IW1A 1OE0A 1OTYA 3L8DA 1C4KA 3HY3A 3UJ3X 1UWCA 3AL0C 5KNDA 2CZCA 4U7TB 1Y8CA 3B6EA 3QG5A 3LGAA 1D8TA 4NR0A 5E6RB 5ARDA 5C0OE 1N7HA 1B26A 2GK3A 3RG2A 3I1YA 4A27A 2WJHA 1ZH4A 1I0LA 1BKDR 1X7XA 3MN1A 4D9EA 1O0BA 3PEEA 1JZTA 5A2GA 5CDGA 3UANA 1N6LA 4KQEA 2C3YA 3MYRA 4QXMA 2HN9A 3N0XA 4D8XA 1N9GB 2FN8A 4K6FA 4W9NC 3QUAA 4E2WA 5CH5A 5HZKA 1DAIA 5KTRA 1OW3B 3F4KA 2W6JD 4LXIA 4NATA 1I3KA 1A5AB 2HOQA 2VSFA 3KZCA 2HD4A 3OJOA 4KUGA 1YZFA 2J48A 4R1OA 2SICE 2Y2UA 3FKSA 2R97A 4FZJA 1P9WA 2X4LA 1BQEA 3HBMA 4UXHA 2X40A 3A7DA 3AGPA 4Q4DA 5U4XA 2XADA 2P9EA 3D3WA 4IJKA 1M73E 3GA7A 4OYLA 2HUPA 1U9YA 3QE4A 4K2HA 4JUBA 4RD2A 4GPIB 4NULA 1PR3A 3R7BA 3HJFA 1RXSA 1CNFA 2VZ8A 1SBIA 3CSUA 4YHHB 3THWA 1TVKA 2P1ZA 2HA2A 4HC4A 3SICE 1V6AA 5HM6A 4AY6A 4EG4A 2XT9A 4LTNA 3CVUA 4YO7A 4DA7A 1HKUA 3OT1A 2RHRA 1RC1A 3IEXA 4WD3A 4FR0A 1L7EA 4EFKA 4OQFA 4W8GA 3I2FA 3FTPA 4M46A 4Q16A 4BLUA 3NB0A 2GN4A 2BH9A 3L7LA 1Z2CA 2Q2VA 3FUUA 3PWTA 1QTIA 2NVUB 5ICSA 1YIDA 4YWHA 3IP9A 2O2CA 1QVVA 1LC3A 3K1TA 3PRJA 4B9AA 4MB0A 1T4BA 4Z8XA 3DNFA 4DMMA 1NLFA 2FF7A 4LYYA 1ESZA 1D2RA 2VWQA 4RTNA 3U4GA 5BWMA 3HUFA 3DC7A 1EVJA 4BJ1A 2EFHB 2NUPA 1E9SA 4K9OA 4MB6A 4UCWA 4URWR 3FYTA 4XIFA 1JJVA 2P4QA 1K5HA 1L1EA 3RC3A 4D1YA 3HZOA 4BQPA 5BYKA 3P52A 1X80B 1E2HA 2P5UA 1GCIA 3L8FA 2Q28A 1JHPA 4WLFA 4AWXA 3FB1A 4C7OB 3D7NA 4JYBA 4CCYA 3E82A 4V0LA 1NX6A 1JB9A 1AT1A 3L0IB 5JZBA 2H2HA 2XMGA 1ZN7A 2NYRA 5K7SA 1ZGCA 2R65A 3CISA 3GRVA 3P9YA 4RHCA 1UM9B 2FOLA 8ABPA 1YCDA 2BHNA 3MHPA 4JR1A 2J9GA 2KYRA 4Q48A 2YCLA 3NDPA 3FYDA 5SZKB 5DNYB 1SCUB 2Q5FA 4XIYA 5IAEA 4XVRA 3DHVA 2D06A 3IUBA 5IEBA 2G07A 4M0UA 3G85A 3IHTA 5TEWA 1E3WB 5COAA 4YRLA 1CYDA 4UBMA 1NI5A 4AKIA 3O1HB 2X8JA 3OHMA 3IIKA 3LGSA 4CKEA 2JZNA 1JDPA 5GMOA 5A9SB 2HWYA 5IJAA 4K9SA 4QRIA 1I1NA 4ZAZA 1HTTA 1D4ZA 3NM5A 2G4VA 1GA1A 2JIPA 1KQPA 3KT6A 3BB1A 1ZUNA 2XCOA 4LCEA 3PFBA 2ZBEA 2BEWA 1SUAA 3V1NA 3BQMB 3ZNQA 5CFMA 2BI4A 3W6ZA 1SXJB 5CYPA 4QDTA 4M0MA 3JR7A 2H1FA 3I45A 4PIMA 5INTA 5JFGA 4YCMA 5JATA 4I8IA 5A02A 3NVDA 2GLTA 3ENKA 1E1DA 3OPMA 4EL0A 3HLTA 1Z22A 3I8SA 2EFYA 1Y3DE 2YNMD 2XF8A 3A70A 3E2MA 3JQ8B 1IAVA 4HT3B 3I6IA 2GD6A 5CFLA 4PZ0A 3UO8B 3QF4A 2PMDA 5K6RA 2OA0A 4XUCA 3O4VA 4J0KA 1OTXA 1GLGA 4IDDA 5JSZB 1EK2A 4MV8A 3V80A 1E3IA 1G8KA 4EO7A 1UKCA 3CLSD 1RCUA 3O93A 4BX0A 5GZ3A 3OC0A 2RGCA 1V9CA 2WHPB 3WYBA 5KNCD 3R4VA 4NBWA 3QFFA 1JPJA 1CJTC 4DXAA 4DR1B 2Z6QA 2IYOA 2F8SA 1QDUA 2HXSA 1RZRD 4KWEA 3WNZA 1SQSA 4RMIA 4CV1A 2QSUA 3AR4A 4ZT3A 3MTJA 4DJJA 3DKVA 3KELA 3P71T 1EIWA 1B76A 2Z5GA 2YH2A 3QUSA 3RHZA 3W2IA 3AR3A 4TSFD 3A6EA 3A3YA 5K0TA 2VRNA 3HKCB 5J3JA 4RTJA 2DUJA 1GADO 4EHIA 4GGOA 1W88B 1LTHR 3PS9A 4YPFA 1JEJA 1ZLXA 2VRCA 3FMIA 3Q2OA 4UFOA 2HK8A 3RNOA 1BA3A 1PBTA 5LR6A 2AVNA 2IHKA 4JJKA 1N5OX 2C54A 1XQWA 2PL3A 5D3ZA 5TGDA 1Z29A 2Z2KA 5GOZA 2FPOA 2ZRPA 2XB6A 3TE7A 2QUBA 1N5IA 3BWBA 3F5SA 4TT3A 4D9IA 3GOHA 1R8JA 4YP1A 1DRJA 2QRHA 2SHKA 3L7IA 2YV4A 3FVTA 2QRLA 3AUSA 1QJCA 1NU8A 4QASA 4R5MA 2P3LA 3BJIC 2B1GA 3KL2A 2B7CA 1P1BA 3T7AA 4ISBA 1E61A 2OGZA 3MJCA 3JD1A 4X94A 1P7ZA 4Z86A 2ZT6A 4I2NA 3MM4A 3O0DA 4LK2A 4JR2A 3HYSA 3VU0A 1DAPA 4S04A 3NBMA 3T06B 4HF7A 3OHPA 1C9NA 4NHEA 3W7BA 1H94A 2C4VA 2ZIAA 4KN8A 3RTEA 1AV6A 3ZCVA 5JZOA 2IJGX 4BO3A 3FBGA 4FT2A 2UYQA 4Y30A 1EWQA 4L50A 3ANMA 5GY7A 5KPJA 2CDCA 1YSCA 1HBJA 3EVNA 5WRFA 3QRWA 5BT9A 5IUNC 2Z2XA 3DEZA 3QHPA 4ZQBA 2ECQA 4JLJA 2WM3A 4MS4B 3LP8A 1H2HA 3RFXA 3A4MA 1TK3A 4PZYA 4XJSA 4RJKA 1DEHA 1MG5A 2I71A 5TF4A 4CG0A 4GMDA 4YRNA 1XNHA 4G97A 1E2QA 4RVUA 2GHTA 2RB5A 5IMBA 4PR3A 4DW8A 1FSZA 3BS4A 2I34A 5A6VA 1LZKA 2V7UA 1ZSNA 1OY1A 1SCBA 1U8CB 3GA0A 3CZ4A 2ZVJA 3K73O 4O4IF 1G3UA 4NJMB 4JLPA 4QBHA 4RGVA 5H70A 3BULA 1ESNA 1OHHD 1LPOA 3R6DA 3FM9A 1EZ1A 4RENA 5FLEX 1JR2A 1W4CA 2ZBPA 4EVSA 1C7QA 3L82B 5CB0A 1G19A 3ECCA 4EB6A 4O4IB 4HNUA 2V4ZA 4FINA 2H7YA 1WABA 3GFRA 4QBFA 4WZBB 3W06A 4EG5A 1IUPA 3PQ2A 5DRYA 3LIIA 2NSLA 3BIOA 3THOA 2F9FA 2GZSA 5CA0F 1PKXA 3OU7A 1FP6A 5IVIA 3TCKA 1U98A 5JRJA 4BE9A 5MFZA 4X1IB 2H07A 1KMHA 1Z06A 3EFOB 5DGCA 3T5PA 3IR5A 4FC6A 2JAWA 1N3LA 8MHTA 1DO2A 4HH4A 3HWX1 1FBNA 4Q47A 4V0SA 4EGCB 3K71B 2NGRA 5CA0B 2BT4A 3OZ7A 4OU4A 5KTMA 1WXGA 4IF4A 4YQZA 1NVVQ 2H4YA 1QB8A 3B8EA 4KL8S 1R4AA 3GDGA 4MQLA 4DE5A 4DA4A 1C3OB 3LP6A 2XDYA 1LI5A 4LXQA 2WABA 1G64A 4JP3A 2GEDA 4K9LA 4RD3A 2J3JA 1A2KC 3AL3A 2W98A 2FZ5A 4QVIA 3IXMA 3ILYA 1I3NA 3HCBA 4CKBB 1VG9B 3CKMA 4G1BA 3TSYA 5H8WA 4KDCA 1KI9A 2OORA 4YACA 2WHXA 3I2YX 1ISRA 1DAHA 1Z2OX 1KEUA 3EGVA 1W94A 3BRWD 1NMQA 2M98A 3LVFO 1NMXA 1S8FA 2NSHA 4IIYA 4TZKA 3VU9B 4CG1A 7MHTA 2JFFA 1IJBA 1R6BX 1NYQA 3R5FA 4DLZA 2YBEA 3S2ZA 4CEIA 2C5BA 3C7DB 2PX5A 3DLPX 3K2EA 1VKHA 3F5DA 3ROQA 3WNDA 2J0SA 3OHSX 1I9CA 1SCKA 2FUKA 2I2WA 3PT5A 1WKCA 2AG5A 3QKSA 1OR8A 5D3MB 3FKJA 1YCGA 4TGLA 2OYRA 5LMNB 3R5TA 1E5TA 2B37A 3RTDA 4J43A 4X66B 5A2QA 2NZWA 2BGGA 2HMWA 3L7AA 3WWDA 3GRUA 5ECYA 1FDWA 3UHAA 1ZQ1A 2VDMB 1KDYA 5GAJA 1CQWA 5TT1A 4DCJA 3IAHA 1KU6A 2P8SA 4US0R 4YCBA 3BHMA 3R8FA 2ZJ7A 3NHFA 2Q5LA 3U31A 3BUSA 3C87A 1EXMA 3VR3A 1JHZA 1U0EA 2GDJA 5DKFA 3URMA 4CMEA 4KXNA 2AZMA 4Q3AA 4ZRMA 1T2FA 2ZYVX 1NJFA 4L4ZA 2G06A 4NBRA 1EKXA 3C3CA 4TXHA 5ALRA 1XRRA 2IPLA 1IZ7A 3PE4A 2NTYC 1XEWX 3T99A 3FNFA 1NWHA 1F38A 1DG9A 1ECLA 3ZIAD 3CZ9A 2C8JA 1KI3A 1ZUHA 1PYGA 5JXHA 2P2CA 3ICEA 5LQSA 5FOXA 1JIXA 4JC0A 4CFSA 2ZITA 3U3OA 3OM1A 2WT9A 4K3VA 4GBGA 4QXRA 5HJEA 4MUHA 1DB3A 3IB3A 3V7WA 2RHJA 2RGBA 4DGQA 2UUAB 3GT0A 2R1VB 2D6FA 4A6PA 1R0SA 2AE1A 3A3NA 3BAZA 1SZJG 1FLAA 4HN9A 3QXGA 3X43A 3PEYA 1PQWA 2P6RA 4ZOCA 3BSYA 4ZC1A 1IRXA 1VZ3A 1NV8A 4B76A 3N86A 1PS8A 3AJ9A 2Y05A 4BDSA 1QQAA 2GN2A 2W71A 1T6ZA 4J1QA 4MV9A 4QNMA 4OHRA 1QIHA 3IEUA 4UQPA 2WUEA 3JQ6A 4BUZA 4DR7B 3CM0A 3BF7A 3R9XA 3V1UA 1TFRA 2DU8A 2QLJA 1RWOA 1Z56C 1E8MA 3Q7IA 1VHJA 2Y92A 1Z7YA 1FA9A 2ERCA 1OZGA 2V0NA 2LCQA 3G5LA 4H31A 4HDCA 4FZ5A 1P19A 5IC5A 3PLAE 3LCMA 1U8ZA 4ZK2A 3S27A 1AC5A 2HDNB 1Z8NA 2QVBA 3QPDA 5FI0B 3UWKA 4US2R 2QMUA 3CVVA 2D2XA 1N2BA 5EMHA 3RVKA 4BL5A 2JANA 1UBTS 1E5QA 1UINA 1QG4A 4UM7A 1VIDA 3EH2A 3GH3A 4G4SO 4LRYA 3W34A 4E31A 3QVUA 4A10A 2ZIFA 1PYDA 3A37A 3MYYA 2QS9A 3S4YA 1QQ6A 4XPZA 3TTTA 2PJUA 2B1JA 2BYTA 2CL5A 1GFWA 2AE2A 2VO1A 1BVHA 2BM1A 2DR2A 5LOVF 1AXRA 5KB3A 1DCKA 5AJVB 3ZX5A 5F77A 2QGZA 3BWYA 3G7SA 2H1SA 4H6WA 1UBRS 4ZKEA 5J4HA 2NOAA 3R0JA 3R0XA 2O23A 3IAS1 4Z9XA 1Q1NA 1ISHA 3CPSA 3IS3A 5FORA 1HO3A 3H7AA 4R3WA 3WGZA 3BFPA 2ZUSA 4YRKA 3GLIB 4KWTA 1DZ3A 3LNCA 2XB9A 5LOVB 3I39X 4C4YA 4NCHA 1W75A 2MHCA 2XGMA 1C7ZA 4MIKA 1N1GA 3U3MA 4MWSA 2YZKA 2VK4A 3SPXA 3BK2A 1TECE 3UHPA 4BMZA 2CSXA 3BE4A 3QTBA 4LHXA 1F2VA 1EUZA 3HYCA 2FZCA 1R00A 3EGWA 3LA6A 4FR5A 4B46A 3CYFA 2NYVA 2WJ6A 3NV9A 3L1JA 2EIXA 2AGVA 5TJHA 3DUFA 4F6CA 1IBCA 2NO6A 4XUEA 3OC6A 4B87A 2ZJ8A 4P8RA 2XZTA 3OZUA 2J9YB 4IS2A 2X0IA 3SG0A 1JHUA 3O95A 1EVEA 1QVZA 1Z7BA 3B7WA 1Y1PA 2I7XA 2EYQA 3EF0A 3I2KA 2W6PA 1UWKA 1DJNA 3K05A 3QQPA 4A2QA 4PXSA 3WX0A 1RRGA 5K09A 1IOZA 2EJTA 1CYEA 2QKYA 3D8BA 2ZQ5A 4Q9NA 1GNVA 4V0ME 4A4DA 3ZI4A 4M0FA 1YTUA 2IUEA 5FI3A 2CLFB 4M1TA 4BBJA 2FSFA 4CL2A 1T8PA 1CT9A 2B1IA 5FAXA 5JUWA 4HX5A 4TM7A 1QAMA 1PJ8A 3ASZA 4EVRA 1P9OA 3WB0A 1SKYE 1NLUA 2O3QA 5EIFA 3V1TC 4HH3C 3LZCA 1Z3IX 4HPXB 1QHIA 3ABOB 4IO0A 4DQ0A