1BYIA

Structure of apo-dethiobiotin synthase at 0.97 angstroms resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of dethiobiotin synthetase at 0.97 A resolution.
pubmed doi rcsb
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHASE
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1byiA00
3K70D 5BN5A 3PV0A 3B60A 2JLYA 5KDDA 3PEVA 2WJJA 1AS3A 2NGRA 3BAFA 3QEJA 5FBQB 3GFPA 1KSGA 2J7PA 2WIBA 3KXIA 4CEHB 3FB4A 3LW7A 4JVLA 4QHYA 1LNZA 5C18A 4B76A 5JHGB 1QG4A 2HF9A 3EIEA 2C9OA 4LHZA 4HB0A 3X1DA 2CJWB 2IYXA 1NVVQ 2XZOA 3OFND 2ZRGA 4HAYA 3G82C 1S4QA 3TW4A 4N0EA 2H92A 3BBPA 1YR8A 1YR7A 2F6RA 2OSBA 4N1AA 3M1IA 2GVZC 4HLUA 1YZGA 4PAQA 3NDBB 1A2BA 2DR3A 1GNRA 2VHCA 1Q3TA 3MLEA 2DFNA 4IVRA 3C4JA 5FOTA 5K8TA 4NCHA 3BD9A 1FW6A 3NKVA 4PHHA 1RJ9A 2FPKA 3UK6A 1E1RD 1U9IC 3JZMA 3Q3JB 3TGPA 1ZM9A 2KI5A 3ZH9B 2XZPA 5EP2A 3OZXA 2OBLA 2EFCB 4TT3D 4AC9A 4MRSA 5GJWC 4GOXA 1MABB 1QBKC 2KSQA 1UBGA 3K0AA 2Q9AA 3LXXA 4Q4AA 3LA6A 3GFOA 3AVVA 4EFNA 5E7JA 5HCIA 5FL7A 2VSXA 3WNDA 4ZIRA 1KO4A 3DO6A 4ASUA 2ORVA 5IK2D 2FF7A 2ZJZA 3ZYCA 4WZAE 1Z2AA 2C04A 4UXIA 3CNOA 3W3AA 5SZHB 1CIPA 1XWIA 3NC1C 5EE1A 3EX7C 5JMTA 1E1RA 1S1CA 4JLOA 1YU9A 5JWOA 3QG5A 1VG1A 4I99A 3RRYA 4CVNA 5D3MA 1G9XA 4FN5A 3G5UA 4HSEA 2V7QA 3MWJA 1VMAA 2W6ID 2ORWA 2XJ9A 1N6NA 1VHLA 2RGEA 3IO3A 5GVSA 1N5KA 2IYRA 1CR2A 1WQ1R 2IEZA 2XJ4A 4KU4A 2ONJA 2XTMA 2XAUA 1G5PA 2Q9BA 1IJFA 3B13B 4HDOB 3W8NA 5CM9C 3ZZ0A 1W47A 3CR7A 1W0KA 4D0LB 4DUGA 3TQCA 2OM2A 1CR4A 2VPPA 2G9NA 1VCOA 2FPMA 4PX9A 4BGDA 1ZC4A 4CDGA 3R8CA 3U6BA 3DVLA 1DPFA 4IXMA 5EP3A 5JRZA 1O87A 5B57C 4B44A 1MOZA 2QMOA 5C1BA 1E2FA 1W46A 1EK0A 4WZBE 2FGJA 2Z4SA 2BIFA 1BKDR 2XGJA 2CHGA 2WSSA 1NVUQ 2CE7A 5GJCA 2IWRA 3IO5A 1RE0A 1H8EA 2DY1A 3IDQA 1MH1A 4FMCB 1TUIA 4OI2A 1WB9A 1XJ0A 4NP6A 3X1WA 2RGNA 4JSTA 1VDZA 1D8TA 4Q1EA 4OI4A 1AS2A 3I92A 5IK2A 2HXYA 3FMIA 1RFLA 2FN4A 2R2AA 1YHNA 1PUJA 2RB4A 5K8LA 3QXHA 1Z07A 2I4IA 2ODBA 2JLUA 4Q7LA 2J9RA 2OBNA 4KVAA 1CLUA 5EJEA 2ODNA 5G41A 2P5TB 1II8A 1GFIA 3THYB 1KJWA 1G64A 2IYWA 2ZE8A 3A1WA 3PENA 1MV5A 5G53C 1TU3A 4NYMQ 2O8CA 4Q1BA 5AR1A 3OEHA 1OB2A 1EFRA 1E0SA 4HAWA 2VHUA 4OQFA 5CIQA 5AK0A 4GOKA 1KIMA 2GHIA 4ZO4A 3PJRA 5KSZA 2WWYA 2BV3A 3CF2A 3RS4A 5C4GB 1H65A 2ZITA 5L8VA 2JIZD 4O2LA 3FMOB 2YOHA 1WMSA 4JVSB 4C0HA 4DCTA 2GEDA 1N25A 2CBZA 4IXNA 2G3YA 1ZD8A 1KDOA 2O0HA 4G01B 4L4UA 2O8EB 3EZ7A 2HEIA 2ZRCA 3PR1A 2RMKA 1TAGA 4ZCIA 3UMRA 4M53A 1WBDA 3D6TB 2OZEA 2XOKA 3KL4A 3WHKA 2R6AA 2EFEB 3ZVRA 3GJ4A 2UVQA 3LLMA 1EWQA 1M7BA 2ZANA 4HUQB 4XSGA 1D2EA 3NIBA 4ZPXA 1Z47A 1N6IA 2GK7A 2CNWA 3O8BA 4TTQA 3GLGE 4LJYA 4V0OA 1OXUA 3RWOA 2UZIR 4PSKA 1VHTA 1VCIA 1PLJA 3KKMA 4Q4JB 1UBCA 3GJ7A 4JKYA 4URZR 3THWA 3BC1A 5JSZB 4HZUA 4C0JA 2V9PA 1E1QD 821PA 1EFRD 3V9PA 1ANKA 2P2LA 4HAUA 5DSZA 4MKFA 4NCNA 3CRW1 2B92A 4DLTA 1MO5A 1HUQA 2JGNA 5IRCD 3LY5A 5CJ2A 4DLXA 5EZ6B 1U0JA 1UEJA 5AJWA 3K70C 1E9FA 1J2JA 3HYTA 2AD5A 4CEIB 4OHYA 4OJKA 1KNQA 4ZKEA 3IGFA 3KKQA 3GLIB 1E4YA 1MRNA 2IS4A 3QBVA 4KITB 3QNUA 3QJYA 1XXHB 1PZNA 3GEIA 3KTAB 2OCPA 5L3RA 2J7KA 4D6PA 4GNKA 5CLQA 1ZUHA 4L9WA 3EG5A 2IHBA 4Q5IA 2REOA 1CJUC 2QGZA 1NN5A 2ASEA 1P73A 2D62A 2VBCA 1KTVA 3X1ZA 4TQUS 1D2MA 1AK2A 3VR2A 1OXSC 4Y0AA 2J41A 5JCZA 4R7ZA 4HI0E 3CKLA 4OJQA 421PA 3KTAA 4V03A 1G8GA 1IN5A 1CBUA 1DELA 3U3KA 5KO2A 1CTQA 2ANCA 1ESMA 2VIIA 2GVDC 3DMNA 1X3SA 2CHQA 1XD9A 3Q8XB 4TQAA 2RGNC 1HEIA 1R5NA 3K0EA 3JVUA 1TX4B 3QBTA 4C0QC 2QMUA 5FTNA 2ZI3A 6Q21A 4WA7A 5GJVC 2JAQA 2Z4RA 5AUOB 3H1TA 2VYFA 1KYIA 1NBME 1E2EA 3VKGA 5KOYA 5TB5A 3BIFA 3R8FA 2CNWD 3SYKA 1RRPA 3AVPA 1T0HB 2RGDA 3U3JA 2I1QA 4Q18A 3OHMA 4B2LA 2JLZA 5LB2A 3I32A 3LFUA 2ZUDA 5HR5A 3KFVA 1XX6A 2C77A 4IW3B 2HUPA 1N6OA 2Q6TA 4MRRA 4FWTA 3VKWA 2QT1A 5F2EA 2QZ4A 1Z08A 2H57A 2ZJBA 2R65A 4Q1FA 4NKRA 4LBWA 3RS3A 1DE0A 1G18A 3H0KA 1AA9A 3K53A 1G291 4MQBA 3I62A 1OW3B 3DMDA 4IKEA 4E07A 1K6MA 1KOFA 2GILA 3K70B 2RGBA 2JJ1D 4KFSA 4DLZA 4BLTA 2BBSA 2VTKA 1A82A 1OHHD 2A5YB 2XNSA 1BMFD 2H16A 2C96A 4V0KA 4MYUA 1NSFA 4D4KA 1JNYA 3T1QA 2QQ0A 1EG7A 1AGRA 2J45A 4M9XA 4U02A 2O8DA 3SR0A 1KHTA 2BMDA 3B8HA 3AVYA 4KYIB 1NMZA 3N70A 4TMWA 4KJZA 5DYIA 5FUXA 3RNLA 1E9RA 4CEHA 4BFSA 3GLHA 3U7HB 4XH9B 3SNHA 2JASA 4BFVA 1XU4A 4ZKDA 1P9NA 2F3TA 2FJUA 3I8SA 4Q02A 4QL3A 2QP4A 3UMFA 1XF9A 2HYIC 2O8DB 1Q12A 1Q1QA 1RYFA 5KPDA 4MDEA 1Q22A 5JS8A 3GQBA 5DO9A 5JJLA 1JQLB 4L15A 4JJZA 1N2CE 4HLUC 4WXRA 4M1YA 3BGWA 1S3GA 2J59A 4Q7KA 4D26A 2GBLA 1HA3A 1FQKA 1TNDA 2HDNB 3DZDA 3GJ5A 5IDVA 1IM2A 3RLFA 3GLHE 3RVBA 1KMHA 3CW2A 4CEJA 2Z83A 2IYUA 4BZPA 2IS6A 3ZVNA 5KNCA 4OHXA 4A82A 3NEJA 1F2TB 1XD2B 4Q1CA 5C2JB 4HB4A 4UKDA 5FR1A 2W6IA 1S0UA 3TW8B 4YMVA 1DAKA 5B58C 2PL3A 1X1SA 1JPNA 2IBMA 3FGNA 2IW3A 1CULC 1UJ2A 4ACBA 3I5YA 2VF7A 4OHWA 2ZR7A 2BOVA 2GZAA 2WPDD 1OB5A 4OI1A 3LBIA 2D7CA 2GXQA 4TMVA 5FH9A 3GCGA 1UM8A 4NDZA 4PC6A 5E4FA 1OE0A 1FX0A 4JLBA 2YKGA 1P62B 3WMFA 1JJVA 4OK5A 3EAQA 3FMFA 3M6AA 4MKIA 5FPSA 3TVTA 2ZS8A 2NO6A 3AH8A 1GKYA 3GFTA 2IL1A 1OYWA 1DBSA 3GJ3A 1G8YA 2A2ZA 4LV6A 3HPQA 4NL4H 4A0FA 1AJEA 3V4FA 4C3ZA 1KI3A 3O8RA 1Z29A 4JLMA 4DT1A 1R5OA 1HTWA 1G7TA 3U3OA 5L3SA 1IQPA 3MD0A 2BBTA 1G3UA 4A8JA 1EX7A 1G5RA 4MRPA 1E9DA 1K8RA 2GXSA 4I1OA 2ZRJA 4P4SA 4EUNA 1JXOA 2V4ZA 4EJSC 2RGXA 3TKLA 3KUCA 4KYUA 5KTYA 3P1JA 3GLFA 1DS6A 1W4BA 2ZRNA 4QNRA 2YC2C 1Z3IX 1S3SA 3BFXA 4JSYA 1OHHA 5BXQC 2X2EA 3IEUA 3Q7PA 2FMXA 5FTKA 3GLGA 3CONA 3P26A 5J4HA 1CJKC 3C7KA 2XITA 1E9EA 4GMXA 4Q48A 3TIFA 3CX6A 3O47A 4UQOA 1U90A 5BN4A 5KDOA 3B1YA 3ZQJA 1W44A 8OHMA 4NCIA 4MA4A 1N6LA 1IXRC 1SVMA 2J0SA 1OSNA 4QHTA 2WWFA 1Q21A 4PO1A 1KK0A 2W00A 2BMFA 1Z28A 2KBFA 2DWPA 4IRUB 4U7DA 3NTUA 1N6KA 3OF5A 4HAXA 3PIRA 4ASUD 2O8FA 1VTKA 1XTIA 4CW7A 1ZYUA 2BC9A 4DRZA 4ESVA 1SXJD 3FHOA 3QKSB 3GJXC 4RKEA 1JALA 1EXMA 3K09A 2PEZA 2O5VA 2QE7A 1OYYA 3ZZTA 4UNNA 2WMNB 4UXHA 5JZVA 2ZRIA 1R0WA 3TBKA 3WMEA 1I2MA 2LKDA 1G3IA 4QGGA 4YQFA 1IOZA 1QVAA 1M7GA 3W90A 1XD8A 4OHZA 3KQNA 4BFUA 2ERYA 2GJKA 3AKCA 2K5UA 5L3QB 4IDPA 1KJYA 3DM9B 1F3OA 1SHZA 2BKUA 2P0EA 4LYAA 5JI3E 5GADl 4B3GA 3K1JA 2O8FB 5K8IA 3A1SA 5ANRB 3AB3A 4H9GA 5CK5A 2ZEJA 4G0NA 1LV7A 1G16A 1XZPA 2B6HA 4HAVA 5AJYA 4YXWA 3CH4B 3LWNA 5HTKA 5SZJA 4AI6A 2PZFA 3ETLA 3PXGA 4F93B 1SVSA 1LS6A 4LC1A 3BK7A 4AURA 1FPMA 1XZQA 2IA5A 3GD7A 2REXB 3QKRB 2W2TA 4M21A 1TMKA 3WYFA 4LJ9A 4B71A 1CRPA 3KJHA 4AYXA 1JEEA 2QPOA 2VEDA 5FUYA 4CT5A 3E5HA 1XEFA 3OIUA 3UMSA 1SVWA 5EUMA 1M1YE 4MRVA 4DEYA 2GK6A 4KBFA 4LK2A 1KNXA 4DCSA 3MCAA 2ZRPA 3U5ZB 1G5TA 1SVLA 2EFHB 1T6NA 5CIWA 2ZSEA 1W36D 3E70C 3TSOA 4MKGA 3W5JA 3LVRE 5KUTA 2A5GA 2CE2X 5CB8A 1GKIA 3I72A 3TK1A 1FMJA 2FX3A 4DLVA 2QTHA 3O8DA 2EFDB 3CRVA 1UPTA 2AK3A 3IIKA 1PLLA 2JJ2A 2VLIA 2BWJA 3CRRA 2CEAA 1RJ9B 2C98A 2XNDA 1XTKA 1ODFA 3MWLA 5EP1A 3OIWA 3RABA 1ZRHA 1KZ7B 5F9HA 4F91B 1LB1B 1IXSB 3EPLA 2QAGB 3EXAA 1X1RA 3U7FB 2Z5FA 1BO6A 4XTRA 1KO5A 3U6KA 2V1UA 4AG6A 4BRUA 4CEJB 1DADA 2YVUA 1KO8A 1U2RA 4TLDA 3WHLA 3TQFA 2E87A 5CITA 2QMHA 5JBQA 1XEWY 3VNUA 3HPRA 3U4QB 1AZTA 1G7RA 1QDEA 1WRBA 2A78A 4QFMA 3RHFA 5IHPA 3BB1A 1KK1A 5H68A 4B73A 4LUCA 3ICEA 4MUBA 2GCNA 1DO2A 1JECA 3VX4A 1BOFA 2C2HA 2VP6A 2PX0A 2ZVQX 1M2OB 1C4OA 4LBZA 4QJ5A 4XD7D 4NH0A 5DGXA 3SN6A 4LHYA 3CZPA 4P0TA 3FVQA 5FBWB 1KKMA 2OEPA 2BCJQ 2ECKA 3TUZC 1GP2A 2OFOA 3QKSA 4QHSA 4PHGA 1PJRA 2QE7D 3WNCA 2REBA 3CUEF 4M1TA 1P75A 5FOSA 2X1VA 5F3WB 1W4AA 2ZRFA 1VCMA 2I3BA 1Z5ZA 2QROA 4JL5A 3WYGA 3BE4A 2VQSA 1ZP6A 3H4MA 4JLVA 3WP1B 4II7A 4F38A 2WTUA 5HZKA 2QSYA 2W6JD 3KXKA 1KY3A 4TSFA 1ZINA 2RHMA 4OK3A 4EPXA 1XCGB 2GAAA 2XOKD 1IN4A 1DARA 1TADA 3IPYA 4P4SB 4Z1MD 2JLWA 2YZ2A 3GJ0A 5CLLA 4RD1A 1NN3A 2VSOA 2Q0HA 1NIPA 1TQ4A 1ELOA 3Q5DA 4LPKA 3NBXX 3LRPA 1SHKA 3WXMA 3AF1A 3Q7QA 4ON9A 1HT1E 4PC3A 3P4YA 1PLKA 5FUVA 3RSLA 3W3ZB 4BECA 4TYYA 3P32A 3AVXA 1NMXA 3DOEA 3KKNA 2NO0A 1S2MA 3QXJA 1BMFA 1ZNWA 3RDPA 4QGHA 4X8LA 3AUXA 4PZLA 4JBWA 4ZI2A 1C1YA 4ARZB 1CXZA 1Z2CA 3B7GA 1SVIA 1ZJ6A 1RYHA 4YMSA 2AL7A 3HU3A 4JBYA 4EJSB 4MUAA 1W4CA 4B2IA 2V3CC 5FL3A 1JR3E 1UKZA 4D4LA 1CJVC 1E3MA 1GWNA 1GZSA 3AGPA 5TMPA 1YR6A 3DKPA 4A8JC 4DLUA 1XJQA 4DSOA 1ETUA 3VAAA 5FI1B 5EE0A 3FKSA 1GL9B 2WVJA 2P5SA 3C41J 2R6FA 3ZGXA 3SS8A 2G6BA 2WKPA 4MH0R 3BB3A 4UNQA 3CO5A 2O8BB 1N0UA 3AVOA 1OIWA 4JLJA 2FZ4A 3GEEA 2PH1A 3F3YA 3KUDA 4DB2A 2V8OA 1FTSA 3MFYA 2IYLD 4G1UC 2H17A 3EWSA 5EE5B 4A2QA 2ZUCA 4Q1DA 3OEEA 2G1KA 5FOWA 3TJZA 1GKUB 4XTCS 5J47A 2ZREA 2ZRDA 3I61A 2IEYA 4TL9A 4EPVA 1OH7A 4MGIR 4LV5B 1TUEA 2NOAA 3K0FA 3TE6A 1RC8A 3ONWA 3GJ8A 3FWYA 3REGA 5DIFA 4EPYA 1L4UA 3AF0A 1MABA 2O52A 3EWAA 3L2OB 4AKGA 2ZE5A 4HLQB 2NQ2C 2GCOB 5FFMA 1E2IA 3J81k 4LY6A 4TL8A 3IEVA 2VRWA 1Z6XA 3BFKA 3SI7A 2WIAA 4TYWA 3RWMB 3T06B 3S1AA 1YZLA 3PQCA 1GUAA 3VU9A 5A0FA 3W9YA 3DL0A 3OESA 2HJGA 4GI7A 2XB2A 1SKYE 5J4KA 3VNVA 1GL7A 4J0QA 3U3RA 1SKYB 2FSHA 3NBYC 2QU8A 1W4RA 4Q19A 4LGMA 2CLSA 2QQEA 4N3NA 1K5DA 1EFCA 4S35A 2IUTA 5FL7D 4DDVA 5JWHA 2OAP1 3HYRA 2XEXA 2PX3A 1DAGA 2QBYB 2WWHA 1GM5A 3TAUA 3CPHA 4DLWA 5TY0A 3MMPA 3TMKA 1F60A 4FW9A 2NIPA 1AGPA 3DM5A 1G1MA 3VTKA 3HDTA 2BMJA 2F43A 3K0CA 3AP2A 2QMEA 4HATA 3MWYW 4Z1MA 2J0UB 4URWR 3AKDA 4O3MA 1IY2A 1MO3A 1XCPA 1ZM3A 4ZDJA 2ORIA 4GZLA 4EIWA 5IT5A 3SJAA 1E2QA 2ZYUX 1TQ2A 4RZ3A 1YE8A 4B35A 2IWHA 3EPKA 4RY2A 2OXCA 4WXPA 4KVGA 3D8BA 2JLRA 3EIQA 4A0HA 3UPUA 5FPYA 4JT4A 4KI0A 5EQTA 4ESHA 3A36A 5JWRA 4HLCA 2VO1A 2EYQA 1E2LA 1GILA 2E9SA 4FINA 2BMEA 4DCUA 5FTMA 1LVGA 4GMDA 4YDSA 4XIGS 3HWSA 1J99A 4YMUA 5KSOA 3HR7A 1XXHE 3OAAD 3B5JA 1SXJB 4LC0A 4DWJA 1Z06A 4TLCA 1NRJB 2AR7A 1W48A 2FH5B 1KY2A 1E2GA 3U7GA 4P33A 1COWA 3LD9A 4URVR 2MMCA 4Z51A 5KU1A 1DG3A 4URXR 1QHYA 1QHGA 4PXAA 4DB4A 1N0VC 1OFHA 2GCOA 2VHJA 2WOJA 4IDOA 4P31A 4XVRA 2ZM5A 3IQXA 1EX6A 1MO6A 4GP7A 1XEXB 4QBIA 4Q9LA 4WZ6A 1G3RA 2A3RA 3QXSA 4DKXA 5EXTA 5J4YA 1B0UA 3LX5A 3VU9B 1A2KC 1QHHA 1XTQA 1DVRA 5CM8B 1XXHA 1VYVA 4LJ8A 2PLFA 1OFUX 2EQBA 2MMGA 2C5LA 1HQYE 3EZ9A 3H86A 1VG9B 2P6RA 1Z8FA 2G77B 2NZ8A 1CRQA 2QI9C 4BFTA 3THOA 4F4CA 3AEZA 1KI9A 3AV0B 2AWNA 5TDHA 2QAGA 2FDCA 4QGFA 4JLDA 1I4LD 1XMJA 4B3DA 1R7RA 4PAMA 5B64A 4DDTA 4FWIB 2ZSFA 2D2FA 4DUGD 1LS1A 4L8GA 1P2SA 1LW7A 3MSXA 4LI0A 4DXAA 4KSCA 1P5ZB 1YKSA 3GEHA 3QF4A 4H1VA 2V7QD 4BLPA 1XEXA 3DDCA 4LV8B 1T8UA 4I1VA 5DI9A 2WJGA 2HJVA 3QVVA 4UXJA 4C2TA 3WY9A 4BPBA 4XWKA 4IDQA 4BFZA 2AD1A 1GAJA 1UEIA 2ZRMA 3CX8A 1A4RA 4Q4AB 3CB4A 3WYAA 4LHXA 4O0MA 1KAGA 2PEYA 4IVPA 1QZXA 1A1VA 3WMGA 2H7VA 3A8TA 3LX8A 4WBSA 1FUUA 2X8AA 4AIIA 2B21A 1KI7A 4U5XA 4ZDKA 1TF7A 3B6EA 1NVXQ 4PANA 4RFSB 4DVGA 3THXB 2GXAA 2JLVA 3TH5A 3TLXA 1NMYA 3HR8A 2QENA 1P7CA 3NG1A 4HB3A 3A1TA 2B7CA 4CT4B 3QG1A 3KKPA 1W2GA 2ZRBA 2VP4A 3LQRA 3QPWA 4XSHA 1WBBA 1ZNYA 3Q9LA 2TMKA 3R7WA 2ZJ5A 3ASZA 4D4MA 4AYTA 1QF9A 1NJFA 2HT1A 3OFNA 1ZC3A 2CMKA 3PUYA 1RKBA 2WAXA 1IN6A 2PCLA 3KB1A 4TL6A 1XP8A 2J87A 5D3QA 2XNDD 3T12A 2IYZA 3B78A 3H2YA 4IFBA 3ND8A 5GJBA 4M1MA 4LX0A 1W7AA 3GLHB 1E9AA 3UG7A 2JLXA 4JVNA 3GLFB 3QIAA 4KSBA 3TVDA 2VP5A 3LBNA 4K81B 4BRWA 2W0SA 3P27A 4FI3C 2AFIE 4PR0A 4C9BA 2ZI4A 4BASA 4DDUA 1XMVA 1NLYA 2QM7A 4G5SA 4YC7A 5F9FA 5JRJA 2Q21A 1IN8A 1W1WA 4Z8XA 2XSZA 4IOMA 5CK4A 1CJMA 4A0RA 4B43A 2WWIA 2CL0X 1W5SA 3EA0A 4ZI3A 3ADKA 3BERA 2GZHA 4X8MA 1G8PA 2QPTA 5EZ5A 4NYIQ 2YJTD 4MITA 4MYTA 2N1BA 4PQRA 1Q44A 4PSVA 2HLDA 1GRNA 5DN6D 3EIHA 4JLAA 1OPXA 3UIEA 4B3XA 3NH6A 3UANA 4BLSA 4W5JA 2WSSD 2NZJA 1TU4A 1L4YA 4V0ME 4TZ6A 2O0KA 4A2PA 3D3QA 1E2JA 4D0NA 1NG1A 4Q4HA 1N3BA 1T9HA 1YZTA 4RCYA 3PEUA 1W36B 2WWXA 3KDSE 1YJ5A 1NBMA 4KXFB 3ZZUA 3AQ4A 3K0FB 2PJZA 4NYJR 3ZLJA 4QG7A 4QNMA 3LXRA 4MGYR 1HT2E 2FFQA 2ZYTX 1QHSA 4Z54A 3T5DA 1G3QA 3TAHA 2BM1A 3RS7A 5LPNA 4E22A 1YVDA 1G4AE 5H8WA 4KO8A 4EDHA 4F92B 3CM0A 1WA5A 3EPHA 2QGNA 3DOFA 1WCV1 2FGKA 2OE2A 4US1R 1S96A 3SFZA 2P6UA 3SJZA 3LAWA 1TPZA 3A4NA 4JT2A 4C0LA 5K8UA 1J8YF 2ZJOA 4CF7A 5JI2E 3QPUA 4I81A 3SHFA 4YMWA 5HE8A 4NCJA 4BEJA 3FOZA 5D3MB 4PPFA 1CEEA 2Q3FA 4DZZA 4TMZA 5SZKB 621PA 1G6HA 2R6DA 2ZI6A 3IHWA 3QE0A 5JEDA 3E1SA 1X86B 1CP2A 3AF4A 3L43A 4LOAA 4DLYA 2QSZA 2DCUA 1H8HD 1P9WA 2OLKA 5BN3A 1N6RA 3IKJA 5TARA 1BYIA 1UFQA 3M4YA 1XBTA 2XSZD 4R71A 2ZAMA 1UF9A 5EE3A 2GZDA 3A6PC 1Z6YA 3KXLA 3VR5A 4WVFA 2A30A 3AVTA 3CPEA 4Q03A 2HXSA 3PFIA 4RZUA 1XPOA 3CX7A 3FHCB 1F6BA 1Q0UA 3RRNA 4ARZA 2X2FA 2QA5A 4IEEA 1D9XA 2ZTSA 3EZ6A 2FPLA 4BQSA 2P3SA 3SQWA 4NE2A 3R20A 2IS2A 1OIXA 1LY1A 1X6VA 1ZAKA 3ZQ6A 4B6EA 2I1VB 3U60B 1A7JA 1P4SA 1K5GA 4LRWA 1G21E 2ZSBA 2GEVA 4OKSA 2IF0A 4ITRC 3W6NA 4PFSA 2FFBA 4M22A 3AP1A 1YZUA 3ADBA 4C7OB 1AN0A 3UATA 3CLVA 1G6OA 4UNSA 1F5NA 4ERNA 3I73A 1HE8B 1L7VC 5KPJA 1Q3HA 2WJVA 2GWHA 1KI6B 3OAAA 5LB4A 3SFVA 2WKQA 5AUNB 1KI2A 1GNPA 1NLFA 3V00A 2ZS7A 2ZYVX 1G8FA 1NLZA 1Y63A 2JIZA 2W58A 4LHVA 2AWOA 3FFAA 1P72A 2OFWA 2QAGC 1KKLA 4LZZA 3VR4A 3WBKA 1NNEA 3KJIA 1XTSA 3FYHA 3KFXA 4OYHA 5DI3B 1KAOA 4QBHA 1RRGA 2ZPTX 4QKQA 3PUZA 3I1FA 4G5GA 5DISB 3NHBA 1NG9A 4B2PA 4HZIA 2GEUA 3RSOA 3KZ1E 4C7OA 1KDRA 1U8AA 3SOPA 4Q21A 1X8KA 4DLSA 4B74A 4TWZA 2CCKA 2OILA 4G3XA 4AK9A 2FSFA 3AGQA 2PMDA 1QG2A 3RAPR 5J5CA 3ZS8A 1T91A 2H18A 4TYPA 2YWEA 4JZKA 5FBLB 2FE4A 5CYOA 2D3WA 1N5LA 2HV8A 4Q7JB 4ACAA 4W9MC 5EXPA 2ZRKA 5JECA 221PA 2ZI5A 2JCSA 4PZYA 1S9HA 1ZCBA 1G20E 4IJMA 1MRSA 1C9KA 1W49A 1SXJE 3RANA 5FPTA 4KBGA 1ZUNB 2NO1A 4Y0VA 1NP6A 4CRWB 4QJ3A 4O25A 4L5BA 4XOIA 1Z0AA 2IX3A 4FD2A 1D9ZA 4TTRA 1NN0A 4GBMA 4C30A 4AKHA 3EA5A 3CH5A 4M4SA 1EFTA 2VHQA 2XZLA 2XTNA 2MSEB 4PSAA 4WIAA 1R8SA 3AVWA 3VFDA 1FQJA 2DHRA 1Z6AA 1F2TA 1XD2A 2GF9A 3CZQA 2OG2A 4UNPA 1R2QA 2ZRHA 5F98A 1FMLA 4TMXA 3EASA 4FCWA 1GITA 4R2HA 5UKDA 3KQUA 2WV9A 2J0VA 2ZROA 1N6PA 4ILEA 4R2IA 4DSNA 4JYBA 3QKRA 4LCBA 3I8XA 3QOFA 4R98A 4AWXA 3ND9A 2BM0A 4TLEA 4CIDA 3W5IA 4UJ5A 1CS4C 2ZSDA 4G5RA 4OK6A 1G41A 3SJCA 4OQXA 2GXUA 2BCGY 1CR1A 1AKEA 4JL6A 3SDZA 4PZZA 1U98A 4BFWA 5TXGA 3QKTA 3SJBA 1GNQA 4LJ6A 2BHRA 2EVWX 2BKEA 5AJVB 521PA 2F1HA 1E94E 1T3HA 2WM9B 3Q72A 2QORA 5TV2A 3VQTA 5KHOC 1T5LA 1WF3A 3WRYC 1R5BA 2BEKA 4HDCA 4B3BA 3TSZA 2NMVA 2O8EA 2DBYA 2CK3D 3I4LA 5FOUA 4KAXA 4TSFD 2VP2A 4CYMA 4KFTA 3LO5A 4JVMA 1YZNA 2FSGA 2QT0A 3E2IA 4EPTA 3QSYA 4AY2A 2P67A 4FMDF 2IUSA 1DAHA 4GSYA 5HE9A 4BWYA 3THWB 3SQXA 2RGAA 5EE9A 2F43B 2F1RA 3UWKA 3HP1A 4G5OA 2ZXUA 1IY1A 2GCPA 2KBEA 3JZAA 1VKJA 3QENA 1XTJA 4QM6A 1E79A 1XPUA 4O2RA 5DHAA 1JAIA 4NONA 2Q9CA 3B9PA 3X1XA 2YWFA 4ZCMA 2C8VA 1YZQA 1I4DD 3TUJC 3KB2A 2QAJA 2J7PD 3B9QA 1R10A 4B48A 3T1VA 1W2HA 4DIEA 1R0YA 3BFVA 2WBLC 3U61B 3QUSA 2V1XA 1NY5A 4W5HA 2W2VA 1HH4A 2XXAA 3L8YA 1M34E 1QHXA 1OFIA 3L0OA 4DEXA 4D25A 2Z43A 3Q5EA 4K46A 3SHWA 1GG2A 2H8KA 2XB4A 5G3YA 1US8B 1E96A 1G17A 1QVRA 3T1TA 1D2NA 1TL7C 1RZ3A 1P6XA 1ZD1A 1UDXA 2VA8A 1N0WA 4KFRA 3DKVA 5AJXA 4ZDWA 2J0UA 4DHEA 5HKKD 2JDIA 5JS7A 4OL0A 1RIFA 2Q3HA 2YYZA 5L3SB 1OV4A 1SVOA 3QPVA 2DYKA 2ZIAA 5LD2B 2CL7X 3BJIC 3C8UA 2GDJA 4FIDA 5FI0B 1M74A 3K8YA 1SKQA 2AKAB 3RS5A 3MJHA 3L82B 2A9KA 3ADDA 4YONB 1UBEA 5FUWA 4M1KA 3A1VA 3RS2A 4RFSA 1U0HC 2PZEA 2QP3A 2ODEA 4DIDA 2WPDA 3DZ8A 4QJ4A 2R6GA 2EYUA 1KSFX 1EFHA 3AF2A 1Z0FA 1DEKA 3NWJA 4DCNA 3AP3A 5C46F 1M7HA 1JJ7A 1OJLA 3BXZA 1TF5A 3BH7A 4PQFA 4TL7A 2DWOA 1XMSA 4TYQA 4TLBA 1ZM4A 1KDTA 2FA9A 4DLRA 3AM1A 3CWQA 1KGDA 1NY6A 3K9GA 2RAPA 1JBKA 2CLDX 4LWZA 1M8PA 2OCBA 3IIJA 3K0AB 1GDDA 2F9MA 4PO8A 3HJNA 1HV8A 3ZD7A 2CDNA 1YQTA 1PUIA 2FU5C 4A15A 1P2VA 3RRMA 4TN1A 3KQKA 5L3QA 2ZUBA 3FTQA 1NJGA 3B1ZA 2NO9A 5HKKA 2WWGA 1LFDB 3DHWC 4F7WA 1VIAA 2GBLC 3GP8A 3BH0A 4DC9A 1OXTA 2GKSA 1VG8A 3U44A 1KK3A 1OH5A 3LBHA 5B2ZA 2FSIA 2YNMA 3KJEA 1F2UB 2IUUA 1OIVA 2HT6A 3BWDD 2VSFA 3QEOA 4JJKA 1UKEA 4MYHA 1GOTA 2FFAA 3ZS9A 2NG1A 5E3HA 1B23P 4LHWA 1E0AA 1ZU4A 4HUQA 4KV9A 3K9NA 5EXSA 2AN9A 3EZ2A 1ZIOA 2AKYA 5JSZA 1D6JA 1E2PA 5B30A 2J0QA 1U8ZA 2C9YA 3RC8A 4PAOA 1CKEA 4TMTA 2QNRA 1YRBA 4ZV4A 1LF0A 3I5XA 5AJZA 3IBYA 3AVUA 3FPAA 3NBZC 3NDPA 4RSGA 2L0XA 2QN6A 3BH6A 4C0KA 4B75A 3IIMA 3QF7A 2N46A 3F5FA 4CZ2A 2CHVA 1FP6A 5BYJA 1T4GA 2VL7A 4L9SA 1E69A 5FOVA 1SZPA 4JMPA 2FFHA 4HLDA 1ZM2A 2YV5A 3K0SA 1ZNXA 3W6OA 4N0DA 3T34A 1R4AA 4LYJA 2O8CB 1RVDA 3T61A 4NTZA 4XVUA 1RRCA 1OKKA 2EFGA 4Q66C 2PBRA 4EFLA 1E0JA 3U3MA 1KI8A 3QXCA 4Q9HA 1NKTA 2ATXA 4HUTA 4GPTA 3U7EB 2QBYA 2W83A 2W2XA 3X1YA 4Q00A 3BS4A 1WDTA 4H1UA 2F7SA 4PPGA 3LH5A 3CF0A 3C5HA 1JQJC 2R6CA 2J46A 1GIAA 4FCTA 4NYMR 4CGZA 4JS0A 4BZQA 5CDFE 1NIJA 2PMKA 2FG5A 1Q20A 1AZSC 4RD3A 1ZVQA 5AUQA 3TUIC 1QRAA 5GVRA 3VMFA 4TQ9A 5P21A 3WNBA 4P3YA 1VCNA 1ESNA 3GLGB 4JIMA 3W34A 1A5TA 3A4MA 3GLIE 1OH8A 2WJIA 1IXZA 1QHIA 4KODA 2IHYA 4IDHA 1TQ6A 1VYTA 4FCVA 4QBFA 3BORA 4Q9JA 3P20A 4TYNA 3KJGA 3NBFA 4BLOA 1II0A 3T5GA 3FDIA 1KMQA 2B8WA 4W7SA 1NSTA 2ZI7A 1OXXK 5KSYA 4LYFA 1G3MA 2BJWA 2ZVPX 4TTPA 1MO4A 3CNNA 3SEAA 4C0SA 2F1IA 4Q4HB 4C4PA 3IBGA 3RRZA 4MDFA 3KQLA 3DEFA 4LBVA 3TNFA 4QC2A 2IYQA 3V4RA 2V54A 2FEMA 4KHZA 4DT1B 1T8TA 1F2UA 1JPJA 4FXPA 5CJPA 1DG1G 2G88A 2YOFA 3UWOA 1JXMA 2X19A 3D31A 1YRAA 1FOEB 2PT5A 2G1JA 2ODWA 2ZRAA 2D7DA 4C2UA 2V55B 4PTLA 4HYYA 1SQ5A 2NO7A 1J8MF 5FOXA 1XTRA 2CXXA 5IF9A 1ZUIA 4E03A 1FX0B 2H1LA 3FFBA 3L0IB 1VECA 2GJ8A 1KO7A 3C15C 4Q9IA 1KI4A 3H84A 2W6JA 3PG5A 3IPXA 2GESA 4I1SA 2D06A 3B1XA 4DSUA 4EJSA 1Q57A 1T0JB 2GTPA 1O3YA 2YINC 2MSDB 5HCNA 4BFXA 2HCBA 3HU2A 4M0LA 3EARA 2OAQ1 4EPWA 2ERXA 4B3CA 2ZJ8A 3ECCA 4S2EA 5EXXA 3NVAA 4OQNA 2HCJB 2GRJA 3ZDQA 2OT3B 4POAA 1E9CA 1NVVR 1OFTA 5H1YA 4EKDA 5SZIA 4HEJA 1FP7A 2BBOA 2D2EA 3CF6R 1YR9A 4M9ZA 5KNBA 3CPJB 1LTQA 5CYPA 5LDDC 1CR0A 4AYWA 3MRSA 2ZSAA 2SHKA 3CIOA 3GLFE 4EFMA 5J4VA 2IC5A 4GZMA 4LJ4A 3TR0A 1JI0A 2IYTA 3VHXA 1XMIA 4XVQA 2WKRA 1XEWX 1U0LA 3CNLA 5FTLA 4A4DA 1L2TA 1E32A 4NYIR 3KX2A 4LBYA 1Z63A 2CK3A 1UAAA 2OESA 1OKKD 1II8B 2OLJA 3B85A 3THYA 1PVOA 1S9DA 2IS1A 1XRJA 1KI1A 3OE7A 4BFYA 2BEJA 3N2EA 4BLQA 4JL8A 5ELXA 2R8RA 1JR3A 1IBRA 1ZU5A 4HB2A 1HQCA 3AF3A 1US8A 1V5WA 1XCMA 3DPUA 4V02A 2JJ2D 5EUQB 1Z6GA 3REFA 3OE7D 4MRNA 4PC7A 5JFGA 4M1WA 5LD2C 4I4LA 4NCKA 4RVCA 2MSCB 3PITA 4B32A 3C16C 1OXVA 2P65A 1I2DA 4F4IA 3MWKA 5DNYB 3UXMA 1W0JA 3GPLA 1KI6A 3NHAA 1ZW6A 4IEIA 3LV8A 2V6JA 3LQQA 4YDHB 1FTNA 2IYVA 3MAAC 1G19A 3MG9A 3SE0A 3FHTA 2C9CA 3SU8A 5BW8A 1IY0A 3BRWD 2VHTA 4M2LA 2B7BA 3VR3A 3ZIAA 1Z6TA 4KCGA 5BYKA 3GMTA 1P2TA 2D4HA 2ATVA 3WP0A 3JVVA 2OO7A 4RD2A 3THXA 3ADCA 3K0CC 2LWIA 4OBEA 4ZCLA 1J90A 1ZBDA 3PCRB 3EPJA 3LLUA 3NH9A 3RYTC 2JJ8A 3VR6A 5FPKA 2IXEA 4DSTA 2IYSA 2ZJYA 1RW4A 2ZE7A 4GDFA 3SZRA 4D2IA 4PC2A 4URUR 2JEOA 3U44B 2C95A 3SBDA 2N42A 1ZCAA 2R44A 4IOJA 4NHOA 3VHLB 1TQDA 4FMCF 3P4XA 4URYR 4I1UA 3S1AB 2IXGA 3BOSA 4RKFA 4D4JA 2QRZA 1CJTC 1DO0A 4JLKA 4W5WA 1W0KD 5LBIA 5E7IA 4LYHA 5DE3A 1Z22A 2ZRLA 4EQ6A 1ZIPA 2V6IA 4MGKR 3X2SA 4BZXA 1NN1A 2IYYA 1U81A 3SBEA 2F1JA 3R9WA 3QXXA 1JR6A 1TF2A 3OIYA 3D7MA 3HU1A 2OXRA 4RZXA 3IILA 1II9A 2XX3A 3N5CA 4V0MA 1NKSA 3KKOA 1HY3A 2ZU0C 3VX3A 3C14C 4YLGA 2Z0MA 3ZIAD 1AQUA 4JKIA 2KB0A 4PHFA 4PPNA 1XB2A 4TMKA 4XWAA 2E1RA 4BUJA 1SGWA 1VIYA 5DN6A 3A58B 2WJYA 3B1VA 1SXJA 1Q1BA 2FV8A 1HURA 4XWOA 1GTVA 5DH9A 4M9SA 1COWD 2HYDA 2JA1A 2Y8EA 3ZJYA 3T1OA 2QP9X 2QUZA 2A5FA 1IJEA 4PPQA 2QPAA 4QBGB 4WAUA 4YMTA 1DAIA 5A5GA 3F8TA 2BVNA 4ABYA 4M8NE 4NPHA 2RGGA 4TT3A 1UBFA 2O0JA 1E2NA 2OBMA 2ZJAA 3IHLA 2R62A 1M6NA 2FOLA 2VH5R 1XDBA 2AFHE 2BDTA 2A5JA 4GT1A 4KLZA 1ONBA 1P60A 4LSGA 4R9UC 2H5EA 1X8LA 3A4LA 4M1OA 4GRAA 1J70A 1CF4A 1W5TA 2X77A 1ZM7A 3FMPB 1VG0B 4MKHA 2WICA 3LDAA 1V43A 3A1UA 1RPZA 2YWHA 3F0TA 1AIPA 4Q9KA 3PUVA 3WRXC 1N5IA 4E09A 3KQHA 2LKCA 2AHOA 1VPLA 3IUYA 4Q4JA 1S8FA 1AQYA 3ZVMA 4NU0A 1SULA 1FUKA 1UKYA 5FBRB 1E0KA 4DJTA 2DWQA 2RGCA 4D80A 5JLJA 2PLRA 4QRHA 2WMOB 2JLQA 2NPIA 5JEEA 1QHNA 1UKVY 2AK2A 4MYCA 5AWFC 2ZETA 2JJ1A 1BH2A 4A9AA 721PA 1TEVA 1XNJA 4RZ2A 5FR2A 3ASYA 1FZQA 2F9LA 5DI3A 1TTTA 2C78A 1VYUA 1E6CA 3CRMA 2ZS9A 1GSIA 5FTJA 2WAYA 1RRFA 1AS0A 5DLQC 4A1FA 4M9QA 3PEWA 3ICQB 2OHFA 3L8ZA 5BWMA 1Q1ZA 1E9BA 2DFTA 4U00A 2WOOA 4B33A 3ZD6A 1W36C 4QGAA 1E79D 3FE2A 1XFAA 2ZI9A 1MR3F 2FEOA 4GL2A 3MUFA 2CCGA 4RJLA 3VKHA 2RHDA 1P3JA 5J40A 3VR1A 1S1MA 4AKEA 2F3RA 2OV2A 3AUYA 1XPRA 2GF0A 3R9IA 1G8HA 3LW8A 2QTFA 3QF4B 4D0GA 1KSJA 3B82A 2CL6X 4RCZA 3K9HA 4M1SA 3AKYA 1GRQA 1Z83A 4DDWA 2FWRA 3WBJA 4US2R 1Z0DA 2GJAA 3EC2A 4OI0A 2AXNA 3W6PA 5TVKA 1P2UA 4LJAA 4IOLA 4LJ5A 1FNMA 2QY9A 5G40A 2OCAA 1T3SA 4AD8A 4F4JA 2UZ3A 2CVFA 1Z0IA 3GJ6A 1NBMD 2IF2A 2CVHA 3TR5A 2XTZA 1AM4D 1IHUA 2GA8A 3K9LA 4PHTA 4RFVA 4TLAA 5CDFA 2EWVA 3K09C 1E2KA 1E9SA 4EQ6B 3I3SR 1IONA 2YHSA 5L3VA 4ZIRB 3AKEA 4PC1A 4LJ7A 1WP9A 2ZR0A 3QKUA 1BIFA 2EU8A 4D82A 4QM7A 3GLIA 1DTSA 3NEYA 2IT1A 4C0BA 1G7CA 2D74A 4A8JB 2A5DA 2RKOA 1Q1EA 4G5QA 1H8ED 4HAZA 4P4TA 1R8QA 4BLRA 1DAEA 4IVQA 4IDNA 4LDJA 1P61B 1Z0KA 2EWWA 1X8JA 4BEBA 2FNAA 2ZE6A 2QRNA 1U94A 1LF5A 3CWZA 4OHVA 4V0LA 5KNDA 1OH6A 2Z6VA 1E2MA 1XJCA 2DPXA 5J4LA 2GJ9A 1IAQA 4GP6A 1OLOA 2OCYC 3A37A 1W0JD 5KYKA 3CBQA 1TEXA 1FFHA 4L16A 1JAHA 3QVUA 4HDQB 4B34A 2ZYWX 4ZDIA 2JATA 2AXPA 2IXFA 1P9RA 1U99A 3SYLA 3UKDA 2WSMA 4Q47A 2DB3A 1EESA 5EP4A 3BB4A 1QHHB 1Y3AA 4GFDA 4P4UA 3MJRA 4Z8YA 3TRFA 5H70A 3B1WA 5AUPB 1N6HA 1U9IA 2C99A 3L0SA 2PJRA 4C0AC 4EAQA 4UJ3A 2J5XA 2WWWA 2XXAB 4YXWD 3RC3A 2BBWA 3OEED 2IK8A 4LPSA 3ZVLA 2QTVB 5A4JA 3LNCA 4QOSA 1SVKA 4RD0A 5C4MA 4IHQA 1G4UR 1WE2A 1KSHA 4Q1AA 1ZNZA 4HZUB 4AKIA 1FNNA 1L8QA 2Q3MA 1PV4A 2G0TA 3RS0A 3R7WB 4X8HA 2GETA 1FL9A 1DAMA 1KK2A 5E7MA 4JYCA 4D81A 1JB1A 4KLNA 4JLNA 5FPHA 3MGCA 4OQMA 2AX4A 2G83A 1R6BX 1CU1A 3EZFA 2WHXA 4AG5A 2JDID 4NBSA 1BS1A 2VP0A 2QG6A 2ZU6A 3T15A 2FZLA 2GAOA 1N5JA 4NYJQ 3CRQA 1GL6A 4X8OA 4Q4LA 2F55A 3PEYA 1OF1A 4JLPA 3U4QA 1ZMXA 4XJXA 1DOAA 4RD4A 4JBXA 2WZQA 5JHHB 2G0NA 4UNRA 4GOJA 1R0ZA 2ZJ2A 2YOGA 4NZYA 2P6NA 4A6PA 1EWRA 2PT7A 1GVNB 2GJSA 1YZKA 2RCNA 2EW1A 3EW9A 4EPRA 5JJKA 1NVWQ 2LCFA 2NPFA 2KE5A 4OQLA 4US0R 4V0NA 1KO1A 4PQYA 1H8HA 2VP9A 3PVSA 1JEDA 1UADA 3SC3A 2DFLA 2C03A 5KDLA 3TSWA 5DHFA 4B47A 3O8CA 1E2HA 1HE1C 1E2DA 1R0XA 2J1LA 2OUKA 5KSPA 5FBVB 5HPYB 3LVQE 1BYUA 2KWIA 2NTYC 1G7SA 1IN7A 2ZAOA 3FKSD 2KJQA 4MGZR 3QI2A 2O8BA 2ANBA 4B3FX 3PUXA 5E95A 3EC1A 4XD7A 5M04A 3QY0A 2ZR9A 1T5IA 4RD6A 3PUWA 2YWGA 4DBLC 121PA 4FMDB 3R9XA 4IOKA 4A2WA 1MT0A 5BQ5A 4Q7MB 4E5UA 1MKYA 4QXAA 1ZD9A 2DFKB 2OFXA 3QQ5A 4NMMA 1NL3A 1T3LA 1KJZA 4A36A 2QL6A 1OT3A 3SYNA 1J7KA 1E99A 1UDWA 2CLCX 2PCJA 2UKDA 2ONKA 4K8OA 2WJHA 3B2EA 5JJIA 5JCPA 4FMBB 5G3ZA 1JR3D 5HZHA 4CEIA 3L0PA 2QM8A 1HYQA 1D5CA 5DYGA 2QEQA 3FKQA 4DCVA 2HLDD 1KDPA 4A92A 1SXJC 3W8RA 3OIVA 3N2IA 2GNOA 1KZGB 3Q85A 2J3EA 4PO9A 2W0MA 3NXSA 3U2QA 4TZ0A 3OEHD 2RH5A 3UG6A 1KMHB 4KFUA 2R9VA 4A0GA 4BE7B 3NC0C 1I4TD 4A6XA 4WOPA 2CJWA 2VF8A 1NI3A 2BJVA 1E4VA 4WW0A 1DAFA 4IFEA 5CB6A 1GRRA 1U8YA 1AKYA 3AVQA 1F48A 1WXQA 3C5CA 4B6FA 2ZQ5A 1EGAA 2JLSA 3CR8A 3IQWA 3T35A 1E98A 2PZGA 1EFUA 2YC4C 4P32A 1Z0JA 1E1QA 2HF8A 4Q01A 2A7QA 2CCJA 3M0EA 3G0HA 2B8TA 1NF3A
chains in the Genus database with same CATH superfamily
3K70D 4Y9TA 3ZWVA 5EMHA 1MVNA 4MUFA 4KG7A 5C34B 3HEMA 3OLWA 4N6OA 3PV0A 4NENA 4W99A 2MCFA 2DLCX 4QPZA 3TM4A 2NGRA 2WQZA 2HTFA 4N8DA 3D8UA 3QEJA 1XLUA 3KPVA 1WMFA 5AVZA 4OV6B 3NTXA 4Q0MA 1JQDA 2MYPA 2QRMA 4FKBA 1KSGA 2WIBA 2P2YA 3H9QA 3TZCA 4BO6A 3EC7A 4JVLA 2JIMA 2OGZA 1MPXA 4NZ9A 5CVEA 3DFUA 3L5OA 3TG2A 2ZTVA 1P7PA 1QG4A 2I4RA 2C9OA 4LHZA 4TSRA 4KUEA 4BX9A 5AW2A 1Y3BE 2IRWA 3G9QA 4IJKA 4HAYA 5CD1A 2DT5A 4N3AA 4AUKA 1D2CA 1KORA 2H92A 4UFOA 2VYCA 1TJNA 2OSBA 3FBGA 2WINI 4I8XA 4HLUA 4RH0A 4PZPA 5DBGA 3O9MA 3NYIA 3VHRA 3H9BA 1A2BA 2ZCUA 2BCEA 3HBFA 1XAHA 1AKTA 1KTIA 3I58A 4FDMA 3UCEA 3CN7A 4I3FA 4MW1A 3PWZA 2AN4A 2QU7A 3QLJA 1KC1A 1RZRA 4LFAB 1EFKA 1J56A 2JPDA 3COYA 3CU5A 1W9HA 3KNZA 3QE2A 4JY7A 3T4XA 3R3UA 1O89A 4PHHA 4G0UA 3NNNA 3UK6A 1UWCA 3OQNA 1E1RD 4D99A 4W5OA 3TGPA 1ZM9A 1ST2A 1IHYA 2E4UA 2J3LA 1QZUA 3BIJA 4MV0A 4MMYB 4NZOA 4TV8F 4XOUA 1JVNA 4O4IB 2FK8A 3RRXA 2R1UA 3IAS1 3LCUA 2J3DA 2O5RA 1RHMA 5CP8A 4ZQGA 2QI9F 3AESA 4OHBA 2ODAA 4G63A 4MRSA 4DGQA 3O8OA 2HWXA 4GPZA 4V3CA 4KGVA 1NT2A 4HXFB 2JGFA 3TRKA 4RK1A 3LCCA 4PYMA 3H9JA 1A76A 1IQ0A 3AVVA 2CLEB 3A7EA 2I2CA 1Q0PA 2X0RA 3C87A 4MB6A 4QOEA 4JK3A 4ASUA 4W8HA 3RK4A 4GMFA 1FJXA 4EG3A 2ZJZA 2J3IA 3CNQS 3L05A 4B3XA 3CPSA 4WRRA 4JCOA 2R1VA 3CNOA 3W3AA 2M98A 3LHSA 3NC1C 3EX7C 4NR0A 4WQMA 5JMTA 1ITZA 4FNOA 1K68A 1NXWA 1IWBB 2D00A 3TFQA 3RRYA 4CVNA 2E2WA 1G9XA 3IDSA 1UODA 4BMCA 2I3DA 2IGTA 4FN5A 3G5UA 1C0IA 2ORWA 5KB3A 2VTBB 5C4IA 1VBNA 1K3TA 2WY2D 4EUSA 4OHYA 3VVMA 4KU4A 4RF5A 4ZJUA 2F2TA 3WGIA 3RG8A 1FBTA 2RHLA 2XAUA 1HOTA 2JI6A 2Q9BA 1YH3A 2R8YA 2YIVX 1BWQA 1QKKA 3GNLA 4KVZA 3T7DA 3B13B 3W8NA 5CM9C 3ZZ0A 1W47A 1GXSB 2HU8A 2PWYA 3FR8A 4YJ2A 1TA9A 4MS3A 2C7QA 4K26A 1IUOA 3AR5A 2OM2A 3HADA 3HN2A 3N3AC 4WXEA 5B53A 2HNKA 3O8OB 1LPPA 4YJHB 2G9NA 3ZHBA 1M1ZA 3R9XB 3H5OA 3SZLA 1E1KA 5IAKA 3OQBA 3R8CA 4CDGA 5IJ0B 4D9IA 1DPFA 2ZT5A 2Z2JA 1OREA 2PRJA 3CTMA 4FSDA 5EP3A 4JQCA 2QMOA 4B44A 1AKNA 1PTKA 2I7XA 3BHNA 3C3YA 1W46A 2HA7A 5JC8A 1SBQA 2OKGA 3GPCA 5AHOA 4Z4IA 1WS6A 2VXYA 6ADHA 2CWDA 4NNOA 1YVPA 1KRXA 3IBCA 3IO5A 1H8EA 4OMCA 2WJ4A 3IDQA 1HFJA 4C06A 5B4UA 1QS0B 5JFTA 1CNEA 4NP6A 2RGNA 4U8GA 1VDZA 3IUSA 3DEHA 1SUBA 5FV7A 3RQIA 2RH9B 1T0PA 2GYVA 3T5MA 1AS2A 1E2UA 5IK2A 3RBAA 1XG5A 3EF3A 4MS1A 1UXHA 1ECBA 2RB4A 5K8LA 2R0QC 3GAFA 3QXHA 3L8GA 1RCTE 2HAEA 4J9VA 4Q7LA 4YV2A 2CJXA 2J9RA 2Q5JA 2XWBF 3RU3A 4F4FA 5G41A 2P5TB 3THYB 2R66A 1EYZA 2XQGA 3ZEIA 2IYWA 4MINA 2ZE8A 5D84A 3HJGA 4U6QA 5JNUA 1MV5A 5G53C 1TU3A 4RCVA 4NYMQ 1EWKA 1P29A 1ZCZA 4IH1A 5IJAA 5F1OA 1OB2A 1EFRA 1E0SA 1R4NA 4HAWA 4O1HA 4TWBA 3RVPA 3TOCA 5ED0A 1KIMA 4ZO4A 4CG3A 2BV3A 4S12A 3T7JA 5ICGA 4C14A 3AEYA 1DV1A 5AT1A 3IX7A 3E05A 3GLQA 4U6NA 2BDUA 1BAPA 2YOHA 1K7EB 4NMLA 1SKBA 4RDCA 3UMBA 2F9FA 5ALMA 1Y4ZA 1TIPA 4HGOA 4DCTA 5AI6A 4WI1A 4IXNA 3DAFA 2C4UA 1OILA 1KDOA 4I5EA 3C74A 4J0GA 1TA0A 2RMKA 2GEFA 1T9BA 4GI3A 4BGEA 2PXXA 3Q7RA 4C0XA 3I45A 1ML3A 1JIUA 2F8TA 2OFFA 4HMQA 2DY0A 1NVAA 4B6GA 1DL5A 2OD9A 1KJ9A 3GJ4A 3LLMA 1PFVA 1R64A 5FI3A 4CN8A 3I6QA 5C1OA 3MB8A 1M7BA 4ZCQA 4UTRA 4XPZA 2YHAA 3NIBA 4XSGA 4DLKA 5L4LA 1QU3A 3N39C 3AI3A 3DOOA 4LY9A 3WJ2A 4V0OA 4BFLA 3NUGA 5DHTA 3QOWA 1ODLA 1TRHA 2PL9A 4BY9E 3KKMA 4Q4JB 1M2GA 3GJ7A 2DSNA 4URZR 3CFYA 3I5MA 1YA8A 1W19A 2IHZA 3CX4A 4HZUA 2A9VA 2RDMA 1Q91A 5DWVA 5JSZB 2UXCB 4CKBB 2BKXA 2FLVA 2BPOA 3QE9Y 3AJ9A 1ANKA 3UJPA 1Y0BA 3BD8A 4QFBA 4MKFA 4EVIA 1PYDA 2ZIXB 4DLTA 2J0EA 2JGNA 2WDPA 4GXTA 3DKRA 4BVLA 1OT5A 1U0JA 4UE6A 2WHPA 1UEJA 2HB6A 4YAFA 4L0MA 1S8NA 1UMCB 5IM4A 1J2JA 2LCIA 1LVUA 3HYTA 2QN2A 1XWWA 3BF8A 4CEIB 1Q15A 1ADFA 3IQGX 3NHSA 2IHTA 2QLNA 5A03A 2AC2A 3K5WA 5HRAA 1VSUA 3MGGA 3FZGA 2OC4A 3ROTA 1EB8A 1RWPA 1JE1A 1JMKC 1NNSA 1MUUA 5AKLA 2PY6A 2VWHA 1E1MA 3GEIA 1L8OA 3IBFA 3KTAB 4HH3C 1UBLS 5LXTA 2O57A 2DQKA 1E61A 4GX0A 4IIXA 3GMDA 4D6PA 3UWKA 3UA4A 5B1IA 1H93A 4FUTA 4JJGA 2MSWA 3MB5A 1CJUC 1G5QA 3W5HA 4EHFA 4Z7OB 1QH1B 1NN5A 4ZAWA 3U7QA 2GI4A 1GPNA 3RYFA 2VBCA 4BB5A 1N9GB 2FR8A 3X1ZA 2AHRA 1CUUA 3EFOB 3T0FA 1U8XX 4CBVA 3KJQA 2AS0A 5INTA 1NDHA 4H6PA 2MJLA 4RLHA 3WL4A 4R7ZA 3IIEA 1MX3A 3CKLA 4OJQA 3NETA 4W7HA 4BB0A 1G8GA 1DELA 1CBUA 3T5TA 1EFAA 5K4AA 1CTQA 3VU0A 1XZHA 3DB2A 2VIIA 5I4IA 1FSSA 6CHYA 2I0FA 3DMNA 4CUZA 4D9GA 3Q8XB 4ZCPA 4TKUB 2J5RA 2DE0X 4GKKB 1DX6A 5EZSA 2YCLA 4FS8A 4RULA 2RGNC 4X66B 1AO0A 3K0EA 1FC0A 3JVUA 3H11A 4BNDA 3MMSA 4C0QC 1CQWA 2Y0BA 3IAHA 3GN2A 4IUCS 1A5ZA 4S1OA 4WA7A 3UH1A 5GJVC 2JAQA 4WBNB 5I9TA 3MBKA 4ZU6X 3HFSA 3WBFA 2VYFA 1A0OA 1QG6A 1RQXA 3PRHA 4TKVB 4F5YA 1DRWA 3LFHA 5JC1A 5KTPA 5TB5A 2CNWD 2IIPA 4TN5A 1BVRA 4DYDA 3C6KA 2L19A 3A2NA 1CB7A 2V65A 3D6VA 2JLZA 1UM9B 1O08A 1ZK3A 2VWQA 1PR1A 2OV3A 3BSWA 3TJRA 1QB7A 2QDKA 5U4QA 2YJGA 3WV5A 2ZBRA 2QQ5A 4IW3B 2Q6TA 4UFNA 4Z9AA 3U9SA 4CI9A 5TLSA 3D6FA 1G9TA 2C00A 2R79A 3KQSA 5F2EA 3E9NA 4DCGA 4ZXPA 1JU9A 4NOMA 2BMWA 3DDNA 3RTGA 1DE0A 1JMYA 2GFQA 4P4LA 4PN3A 2YHIB 4RPGA 1AA9A 2ZSUA 5TMEA 3LHDA 1GRCA 3ET4A 4BVBA 4CJXA 2P2CA 4ZMBA 4BP1A 1RAHA 3DAHA 4ZCTA 4IKEA 1NOIA 1SOUA 1XE3A 4DPMA 2GILA 1P0IA 3BMXA 3WA6A 1FE8A 4DLZA 1DOHA 4ZICA 1BDHA 4EW3A 2VTKA 3SF8B 1RLUA 1BQ4A 5B2FA 2OP1A 4LVCA 1F8GA 2HRRA 3GRFA 1BMFD 2AFIB 3AR9A 3S68A 2H16A 2W6QA 3QEBZ 3K6RA 1NSFA 4MYUA 1JNYA 2MINB 2QQ0A 4E5SA 1AGRA 1WLSA 1R37A 3ESYA 2BFOA 2FMKA 4U02A 1TM2A 5CCBA 2BMDA 2XT0A 3UAXA 3B8HA 2X7HA 3CWCA 4XWGA 2F67A 4CLXA 1J33A 4MKZA 3PC6A 4KYIB 4DJ5X 2R8OA 1ADGA 5FUXA 5DYIA 3NVKI 1HKUA 1E9RA 4CEHA 2BR5A 4UOZA 1XRLA 3U7HB 3ZIUA 5EJ7A 1WXEA 3RC2A 2JASA 5KNBD 4E5VA 3OA0A 4ZKDA 2F3TA 1UDBA 4QL3A 2YBDA 2VPIA 1PS0A 3LQ4A 4UU0A 1Q12A 1P45A 1Z68A 1CZKA 2VNHA 1YR1A 5AH0A 4E11A 4C20A 3KE9A 4KEAA 4DIMA 1E3IA 2PBFA 3TNDA 2XBLA 3HY6A 4HDSB 2YFHA 3IMGA 1M1NB 4O1IA 2RK6A 3T3PB 1EVLA 1I30A 1SH7A 1N2CE 2Q5QA 2XQIA 3GGPA 4XVCA 4M1YA 3BMOA 4CFZA 1S3GA 4OOEA 1P80A 2EZ4A 4NXMB 1HA3A 1NNUA 1FQKA 2E4YA 2G9RA 3EHEA 3RK1A 3DXZA 3PHGA 1KMHA 4LZPA 3G7NA 2OBFA 1ZISA 4U8HA 2OMKA 5LLTA 3KE8A 4F9GA 5I01A 1KYTA 5ISMA 3HCEA 3TFWA 3ZVNA 5A4AA 2VDJA 3NEJA 3N7AA 2P75A 1XD2B 1GZ4A 1GT91 3D59A 1JEQB 1EA7A 1L5ZA 1S0UA 1GPH1 2W6IA 4WINA 1RE1A 1DCKA 1ZO8A 4I50B 4J2OA 2QHXA 3SR4A 4G07A 1AKWA 3NBUA 4RL4A 4XEHA 2D1SA 3AJ8A 3TW8B 3X0DA 1GU1A 2TECE 1VZ2A 4YMVA 1ZD5A 3FZYA 1X1SA 5A04A 4YMLA 2HUNA 5E3JA 3S5UA 1P44A 2YHBA 3E84A 1NYLA 4ZZ1A 3WA7A 3HCRA 1IUNA 2VF7A 3GBPA 4OHWA 3UXEA 3IV7A 4KIGA 2G7MC 2Q5LA 2PGNA 3D1JA 2I8LA 3ADOA 1A8PA 2CC2A 4Y0NA 2C1ZA 5E8JA 4OI1A 2XNHA 1EPUA 3WGGA 1B42A 2AR9A 2EZ9A 1FIUA 1Y8ZA 2YV1A 4JWKA 3FLEA 2HQ1A 1J9ZA 1FS6A 2JIDA 2ZXEA 2GM3A 3EAQA 3QEMB 5FPSA 3EBOA 2AFHB 4XUEA 1QYRA 1XHFA 5DGCA 3LVFO 4LRXA 2A2ZA 1V9LA 2QX7A 1ADCA 1SCUA 1Y6ZA 1MN6A 1Z88A 4FFLA 3MPOA 2BFCA 1CW2B 3LRXA 4FYJA 4U3JB 2NSLA 3JZFA 4O6VA 1HTWA 1UUFA 1RXVA 3CX3A 3K35A 1PI3A 4LRQA 1G7TA 5L3SA 1D4ZA 1DTEA 4NEGA 1V37A 5HILA 5K1ZA 4AL4A 2PKXA 2B30A 3KYCB 1M2VB 4A8JA 3WDMA 1MAWA 4JJEA 3OZEA 4YMHA 2C5AA 4Y2YA 3FNHA 1G5RA 4YRTA 3R5JA 4MRPA 2GXSA 3TRJA 4AAYA 2ZRJA 3FPGA 4P4SA 5HGJA 1EP2B 2R97A 2Z3WA 5HJ7A 2RGXA 3IMFA 5EYPB 1ZRSA 2C7BA 4KYUA 1E6UA 3TKLA 1VE9A 5KTYA 1SWWA 2Q29A 3GLFA 1J2EA 1RXEA 1QYVA 1W4BA 4DV4B 3RARA 3V2IA 4W1SA 4PCAA 4JSYA 1XRPA 1OHHA 5BXQC 1JN0A 2WF6A 2C61A 2ZT7A 1PG2A 2FMXA 3IEUA 1Q1NA 3QMWA 5D7BA 3P26A 4E5MA 4S05A 3EXIB 2WTXA 4RSRA 5J4HA 3MMXA 4AZVA 1LFAA 1U9CA 2XITA 4E2ZA 4F2WA 4IUYA 5DZSA 4D9FA 1OU0A 1IHPA 1U90A 2R6ZA 5BN4A 5AM2A 1P8AA 3B1YA 3KBBA 1O6ZA 2J3HA 4CV0A 3EGXB 4NCIA 3VNRA 3VZPA 1HFEL 4HZGA 1IXRC 3ZR4B 4BE4A 1OSNA 2Q8NA 1B8UA 4PO1A 1KK0A 1LJUA 5G0WA 1WUTA 3STUA 2HBRA 1T25A 4EB8A 3L07A 4IRUB 1XK6A 3L8DA 3GA0A 3KT3A 1N6KA 3RWBA 3R3ZA 4J7XA 4RJIA 1KJIA 1DKMA 3PIRA 3MJFA 1SVNA 2HK9A 3D4OA 5IZCC 1ZMBA 4JITA 1SZJG 1ZYUA 4JNCA 2EARA 4GAEA 4P5EA 4PTYA 3GJXC 1Y9JA 4V24A 4BMOB 3RIYA 5C8ZA 2ECQA 5A6SB 1JALA 4RHFA 4I4TB 3UJ6A 4AB1A 3K09A 4GWKA 3ZNOA 4JU9A 4G65A 3UAGA 1T24A 1X3LA 3NEPX 1R0WA 1VB3A 1E66A 2FWJA 5B5SA 4X60A 4EZEA 4C08A 4NDNE 1ZZEA 2O7VA 4II2A 4GW3A 1IOZA 2FKNA 2JIBA 3GG2A 3W90A 3KYDB 1T10A 4R8SA 4BFUA 2UAGA 3HUFA 4GC9A 5IDQA 1QQTA 2I33A 4RZSA 5KSWB 3TYXA 1G66A 4PR3A 1PNVA 1QP7A 3GFVA 4N8SA 3GEGA 1SHZA 2BKUA 2P0EA 1RYNA 4PGFA 3DDSA 4I55B 1L0BA 2DMRA 5K8IA 3A1SA 3L4SO 1PBNA 5AJYA 1LU9A 2PZFA 3ETLA 2Z5GA 1M66A 3M5DA 5BSGA 4G1VA 4AURA 3PHHA 4RSMA 3HYCA 3ZHOA 1FYWA 5K5EA 1ZI6A 4E1VA 1TQHA 3DDOA 2VDOB 4WLFA 2BD0A 1EGMB 4LJ9A 2HZ7A 4B71A 2BFNA 1XCOA 5LLSA 2HR1A 9LDBA 3E5HA 3ZQKA 5HKLA 1NVEA 1P9OA 1XEFA 1VXOA 2WAMA 3GYGA 3UJNA 4L0DA 4FFNA 3USZA 4E2YA 5EUMA 3ENVA 1M1YE 1X9HA 4LNUA 5BW5A 4GNRA 1FP2A 2A0YA 2IEGA 3A25A 1KNXA 3HUDA 4DCSA 4CETA 3RUCA 3PKJA 1TU0A 4I08A 1TE2A 3GC6A 5C51B 1SVLA 1K88A 4IV0A 4KXVA 4MVCA 2J09A 1UZUA 5CIWA 4XRGA 4ZOEA 4NC9A 1SHUX 1U8FO 1UJCA 4KR3A 1K5HA 5C37A 1HEYA 2H5LA 4EBFA 5A0TA 3F6SA 1JYSA 1ZOIA 1B7GO 1TMOA 5KNDD 3JQBA 1QAQA 1AUOA 2A5GA 2CE2X 3PPXA 4MWSA 3V8EA 1QFZA 3I72A 1ZH2A 1GKKA 1UDCA 5CB8A 1PNRA 4B3RB 4DLVA 2QTHA 3O8DA 5B6JA 1F7UA 5HUJA 4MMXB 2AK3A 4TUYB 4KIWA 4GYWA 4Y2GA 3N0VA 5DMXA 1R3DA 4M87A 3P9CA 2O48X 3VO8A 2VJOA 5L7YA 1Y9EA 1X7ZB 2FWPA 1XTKA 2ZBVA 3MWLA 4J4BA 4M7OA 3BREA 3IH5A 2OV6A 5ESDA 4FOTA 3RABA 4ZFNA 2HV9A 3IUMA 4PBSA 4ZGGA 2JAUA 3G9TA 5F9HA 2O2HA 3K32A 2AQIA 4NJMB 2EZ8A 5DLEA 2PAAA 2PQ0A 1RKVA 2W37A 1X1RA 1V7ZA 2ZIGA 1BO6A 2M1XA 3AHHA 4KWIA 4XTRA 3UHJA 2AW3A 4KLAA 4AJOA 1KO5A 4FKZA 2V1UA 5TC4A 3JCZA 4LOHA 3OZTA 2CXQA 3LCMA 3WGKA 3W2TA 2RBGA 5JSKA 3ANSA 3WHLA 1KO8A 5JBQA 5CITA 1J23A 1VIVA 2IOYA 3WQQA 4G4SP 3OX1A 5EXEA 3U4QB 1G7RA 4EG8A 4RTQA 1DPGA 1KK1A 1THGA 2WIDA 3TAXA 1NAIA 3HBLA 5H68A 4GBGA 3OY7A 3ZPXA 4LUCA 2GN0A 4B73A 1NULA 2R4UA 4Y6RA 3AETA 5H3CA 2XD9A 3BL8A 3V1MA 2C2HA 2PSFA 4NXNB 2PUAA 1LK0A 1PT9A 4JBLA 1I3LA 2VP6A 4LBZA 5DGXA 1D0VA 1QH0A 2IU3A 3I64A 3SN6A 4LHYA 3T6KA 3CVXA 4P0TA 3FVQA 4MUHA 5A6SA 3PUHA 3TUZC 1NUTA 1HLGA 2PX6A 1Z2PX 2BGKA 3RFFA 3NCHA 4X20B 4A26A 4FUQA 2WB2A 1P33A 3CUEF 5FOSA 2A1TR 1P75A 1GCUA 5EHXA 3ROQA 4P3KA 1UPFA 5JAZA 3BE4A 5LWQA 3I4CA 1JIQA 4KO2S 4II7A 3RFCA 2WTUA 2NSYA 2VVTA 5HZKA 5AK4A 4RIHA 2RARA 1U3TA 2WTBA 3ZV4A 1MP0A 4D46A 4EPXA 2IODA 2GAAA 5DBHX 4R7GA 1TADA 1NHGA 4YJFA 2AH5A 1C9EA 1Y98A 1H6CA 3QVLA 5CLLA 1KFKB 4J07A 3IAS6 1RXIA 2VSOA 3N8IA 1N92A 1R18A 1NRXA 2FHPA 3UC5A 3WDKA 4G9EA 2E5WA 3NBXX 4PSUA 3LRPA 3WXMA 1PZXA 2WD7A 3Q7QA 3UTCA 1HT1E 3RSLA 4YP5A 2GPTA 3I9MA 3P32A 3AVXA 4N49A 3D3NA 4GICA 4QE3A 4OHCA 1BMFA 4DLBA 1UEXC 4EUEA 5ALIA 1T43A 5F64A 4CIAA 4IF4A 3GRRA 2O7NA 3EOZA 4KK4A 4ZI2A 1X1CA 2J3JA 4Y7CA 1NR5A 3LIIA 3B7GA 3ES9A 3EGWA 2AL7A 2Q4RA 4MP8A 4EJSB 1PR9A 2QTCA 2NUPA 1VMKA 2V3CC 2PM8A 4K9PA 5EI5A 3FF4A 2C7VA 2FR1A 1UM9A 4GI1A 1ZHFA 3M4XA 3NBMA 1R6VA 2WFZA 2QXTA 3WGMA 5CDSA 2E18A 3F1KA 2HHJA 3IT1A 3HU5A 4D9HA 2XGOA 4M89A 3UFXA 1T4CA 3AGPA 1IXYA 1W85A 5TMPA 1JKJA 1Y5NA 1UBKS 4MWGA 1Q6ZA 1ETUA 3GCXA 3VAAA 1KBZA 3FKSA 1GL9B 2WVJA 4ZT4A 3PNLA 3HWWA 2VTEA 3SS8A 2G7ZA 3DE7X 4FYHA 1ARZA 4NICA 3TZBA 2RG7A 4DRXA 5B7QA 1M8KA 2PANA 1N0UA 2W6ZA 1F4VA 3CO5A 2EJUA 1OIWA 3KZMA 4KC0A 3KEOA 2XQJA 3JALA 4HQ0A 3U19A 3IXQA 1SUFA 2F1OA 1CF2O 3HR4A 4OQQA 3VR0A 3WL7A 4QXMA 2ZSHA 2ZULA 4A2QA 3H5WA 3URMA 2XWSA 2HU7A 4HGYA 4R2KA 3OTIA 2ZZMA 4Y2UA 3TD9A 1YI8A 5IT0A 2COUA 2CV1A 1QE5A 4UEJA 2ZRDA 1OH7A 5CA1A 4X85A 1TUEA 1MIOB 3K0FA 3QZUA 3KJNA 1HI9A 2COKA 3LTNC 2O2SA 4X41A 3IP8A 3TE6A 1RC8A 4WL0A 4WBNA 1QTIA 5AVWA 5E6SA 1S2DA 3REGA 1L4UA 4HF7A 1P1RA 2B4TO 1Y33E 2FZVA 3HZZA 3BM5A 1V0JA 3LY9A 2WABA 4BGIA 2ZE5A 2NQ2C 2ONYA 1B6GA 1ZZGA 5AW9A 2AMYA 3J81k 4LY6A 2WP0A 3ZW7A 1K6IA 4TL8A 2VRWA 4MQFB 2Z8YA 3OIFA 1Z6XA 3H5TA 2WIAA 3SI7A 3T06B 2IIBA 3R74A 2J5QA 2O6HA 3W5SA 1T1SA 3JAMA 3VU9A 3MQ2A 5A0FA 3OESA 1N2SA 3KV1A 4MHSA 1IIBA 3RU7A 3KT6A 4Q9AA 1QFXA 5J4KA 4M54A 2UZ4A 1RWBA 2FSHA 2GN8A 5K3EA 2IDKA 2X9VA 3SGLA 1NVTA 1UL1X 2V7UA 3JALB 2WRZA 5CVVA 5KAMA 3V7UA 2C8KA 2A14A 3CF4A 4DDVA 3ORSA 2H54A 5IYZB 4DV0B 1M5RA 1AXRA 2XEXA 1FFBA 1NE7A 2QBYB 3R5XA 3E9MA 3WKDA 2X8JB 1A9TA 3P2IA 2R85A 4BMYA 3JQPA 1GZ3A 1U0GA 3C7DB 5DWQA 5IBQA 3S2EA 3RT9A 3R6LA 2WWVD 4DBLE 4DLWA 5CDHA 3MMPA 4A8TA 1LPBB 5C1IA 4D0SA 1JDJA 2Y1GA 4ER6A 3LLVA 4X1IB 3QOXA 1V25A 2Z1DA 1K08A 4OSPA 4WUTA 2LD4A 3GB9A 1KC3A 2P6PA 2VDKB 2F43A 3PC2A 4MCAA 5K03A 3AP2A 1CQIB 4KGDA 3AHEA 4NG5A 2HMWA 3MWYW 1YC2A 3Q7TA 3FYCA 4Z1MA 1LH0A 1UFRA 3AKDA 3BTVA 3DE1X 3E5MA 3DHYA 4OHMA 4P6VF 1IY2A 1XCPA 2WB4A 4QPDA 3C5VA 2OHVA 3KKLA 4FONA 1N77A 2QK4A 4GZLA 3IURA 5IT5A 1DTWA 1M2OA 1UC9A 1E2QA 4ZEXA 3TRHA 1QWSA 1REQA 3W6ZA 4RZ3A 1AY0A 6AT1A 3KSZO 1RWOA 1JHAA 5JARA 2ZAIA 1BH6A 3E1GA 3I2FA 3OKPA 4RDHA 2OXCA 4RY2A 2YXEA 2I7DA 3U4AA 4KVGA 3D8BA 5HDBB 2X9NA 3AL3A 3EIQA 4A0HA 4IHKA 3TTTA 3EAGA 5DHPA 3UPUA 4WASA 4KI0A 5EQTA 5EYPA 4M49A 4MQEB 1D6NA 1FU8A 3FH0A 3AILA 4LE0A 3KSBC 5A02A 2YQ4A 1HG0A 3L3BA 4P86A 3N74A 1YJ8A 4MVJA 2FJPA 3CW8X 4J3NA 3LLCA 4DCUA 4EF6A 3K4QA 1UZAA 2BHSA 4Y3UA 4GMDA 5DTIA 3T4PA 1SU4A 2XF2A 5K3DA 4YMUA 4BV8A 3HR7A 1PJQA 2DTXA 1ZI9A 1XDDA 2ZATA 2Q9UA 1SXJB 4B3JA 2D0IA 2IE8A 3E58A 2JS7A 1U0OC 1DFGA 2VJAA 1W48A 1Y7LA 3EGXA 3H5LA 4IWNA 3ZDCA 5LMZA 5BUCA 2OB2A 4WZAB 5DYYA 4AS1A 1BSVA 5KU1A 2OQVA 4URXR 2PS9A 3IQZA 5KJFA 1AURA 5KC8A 4L8VA 5JH7F 1RXYA 1CYDA 3RB8A 2J9ZB 2GCOA 1WOYA 2SECE 3WDLA 4ETWA 4QBIA 5E6UB 3OOEA 4OMFG 3DGFC 5IKOA 3MVEA 2AF4C 1QS0A 1Q7CA 1TKCA 2VLBA 3A9TA 3L7DA 3BRQA 4RQAA 3UVEA 2QXUA 1W93A 4MWTA 1WVIA 3PL1A 4KBYA 4OJYA 2AJBA 1MB2A 4IXDA 5CM8B 1MIOA 1VYVA 1Z8DA 2QUJA 3GMIA 4HNAA 3VMMA 4AF7A 4CPDA 3O4IA 5BUQA 2C5LA 4IFIA 2H59A 5AM3A 2P6RA 1SM4A 4HVTA 3HJFA 3THOA 1G6KA 4MK4A 2JFOA 4YRLA 3F7TA 4F4CA 4MW6A 4IIEA 1E3TA 4X7RA 3UEOA 2G1PA 2X6TA 4FFWA 4OPMA 1A9PA 3UHAA 2P8JA 1XMJA 4HEQA 3BMQB 5GIPE 4UU1A 5FTWA 4Q3DA 5B64A 3ZGYA 4F45A 2ERCA 2I8AA 1LK5A 4OP3A 4E0BA 3DS8A 1E1CB 1ULZA 2A86A 4LRYA 3N2LA 3OJCA 4MUKA 4L8GA 5THXA 4AVYA 3MSXA 2EW2A 4LI0A 3ESCA 1C2YA 4CMCA 5EJ8A 4KSCA 1P5ZB 3TTWA 4CNQA 2FRXA 2J85A 2REQA 3AOGA 5IN4A 2JL1A 3A10A 3QF4A 4H1VA 1XL1A 4HDSA 5FB3A 5IANA 2QJOA 4BLPA 1WJGA 2CDCA 3KUUA 4LV8B 1QVWA 2PGJA 2X5KO 3WK8A 4BAGA 2QMYA 3WHIA 2O07A 2PZKA 1U2GC 4LCEA 2HJVA 1WBJB 1P3Y1 1DC3A 2GERA 4MA0A 1HNZB 1FVHA 1H42A 1SG6A 3HFRA 1NUQA 3B7PA 4W8OA 4JB8A 3TTYA 4DIFA 4IDQA 4EHLA 1H2XA 2AD1A 2O2XA 1X2EA 2ZRMA 1QO0D 2QVBA 3CX8A 4FVTA 2ST1A 1AC5A 4IWYA 4BO1A 4B1FA 4DDKA 1VBKA 1CJCA 2PPVA 4E7OA 1T0IA 4XYGA 5JNRA 2CLLB 1FCJA 3Q2OA 2PEYA 1MJ5A 5ESRA 2VSYA 1PQUA 5LBUA 4D74A 5DP2A 5DNDA 2I6SA 2CYBA 1ZEJA 1PEAA 4PGHA 2X8AA 1FA9A 2XUOA 1MORA 4MVWA 4MB0A 1KI7A 4U5XA 1TF7A 1QYCA 3THXB 2XUFA 4CKBA 1I80A 2X0NA 4GH5A 4ALKA 3HR8A 2QENA 4CT4B 3EHDA 2JIPA 1RWKA 1W2GA 2UVPB 1QR2A 3FCXA 5KNCD 3LQRA 5GZ3A 1CRWG 1RQRA 2C2WA 4EKYA 1SUWA 2CD9A 1NW7A 3KKKA 1WBBA 2TMKA 2YVLA 2Z3VA 4AYTA 2QTLA 3NBAA 3ZGNA 1OBCA 1EGQA 4ID3A 1RQNA 4JI6B 3PUYA 2CMKA 3FX2A 1PTJA 3HJCA 4K9KA 3KVRA 2HDWA 1DC8A 3FF1A 5A9RA 1SBZA 3GRKA 4LJKA 4HXYA 2JCYA 3EEIA 4I6EA 1T13A 3LA8A 4DUPA 2IYZA 4P81A 1J2TA 3H2YA 1JKMA 1MX1A 4UQLA 3NIWA 5KWJA 1GGKA 4Z53A 3UYLA 1W7AA 3GLHB 3UG7A 5DFAA 1N7HA 1ORIA 2IBSA 3RJMA 4OLHA 3RF7A 3AY7A 5DM2A 3QIAA 1T2NA 2PX5A 3A04A 1H22A 4JUIA 3PIDA 4PR0A 1L4FA 5DEIA 1R1DA 4L4SA 3B9RA 3LT0A 2WU8A 1X70A 1XMVA 4YC7A 2QM7A 5L9AA 4IS2A 2GN1A 1RI4A 5JRJA 4FHEA 1ORRA 5F9FA 1ZOSA 1JKFA 1G2QA 1W1WA 4Z8XA 2XSZA 5CM2Z 1Z26A 5ICCA 1CJMA 4BX3A 2FN9A 3AR4A 3C1OA 1W5SA 1T5SA 2C88A 1DG9A 4E15A 4TKUA 2CLHB 2WF7A 2C4TA 1WEKA 2AN5A 1H2WA 1BHJA 3DZIA 3PS9A 3JVEA 3WX0A 2AKEA 4MI6A 3KOZA 2GMWA 2QPTA 4EA9A 2YJTD 4MITA 3RGWS 4CKWB 4PQRA 1Q44A 1NX9A 3D7KA 2DHCA 5LIPA 2AEEA 5REQA 4JLAA 3NH6A 4EG1A 4ZI5A 1P2FA 4ARUA 1TU4A 1L4YA 2NZJA 4H7DA 2X5NA 5U1PA 3WGJA 3NAMA 3C5EA 3VPXA 5K8VA 1NG1A 3FGZA 3TGLA 4QG3A 2CF6A 1AT1A 1YZTA 2FN8A 4KE8A 4L6CA 4M7WA 4RCYA 2JGIA 1E5TA 1RM4A 2ATCA 2WNHA 5DM60 2IZZA 2II6A 1YJ5A 4MWOA 3AQ4A 3S7ZA 4GKJB 3BXXA 1K7YA 3LXRA 4QNMA 4MGYR 3WK4A 4MWBA 4JC4A 2FFQA 4U7PB 3IKLA 3SXJA 4WOCA 1U0RA 4XSVA 5IKPA 5LPNA 3NHPA 1YVDA 5FNVF 2YZMA 3OBBA 5H8WA 1LBQA 4LQLA 4EDHA 4JSRA 1X80A 2PRSA 3SY8A 1WA5A 1SR8A 2ZJFA 3BMNB 4FJ0A 3WOVA 3EPHA 3WK5A 2V6FA 3TZEA 3DOFA 5K99A 2FGKA 3T3DA 4I14A 3E3OA 1OZ0A 1VLQA 2WE7A 4XZ3A 1TO6A 1ZW1A 4HWGA 2DG2A 2ISQA 1YKFA 1QIFA 4NZPA 1EXVA 3LAWA 3CLSC 2ZJOA 2FP3A 3WOHA 3ZTTA 5JI2E 5K0GA 3O5AA 3NIGB 5BOSA 1T4CB 2B2CA 4UBLA 2A92A 4DSZA 5JSFA 1CUZA 1FVOA 4BB6A 4KYVA 1CUVA 4UAJA 5KWIA 5SZKB 1OWNA 1U04A 4Y7DA 621PA 4NI5A 5JEDA 2HHAA 1X86B 1CP2A 1NE2A 2PS1A 2ZT8A 4E70A 2A3NA 1V1RA 2ZUTA 3UT5A 1BVYF 3ZCSA 1OVMA 2OLKA 1OX4A 4OP2A 4AN4A 1YVEI 2GCGA 4QO8A 5JU6A 3I28A 4RMNA 5BO5A 1B00A 3VH1A 1BYIA 1T34A 2HBQA 3M4YA 3UMGA 1EXNA 4TM8A 1KQGA 3G2HA 3R5SA 5EE3A 1F06A 3FIUA 1BWPA 1CG6A 3KXLA 1O5OA 3FI0A 4BQNA 4BJ6A 4F85A 1J00A 4DABA 5C7LO 2HWUA 2WM8A 3PVZA 3R23A 4K6FA 4WVFA 1F8UA 1WZCA 3E1KA 4X6YA 5CT5A 2A30A 1M0SA 3NW9A 3HDQA 4C4XA 2GJ4A 3PF8A 1T9CA 4RZUA 2M6RA 2QRLA 1JEYA 3IELA 3EISA 3ZOKA 1Z15A 1Q0UA 4YO8A 2V3VA 3TB6A 4ARZA 2RAFA 4JGBA 2QA5A 2ZWMA 3D6JA 1M2JA 3QLUA 4BQSA 3WNQA 3N53A 1BMTA 4FI3F 3HYLA 2IS2A 1YTLA 1OIXA 1ZAKA 1E63A 4B6EA 2I1VB 3U60B 3W5AA 3C0KA 3RC1A 5I8PA 2GEVA 4JOSA 1U9JA 1UBUS 4OFXA 1V3QE 4PFSA 4JEUA 2IH5A 1VJGA 1L5QA 2M1ZA 4G2TA 1ONSA 4BNYA 1AN0A 3ADBA 3CLVA 4UNSA 1NX6A 5EMMA 2DPHA 1SBYA 2V58A 2QTNA 4N3CA 1BCRB 1ZIYA 4MR8B 1YC5A 5D85A 2WKQA 3TZQA 4F5DA 1KI2A 5AUNB 3R3WA 2QTTA 4WNIA 6REQA 3V00A 1VP3A 4OA5A 1DKUA 1FJHA 1G8FA 1O8CA 4ZT6A 3NLLA 3EG9A 4G89A 1IEQA 2J08A 2RSLA 3FFAA 1QIIA 4U2EA 3W2EA 3WIUA 5JNVA 5JXJA 3Q7IA 2AVNA 3CNBA 4NECA 2B34A 5I47A 4I9HA 3Q6MA 3JQQA 4QBHA 3KJXA 4QX6A 3WZ2A 5LMUB 4MQFA 2ZPTX 2VYND 4XI9A 4J1TC 5JASA 2WKWA 3QU2A 3GZ4A 3DVSX 3RSOA 3T5CA 4C7OA 4RY9A 1LRLA 3U13A 1X42A 4XLTA 1VJ0A 5HSGA 3ED1A 4WN9B 5J5AA 3RLIA 1JU3A 1MB9A 2OILA 2O1EA 2Q7XA 4AK9A 2ZB7A 2QF7A 3OJOA 3EPRA 1QG2A 1WM1A 3U4IA 5CVDA 1IULA 4R2MA 2BGTA 3AFMA 2BN4A 2X23A 2NXCA 5CYOA 1GQFA 2D3WA 4XDHA 3B6MA 5AJHA 4Q7JB 4EJFA 2F1KA 2ZRKA