1BZ9A

Crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
273
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CLASS I HISTOCOMPATIBILITY ANTIGEN)
publication title Structural evidence of T cell xeno-reactivity in the absence of molecular mimicry.
pubmed doi rcsb
source organism Mus musculus
molecule tags Murine class i mhc/peptide complex
total genus 64
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bz9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1bz9A01
2MSPA 4XXCA 2OZ4A 1EEYA 1FNSL 2Q87A 3FT3A 5I8OH 3ULVF 2D7TL 4ZNEE 2DQUH 1G6RA 3KPSB 1Q72H 4B41A 3QI9D 1NGPH 1UWXH 5CWSA 1F3RB 4NBZB 5HD8C 2RAMA 3RWGA 1NKOA 2VDRL 4RFNB 3VA6A 1RAMA 4ALAH 5KSAB 4PJDF 1KCUH 4YDIL 2IH1A 4LEOA 1IGCH 2HVKA 1UJTA 3MRRA 1X7QA 2NY5C 7FABL 1U8IA 2PO6D 3TF7C 3BIKA 1RFDL 1P7KA 4NO2A 2ED9A 3O4OC 3AY4C 2VDKH 4X80H 2W65A 2BC4B 2B8OT 1G1YA 5F6HJ 1ND0A 4YHLH 5I1GL 3BKCL 3GMRB 2BVOB 5TH2A 3D39D 3WNNA 15C8H 1KENH 3UYRL 4Y5XA 2BVPB 2SEBA 4LCWD 2UZXB 4H1LA 2OL3B 1NAKH 2AP2A 3GRWL 5TPWL 4FQXA 2PYFA 4N1CA 2CKNA 4NQEB 4NZTH 2BJMH 3MMEB 3PJSA 4L3CB 3GKWL 5ICZA 5F7HA 4ZAKC 3NCFB 4G42A 1M05A 3SDYL 3I84A 4OZIF 5EORL 4BUGA 2G75B 4MJ4A 2Z4QA 4AK1A 2L7JA 3DIFA 3D9AH 1CXEA 3L3OA 4P9HL 2ERJB 3IJSB 4NN7C 1JZ3A 2OI9C 4QHLA 5CEZE 1MY7A 2ICEA 4DAGH 3K80A 2X4QB 4RCAA 5LGJA 4P2OC 3OPZH 3D85D 1N4XL 1X4XA 2ARWA 1G7JA 1RUQL 3PABB 3MJ7A 2V7HA 3SBWC 4M7JH 4V1DD 1ADQL 3K1DA 4UDTB 2E7LA 4IMLB 1IC4L 4W6XB 2YD8A 4ZTOH 3UPRB 1BECA 3D2UB 2DF3A 3SO3B 3I6LE 4FABH 1X3DA 5T33L 3WIIL 1IQDB 5SX5H 4M7LT 1JWMB 5KOMC 1NLDL 1JRHH 3WNOA 1N5YH 5KBNC 3REVA 4MYWB 3H42H 5AD0B 1T03H 3MCKA 4N5ED 3C60C 1NBZB 5F9AC 5JUEL 5KANG 1QKZH 4F7MB 3WHXA 4KAQL 3K2UL 1TZHA 3TNNA 4CNIB 4JRXB 4KXZI 3KLHD 3VMPA 4GRLA 3ZTNL 2HT3D 4WDIA 4GSDL 4WGWB 3V4VL 4BSWA 4Y89A 3LRSA 4PLNC 3P0VL 4K7PL 5ICXA 4O2FB 2VXTH 1J1XL 2AK4D 5ISZE 1OAKH 1KPVA 2X4PA 3L3DA 3TBVB 1KJ3L 2OTWA 5EUOF 1UG9A 3FKUS 1OP3K 1JNNL 5I8EA 5H94A 4M3KB 5MP6L 2C3GA 3LS5H 3E0GA 5GGRB 1KXVC 5KSUA 5FYKL 1W72L 5IMLB 5AYQA 1CGTA 1AJ7L 3KPQB 5FHBL 4XCCL 5TDNB 2HRLA 3MCLL 4OIBA 5C0BA 3MNVB 4WHTB 3SOBL 4Z77A 1F3JB 5TE6H 3QZWG 4LGRB 3P4NA 5C2BH 3MRKA 3TCXA 5F1NA 4QOKD 4D94A 3OB8A 1RZ7H 2VQ1A 1OGAD 2NPLX 4LU5H 1U58B 2PTTA 4PJCF 1MCEA 2BVUA 4JJ5A 2GITA 1CXHA 3UROR 4PJ9D 2YXFA 3QUZB 3WIFA 2OLDA 1T1WB 3WUWG 3ZTJH 2E7LE 3BJLA 4X7TB 4EDXA 1B88A 1MQ8A 3LKSA 1QOKA 3WJJA 3DGCR 3QXDB 4XH2B 3GSUB 2VKWA 4WW1B 3MRGB 3U4EB 3O41B 3QZWB 2D7QA 3FQNA 3UC0L 2Q8BH 5IFJB 5J89A 1AY1H 1CGVA 2P7TB 5E8DL 4JPVL 3TZVA 2XTJC 3AS3A 4XTRD 3WUWB 1LK2B 1Q0XL 3ARGD 3LKOB 3T2OA 4KJQC 5CSGA 3TV3H 5ALCH 1MLBB 3PQYA 4X6CA 2ZUWA 1ZKAA 5EZLB 5CEZH 4LPVA 4F3FB 2OZ4H 4HMCA 5LWYH 3MRJA 2B7DT 4YWGH 1AQKH 3AAZB 4FQHA 4GRWF 4I5BA 5FGCB 2XOTA 3DX6B 5LAXA 1G6RH 1HSAA 4LSQL 3UJIL 3N50A 1QSEA 4XZUA 3PXHA 2F54A 4MS8D 4QF1A 2EKSA 5F9DC 3ZE1F 2DQJL 4JM4L 4PJGA 5EZJA 4HUVB 4U1KB 1RIVL 1CBVL 4HUUB 1KCKA 3FT4A 2G9HB 2LAAA 1U36A 2DQHL 4E9LA 3HHRB 4EOWL 3MUHL 1B4JH 3RP1A 2Z91A 4PFEA 2YSSB 2Q6WB 3NFNB 1FIGH 5KSBF 2CPCA 3OKOA 4GW4B 5CGYC 3LKQA 5C0BE 1MCPL 1RZGB 3BPLC 4NRXA 1IGTA 1WZMA 5HYQA 3LIZH 3I6GB 2CMRL 4LPTA 5D6DA 4JM2C 3L7EA 2J8UB 4UILH 4YPGA 3QH3B 3VFUB 2BDNL 3VXMA 4D3CL 1EMTH 4XGZA 4UIKH 1K6QL 2FL5A 4HS3B 1NC2D 4PTUB 1NGWA 4WCYH 2HFEA 5J6HB 1WITA 4PIRF 3O4OB 5CD5C 1WWCA 4MVBA 3UJTH 1IFHL 1XR8B 1U2CA 3O2DL 3VRIB 1K85A 5JW3H 4XBPB 1S7QB 2AJZA 2C1OB 4H1LH 4BKLA 1HN1A 1UXWA 3BRDA 1D5XA 4ZUUB 3UP1A 1OAZH 3DROA 1WWAX 4LLYB 5I1JL 4NQXB 3NCCB 3FTGB 5EO1A 4KROD 5FCUH 1C5CH 3PIQB 3UO1L 3OGCB 1U2HA 4Z7WF 4ZAKB 1KTDA 3RIAF 5HYSA 1JNHB 5HI4D 5I1LB 3TVMA 1C5DA 1FFRA 3V6FA 5FECB 4MA8H 4X6CE 3PQYE 4IOIB 1DUZA 2XWTA 5C0ND 5MEQB 1J0HA 1TZIB 4NN7B 4CVZA 4OGZA 5C07D 4Y8AA 2OI9B 3M8OH 4QXGH 5DJAA 5DEGA 4MXVE 3T0DA 2Y6SD 4PUBL 2COQA 1QSEE 2BCKB 1QFWI 3NA9H 2F54E 4P2OB 1J5OL 2EYSA 4UOJA 1MIEL 5L9DH 3GK8H 3CDCA 4Y2DC 5HHMD 4PJGE 3V7MA 3KWWB 3MOBH 1V05A 1V7MH 3KYKL 1NMBH 3LRGA 2OQJA 2QADD 3HPJA 1S7TB 4PG9A 3SKMB 5CJXC 1CR9L 1BX2A 1G9NC 1LEGA 2YRLA 3C2AH 4JKWA 1OOAA 1HDMA 3A0OA 3VXME 1QD0A 5C0AB 1RJZA 5IV2A 2PW1A 5KJRH 4M62H 3MO1A 3QDMD 4WGVB 4UT7H 4HKXB 5BMFH 1MCOL 2X4UA 4BH8A 2X4TB 3OR6A 3ZYOA 3F58H 3C60B 4P2QD 3WMSA 3WS3A 4Z8FH 5ERWB 4JQVC 1PLGH 1CFVL 2HFFB 4HGMA 2GJ6A 1K2DB 1S5HB 2HKFL 2NNAA 3F62A 1KULA 1PJ9A 3PNWB 3RU8H 4MJID 5L2KA 4R0LA 1QLEL 3SY0B 4NHCH 3O3BA 3CSYA 3HE7C 3ERYA 4FFZH 3MUZ1 4JKPH 5SWZB 5JW4Q 3W81A 4LRIA 3C6LD 4NWTH 2AQ3A 1VADA 3A6CL 1ZGLA 3MFFB 5JA8B 2Y72A 5GGUB 1E0OB 2DI9A 2JTDA 1YMMB 5J1SC 2OL3L 5H8DA 4KTEH 4D0DB 4OFYA 2DQFB 2CXGA 1N3NB 2AXJA 5DO2D 2MCG1 3VXQA 1CQKA 1I3UA 3L1OL 4KC3B 2QQNL 4WJ5A 1Y6NR 1J7VR 1KV3A 3EYVB 3MGOA 4G8IB 5DUBA 4Z76B 1F58L 4TUJA 2FDBP 3O3AA 3ZYJA 5ID0B 4HJGB 4JY4B 4MQ7A 1IEAA 5J13C 5L0QC 2EIBA 4G6FD 2WINA 5SX4H 4WY7H 4DGVL 3DURB 5T3ZE 4OZFG 3W5NA 2BXZA 3FT2B 2BSTB 2NXZD 4PJXA 2PKDA 2R2HB 4A6YA 3DXAB 2XZAL 2XTJB 4NKMA 3ARZA 5CBAA 4YAQB 4M1CD 3P4MA 4K8RH 4NQUA 4RAVA 2H26A 2BXYA 4MA3A 4ZUSA 1ZA6A 1JPSL 3SDCC 2GJ6E 4OZFB 4QRUA 5L7XL 5GIRB 1A14L 2XZQL 3EZJB 2VXVH 2OR9H 2VXUH 3PGFH 4KVNL 5JXAH 3DSFL 5TE7H 1HWGB 2R9HC 2XXCB 1DUYA 4GLRH 5C71A 4WRLA 4APQC 3EUUA 1CVSC 1U3HC 3T2NL 4DKEL 4X99B 2O5YL 2IAMC 5D1ZD 1X5FA 2BNUA 2AEWA 2F19H 5D96C 4M1GH 4OSUH 5GS0H 1XFPA 3CLEL 1GAFH 4Z6AT 1X5HA 3BPLB 3F7QA 4JRYD 3NCJL 1VGKA 5EH1A 4JM2B 4JANB 4D2NA 5JZ7C 2ENSA 5DLMH 3QDJB 2IPTL 4JN2A 2Y23A 1I8LA 3VD3A 2KL6A 1A0QL 4KMQA 3PHQB 3KS0J 3F6IA 1FAKT 2Z9TA 2Q8AL 5JXED 3FQXB 3BZDA 3HUJB 1Q9LA 4R7DA 4Y19B 5JPNB 3RGVD 1NH6A 3IAQA 4N5UA 1RY7B 4JZJB 2ICWB 2ZUSA 4Z95L 3SKOB 1A6AB 3U0TB 3AS1A 3VMNA 1DDHA 3HG1A 1JV5B 5EOTA 3V95A 5BRZB 4PJXE 3VFWA 1T20A 4LSDA 5T3XE 1INEL 4XPAL 3W0WB 3LKNB 3ZE0E 3H7LA 5D7IB 5E6IA 1UM6H 4KKAD 1DQLL 2UYLA 5ANMB 1I1CA 2A6JB 1XGRA 1HNFA 1NCUA 2MTPA 5EU4A 3S88H 3BH8A 4L8SA 4LDOB 1KTLA 2QKIB 3EYFB 4ZS7H 1LO3H 5H37H 3T2PA 4RFEB 1NJ9B 3OR7B 4Y2DB 4YHIA 1F5WA 5F21B 1MAMH 2XWJB 1FFNA 4EBQH 2B4CC 4LBEA 3VXSB 4XP5L 2FX8L 3T1FA 3VDBA 5T3ZH 1LE5A 5C1MB 3JV6A 4LSUH 5CGMA 4MAYD 3SE3C 5DJ2B 1NAMB 5KS9F 4X5WB 5MEOA 1U8LA 1OGTA 3P4OA 1YUHB 5BS0D 3WBDA 1VEMA 1IEBB 3H9YA 2W60A 3WKML 3G9AB 1AXTH 3BE1L 5F7LB 2W9EH 4Z7UA 1SEQL 3QJFB 4HWBA 2ZCLL 4IRSC 5D7JD 5T5FH 5BQ7B 1A6ZB 3DECA 4O02L 4AYFA 3MRBB 3P77A 4P5KB 5C86A 3C8KA 3HG1E 4GW5A 4YDLC 2WBJC 2NY5L 4Z18A 1CICD 4XP6L 3DI3B 4JO2H 3QDGB 4LCYA 3TM6A 2A6IB 3HE7B 2F5BL 1TJIL 4QRPA 1ED3A 1ONQA 3A6BH 1OF2B 4R8WH 4OCRL 5D5MF 4NP4L 2Q76B 2YD4A 2EYTA 3TCLA 2EEAA 4BK4A 3P9MA 4WIQA 4HIJB 3AXLA 1TZGH 2EIZA 5TF0A 1HCFX 2M8XA 4OLZH 3QIWC 5LVEA 2DKMA 3IU4H 5D71H 1KBGH 4AIZB 1LHZA 1JYWA 4RZCB 4ZFOA 3EOTL 4YFDB 5DRXB 1BBJB 5HHNB 1FORH 1LVEA 4JB9H 9CGTA 4L9LC 1VACB 1ZLWK 1MVUB 1KB9J 4TUOB 4P59H 1OY3B 3BH9A 2NTFA 2I9LB 4GQPH 2VE6B 3OZ9H 1IGMH 4UV4L 3MYJB 5DUMH 5J13B 5L0QB 1HQ4A 2UUDK 1FH5L 4Y5YA 1PQZA 1RZKH 3QHZH 1JF6A 1OAYH 5T3XH 3RPIA 4A6YH 2J4WL 4XWOD 3OJ2C 4PV8A 2FEEL 4X6DB 2F9BT 1QYGL 4XPHH 1MCIA 5KVFL 5EOCJ 1XAUA 4Z7UE 5F3HA 1A1NB 3BZ4B 1ZHBB 2EDLA 1E4WH 3GSRA 3RUGF 3MRCB 3U0WL 2FEDD 4ZSOB 3SKJH 4HFUL 3ULUD 3SDCB 3CPLA 4J4PC 2DB8A 3EJZC 3DGGB 3NN8B 5FUZL 2HH0L 5DJDB 1HYSD 2C3HA 1QRNB 2UZIL 4PJHB 3I6KA 5DQDL 4Q6YA 4XP1L 4LPCA 4QRPE 5F7EH 3U79A 2VQUA 4DOHE 2VSCA 5HHQB 3NVQA 4APQB 1HKLH 1JZ7A 1FG2B 4JDTL 1U3HB 2DQGL 4HAFA 4AJ0A 2IAMB 4KQ3H 2HFTA 2DL9A 1FE8L 5IEKA 5D96B 2HLAA 4HKZA 3BXNA 4ETQA 1PG7L 3S34L 1JGEA 3IU3B 4PR5A 1YY9C 4XNUH 3RJQB 2BOCA 1I1YB 5FYJL 5INCA 3JTCA 4RWHA 2FYYA 2R8SH 4UUJB 1B0GA 1XGYL 1MNUH 4HWUA 2QQQA 4J8RA 3JWOH 4YDKH 2XZCH 3S35X 3ULVE 2CIIB 3Q2CA 2DIBA 1XGTB 3X13B 1T4KB 4EN3C 3CXHJ 5ITBH 4J7RA 4IOFD 1X5KA 5IMKB 3T0EA 2EDJA 1HQRA 2G60L 3SGEH 2VOTA 4XNMA 1UWXK 3C6SB 4HS8H 2AV7A 3MUGA 2VDMH 5GRVK 1RUPH 3TJHA 1HHJB 3PWPB 3S98A 4X6EB 1IM3A 1BIIA 1O7SA 2A0LD 2P5WD 4YHZL 1S7RA 1Z3GH 2ESVA 1MIML 5CSBA 1JZ2A 2BY0A 4OTXL 4WFGE 3CUPA 1KCVH 5CSZA 3CIQA 3UTTD 3TIEB 2IBGA 3MA9L 5EU3B 4IRZL 4YLQT 4M9PA 1QEWB 2KQMA 3STLA 2XY1A 2X9YA 1G7PB 4QY8A 3SHSA 5AUMA 3V9FA 4PJFB 2EC9T 3MRFB 5D7LA 5CD3B 4Q2ZA 1HXYB 1I8KA 3QI9A 1GJIA 1Q9KB 4C4KT 2YZ1A 3TBTB 5DHVH 3K8MA 4AENA 1BD2D 1U8MA 3BGMA 4PJIB 4AEFA 3CAFA 5HI5C 1SYVB 4OAWB 1SHMA 3I75A 1N6QL 5EUOA 5AG9A 1J0ZA 3MZGB 3S6CA 2FECI 4BYHA 4YR6B 3RIFK 4MD5B 3HNSL 2EDYA 2PO6A 3IKCB 1L7TH 4ODVH 5E2TH 5E99L 1PAMA 4HWBH 1XGUB 1OCWH 1YC8A 5IB3A 2GSGA 5IGXH 4O58L 3IRZA 5JHDB 5DK0A 4NZRL 2UWEB 4QYOB 4JFHD 1VB9A 5ACLA 1J8HB 5CZXC 3CFJA 4E0RA 1IVLA 1MRFL 2JB5H 32C2B 3BAEH 4IRSB 3HKFA 3C9NB 4PJCA 4K7FB 3KDMB 2BOBB 4W68A 1JWUA 3D39A 3DUSB 2J8HA 3T0XA 5DMGC 1F6AB 1SMAA 3T0EE 4JFEB 4LCWA 1B2WL 5K9JH 5IOPA 4G5ZH 4YDLB 2WBJB 3U1SH 1MCJA 3KLAB 4JREC 1AIFB 3HMWH 1JMZA 3T1WA 1XCTA 4U6YB 4X8JB 5DMYA 4F7CA 1OT1A 5LQBL 1BWMA 3H0TB 2H3NB 3KPRD 1IARB 2ADJA 4GG6A 1N7ML 2I24N 2ESVE 5JPMB 5E5RB 1YEEL 3O45A 4P5MB 4X7SL 4JO4L 1KT2A 3IDIB 3FO2B 2X05A 3S9DB 1Q9WB 3NOIA 4PDCE 3DX7B 4HT1L 3QIWB 3C5SA 3X14A 3O0RL 1EFXB 5E2WH 2FH6A 2YD3A 1X4YA 2JK5A 3O4LB 1J1PH 5SX5K 1BFVH 1AHWA 4MQXC 4KKBC 4DGIL 1JP5A 4GMTH 3ULVH 4WW2F 4PGCA 3MLXL 4L9LB 1W0WA 1FGVH 4V1DA 4LRNL 3BPCA 1U8QA 4NZJA 1JPGA 3BVNA 2G5BA 5IM7B 1J12A 5IT2H 3MPCA 3NIGE 5EUOE 1HIMH 2BHUA 5J6GB 4KY1L 1GGBL 1HHIA 3BP6A 5EPMA 4LCIL 5AAWA 4ORGA 3MRMB 4E5XA 5IVOA 3MYZA 3CH1A 5E5MA 4MNGB 4R3SA 4FFYL 4KK8D 1BWWA 2FZ3B 2CDGB 4HJ0D 1B90A 1EZVY 4N5EA 4NHUB 4MJ6B 4PJCE 1F13A 1A6VL 2BVQB 1JZ4A 3D39E 3EJYC 4LDLB 3MFGB 1WFTA 2JIXD 1G9NL 4R90L 4K2UH 4XBGB 4HZAA 3OAUL 4LCWE 2LFGA 4G8EA 4M48H 4JR9H 1Z0MA 4R9HA 5CBEB 1NAML 4PGBB 2P24B 5KZCD 1MPAH 1OAXL 3O8XC 4YQXL 4URTB 1MLCB 1G0YR 4KKCD 4FG6D 5K9KA 2AK4A 2R0ZL 3GHBL 4NNXA 3GI9L 1MCRA 1ZV5A 4DCQA 4GG6E 3QFJD 1S9VA 3S8WA 5EZOH 3LHPL 4XNQB 5FYKD 3IF1A 2HJFB 2NXYC 1AXSA 3EYOB 3QWOA 3L3KB 4U1JA 3WFBL 4I0PC 1GGUA 1I1FA 4WI9A 4NO5A 3VXUA 1FZOA 1ZEAH 4H26A 2AEPH 4CGTA 4QO1A 4JDZA 1J1OH 2XQBH 4QOKA 4Y2OA 1OGAA 1T1ZA 5GGRY 5JIHA 2X7LB 4V1DE 1LEKA 2IBZY 4JLRB 4PJ9A 2F58H 4ELKB 4DZ8A 4H88L 5FHAH 4MNQB 2IBBA 4Z7VA 3FO9A 4Y1AD 3C8HA 2I9TA 1UACH 3ZE1E 5K9QG 3NZ8A 3QIBD 4EN3B 1ZE3C 1TTGA 1ZLVH 1UM4L 1A8JH 4LCUB 5DJYA 5IHZB 3GGWB 1C08B 4OZ4A 4LNRA 1VGEH 3HZMA 4XRCA 1MH5B 2WLZA 2Z8SA 1KPUA 2HVJB 4LLMA 1YDPB 3HR6A 4S0UC 3WIHA 3ARGA 2XFXB 4XNYL 3DI2B 1S8DB 1JHKH 1UB6B 2BP3A 3VWKC 3V5KA 2ITCA 1DZBA 3EGSA 5I1IH 1RZJC 4Q9RL 5SWSB 1U3ZA 1KLGB 5ICYB 3HE6D 3BO8A 1PVHA 4JFFB 4LFHD 3DV6B 3HTLX 2Z31C 1WBZB 3ROLA 1FYHB 2RBLA 2DJ4A 2R1XB 1P4LB 2AK4E 4OV6F 2BERA 4HUXB 5EBWB 1MHPL 4LLQA 3ARED 1FV1B 4K3EH 2R1YA 4QRTB 4OM1H 3TT3H 3ULSA 3U7WL 2NY2D 4ODHL 4QXTB 3O6ML 5DVMA 5ABDE 2NYYD 5H2BB 4FNLH 2C5DC 1JPFB 4HBCL 4IS6B 1F6LL 2P8PA 1NBYA 1G7IB 1U8JB 3PL6C 2DM7A 5T1MB 4C58B 4QOKE 4TSCH 1BZ9A 1OGAE 1NC2A 1K9TA 4AG4H 3TFKD 4OZHB 5HHOD 5EU7E 5JO5A 1X9QA 1JGVH 1BEYH 4FQJL 4Z7VE 5EU6D 1ZOXA 5GJSH 5FUCC 1FFOA 3QJHA 4N0CD 4UQ3B 4WI6A 2YPLB 3OJDA 5HVFB 2I5YL 3IFLH 4I4WB 4XB7A 5I8CA 3NCEB 3DRTB 2R2EA 2NY3D 4MD4B 4K9EC 3QFDB 5DC9B 3RZCD 4PLJC 3U9PH 3PV7A 3IS1X 4JREB 1YEKH 2EZ0C 5I8KH 4RAUA 5IK3B 3CX2A 4WO4C 5DMIL 4PYGA 2R69L 4PJ8D 3GMPB 1IAIL 4TOYL 5E7FA 1T3FA 3BKJH 3TT1H 2NZ9C 4FXLA 1LO5B 5E95B 1CGSL 1OSPH 3P73B 5C07A 1MCCA 4KRPD 1JI2A 1II4E 1X5ZA 2MFNA 4ENED 3ZKNC 1EVUA 3HPLB 2FLRT 3L95B 3FOMA 3QA3A 2VH5L 4BZ2H 1WIOA 4OIIH 5CJQH 5FA4A 2VLRB 5FYLL 4LHJB 3S4SA 5HHMA 4L8DB 4LL9A 2JB6A 1EV2E 4G80A 5EWIH 5D1XC 1XF3A 5FGBA 2DD8H 3DYMA 4J3SA 3WXVH 2VITB 3QNYB 5IB5A 5I1DB 1EAJA 4OUUB 2YOCA 3RWDA 1NMAH 4LOUC 5HYJD 4KGJA 3NZHL 1F42A 35C8H 3D87B 3NAAL 1K5NB 4I8DA 3G6JA 4QWWD 3E8UH 3QDMA 4S1SL 5CILL 2C7UB 3B2UC 1V7NH 4U4BA 5BZWB 4Y16C 3Q6FA 4UTBL 3VXNB 3UTQB 4W6YB 4OFDA 1D6VL 4GXVH 1ZGLP 3KPSD 1Z0NA 2XA8L 3HFMH 1WWWX 3RWEA 2B4CL 4P2QA 5DJXA 5LBSH 2ZCKH 3ZYIA 1PEZA 1OPGL 3JXAA 3OG4B 3K74B 3KPLA 3O2VL 3IVKA 4U3CA 5HGBB 2B20A 1YPZB 1KJ2H 2YPKB 2GYSA 5E94B 3SPVA 1WUNT 1KOAA 1P84K 4MJIA 5C7XH 4IIQC 3ZL4L 2J6EL 3O8XB 4FQQB 1G7LA 3GBNH 3RAJL 4U0RC 5FF6B 4BQBA 2DTSA 3LEXB 4QT5B 1U8PA 1OTSC 2DOCA 2AJ3A 1G7QA 4Q0XL 1Y6KR 5B4MC 3GSWB 4R2GC 3MROB 4KZDL 3C6LA 4XC1L 4X9FA 1RVFL 4ZOEA 1XZ0A 2CDEA 4G9FB 1CQYA 3GJFA 1P7HL 5C07E 2NXYB 4LSVH 4I0PB 4P48A 5ITFA 5C08B 1GYAA 1S78C 1AR2A 4L5FH 3B5TA 4KI5F 2PCPA 1KN2L 4FFWC 5HHME 4LPWA 3WLBB 3GIVA 2QQKL 2IFFL 5GZND 3PUCA 2VZTA 2V5MA 4HS6B 4U1LB 3HNTH 1FYTD 4OM0H 3SQOL 2VR9A 2X1OA 3HMXL 3O6LL 3OKMB 4FP8H 2FGWH 3WNMA 3KYMA 4FQLH 5FO8B 3F5WA 2R29L 1CXFA 3G04A 3AMKA 4JKLA 3I02A 3G6JE 2HG5A 3QDME 3WIHH 2PNDA 3IETB 5I15L 4JFXA 5B3JE 5IJVB 2V2WA 3CD4A 4DN3L 1T5WA 4HC1A 4P2QE 5GZOD 4GG8A 1FAIL 3TIDB 4J1UA 3BDYL 5I73C 4HIHA 3VWKB 1SJHA 3BDBA 4NOFA 4JN1L 3OF6D 5EC1A 4Z78A 1S5IL 2XQYK 2XPGB 3MXWH 3D2UD 4JO3L 1BFOB 1R24B 4MJIE 4BH7A 1F4XL 4OZGF 4QCIA 1E27A 5C0FA 2Z31B 1KCLA 1MF2H 1A02N 4OLWH 3NABL 2HWZH 4OLUH 2Y36L 1Q94B 1IC5L 4LGPB 3ZT7A 2NY1C 4Y4FB 3TO4C 1KFAL 4U1MB 4LSPL 5D1ZA 2Q3AA 4WFHD 4GBXC 5E2VL 4XPFL 5GJTH 1VFAA 5DVKA 3EYUH 5D5MA 2VNCA 4JRXD 2AI0H 2HJKA 3MLRL 3B83A 4JRYA 4M5ZH 3U7YH 4HIXL 3PDOA 1VSCA 3FQRA 3G6DL 4YUEL 4CU8A 4C57C 5E1AB 4DKDC 1DLFH 3PWVB 5DZLA 3RI5K 3EDDA 1RHHA 5L6YL 2R23A 4DVBA 5JXEA 1ORSA 1IE5A 4DN4H 1TQCC 2Q86A 3TBWB 3RGVA 1C5BH 3SDDA 1KJMB 3IFNL 2W91A 5GISH 3AMLA 1V8HA 3ARPA 1UFUA 5DI8B 3QXAA 1YEJL 4OF8A 4YXKH 3VFOB 4CVXA 3CDGA 3OKLB 3HC3H 3JTTA 2BFVH 5GGSB 4CDGC 4WO4B 4LKCB 3SJVD 3GSVA 2DL2A 1NBVL 3FB6B 1HNGA 4QLRA 2FJFB 5DT1H 1M4KA 2BNQB 3BP5B 2NY6C 4TNVK 1KUMA 3MNZB 3T2QA 1RUAL 1GZPA 3TN0A 4JHAH 5K33A 3WN5C 1KCSH 1OSZB 1NDMB 3QO1B 4QRQA 2M2DA 4LPYA 3RKPA 4P4KC 4E41B 4NO3B 5KANI 1B4RA 3LH2H 1X44A 1BVKB 5D1XB 3O3EB 3Q48A 3RVUD 5JOFB 3ARBD 3ZHKA 4ZFFB 4NGHH 4U49A 4TQEL 4MJ5B 4NUGL 5ESAB 4MAYA 4LLWA 4JRYE 1FL5B 4ZS6D 3CZJA 4LSRH 4OD3H 3RY6C 3P9LB 1ZVSB 5I1CL 1FVCB 4OLXL 5B39G 3U6RB 3DRQB 2NX5B 5BS0A 4YHNA 1G9EA 1FIEA 2CLRA 4ZUTB 4Y16B 5JOPD 4DUXA 4U31A 5D7JA 1MFEL 1WTGT 3E3QA 1KNOB 5HD8D 1D6EA 2JJSA 3OXRB 4KZEH 3MV7B 3E6FA 2GUOB 1YN7A 2B0SH 1RZFL 2DQDL 3I9GH 4HWEL 4PRID 5C6TH 4MXQD 4W4OA 4EQ3A 3MLPA 3PWUB 5B39B 1LO4L 1BZQK 5D2NA 1FPTL 5L2JA 1CICA 4IIQB 3FB5A 1YN6B 3ARDC 2F5AL 3GSXA 4U0RB 3BW9A 4NFCA 3MOAH 2N1KA 4O5LH 1S7XB 4HK0A 3GJFH 4OFVA 3W2DH 2VXSL 4HF5L 1QSFB 3DMMC 2NY4D 5ESVB 4R2GB 3MLTB 1SJEA 1IZJA 1JZ6A 1HSBA 1MEXH 4M5YH 4ODTL 4AMKL 4BFIA 1HHHA 5F9JB 1GGCL 4N8CL 4GMSL 1ZT4B 2V6HA 4XMPL 1ZHLB 1FL3B 1YEFL 4LLDA 1UXSA 1QBML 1RMFH 1OB1B 1CL7H 1U8KA 1MJ8H 4K7PX 2RCSH 1XF4B 1OM3H 1AD9A 3B43A 2DBJA 2VWEC 3F7YA 4ZPVB 1KEMH 3IFOA 3RL1B 3WS6A 5CINH 5FEBA 4KK5D 4LQFL 3NFSL 4JFQA 3MQIA 4HHAB 4HUWB 3L3JA 3CLFL 4LQ1A 3IDXL 3ZKXC 5BS0E 1VA9A 4P2OD 2R4RH 1BQHA 4F37F 3AUVA 3VFPA 4OGAC 2W38A 1EGJA 3QUYC 2ZKHL 3E3QE 4NJ9H 1Z2KA 5DJ0A 3GSOB 5I73B 3BYTA 4ETYA 5D7KD 5GRJH 1NFDB 3RDTC 2CUHA 2VLJB 2PF6A 3KPPB 5D2NE 2EYRA 5KTEL 3D0LB 1HWHB 1PY4A 5C0AD 4OCYL 5CJOH 1UB5A 5MENB 2F15A 1ZS8A 2Q7NA 4G9DB 4NNPL 4HWZA 3CFKA 3WFHA 4QRSB 3KPNA 3KPOB 5C0DA 1OVZA 3TO4B 1P2CB 3UYPA 3GIZL 3C60D 4GBXB 3ALXA 4KK6C 1VKXB 3WJLA 3I3EA 1GIGH 2AAVA 5GRUH 1S9WB 4LAQH 4XMLH 5D2LF 4WHCA 3LZFH 1UVQB 5AZ2H 2D31A 4FTVD 1A7QL 1T21A 2OX5A 1DBKL 2JJTC 4OKVB 3K4ZA 4PLKC 4YXLH 2RQ8A 2VIRA 5K59F 1PG7W 4X4XA 3LB6D 1DFBL 1EO5A 5SWZD 1OARH 4H8WC 1A9EB 3ARVA 2VAAB 4WW2A 1TQCB 4R4FL 1NEUA 5DK2B 3HZVA 1J11A 2CQVA 1QPPA 1AFVL 3H9SB 3U2SB 1YMMD 3VGHA 3MLVL 1PBYA 3BSZH 3GJEA 3D25A 1PSKH 4XP4L 1ITCA 4XCEB 5KVDL 3O9WC 1WC7B 3WFDL 2GJZA 4LASL 2FB4H 1JUFA 4XPGL 1FCGA 2X4NB 4JFYB 1MWAB 25C8H 3Q3GA 3QNZA 5IF0B 1G7HA 1K4CB 1P1ZA 4PJBA 4YFLI 4F80A 4DKAA 2P5WA 4UOW0 3ULUE 3T3MF 5D72H 4GOSA 3MA7A 3UTTA 3SKNB 3RX7A 1SM3L 2MPAL 4GH7B 5GRZA 1AR1D 2NY6B 5DYOA 1H8NA 4HK3N 4N0YL 2H41A 4KUCF 3WN5B 4AEHH 1RJYA 5FO9A 1L7IH 2X42A 3MLYL 1IL1A 5DD1L 4P4KB 2J5LC 3DXAD 4LVNC 1UM5L 1J05A 1H3VA 3FRPG 4LHUD 2PW2B 3L5XL 4TSBH 1KGCD 3T65B 5HBBA 1XGQB 1ZHNA 4WHYH 4RMWA 4JDVB 1IKNC 4PV9A 1H5BA 5AYUH 5I19H 1RZJL 5GS1C 5EOQL 5EU5B 3VXPA 2OTUB 3LEYL 3MV9B 2OJZL 5C09B 4U6VL 3ZDYF 2IH3A 1Z9MA 5C9JB 1HEZA 1M71B 3VU2A 1HINL 1KYOJ 1NCCH 2FBJL 2QEJA 4ZNCD 5I1KL 4FXGA 4ZTPH 3BEWA 4NRYA 3GBMH 4XVTL 2V2TA 3RNKA 1XMWA 3VI3F 3BGFC 1YEHL 2E6PA 2JJUA 2ZUYA 5DDHB 1KPRB 4KHTL 5CGYD 1KIPB 5LXGL 2AV1B 2CRYA 4YHML 3LKPB 3GRWA 1MFBL 3VFNA 4ZO9A 1LNUB 5HVHC 1UADC 5TF1L 1DE4B 1A4KA 4KHXH 5INDA 3ARDB 4JQIH 1KCRL 3QXVA 4LP4A 3CCHA 4PJBE 4YFLF 1FZKA 3BWAB 2ZOLB 4MQSB 2C4FT 2EO1A 3KPRA 2P5WE 3DMMB 4F15C 2IANB 1T83A 3VFTB 1VPOH 5HVWA 4N9GB 3QEUA 4Y19D 3UTTE 4ODSH 3R8BB 1A3LH 4EI6A 3FB7B 3JSSA 1CDYA 4K9EL 3V4UL 5IB4B 1NCAH 2G5RA 5BRZD 1YNTA 3GI8L 2IMNA 1BQLL 4PGZA 1A64A 4S0SD 1S9XB 5M95B 4OV5A 2Y1VA 5ID1B 1U9KA 4NBYB 3W0WD 4YIQB 4MB4A 1KXTB 1I8MB 5JLZB 4G6KL 1WLHA 1BD2E 2HFGL 1ADQA 4M1DL 1VENA 4KVCL 2FWOB 1JF1A 1M6OA 4OCXL 2X89D 2OXHA 4HH9A 3QHFH 4MSWA 3CXDH 1ACYL 3IAPA 3JWNC 4FQ2L 1MUJA 1YY8B 2FX7H 4UBDC 3ZKXB 1UZ8A 1XR9B 2YBRB 1A7NL 1EGJH 3ES6B 2P5EB 4NZDA 4JZOA 1RUKH 4AM0A 3S97C 4Y2DD 3RL2A 3N1PC 3P9WB 4JFHE 1JJUA 2VN4A 5IBLC 3GZKA 1YMHB 2R4SH 3QUYB 3ULUH 2ICWI 1RZ8A 1TETL 4KTYA 1HH6A 2VERN 3SGKC 1BP3B 2JIXA 3RDTB 3T0WA 2GFBB 4GAJH 1K4DB 1S9KC 4B7LA 3PF2A 4XCYA 4AT6B 1FNAA 4XI5C 1CZ8H 2EC9U 5DC0A 1DL7H 1DCLA 1A6UH 1HI6B 2W92A 3NACH 3KPRE 5F72S 3GMLB 3G08A 4WUUB 1CD1B 3QFJA 2DMKA 4NPYB 3T0AA 1ZLVK 2EEBA 4GAGL 4LSTL 2X40A 1IGYB 1FFQA 1AP2B 1W72A 1EZVX 4ZG1A 3HI1A 2CUMA 3SE8L 5DJ8B 5F88A 4L8BB 3EDEA 4F7EB 1A7OL 2F53B 5IIEA 4V3DB 3S3PA 3W11C 2VXQH 1EEUA 1JYVA 4AL8L 3HE7D 3OSKA 3KYAA 2OMNA 4NDMA 1FVDB 3TGXA 1A2YB 2OP4H 4Y1AA 2EO9A 2O5ZL 3QEHB 3QIBA 1IGJB 4N1EA 4JM2F 4X6FB 5B3NA 3G6AB 5C8JA 3HRZB 1INDH 1E6JL 1YQVH 4G6ML 4P23A 4WEBL 3BDXA 1JFMA 5F7NC 3IDJA 3O9WB 4PB0H 4U1NB 3UTOA 1IAKA 3QEGL 3HUJF 1IAOA 5DC4B 1K8DB 5HHVH 2ZJSL 4CN6A 2FJGA 3P0YL 2E9JA 4O2CB 2GK0B 3VWJA 3E2HA 5DD3H 4QTHA 1Q1JL 3D0VB 4X4MA 1L0XA 4OFIA 5HHPA 1FNSH 3QEQD 5FA3B 1ORQB 5IVXA 3HE6A 3CDFA 1A6WH 5D7IF 2D7TH 4PRHB 1CFSB 2AJVL 5F7DA 4PG2A 1EK3A 4ZUVB 2Z92B 1MAJA 1FJ1A 2R0WL 2F8XC 3IDNB 4P2YA 1CDBA 2IGFH 2J5LB 2C1PA 5FOBB 3AREA 3QFJE 4LVNB 2VDRH 3B9AA 4P3DA 4P57B 4TPRH 1EX0A 4YDIH 1CDJA 5FYKE 1OWWA 2DLGA 1UH2A 4PGEA 5CMAB 5C6PB 3HC4L 4Z7OF 5KVEL 4S2SA 3VXOB 5GS1B 5IW1B 1NCBL 3TZVC 4I0CC 3HS0A 4LCCA 1ETZA 3TFKA 5HHOA 3EHBC 1CE1H 1GGTA 3FN0H 4G7YH 4UT9L 5C3TA 2ARJB 5EFIA 5EU6A 1FNEB 3MC0A 4K8RC 4MXWH 4Y1AE 5IW3A 1FL6A 1I8IB 3UYRH 4KRLB 3RKDC 1R3KB 3KJ6L 1LO2L 1R3LA 5TPWH 2OJEA 3GRWH 3FT3B 2BX5A 2R56L 3BGFB 3EDKA 5BOZG 5CKAA 3U7AA 3V5DA 4S1RH 1ZANH 3GKWH 1NLBH 1G6RB 2WAHA 4PBVC 3RZCA 3FQWA 3SDYH 5EORH 3DUUA 5HVHB 3BESR 4QEGA 1S7VB 4HEME 3RWGB 5C0IA 1FZMA 1ZK9A 4PJ8A 5GGVH 2IH1B 4F15B 1NGZA 4LEOB 4X4ME 4OLVL 3OB0H 2HVKB 1XCQB 4OCSH 4NYLB 2VDNL 2LE9A 1EO8L 1T1XA 5IVXE 4UIMB 4X98A 3HC0A 3GMMA 4K23L 5GSRA 2W65B 1GL4B 2DJSA 1JMXA 4JFDB 3MJGX 4Z5RB 1QP1A 1ADQH 2A74A 1MWAL 4OZGA 2ADIA 1YECH 4ODXB 1TVHB 4PP8C 3PWPD 4LKXA 5AG8A 2HKHL 1IQWL 5CEXB 5DD5L 2YHGA 1GGIH 5I66B 1ZT7A 1CDIA 1YNLL 1CFTA 4D0BA 2MHAA 5HYJA 1U95A 3ZKMD 5AZEL 5ICZB 3UZVB 5HI3D 1NLDH 1JNJA 5ISZB 3NCMA 2IPKB 5HHOE 4NRZB 1IAII 3BZEB 5DRZA 1CLZL 3LKRB 4FXKB 5EU6E 3KPSA 5JUEH 3OTTA 1N59B 2VISB 5ALBL 3ARXA 4JGMA 3UAJC 5A1AA 1H3PH 2QSQA 5KSAA 4L1HA 1MCWM 4GSDH 4X6DF 1MQKH 4OF0A 4XVJL 2ZOKA 3LN4B 3BD3A 3ZMRA 3P0VH 4K7PH 1G7JB 4F2MB 2Y5TB 4ZFGH 1I9JL 1J1XH 1J8KA 2V7HB 3OKYA 4R97C 3ALWA 3LMJH 3D3VD 5JHDD 3H2WA 1JL8A 1OQOA 5FYKH 1W72H 2EE9A 1WJ3A 1T66C 4IRSD 4YBLC 1GPOL 5IVNA 4PJHF 2GI7A 2R0LL 2DQTH 2ED8A 4PD4J 2XICA 4OI8A 2BVPA 4JFED 4ELMB 3ILQC 4U6TA 3REVB 2WBJD 4FQXD 3TO2A 4Y4KB 3MMEA 4L3CA 4F57L 4OZGE 2DQUL 1NGPL 3T4AA 3OWEA 4IM8A 2ZG1A 1QFOA 4DW2L 2G75A 3TNNB 3WXWH 5GRVL 1FYTA 5I18H 1YNKL 2XIDA 1WVZA 4J12A 5HYJE 3IJSA 1MCLA 1KCUL 4R0LC 3UC0H 2OSLA 4JE4B 4BSWB 3QIWD 1A7BA 1RJLB 4MLIA 1IGCL 2HRPH 1P53A 5E8DH 1JK8B 1I7TA 2X4QA 2HLFC 2OCFD 1AC0A 4Y7MA 4KJWD 4LRIC 4YZFE 4LVOC 2VDKL 3KPSE 3PABA 3VMOA 1Z6JT 2X4RA 3KYNB 1R3HB 4YHLL 4OD2B 3EW3B 4Z77B 4IMLA 3OF6A 1TJHH 15C8L 1CIDA 3FAWA 5I2IB 1SVCP 5F1NB 1ZA3A 3D2UA 2VQ1B 3QR2A 5DZOA 1NAKL 4WTXA 4UI2A 2GITB 5I30L 4NZTL 3WIFB 1RIVH 1JWMA 3AFLA 2BSRA 4EDXB 1CBVH 1INQB 3WFZA 4RGOH 2DQHH 5AD0A 1CTOA 3D9AL 2EDKA 4G8FA 1MCPH 1FP5A 1CFQB 3UTZB 4F7MA 2LU3A 3SGDI 3PP3H 4OBSA 4ZUWB 2CMRH 4CNIA 4JRXA 2XG4A 2BDNH 4PJFF 4D3CH 1QLRB 1RZKC 1K6QH 4J4PD 1R6VA 3TZVB 5CIPA 4GKNB 3OPZL 1HXMB 1GSMA 2XN9D 3CFCL 3O6FD 4PJIF 4O2FA 4X6CB 5M7QA 1MAKA 4M7JL 3TBVA 3PWJB 1FYTE 3PHSA 4DK3A 1Q38A 4PJEB 2FIKB 3X12A 5F3BB 3H9HB 4FQHB 3RNQB 1IC7H 2C26A 2VC2H 5IMLA 5LAXB 3ME0A 4X9BA 5L88H 3KPQA 5TDNA 1NUFA 3MNVA 3LQMA 5EC2A 1F3JA 5F8QC 2WUCL 2XQYG 2UWEF 4ONGH 1K3IA 1JRHL 3VI4F 3FT4B 1DQQA 4GUPA 1U58A 2C3VA 1T03L 1T22B 4N0UB 4RMTA 3SJVA 4MNQD 4YPJA 4IDJL 4H8WL 4NRXB 4X7TA 1E4XI 5HYQB 1QKZL 5KW9H 3CDYA 1T04A 3L7EB 3CMGA 3VFGL 3HN3A 3LS4H 3QXDA 2FL5B 3MRGA 1J5OH 1JPST 4F7TB 3U4EA 4BZ1H 3O41A 3RUGB 3QZWA 1DBAL 4YBHA 5GGSY 4NCC1 2WY3A 4KPHH 4KDVA 2VXTL 5E8PB 3B9KC 4U1SA 3JWOC 5E4IA 2AJZB 3QDHA 1KF9B 5C0RH 4WFHE 3LS5L 1P7QB 1MLBA 1JCKA 1P4BL 2F74B 2FX9L 4JRXE 5D70H 1JTOA 5F9OL 1U92B 4OUOA 1MJ7H 1WAAF 1EUTA 3V0WH 1PW3A 5SWSD 4FFVC 5H37G 3OKDB 3AAZA 5TE6L 4JFFD 1MCOH 2CD0A 3DX6A 4AQOA 1BPVA 1OAUL 3GJFK 1DUZB 4Y4HC 4RRPG 3IDGB 3CFEB 4U1KA 3U4BL 5CHNB 2G9HA 2HKFH 4X4ZA 5JR1H 5HI5D 2V17H 2FHBA 2YSSA 4OQ1A 4PRIA 1P5VA 4ISVB 4MXQA 4N1HB 3AC0A 3I6GA 2Q8BL 4YXHL 4NC2B 4HIIB 3VFUA 2J8UA 4N90D 3QH3A 2J88H 3TF7A 4HS3A 4R97B 4PTUA 5J6HA 5K9QI 1N64H 2UV3A 1ZHKA 4PG9B 5BO1L 1QFWL 3SJVE 4C56D 4MVBD 5EO0A 3TJEH 1XR8A 3TV3L 4GW1B 2RFXB 1HDMB 4ODWA 1KIRB 5CZXD 1VERA 1FBIH 3LQAC 4XBPA 4YBLB 1S7QA 1ZTXH 2OZ4L 2C1OA 2R2CA 4LMQE 2F8OA 4K3JH 4WEMB 2H8PA 3GMOB 5TGBA 5TQ2L 3MO1B 3O3UN 4UDUA 4NQXA 5I0ZA 1G6RL 3FTGA 4X9GA 3OR6B 1EFQA 2QQNH 3OGCA 5FKPB 1RJCA 1F58H 3WS3B 1JNHA 3S36L 1R5VB 5FECA 1MCFA 4IOIA 2CKBB 3F12B 4K3DL 1B4JL 4X9IA 5MEQA 3LEVL 5EIQA 4ZDHB 1FIGL 4R0LB 3V6OA 4XNZC 5MERA 4TTDD 4UILL 4UIKL 4O00A 4P2OA 4KKBD 4LVOB 5JOPE 1VADB 3UJTL 3TPUB 3T77B 3KWWA 5E00B 1S7TA 5JW3L 3RTQD 5L7XH 1EEQA 3SKMA 3HI6H 2XZQH 3JV4B 4KVNH 1NMCC 4PRIE 4CBPA 3TC9A 3DSFH 4OKDA 3RWCB 3MRQB 1WT5C 2J8UE 5FCUL 1C5CL 2ZUVA 5C0AA 5HDBF 5J3HC 4NWUL 4YBQC 1WWBX 3MUJA 5DUBB 3T2NH 4TUJB 2Y06H 2M26A 2O5YH 4HKXA 2A6KA 1MFAH 3UPAA 1J88A 2X4TA 3ZDZF 4XPBH 4PRNB 3CLEH 4Y5YC 4S10A 3C60A 1T7YA 3KAAA 4WWID 5ERWA 5CIPH 2ZCHH 3NCJH 5I76B 3EJYD 1RQ5A 2V5RA 4QXGL 4GRMB 1K2DA 3UBXI 4YHKL 4P46D 2IPTH 5BOPA 1YEGH 3PNWA 3NA9L 3WNPA 3LV3B 4X5LA 5L2KD 3O8XD 3TESA 3SY0A 3CC5B 3KHOA 2WZPD 3MOBL 1NMBL 2Q8AH 5LGHH 1ZA6B 1Q0YL 2ED7A 3K7UA 5SWZA 4Z95H 3VD5A 2P8MB 3EJJX 3IXTB 3WL9B 3MFFA 3K3QA 3V6OE 1CN4A 5GGUA 2DS4A 3OJMB 4I3SL 1YMMA 1IJ9A 4OZHF 5DA4A 3RVTC 1FZJB 3TNMB 5C08D 2DM4A 2WSKA 4D0DA 4M62L 1N3NA 1DQLH 3D18B 4OFYD 4X4YB 5BVJA 5BMFL 1C12A 5EN2B 3ZDYE 4ZMAT 4P99A 3F58L 1NC4D 2AK1H 1F11B 4G8IA 4Z76A 3QB7C 2FSEB 4PP1D 5D7KE 3NFPB 5ID0A 3QNXB 4HJGA 5I16B 4Y8DC 4L8CB 2D7MA 2DWEA 2EE3A 3RU8L 4JO1H 5C0AE 2NY0C 3FT2A 2BSTA 1NGYA 3B9KB 3DXAA 3ZSSA 4XP5H 4JKPL 3D1MC 3BP7B 3FN9A 4LHUA 1JHLL 2MQ3A 4YAQA 5I1HH 4NWTL 5CZKA 5F6HI 5DR5H 3RPKA 2DMBA 1CGYA 1EEZB 1UCTA 1ZVHA 4OZFA 5I1AB 2P1YA 2IQ9H 2H9GA 4L4VB 2GY5A 5GIRA 4KJPC 1FFPB 5IHUH 2UYLB 4DVRL 1I3GL 4FTVE 3WKMH 3BE1H 2FO4B 1GXEA 1G7MB 2ZCLH 4Y4HB 2E9IA 3THMH 4KRMB 1GRWA 4UOW1 1NANI 5SWZE 1KTLB 4Y4FD 3S37X 3HCVA 4GAFB 4X99A 3L3HB 3RWHB 3H3KA 4YNYA 1TCRB 4WY7L 4LEXL 4HPYL 2NY5H 1QPXA 1YMME 1KLUA 4XP6H 4XBEH 3V2AR 5A3IC 4EUPA 4YHIB 1P69B 4JANA 4NP4H 1CYGA 3IFPA 4LBEB 3BKYL 3VCLB 1GC1H 4ESKA 3FFDB 3T1FB 5DHVB 3PHQA 4K8RL 3ZSTA 1WIUA 2VRAA 1DBJL 1YPZF 3I2CH 4Y5VC 2NR6D 3FQXA 3OMZA 2YD1A 3QSKB 2KZ1B 4Y19A 2CRZA 1N2RB 2PO6C 4JZJA 3SKOA 2NY7H 3U0TA 2VXVL 2OR9L 4LDEB 3PGFL 4B53A 2VZSA 3L6FA 1JV5A 5TE7L 2ORBH 5BRZA 3CGTA 4PLJD 3DXAE 4WV1B 5DZNA 4WENB 4FFEX 1WTLA 2EZ0D 3LKNA 2VAJA 3OQ3B 3W0WA 5D7IA 1UA6H 4O2EB 1KGCE 5C0JB 2XXMB 2B5IC 2Z35B 1RZIB 4WO4D 5CP3A 5ANMA 2A6JA 4MD0B 1U8HA 4UV4H 2F19L 4PRBB 5CS7A 1FH5H 4XP9L 5GS0L 2X89A 2J4WH 1GAFL 2VZUA 2QKIA 3EYFA 4XNZB 5MI0C 4QRPB 1ED3B 1L4IA 3ZKND 4CN4A 1CLYL 4RFEA 1NJ9A 4DOHB 2AXHA 5EO9B 4L4TB 2DQCL 5KVFH 1WEJH 3P9MB 2BSED 1LD9B 3LCYA 4Y2DA 4E41D 2D2OA 3CVHB 3SDXE 1IBGH 2XWJA 3FO0L 2ZUXA 2A83B 5D1XD 4HFUH 5J1AB 3H3BC 5DVLA 4HZLB 2XKNB 1AHWC 4ZFOB 5J12C 5CJXA 2BNRD 2HH0H 1NMCB 2UZIH 5DQDH 4PGDB 1SMOA 4XP1H 5DJ2A 3TLRA 4OGXH 5DJZA 4X5WA 3JWDH 2NX5D 1YUHA 1F90L 2DQGH 3BH9B 4ZOBA 4YFEA 1F8TL 1IEBA 1UM6L 3AROA 3CX5K 1FE8H 3VG0L 2GY7B 2A38A 1HQ4B 3IGAB 3QJFA 4Y5YB 4HULB 1LWRA 1YQ2A 3KXFD 5BQ7A 1A6ZA 3S88L 4Y19E 1A6PA 3S34H 1R3JB 2E8YA 3MV7D 4JQVA 5FXCH 1LO3L 3MRBA 1NCDL 4P5KA 1JWSB 3HZKB 1M1SA 1X5YA 2DTMH 5BRZE 1XGYH 1ZLSH 1SYSB 5IBTH 1F2XK 4N5EC 12E8L 3W0WE 3QDGA 3MOQA 5D7IE 3HE7A 4M6OH 5IHLB 4BZYA 1OF2A 5ANME 1D5MB 2CSPA 3L3GB 4EBQL 2YWZA 3KLHC 1QSFD 4R2GD 1VFBA 5T3ZL 1NGQH 5HYIA 4HIJA 2VZOA 4KK9D 3G9VA 3VXTA 2G60H 4NC1C 3FONB 4AIZA 2VDQH 5DFWH 1R3IH 4KH2A 4RZCA 4S1QH 2IC2A 4Z7OE 3GBLA 1TDQA 5DRXA 3EYSH 5DTFA 5HHNA 1JZ8A 4KRNA 4MA1C 1AXTL 4YHZH 2C4FU 3IB4A 5IEKB 1VACA 5IROC 1MIMH 2HLAB 1MVUA 2P43B 2W9EL 4TUOA 4OTXH 3QO0A 1CU4H 2CKBL 4NNYB 4X83A 5KOVC 3MA9H 2I9LA 4IRZH 2VE6A 3MYJA 3QEQA 1CT8B 2EC8A 1B0GB 2YA1A 3QQ4B 4D8PB 3GMNA 2NY0B 5J9PB 4JO2L 4NC0B 4PRAB 2AJXH 1NCWL 4X6DA 1BM3H 4R8WL 4YJZL 1EHAA 1A1NA 3BZ4A 1ZHBA 5DD0L 3V6ZB 4OZFH 1ZLWH 3MRCA 3RBGA 1NDGA 3TBYB 3HNSH 4NKOB 3IU4L 1HQRB 5D71L 1W8NA 3BRFA 1KBGL 5DA0B 4EDWH 2AV7B 1I1AC 4TUKL 3DGGA 3NN8A 3EIFA 1FORL 4O58H 4PJHA 4JHZA 3QPQD 1BIIB 4NZRH 3GNML 7CGTA 5MEND 2ESVB 4NT6B 4P59L 5A2LH 2JF1A 1FG2A 5TFSH 5BZDA 1U3HA 3OB0K 4P49A 1KIQB 2MQ0A 3R0NA 2ZSWB 4GBXD 2A2QT 1NKRA 4B7IA 2W0PA 3OZ9L 4AEIH 4EUPH 4M6NL 3U48A 1RZKL 5T3XL 3MBXL 4A6YL 2ZZUT 3IU3A 4MS8C 4Q2ZB 2R39A 4G6AD 1I8KB 1MRCL 4NUJB 1I1YA 3PXJA 1DTUA 1I7UB 1U8MB 4UUJA 4XPHL 3BGMB 5I0DA 3E6HB 4M6ML 4YDVB 3TYGL 2UVEA 4X7SH 1BOGB 4JO4H 4DKFL 1BLNB 3PDGA 4UU9B 1E4WL 1QFWM 5B8CC 1AI1H 4HT1H 3X13A 4GKSA 2DYPB 3O0RH 1T4KA 4Y5VB 1KC5H 2FR4B 2RGSA 1ZXQA 3QEQE 2DIJA 2PO6B 1MRDL 3VRJB 3H9SD 2GAZB 4LHQB 4DGIH 3P3YA 3A67L 5IMKA 4DQOL 2YMXH 4BELD 4X6DE 4PRDB 4RIRB 5TDOB 5CP3H 5F7EL 5LKNA 3CFJB 3NIDF 3VRLE 4E0RB 3C6SA 4IHOB 2IADA 4U1GC 1MELA 2B5IB 3PWPA 5FKAB 1QBLH 2QBWA 4XMKH 3ZDXE 2DJUA 3RWIA 4HUMB 4LCWB 3VFMA 5IOPB 4KROC 2VLKD 3RBSA 2E5EA 4LCIH 3TIEA 4XNUL 5IFHH 1GZQB 2CUIA 1QEWA 5MI0B 5HDQH 4PJHE 3TH4T 1G7PA 3O45B 1A3RH 5CD3A 4P4KD 3JWOL 5D7LD 2XZCL 2AJYH 4RWYL 4BUHA 1E4JA 3TBTA 1S7UB 1YA5A 1G9NH 1I3VA 4R90H 1IKFH 1QQDA 1SYVA 2I07A 4OAWA 4D9LL 1AHWB 5J12B 4HXAH 4DZBA 3D85B 4Z7QE 1OAXH 1UCBH 4YQXH 4YR6A 3T4YB 3SE3A 4PGCB 2Z8WC 3MV9D 4HXBL 2QADC 4RMUA 3DBXA 4Z7NF 3GI9H 1WV7T 4HS8L 5IB1B 1XGUA 5J56B 5JQHC 1RUPL 3D3VA 5JHDA 3LHPH 1NFDF 2VB5A 4QYOA 4BQ9A 1F2QA 1Z3GL 32C2A 4IRSA 4CL7A 2IF7A 3C9NA 4X6BA 4K7FA 1KCVL 3KDMA 2BOBA 1TMCB 5FYKU 3DUSA 4E5XB 1LP9A 2V2XA 2PTUA 3VW3L 1F6AA 4JFEA 4R3SB 2WBJA 3KLAA 1AIFA 3B2VH 5D93C 5SWQB 1I7RB 3A6OA 3MJ9A 4X8JA 5GRXG 1NPUA 2H3NA 3PWPE 4WU5B 2X70B 3DMMD 5JPMA 2IAND 3LQAL 4TVPD 3IDIA 2LU4A 3FO2A 1KB5B 1EHXA 4OF7A 1CCZA 1Q9WA 1KJ2B 3DX7A 3QIWA 1PGRB 3QRGL 4YX2H 1S9YB 1F00I 1S9VB 1OCWL 1EHLH 4XNYH 5IGXL 4QXWA 4MA1B 5HXMA 4L9LA 4MB3A 1AXSB 4U1JB 2DDQL 3PP3K 1JGUL 4Q9RH 4K3GA 1FZOB 2EECA 5IM7A 5ADPH 4NKQB 4PJ7B 5DO2C 1TQBC 4QOKB 5HPOA 5J6GA 1MREH 3MRNB 1T1ZB 5K9JL 4BA8A 1PY9A 5EUKA 2E7BA 4I18A 3LDBC 3MRMA 3OXSB 4R6UA 3M1BB 3FO9B 5T1KB 3D3VE 5JHDE 4RMSA 4MNGA 1N0XH 3NZ8B 3EBAA 1AGCB 3CVHL 4M7KH 3G5YB 1G9MC 1A47A 2FZ3A 3WSQL 2CDGA 5HVGB 1ZT1A 4LNRB 2BVQA 1I9IH 2N7BA 4ZFOL 1H9VA 4XRCB 1LP9E 5JIPA 3NTCH 3Q1SL 4JFEE 3UZQA 1J1PL 4J4PA 4V2CB 3CSPA 1I1AB 4RNRB 3PGDA 4PGBA 1A4JB 3ZKSD 2P24A 1ZWIA 2XN9A 2YN3A 4M1CC 3NIFE 3O6FA 1MLCA 4UB0L 4TRPL 2RR3A 2DWDA 5DD6B 3V5KB 2DBLL 3QQ9D 2ITCB 1MCBA 4WUUD 2BY2A 1G6VK 5I17B 1EDQA 5IT2L 3NH7L 4JFPB 1D5BB 2VDPL 4IOSD 3V4PH 1UJ3C 1HIML 4XNQA 4R96A 2HJFA 5F93C 3ESUF 3EYOA 3IDYC 1KN4L 3L3KA 4X0KB 3RY4A 1CGXA 2LVCA 4NQSA 3VD9A 2AVGA 3VXUD 2YR3A 1IM9B 3X3FH 2X44D 4BFEA 2R1YB 1IAIH 4TOYH 2X7LA 1OHQA 3JZ7A 4KDTC 4M8QA 3AU1B 4ELKA 4KKLD 4NSKB 4PLKD 4MNQA 3VG9C 2XY2A 5B8CB 5F96L 4RX4D 1NBYB 3QIUC 4EN3A 5L8JB 4M48L 2VH5H 4LCUA 4JR9L 1WCBB 4C55A 2RJMA 1MH5A 1BF2A 1I4FB 4WTZG 3LSOA 4HX1B 2WW8A 4MNGE 3S37H 5JXEC 1RIHH 1YDPA 1FFOB 4GO6B 3OGOE 3UJJL 5TDPB 4U1GB 3RWFB 3OJDB 2XFXA 4CDHA 4I2XB 2WANA 3BIBX 5EZOL 1S8DA 1HHGB 1UB6A 4PS4L 4RSVA 4JG0L 3FCTA 1H3UA 3NZHH 2GK2A 5SWSA 1KLGA 2AEPL 2BMKB 5ICYA 1KACB 1JRHI 3AM8C 2IJ0C 3C5JA 3GM8A 4GAYA 4JFFA 5CILH 3DV6A 2W59A 2XN9E 4JQXC 4PRHD 3ZHLA 1WBZA 5HTSA 2XA8H 3QQ3A 1NSNL 4LVHC 1T3FB 4MWFB 2B4CH 3FQTB 4HUXA 4M6AA 5EBWA 5D2LB 1TITA 2F58L 1T80A 2E6QA 5FHAL 1FV1A 3MJ8B 1D9KD 1X6LA 5D6CB 3O2VH 4QRTA 1UACL 3RHWF 4G43B 5CJ8A 2O5XL 1W2KT 3UYOD 4OB5H 4BQCA 1R5IB 2JLLA 3RIFF 1A9BB 5H2BA 1PZ5A 4M7LH 1JPFA 3P2TA 5HHMB 1ZMYA 3QDAA 4IS6A 3RAJH 3C08H 5IFAH 1G7IA 1U8JA 4G80B 5T1MA 4XNXH 4Q0XH 2XNAB 2Y07L 2H2PC 1PZUB 4XC1H 1RVFH 4C56A 2P8LB 1TTFA 3EOBB 4MNQE 1TJGL 1YEIL 4CW1B 2ZPKH 2PETA 2R0KL 4PY7A 4UQ3A 4U6HB 1P4IH 1M7DB 3WHE0 4P5TD 3EO9H 2AEQL 1KN2H 5I71C 3JUZA 3MJ9H 5JMRA 3QFDA 2QQKH 3BWUC 3ZE2F 2IFFH 5D7JC 5D93B 4I3RH 5E8EA 3V5HA 3UX9B 5IK3A 4K3EL 3T3PF 3SQOH 4XVUC 1WCQA 2CDFB 1CDUA 4U6XB 4RGND 3GMPA 3TT3L 1XF2B 4K94C 3NCBB 1KTKE 2J1KA 4CAGA 5HGHB 3D48R 4FNLL 5D2NC 2R29H 3P73A 2CJUL 3MRHB 5SWSE 1G7LB 4JFFE 4S11A 4XVSL 3HPLA 3L95A 1U8PB 4TSCL 2AJ3B 4AG4L 1JHTA 4DN3H 4I77H 5C3LD 5DQJB 1A1MB 4JFDD 2CDEB 4X5XB 4L8DA 3GJFB 1JGVL 2GEEA 2V9QA 1WICA 3MBED 2KKQA 5GJSL 2EKJA 4LIQE 4EJ1C 3RTQA 2VITA 4NQVA 1OTTC 4JO3H 3QNYA 5I1DA 4OUUA 3IFLL 5EIIB 1EBAA 4KJYA 1TQBB 5DXWA 4EEEA 4PP2A 3FQUB 2WWKT 3WUZA 3B6SB 4N90E 4UV7H 2Y36H 3MREB 3B8YA 4UBDD 1IC5H 3ZT5A 1YEKL 1K5NA 1QO3A 3LDBB 4JPKL 3BT2H 1OLLA 5BZWA 3VXNA 4C56E 1O7VA 4GQ9H 4MGXA 5E2VH 4XPFH 1NGXB 4G6FB 3ELAT 3BKJL 5CUSL 3TT1L 3ZLQC 3F5WB 4IRJD 3MLRH 4XWOC 4HIXH 3Q5OA 2FJHB 2IALB 5HGBA 1MHEB 1YPZA 2YPKA 3VE0B 5KN5B 4YUEH 4HMDA 4P46A 2WIIA 4AIXA 1CI5A 4BZ2L 4OIIL 1H3WM 4N9OB 5FCSH 5BXFB 3O8XA 4FQQA 4XI5D 3VFSA 3FAXA 2FIRT 5FF6A 4Q6IC 3LEXA 1SJHB 2FEDC 4QT5A 1NFIB 3CK0L 3ULUC 5EC1B 5FO7B 3GSWA 1LO0H 3MROA 1DBMH 4BH7B 3IFNH 4ZPTA 1UJ3B 2PR4H 3PP4H 3F6LA 5C0FB 4HGWB 1MCQA 2JCCB 4H5SB 3MRIA 3IDYB 43C9A 1BJ1H 1JFQL 35C8L 5C08A 1L6ZA 1V7NL 4Y4KD 3W11D 2QSCL 4GXVL 3K46A 4TYUA 3HFML 1RIUH 1NBVH 2VQTA 1NC4A 3VG9B 5E8OA 3V0AC 2ZCKL 4BK5A 1E4KC 3WKNA 4F9LC 2WLYA 5H35A 4O4YL 2P42B 3QIUB 2EDOA 3RA7H 3FQRB 1KB5L 1KJ2L 4FRWA 1Y0LB 3OKMA 2PTVA 4LSSH 2GCYB 5F7KC 1FDLH 5FO8A 4JKKA 2YK1L 4LNVA 3RX5A 4NKDB 1CGUA 5IWLC 4P4RB 5IJVA 4PGJA 4ONHA 5DQ9A 5T1LB 4DGYH 3MLZH 3GHEL 4IOFC 3TIDA 3W82A 4POYA 1YPZE 3QXAB 5I1CH 2XPGA 4OLXH 1BFOA 1SJXA 1R24A 3MZTA 3WNLA 5L2KE 2WWMC 4DWHA 5MEPB 4LVHB 4U33A 1Q94A 4PJAB 4LIQH 2XZZA 2A77H 5DMJB 4L29B 4Y4FA 4R4NC 1HE7A 4U1MA 1NQBA 3HNTL 2VL5B 3LN5B 3LQZB 4OM0L 1FVEB 3BISA 4OJFH 3R06A 4FP8L 1LO4H 3IDMB 4ZXBC 5GS2D 1U91A 1M7IB 4I48B 5C08E 4Z0XB 3D69B 5E9DB 2F5AH 4BSJA 4H0HB 1XEDA 2VXSH 4RGMC 3MRLB 5BJTB 1S7SA 4YHPB 4HF5H 1AGEB 2W9LA 3EHBD 5E1AA 1H3XA 2HT4C 3PWVA 3S7GA 2XYCA 4AMKH 4CUCA 1DLHB 4N8CH 4GMSH 3QPXH 2E9WA 1YEFH 3TBWA 1QBMH 1XH3B 4I13B 5BS0B 1KG0B 5CZVH 5F6IC 1KJMA 3SDDD 2OR8A 1S7WA 5I71B 1LDSA 1MF2L 2E7HA 1AKJD 5DI8A 1NEZG 2HWZL 1HH9B 4OLUL 5IG7A 5D7JB 5DRNB 2QQLH 4NM8L 3VFOA 3EOYG 3ARTA 1CXIA 4YH6A 4HUNB 4WO4A 4LKCA 4CU7A 4QXUL 4JGUA 1F4YH 5SX4I 4LQFH 3NFSH 3EYUL 4LLAA 3FB6A 3MV8D 4ELMF 5E03A 5K9OB 3VFVA 5D2NB 5J4MA 1FQ9C 3TEUA 2FJFA 3FB5B 4M5ZL 4NN5C 1KJVB 5IEHB 1NEZB 2FD6L 3TN0D 1OSZA 1NDMA 3QO1A 3WFEL 1T83C 2YA0A 1SJEB 4E41A 1WBXB 1HSBB 2APTA 1DLFL 1RHFA 3QP3A 3GB7B 4BFIB 1HHHB 2CO7B 2H2SD 3ZT6A 1BVKA 5D1XA 3O3EA 5JOFA 3X17A 2FRGP 4ZFFA 1HOCB 1P7QD 4LLDB 1A1OA 2BNRA 5F97E 3CNKA 5ESAA 3U36B 3DO7B 2WQRA 5GISL 4OCYH 5KVMC 1FL5A 1C16B 1CG9A 4GLRI 4W70A 3VGAC 1ZVSA 4JHWH 4KUZL 5JNYB 3U6RA 3F7YB 4F33A 2UVFA 3DRQA 2NX5A 5F7UA 4YXKL 4XC3H 4ZUTA 3KLSA 3HLAB 3HC3L 3DUHA 2VLLB 4UNTA 4XAWH 3KXFA 3OXRA 1RK1A 3MV7A 4UQ2B 2KZWA 5DT1L 3UAJD 4X8XA 2A73B 4Z0BH 3M45A 4R7NB 2YEZA 2KQNA 3PWUA 1KCSL 3B3IB 1DBKH 4KTDH 3VFPB 3GM0A 3PGCB 4HJ0C 5C0EA 5FYJU 5GGTA 1XF1A 1YN6A 4KQ4L 1DFBH 3VGGA 3LH2L 4Q6IB 1S7XA 2G2RA 3K8KA 1U6AL 3C5ZD 1TPXC 3IS0X 4MQTB 1QSFA 2NW3A 5ESVA 4DTGH 3MLTA 1T66D 3DWTA 2EYRB 1JN6B 3MLVH 5F9JA 5KVDH 4OD3L 2HMIC 1ZT4A 4X6CF 4HWZB 1ZHLA 3WFHB 1FL3A 3FFCD 2RIKA 3KPNB 1MY5A 4HUKB 1XIWD 2VZ1A 3ILQD 1I9RH 5GXBB 1OB1A 1X5LA 3QUMB 4E41E 4PJEF 1XF4A 5IMMB 4U1IB 2V7NB 5CJBA 4ODUB 4CADA 2ZNXA 4KZEL 1SM3H 2MPAH 2BNRE 2B0SL 3SO5A 4P9MH 3ARFD 5C6TL 3EFDH 3CFDB 3MLYH 4HHAA 4NQCB 4QHMB 4HUWA 1D5ZB 5DD1H 1X5XA 1HKFA 1LE9B 4FZ8H 2NX5E 1RI8A 4PJDA 1VFOA 3L5XH 4JY5H 3MOAL 4O5LL 5E5UB 5SV4A 3QIBC 2WV3A 3WE6A 1FC2D 1HILB 3QISA 2KPNA 3BPOC 3KXFE 2ADGB 4QNPE 3DTXB 3GSOA 1MEXL 2HN7B 4M5YL 1RUML 3MV7E 2YPVH 1ZVYA 3GJEB 3LEYH 4JJHA 1NFDA 4U6VH 4BFGA 1HZHL 2AGJL 2Q7YB 1RMFL 3KPPA 3WDHA 3Q3GB 3QNZB 3D0LA 1CL7L 3MNWB 4PJBB 4GS7C 2FBJH 2RCSL 5I1KH 4HKJA 5MENA 2P5WB 4G9DA 3E2HC 4QRSA 5JW5A 4L9DA 4NJAH 1G9ML 1QSFE 4DJMA 2AW2A 5ADOL 3MA7B 2HJLB 4XVTH 3UTTB 1LILA 1P2CA 1U93A 3HR5B 2VDOH 1H8OA 4GBXA 4KHTH 4EZMA 3QT2A 1VKXA 4PG2C 4YHMH 3KR3H 4OZIA 1MFBH 1OD7A 2B1AH 4YHOH 4ZXBB 5FO9B 1CK0L 5A2FA 1EH9A 5ESQB 1EJOL 1QR4A 3AREC 3V7AG 3QCVL 2LQRA 1KCRH 2R4RL 4LP5A 2VDLH 2XI9A 4RGMB 1BD2B 3RI5F 4QGYA 1FNHA 1LK3H 4OKVA 3CSGA 5E08H 4NJ9L 3ABZA 2IFGA 2I60L 2QSVA 1KELL 5DJCB 5GRJL 2VAAA 2ZWLT 5DK2A 4LCCC 2E6JA 4K9EH 1KEGH 2IH3B 2KBGA 3TFKC 3GI8H 1HEZB 3L9RB 4NIKB 5F6IB 3H9SA 5LCVL 1CLCA 4PTTA 3VXRB 5LG1A 2F8VA 4WUKH 4MDIB 4PJDE 4XCEA 1W0YT 1WC7A 2HFGH 4N0CC 2X4NA 4JFYA 1MWAA 4KVCH 4Z7NE 5BW7C 1QFUH 4FZEH 4MAUH 1I3RA 3HI5L 4U1HB 1H15B 1NFDE 2VLKA 4FQ2H 1GIGL 5IB2B 1YEDA 3JVGC 4LAQL 5GRUL 5B38A 3SKNA 5JORB 2XWBB 5INDB 4NN5B 2Q3ZA 1FZKB 5AZ2L 1BMGA 4C83B 1TTUA 1QR1A 3KPRB 3WN5A 4PJ8C 5MENE 3ALPA 1EXUA 4G59A 1BJ8A 2Z0BA 4P4KA 4GJTB 3B9KD 4YXLL 3S36X 2ZG3A 1U8NB 1TETH 2PW2A 1X5AA 4OI9A 3PWNB 1CLOL 4GFTB 1XGQA 1EHNA 5DURB 1VFUA 5JDJA 4L4JA 4OZIE 1DVFC 4JDVA 1ULVA 1DANT 3IJHA 3G5ZA 1CXLA 5EU5A 3T0BA 4L4VD 3BSZL 2GJJA 1PSKL 3MV9A 2ARJQ 5C09A 3VGAB 3CVIH 3MLWL 2FB4L 5C9JA 5DUPH 5EBGA 1M71A 3QXWA 2HT2D 25C8L 4GAGH 4Y4HD 1M6OB 3EO1B 4K3HA 1DQJB 5HDOA 4G8GB 3T8XA 5HSFA 2WMPA 1MUJB 2L0DA 3QG7L 5KVGL 3C87A 3R1GH 4PYHA 1FRGL 3V8CA 3MCG1 3U9UB 3H9SE 1UQSA 5TJWK 5DDHA 1KPRA 5GGTH 1KIPA 4JZOB 4AM0B 2AV1A 5D1QC 4M3JA 3ARSA 1U41A 2DAVA 2DKUA 4J6RH 1LNUA 3IXAB 2EH7L 1DE4A 4H0GA 3W39A 3ARDA 2O5ZH 1HH6B 2ZOLA 3BWAA 4FMKA 1TPXB 4PJXF 1MI5B 1ZLUH 3DMMA 2IANA 3VFTA 2VLKE 1ACZA 4N9GA 1IGIL 5AYUL 1E6JH 4FQIL 1V3KA 4LLUB 3SGEI 5E6YA 3FB7A 3G08B 3MRDB 6FABH 3EYQC 5IUSA 1Z9LA 2ZJSH 1S9XA 2DLIA 5D7LE 5ID1A 3I3DA 2LAGB 4M7ZC 1NCCL 4LLVA 1UZ6F 1MHCB 3KPTA 2JJWA 2DLTA 2O93L 4BSVB 4FQCL 5CEYB 1UWEH 4MNHB 5F88B 4K94L 2FWOA 3OX8B 4AH2B 4NCC2 5I74C 2WBWB 1CFNB 2AJVH 4PJ5B 2APBA 1P84J 4DUWA 3MV9E 2R0WH 5GZNC 1N5AB 5F89B 4XWGH 4HDIB 2OM5A 4LARL 1XR9A 4L4TD 2OS7A 4KHXL 5ENWB 1JYNA 2YUXA 3ES6A 4G6JL 4JQIL 5KSBA 5DFTA 3D5OF 3QIBB 1X5IA 1C1EL 5IQ9A 5JW4N 1YMHA 3BPOB 1VPOL 5GRYA 3HC4H 1BOYA 5E56A 4LFHG 1A3LL 2N56A 2AERT 4QTIH 1OW0A 5F1IB 4OCNC 2AXFB 1IAKB 2GFBA 1NCAL 2APXA 1K4DA 3MACH 3TH3T 5GZOC 4QRRD 4GS7B 2FJGB 5E2JA 2YKLH 4CU6A 2PN5A 4XXDB 5JA9A 3E2HB 2CLZB 4QTHB 4M4PA 1QLFB 1D5IH 3KJ6H 4WUUA 5IQ7L 1WQVT 1CD1A 4NPYA 5L8LB 1N6UA 2IANE 2X10A 5A16B 4F9PC 4TVPE 5EDXA 2R56H 3KPMB 4Z7WA 5JQ6L 3QHFL 1AP2A 5D9SB 4DFIA 3CXDL 1FJ1B 2NW2B 4Y0GA 2OXGA 5FM8A 5DJ8A 2GTZB 4OD1L 4F7EA 4P3DB 1EAPB 4JCMA 1EGJL 2AXGA 2JJTA 4GRWE 1BZ7B 3V0VB 4OLVH 2R4SL 1FVDA 3FZUD 2VWEE 4ZQKA 3N9GH 3ULUL 3Q6GH 3L3IB 4L3EB 43CAB 1JNLH 4ZD3H 1T0NB 2XTLA 4N8VG 1EO8H 4UT6H 3EDFA 4RX4A 5HYEA 3QEHA 3ARRA 4K23H 3VA2C 4X6FA 4WHDA 3JUYA 3G6AA 4GAJL 2Y4SA 3HRZA 2GKIA 1MWAH 1CZ8L 1DL7L 3O3DB 4P23D 5KSBE 3QUML 1J87A 1FL6B 4HCRA 1SY6L 3NACL 2HKHH 1IQWH 2VABB 3VJ6B 4MLSA 3WFCH 4N8VB 5DS8B 1YNLH 3U0PA 4WNQA 2GK0A 2GTWA 3VWJD 3D0VA 4PREB 4XCNB 4Z7UF 5FA3A 1ORQA 3MV01 3SE9H 4PRHA 1CLZH 5T1DH 1CFSA 4B5EA 4PJ8B 2HAZA 4ZUVA 4XPTL 2AKRA 4XCFH 3ZE2E 4MCYB 1WIPA 3OL2A 5ALBH 4WUUE 4P57A 1D9KA 4EIGB 4Z7WE 1WSST 5DEFB 3JTSB 1DVFB 4JEGB 5CMAA 1IKNA 1AGBA 1N26A 3VXOA 4RISL 1INDL 3VXUE 5GS1A 5IW1A 5HGGS 1YQVL 2ADIB 4KJPD 1AGDA 1PKQA 1F97A 3RVUC 1LDPH 3ARBC 4OT1H 1VHPA 3VGBA 5DHYB 4C54A 2YRPA 2ARJA 2D9QB 3BD5A 3MR9A 2IQAB 1FNEA 1LQSR 4KI5D 3BUYB 4ZS6C 5DD3L 1I8IA 4ONFH 1DQMH 3VFRB 1P9MC 2R0LH 3QG6B 2X41A 1R3KA 1NUDA 4KDWA 5HPMB 3DYOA 4P5TA 1R5WB 1A6WL 4G3YH 5DRZB 4F57H 5A3ID 1WGOA 5D1QB 3RVXC 4HIEB 5I1EL 4DW2H 2DICA 3NMEA 4UINH 2IGFL 1CGWA 1S7VA 1UEMA 3UBXG 1H0DB 4TVPH 2AABL 1YYLH 4PB9L 1YNKH 1T0PB 4TPRL 1U8OB 2FHFA 3KS0H 2DLFL 4MXQC 5FUOL 1W0VB 2ZOKB 3SDAD 4RDQG 3REWA 2DYPD 3MRPB 4MHHI 1XCQA 2XKSA 1E28A 3BZFB 4NYLA 1YYML 4FQPA 4KXZH 4UIMA 2ATKB 3IDUA 4PRHE 3PWLB 1P6AB 1FO0B 4NM4L 4GRWH 2NY4C 1UYWL 1GC1C 1PKOA 3UBXB 1CE1L 3FN0L 3HB3D 4G7YL 4JFDA 4Z5RA 3X3GH 4M7ZB 5JIKA 4ODXA 1TVHA 4MXWL 3O6KH 1MFDL 3MBEA 1F4WL 3N85H 2EXYC 3DPBA 3DETD 3LN9A 3V52H 3WHE1 1PX3A 5CEXA 1JPTH 1DP0A 4OF3A 5I66A 1IEHA 1FNFA 5I74B 3TO2B 5I30H 4TULH 4S1RL 3EOAA 1ZANL 5DFVD 5D7SL 1NLBL 5IKCB 1AE6L 3VH8A 1J18A 1PKQE 3T4AB 5KAQF 5ISZA 1XGPB 1GHFH 5ELIA 2IPKA 2GSIB 4R4BB 4NRZA 1FYTB 5CCKH 1A5FL 3BZEA 2ADFL 1TVBB 2D7PA 3LKRA 3SE4C 4FXKA 2E27H 4KK5C 5GGVL 2OSLB 1N59A 4I0KA 3V6OC 2VISA 4HLZH 4CMHC 1CDHA 4IRJA 3BKMH 4OCSL 1I7TB 1C7TA 1MCHA 4TN9A 3SGKA 2BY3A 1T2QL 3DHJA 5KSAD 2APWA 3CFCH 4QGTA 1Y18B 2A6DB 3LN4A 2EE2A 4F2MA 2Y5TA 3GUTB 3K4DA 2X4RB 3FMGH 5AWNH 1WFUA 2C4XA 1YECL 1FHGA 3N1QC 4RGNE 5BVPL 3O2WH 2E9BA 4IMKC 3IJYA 3UEZA 4EI5C 3RFZC 1ZA3B 2YWYA 1J0IA 4PRPB 1GGIL 3ORJA 5E8NB 4R26L 4M43H 3X11B 4RQQB 2WUCH 4U2YA 4N68A 1WBYA 2BSRB 3NCYP 4ELMA 4HLJA 3JWDC 5A2JH 4Y4KA 4JFDE 4NQED 2QHRH 4G8FB 1RK0B 4IDJH 4H8WH 4CMMB 1AO7B 3VFGH 2EH8H 1Q8MA 2W0FB 3QXUA 4F8QA 5CIPB 4YGAB 1H3PL 4FMFA 5FAAA 1DBAH 1MQKL 1SEBB 1DEEB 4MX7B 1RJLA 4ZFGL 4HCRH 3NPSC 1JK8A 3LB6C 3NIGF 3LMJL 2ZP0T 3X12B 2CH8A 3ETBF 4TSAL 3OBAA 1MSPA 5KS9A 1P4BH 3KYNA 5K93A 1R3HA 2FX9H 4KMTL 3MLSL 1AQDA 5F9OH 1PYWB 3QCUH 4OD2A 5BV7C 5EC2B 5IJKC 1U42A 4HG4K 5E1HB 3KNBB 5I2IA 2DQTL 3L7FB 1T0MB 2YC1B 5DSCA 4JY6B 1OAUH 1DQQB 4GUPB 4RBPH 1EJ6A 4RMQA 2C3VB 4D0CB 1OTUC 5C6WH 2L4OA 1ZAGA 4NKIL 3ROOB 3GSNB 1ZSDB 3SJVB 1A7PL 3S35H 5T1KD 4TNWF 1INQA 3L5WA 3U4BH 1UWGH 1JF5A 2DQEH 5EOCH 1T04B 3WXWL 4G7VH 5I18L 3QULA 1AR1C 4D9QD 1CFQA 3UTZA 3BYYA 1QA9B 4ZUWA 4YXHH 3WV0A 4GG6F 1AD0B 4OI7A 1E4XL 2HRPL 1QLRA 4ELME 3G5VB 2R1WB 3CMOL 4U1SB 4MZ2A 2EXWD 2W9DL 1I1AD 3PL6B 4GKNA 3EFFB 3UZEA 3MXVL 1HXMA 1QFWH 1X5JA 3ARBB 3IYLW 5BO1H 5DGQA 1V5JA 3H3PL 5IESH 2MCPH 2CGRL 3PV6A 4NFBA 4P2RB 3PWJA 5EBLA 3RVWC 5IR1B 3CU7A 4PJEA 2FIKA 5TQ2H 5F3BA 2ICCA 2QV2A 3H9HA 1TJHL 3RNQA 3U4AA 1WFOA 4M8VA 2Z8VC 5DF0A 1IGFL 3U46B 1IM9D 1V3LA 1CF8L 1AKJA 8FABB 3TA3C 3S36H 2XG5A 2PYEB 4RGOL 5DRWB 3BEVA 3STZB 1AGFB 5KS9E 1T22A 4K3DH 4LF3B 4YDJA 3LEVH 4N0UA 1T1YB 3VD4A 5ILTH 3QUZD 1IT9H 2E8ZA 4PRIB 3H6JA 3QUXC 5GHWL 3MV8A 3BUTA 5C70A 4EQ2A 1SBSH 3FO1A 5C0CB 4H25B 1BBDH 4WI7A 1H3GA 4WI2A 4C4KO 1T6WA 3GSQB 4F7TA 5F7WC 3RUGA 1ZHKB 1DQDH 1FNGB 5EBMB 2H32B 5EO0B 1G0XA 2NY4B 1FNLA 3BHBB 4HEPG 2L7UA 1GH7A 4ODWB 5E8PA 1F6FB 2CR6A 2QJDA 2H8PB 4JZJC 5TGBB 1P7QA 4UDUB 4S1DC 1IC7L 2VC2L 1RULL 5D5ME 2F74A 5L88L 4Q9CA 1U92A 4FQ1L 4RAHA 4DUVA 4NWUH 3OKDA 4JPIA 4S0TD 5JDSA 5HJ3B 1DSFH 3ZHDA 4ONGL 5ACZA 5TQ0H 2UZYB 5J11C 5I9QC 3QXTA 3UTSB 3GO1L 4PJ7F 1BVLB 3IDGA 3CFEA 4DEPC 2DI8A 3ZZ1A 4PJEE 3DVNB 1UKSA 3OKNB 4U7KA 2GQHA 5CHNA 5MERB 4CMHB 5KW9L 1TCMA 4NQDB 1MJUL 4YHKH 3LS4L 5L8KB 4Z7VF 5CP7B 4BZ1L 4ISVA 2OYPA 1GCFA 4ERSH 4HIIA 4KPHL 1ODAA 4AQ1B 4WWKC 3DX8B 1Q0YH 4RRPA 4N0FB 1K3ZA 4JFOB 5C0RL 1QUNA 4N0UE 5IVZA 3C5ZA 2D03H 3BX7C 3IKKA 4EI5B 4GW1A 2RFXA 4LPUA 3MV8E 1KIRA 2NLJB 3ARYA 1CE6B 4I3SH 5D70L 4M02A 1MJ7L 5FB8B 3V0WL 2YD2A 3GMOA 2ZUTA 4MA7L 3RUGE 1NL0H 2A6KB 3FFCA 1XIWA 2NMSA 1Z9SA 1EIBA 4UMGA 4ZO8A 4HPOL 1R0AL 5FKPA 3M17B 2H1PL 4CVWA 1AC6A 5GGQL 1UKTA 4ZAKD 3DX9A 4HKBB 2B2XH 4E42B 2CRMA 1R5VA 4KUCD 2VMFA 2CKBA 4Q9QH 5JR1L 3F12A 2V17L 3QUKA 4JKMA 1LEIB 4ZDHA 3ARFA 4U2ZA 2CK0H 2KUTA 2Y5EA 4FTVB 4XHQA 1WZ1L 3SCMC 4MDJB 3NPSB 4XHJC 3VGFA 1FO0L 3U82B 2J88L 3WDIA 1OAQH 4HC1H 1JHLH 1MVFA 1N64L 4ZYKA 1QNZL 3OKKA 1QTYT 3TPUA 3H9ZA 1VEOA 3T77A 3TJEL 1TXKA 3CFBB 4YGVB 1IMHC 4YE4H 5E00A 1FBIL 1ZTXL 5KG9B 5BV7B 2X9WA 5IW6A 4LAJH 3BN3B 1LQVA 4K3JL 5CLTA 2VN7A 1FLRH 3FB8B 3JV4A 5FDWB 1QFHA 4ZFZB 1MJJA 4DVRH 1WFNA 5BVJB 3RWCA 1I3GH 1C12B 3MRQA 4Q97A 1MCKA 4DFHA 1Q9OB 2E7MA 4LHUG 3UTPD 2X1WL 3FRUB 4EVNA 2WK2A 2NY1B 4PRNA 3ILPB 2X1QA 5GS2H 4LEXH 4HPYH 2AQ2A 2DWEB 3TYFB 1RURL 4HJJL 1MHHB 3DVFA 3CZFB 5I76A 3P30H 4PY8I 1I85C 3EKCA