1BZ9A

Crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
273
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CLASS I HISTOCOMPATIBILITY ANTIGEN)
publication title Structural evidence of T cell xeno-reactivity in the absence of molecular mimicry.
pubmed doi rcsb
source organism Mus musculus
molecule tags Murine class i mhc/peptide complex
total genus 64
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bz9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1bz9A01
3OR6A 4OGAD 1NCWH 1BOGB 2NY3C 3BSZL 1IJ9A 3DVGB 3DX8A 1KPUB 1YEDB 3QHZH 3GBMH 5DK3A 4KK9C 1U8LB 3KYMB 4OI9A 3HNSH 2BNQD 5F1KC 3CK0H 3TBYB 5DJAA 4Z7OF 5DMIH 4IDJL 3MJ7B 4DVRH 4H8WC 1JHLL 1ED3A 1FDLH 2VLJB 1SEQL 1N0LA 4L8DA 4YNYA 1DN2A 4IIQA 1XF3A 5CUSL 3S97C 2AXGA 1H5BC 3F58L 2XQBH 3V0VA 3V6ZA 3VWKD 1N2RB 2J2ZA 4HKJA 3GIVA 4PRPD 5GGRY 2JB5L 1OAXL 3LMJL 1ORSA 4WHYG 3IF1B 2UWEB 1EHLH 3UTQA 5IQ7L 4KZEH 3CLEH 2ZUUA 4DQOH 3NACH 3P0YH 4H0GA 4QY8B 4X7FC 1VCAA 4OIIL 1HHKA 3GIZH 3MRGA 3VD5A 3GSXB 5JLZB 1RU9H 1UEMA 2NY1B 4NUJB 4Q6IB 2N7AA 4FMKA 3C5ZD 2DKMA 1E4XI 2VSCA 4XP9L 1OM3L 3GRWH 4G42B 1WZKA 1NMCC 2NY0D 2FJFA 2NCMA 3ARFB 4U1KA 3S35L 3IGAA 3RNQA 4CN1A 2AJZB 1WIPA 2R39A 3IYLW 5TPWH 2YZ1A 1T1XB 5JOFA 3A67L 4LRNL 5KS9F 3PNWB 1T7XA 5H35A 5IVZB 3MACH 2NYYD 3GKWH 4MNQB 5EU6E 4RMRA 4PJ5E 5I18L 4HWBL 5JQ6H 1OAQH 3RQ3A 1CLCA 4EI6B 2EEAA 4E41A 4X8JB 4KUZL 3LKNB 2DDQH 5LG1A 2QKIA 1OGAD 3F7QA 4MXWH 3I6LD 1X5XA 3RL2B 5AYQA 3EJYD 3X11B 4LCWA 1MF2H 4QRPA 4Q0XL 1A3LL 2ARJA 5DS8A 3BIBX 1RIUH 4HWNA 3HC3H 3TVMA 3O11B 2GCYB 1U8MB 2AABH 3BAEL 3TJEH 2C26A 1AGFA 4U6VL 5D6DC 5FECB 3RGVB 5JW3H 5D5MA 5L6YL 3RTQC 2ESVB 1L6XA 4X4ME 5EZOL 1DE4B 1EHXA 1BVZA 4FG6D 2AQ1A 4RAHA 4UDTA 4ZYKB 5DJ0A 1RPQA 5I1AA 3CDGA 4W4OA 2Z31A 4PJHF 5GGUB 4POUB 3MRLA 4Y88A 1D6VL 3W9DB 1JWSB 2DTMH 2DYPA 2EZ0C 1CFQB 4KTEL 4P4KB 4NO2B 3TH3T 2OYPA 3SDYL 5DGRA 1T21B 5FOBA 3VG9C 2IALB 5ALBL 2XWTA 2NY2B 4LCCA 3TFKA 2B1HL 4RAUA 3ZHDA 4KRPB 1FORL 1NGWB 4R7NB 4RDQF 3KYKH 1J0JA 1UM5H 3U46B 1NFDA 3PQYE 5DJCA 5IROC 1N0XL 5KN5B 5IT2L 4D2NA 4NKDB 1XCTA 2IBGA 5DLML 3CFJA 3DX6B 3Q1SL 3LKPB 3QDGA 2EIZA 1MRDL 5B8CA 3AVEA 1OSZB 1MHCA 1TZGL 4YZFF 2GKIA 4IRSA 1IM3B 4HW6A 4MJ5A 1XF4B 3UDWA 5D6CA 5FHBH 4LLUA 4JRXA 1JZ6A 4U1JB 2QADC 4JKWA 5F88A 4RQQB 1TMCA 1YA5A 3OKDA 2Y07H 3ZDYF 3TH2T 3JBG7 1DBJH 3ULVF 3OKEA 1JWMB 5C09D 2Y7QB 3ARDA 3P9LA 4P0DA 4JM4H 4WO4B 3WHE1 5DJ8A 4BFEA 3VWJD 3MV8E 3AS2A 4J6RH 1ZGLB 4P59H 3E6HB 4RWYL 1DLHB 5IQ9A 5DDHB 1CDHA 4KK8D 3VFUB 2N7BA 3P9MA 5DMKB 4EOWH 2PYFA 5C8JB 3ULSA 1H8OA 3LHPL 3ULUF 2EKSB 3TP4A 5JZ7D 1F6AB 2OBGA 4PGEB 1M4KA 1BZ7B 4DVBB 5DHYA 3KXFD 5HDBE 3OB0H 4WFEE 3DIFB 4HF5L 5C3LD 3BD5A 1GHFH 3VXQA 3T2QA 2XKNA 2Y23A 1F90H 4NNYB 1HQ4A 1A47A 5C0JA 4LSSH 3LQAC 1JE6A 1P4BH 5D7LA 2I25N 2VXVH 4YHNA 3HMXL 4X7TB 1LK3H 2WQRA 5EO9B 5B3NA 3OG6B 2XRAH 2FD6L 3NTCH 3DX9B 4Z9KB 4X6DA 3MLVH 2H32H 1T89C 3D1MC 1IGYB 4P23A 1PEWA 5ESQA 4ZAKA 1I9RL 2B4CL 4PBXA 2BSRB 3QXAA 4JQVA 2PXYB 2FZ3A 3QQ4B 5ADPH 1AQKL 3O3DB 1HINH 1U3ZA 1C5BH 5GGTH 4DK6A 1EA9C 3VXUE 3WFEL 1GJIA 1NANH 1WTGT 2D2OA 3DYMA 3GJFB 3GSRA 4P2OC 1QQDA 1WFTA 4EJ1C 1N64H 1UWXH 3QDMB 4GG6F 1F4HA 3KPSD 3FO2B 4LHJB 4NQDA 4JCMA 4IMKA 2DQDH 1KJ2H 1VACB 2X05A 1F3RB 2FX8L 5GZOD 1GPOL 5IB3A 5GGSA 1IAMA 1EEYB 4Y19A 1WCQA 4L3AA 5DD1L 3R1GL 3MRHA 4E0RA 4BQ9A 1G84A 2JK5B 1CD0A 2O5XL 5T3XL 4Y4FD 5T1KA 3SDDD 4QRRE 4HC1A 4U2ZA 5C0FB 5TJWK 3O8XB 1UZ8A 3QH3A 4G8FA 4NO5A 3KPPA 3A0OA 4JHWH 3F5WB 1XEDA 1YEGL 3QISA 4ZXBC 4XRCA 3MJ8A 4NIKB 5FEBA 1FG2A 2QSQA 4M00A 2BMKA 4X6CE 3U30B 3ZHKA 4PJFB 5ESVA 3DXAA 3W2DH 2AGJL 4WWID 4YWGL 3K81A 3HC4L 1JTPA 1KB9K 1N4XH 4J2XA 1XGQB 3CX2A 2W92A 1F4YH 2J5LC 5CEZH 4O2FA 3SO3C 1JPSH 3GKZA 4J4PA 1UENA 1WJ3A 1HH9B 1TCMA 4WI2A 1UJ3A 3ULVC 2R69H 2CJUH 4LP5A 3V8CA 5K9OA 1I1YB 5SWQA 3TNMB 3MQIA 2BVQA 3L3DA 2WLZA 4LLYA 3QUZC 3RWFA 1IM9B 1UWEL 1GXEA 1NMBH 4LVHB 5DD3H 4X5XA 3RL1A 3MLXL 5F9JA 3B9KD 3ULUC 5DUBB 1Z9SA 3T2NL 5DO2C 1RV6X 3U6RA 3V5HA 4WUKL 2CRIA 1Q9WA 1U92A 1NGYA 3N9GH 3EOTH 4O9HH 1ZS8A 3QEQA 4QHNA 1WC7A 2J8UF 1U9KA 1IGJA 3MLPA 3Q3GA 5F7EH 1W0YT 3U9UB 3CFEA 3OAUL 4NKIH 2GT9B 1DANT 1T04B 2YD6A 4JGMA 4GT7A 2E9WA 4OZGE 3HG1A 3WIFB 4KQ4H 5D9SB 3BEWA 2GEEA 5AUMB 3TN0A 4PJAB 2NY5H 1S8DB 4K9EH 4P48A 2Y6SC 1MCHA 4M1CC 5L2KE 4KMTH 3C8HA 4PD4K 3V52H 3S36X 3DUSB 2F53D 4JY4A 2YD5A 4PJBA 3BW9A 1NJ9A 1Q9KA 4KKBD 4R8WL 5CINL 3AREC 1MCPL 5F72S 4ODHH 1OW0A 4TSAH 2VSDA 4FQXA 2A2QT 4N0UE 1U8KA 5TFSL 2VR9A 3T8XB 5EBWB 5M94B 1C16B 3C08L 1VEOA 1T1WB 3EO0B 3QXTA 4PTUB 1MSPA 4HKBB 3AS3A 1VADB 1KB5H 2XZQL 3C09B 4M7LL 1RZKC 4NRZA 1QEWB 1A6AB 1OTUC 5DRNB 1BMGA 4DK3A 1W72A 1Y6MR 2W0FA 5FKAA 5D70L 2E9JA 1T0MB 3LSOA 4IM8A 4W6YB 3H3BC 4MJIB 2P42B 4PRBB 4NN6B 2IADB 5EPMB 5AZEL 2ENYA 5GS1A 5C6TH 2VN7A 3PWLB 2CSPA 2VYRE 1MFDH 3BD3A 2WW8A 4Y5YA 3NPSC 3L95A 5DK0B 4K2UL 1HOCA 5JW5A 1BQLL 1RULH 5DRXA 3FONA 3KPMA 3LRHA 5T1DH 4N8CL 3MRRB 3ZE2F 2C3GA 3UJIH 3MR9A 1S7RA 4D94A 1G9MH 2FECI 1KYOJ 2P5WE 1MQKL 3REVA 2DQIL 4YFEA 1E27B 1QFUL 3MLRH 1I9JL 4PP1D 4JZOB 2JIXA 4LSVH 4MB5A 5D2NA 2ZZUT 4LHQB 1VGKB 4RFEA 4WTWA 3P73A 4IHOA 4CDGC 3ROLA 5HJ3B 2Y72A 5LGJA 2NR6D 1DSFL 2XT1B 5B3JF 3BP4A 4X9HA 2X4UA 4YDKH 4MDJB 2AEQL 1J8HE 4XAWL 5D7JA 5DSCB 3CFCH 3QEHB 4YC2B 1U3JA 1YPZE 4G8IB 4OZ4B 1QVOA 4DN3H 1CN4A 4FFZL 2WIIB 5A3IC 4KJWC 4OLYH 1H0DA 2R4SL 2BFVL 4K3EL 2PUQT 5F8RC 1GGUA 4RMVA 1UCBH 3AU1B 2OQJA 4L8DB 3BGFC 4QWWD 2R8SH 1BAFH 4OGYL 4OFPA 3MV8D 3S34H 1P7QD 2OTWA 4ZS6C 1YEHH 3UTQB 5HVHC 3RDTD 1GC1C 2NLJA 1C5CH 4ZTOH 1UQSA 4ONOA 3W0WA 5E99L 4ODTL 3LB6C 1MFEL 3WUZA 1B6DA 1VEMA 5HHOA 1U41A 1G6RL 3VI3F 3B6SA 1DEDA 5I75C 4U1KB 1DEEA 3IGAB 4IMLB 3RNQB 3LAFA 4R4FL 4LQFH 3LPWA 2DKUA 4AL8L 5IHUH 1K3ZA 1CG9A 1NEZA 8FABB 4YHMH 1EIBA 3MOBL 4Z7NF 2XV6B 1G9NC 4CJ1A 1MHHB 3QCUL 1E4KA 2B2XH 1INEL 4R96B 4XBPB 3PL6A 2VXUL 2RR3A 1BIHA 3KNBA 4XP1L 1PY4A 5KVEL 4QXTB 4GKSA 4PP2A 1DVFB 2QKIB 1ZHLA 5EWIH 5EU7E 1IILE 3L3GA 3INUH 4XVTL 3FQXA 5BV7B 1T7WA 5C0BB 4KDWA 5GIRA 4LCWB 1PJ9A 4QRPB 3ES6B 4PJIE 2ARJB 3VXUD 3TVMB 1QP1A 1U8JB 4F7TB 5FA3A 3CVHL 1HXYB 4L4JA 1NDGB 1N8ZA 4YQXL 1WBXB 2H45A 4WJ5B 1YNKL 3SOBL 3RY6C 4P3DB 2ZUQC 5D5MB 5MENB 1HXMA 4G8GA 3G08B 3DYOA 4JGUA 4LPUA 2CUIA 4NWUH 1WITA 3CDGB 4EI5B 4Y16A 2ED9A 1Y18B 4U6XB 5CJQL 3GMPA 2XWJA 5FF6B 2AXHA 4FQIH 2BY3A 2C9AA 5M95B 1FE8L 2A9MH 5GGVL 4ODUB 3GJEA 3NIGF 3D18A 2V2TA 1H8NA 1EZVX 4J3OC 4QRRD 1OY3B 1G7MB 4LVOB 3T0AA 4YH6A 4BK5A 2AEIT 5FOBB 3HMXA 1TETH 2XTJE 1NSNL 2Y5TB 3G6JA 2R0WL 4NKOA 1IAKA 1K2DB 1YC8A 3BN3B 4LCCB 5DVOA 4RCAA 2X41A 1YEKL 3QG6A 2XG5A 5JOPE 1EHAA 1MUJA 1Q0XL 4MGXA 1P4IH 5I0ZA 1FP5A 3L7FA 3CJJA 4BSVB 2RGSA 1EFXD 1FRGH 1SHMA 3RWEA 5L8JB 3QPXL 4JY6B 3BWAB 2FIRT 1DQTA 1QSFE 4AEIL 2YK1H 2HVJB 1KN4H 3UO1L 2EIZB 4TUOA 1N6QL 2VABB 4RGNB 4WI6A 3T65A 4OD3H 4GW1A 1CGYA 1X5YA 1T3FB 2YMXH 4LLUB 4JRXB 4KUCF 2DM3A 2E3VA 2DIJA 4OZFH 5F9AC 3STLA 3T0XA 4APQD 1ZVSB 1CLOH 3ARRA 4L3ED 4WWKC 1I4FA 1TCRA 3CXDH 3EOAB 1ND0B 3FN9A 4KROB 5ISZB 3MYJA 4IRJA 3TF7C 3T3PF 1FZOB 1HK6A 1T66C 5JDJA 5E24E 3TZVC 5EUOF 5J11C 3PWPE 2VKXA 5HI3D 4QRTA 5GJTL 3SGEH 4N1HB 2EE3A 3EOYG 2XKSA 3DSFH 4Q74A 4MS8A 3FT3A 4OD1H 3C2AL 4TOYL 1YNTA 3I75B 4WEBL 1A8JH 2HT3D 3QIWD 4JO3L 4ZO7A 1OAKL 3T4YA 1JZ8A 4QT5B 3P3YA 3RUGA 4D9LH 5HI5C 3IDYB 4HUKB 3QWRD 4LVEA 5A2KH 2HFEA 1T0NB 2YWZA 2VE6B 4Z7OE 3O2DL 1IAII 3FFDA 5C0JB 3BZDA 1GGBL 5KVDH 3IXAB 2ZP0T 3FB8A 4XNXH 4RISL 5E08L 4U6HA 1FPTH 4MVBC 3H9SE 4U7MA 1SJHB 3LKQA 4UQ2A 4MQSB 1CICC 4IJ3B 4JFEE 3K2UH 1S7TB 1C12A 2IANE 1LO4L 5ESQB 4ZAKB 1NAML 5HHVL 4PJGF 1TQBB 3BHBA 4WTZA 1CL7L 4POZD 4MAUH 4LKCA 4XWGH 4BQCA 3PP3K 3MBED 4Q9QH 1PLGH 3ALPA 4D9RE 1IT9L 3LEYL 4LSRL 4JFHE 4OM1L 2F9BT 3GSRB 1CLZL 1IGML 2F5AH 1QQDB 5INDA 2RCSH 3ZE0F 2BNRE 2YPKB 5IB4B 3VD7A 2DI9A 4NQDB 3G6DH 3VG0L 4HIHB 3OKOB 2UY6A 1KJVA 4RIRA 4NO0A 1MCWM 4M7KH 2KDGA 4P2QD 4Z7QF 5TDPA 3RIFK 3TGXA 5CAYB 3U4AA 4EUPA 3HZKA 1FFOA 2BVOA 5JW4Q 4O4YH 3H8NA 4E0RB 1UA6H 4JFXA 3GMQA 3WO4B 1I9IL 3HUJE 5BJTA 3S37H 5F1OB 3WKNA 5KAQG 3U0WL 4PLJC 2DKSA 2XYCA 1OP3H 1UZ8B 3QH3B 2BNQA 3KPPB 4C58B 4QHLB 1NUDA 5F7LB 5CD5C 4CAGA 3MJ8B 2BDNL 3LN4A 4Z7VB 5MHSD 2P24B 1NGXA 3IDIA 4JREB 3BRDA 5ESVB 2F58H 2IGFH 5HDLA 3QO0B 4PRPA 5AYUL 4KKAC 5A2LH 4PV9A 3QEGL 3Q5YA 1IGFL 5GRJH 4OCYH 3SE3A 5C07B 4KVNH 5GGQL 3Q2CA 1NLBH 1X5ZA 3C5ZA 4PY8I 2ZUWA 3QNYA 3DRTB 5K9OB 4PY7B 4UNUA 4Z7UB 5FIEA 2BVQB 4JFDE 3W11C 2WBJB 3PWUA 4X99A 3L3DB 2A6KB 1YEIL 4YDJB 2GQHA 1WWBX 2V9RA 3STZB 5TF0A 3RL1B 5IEHB 2IMMA 4I5BA 3CZJA 1ZA3B 4HPYH 2OL3L 1JRHH 1CDJA 2A6JA 2XXMB 3IFNH 1FN4B 3VXSD 3CXHK 1F00I 3PJSB 4JB9H 4JRYD 4PRHD 4XNZB 3D2UB 1GAFH 3QEQB 2NNAB 1OGAA 3L3HA 5JO5A 5LGHH 3BP6A 3CFEB 4I3RH 3G5ZB 3HG1B 3QG7L 4K7FA 2M8XA 4UUJA 1F58H 4KRNA 4Y2DC 3V5KB 1LQSR 2NY3D 1T2QL 1NLDL 3JTSA 3F62A 2E5EA 4JY4B 4LLQB 2H9GA 5HGHA 3D48R 4PJBB 4KK9D 4AY0A 4YO0B 2HA1A 2VZUA 4MZ2A 3UPRB 1T7YA 3GMMB 2EDEA 5CSZA 4WDIA 3ZDYE 4Y8AA 3KG5A 4Q7DA 1CZ8H 2VITB 4Q9BA 1A6VL 4N5EA 3GSQA 3MRDB 3VA2C 4QHUA 2Q76A 4FFYL 3NA9H 3ARGC 1T5WB 4HEPG 1KTDA 2CUMA 3HRPA 1TQCB 4OM0H 1T03L 1JN6B 4YFLI 3ARWA 2YD2A 5F3BA 2ZCLL 3VGAB 2V7HA 3AAZB 3BPCA 5T1MB 4MD0A 1LD9B 4DW2H 1FYTD 2WIMA 2E27L 5KJRL 1QSEB 4R0LB 5FKAB 5JHDE 4WNQB 1A7PL 4KV5E 4HMCA 3ESVF 1GL4B 1QA9A 1A9BB 3NABH 3ZYJA 4KDTA 4QOKD 1ZHNA 1YQVL 4HMEA 1IQDA 1LO0L 3T77B 2BOCB 3MA9H 1B88A 1MHPL 4NOFA 2OS7A 1FC2D 2XN9A 3MV7E 1J0HA 1HOCB 2ICWB 1NBVH 1BREA 2A6IA 2VH5L 1J12A 2OR9H 4JR9H 4YHKH 2EYSB 3AS0A 4PG9B 3F12B 5C0IA 1TLKA 1PG7L 2CLRA 4UT6L 3FOLB 5ETUB 1S9XA 3SDXA 3QXWA 1T1ZA 5DQ9B 2CR3A 3VRIB 1LEIA 4OJFH 1ZT7A 3L3JB 3LPGA 4BA8A 2SEBB 5D2NB 3BMWA 2BNUA 1MLCA 3ROLB 1I7ZA 3O9WB 2YSSA 4M5YH 3BP4B 5C09A 3HNTL 5KVFL 1UACH 2FO4A 3VWJA 3MMEA 1Z5LB 3VI4F 1U2CA 3VW3L 2X89D 3DETC 1QVOB 3SKOA 1I8MA 4PJ7F 2IEPA 3C2SA 1MI5E 3BQUB 5ERWA 3RTQD 3PHOA 3SJVA 1ERNA 5E8EB 1I8KA 1X5HA 3GFUA 4PJCA 5I8OL 1F4WL 1HYSC 5L2JB 3TA3C 4YDIH 1GGTA 5C2BH 2VLKB 1N5AA 2QQQA 3KXFA 4QXGL 5BCAA 3BKMH 1HZHH 2B20A 2EZ0D 4ONHA 4G9DA 3DI3B 4S0UC 5I1DB 1FAKT 4F15C 5JORA 3MRNA 2KUTA 3EOBA 4LNVA 5DK2B 1E4WH 2HT2C 5DEZA 2E6JA 2Q3ZA 4PJ9B 1UKTA 4S1QL 2HKHL 2EXYC 1O7VA 3JTTB 2G60L 4X7DC 2R1WA 3VFNB 3SPVA 2MQ3A 1W8NA 5FYKU 1VFAA 5IHZA 1JHKH 2BSED 2EYRA 4NZRL 2FX9H 4P9ML 3X3FL 2A1WH 3QI9C 2C7UB 3KGRA 3WFZA 4RRPA 2VDML 4EDWH 3UPAA 3MBXH 2BRRL 2QL1A 4WW1B 1Q1JL 4K3DL 3KPSA 4X6EA 3PL6B 2VUOA 1CIUA 3K1KC 4YXKH 4UB0L 5INCA 1KEML 4GKSB 5GRVK 2Z93B 3IDNA 4PP8C 2QADD 1KBGH 3GBLA 2CRYA 4POYA 1ZHKA 2ICEA 2J88H 3FQXB 4O5LL 4QHKJ 1I3RB 5D2LA 1KLGA 1X4XA 4V1DE 5GIRB 5IW6A 4LSPH 3KYAA 5KANG 2BZDA 3TNNA 4D9RD 4HXBH 3ZDZE 1CDBA 1FQ9C 1H5BB 2BNRD 3DTXA 4N9OB 2D7TH 1TJGH 3VGDA 5I30H 35C8H 5ADOH 5ALCH 5EC1A 1TNNA 1R5IA 3LPFA 4KY1H 4Y4FA 3SDDA 4D8PA 4ELKA 4BM7A 1DBMH 5EIIA 3WE6A 4TNVK 3GO1L 3DROA 3ALXA 2GSGB 1DBAH 4AENB 5I8EA 4OQTL 1P6AB 1JGDA 3EYSL 5HHNB 1QO3B 4K23L 4OLUH 3HE6C 4K3GA 4OV5A 5E7FA 2GY5A 5AD0B 5KANI 1IC1A 4JKPH 1KCRH 2XWJB 3GMPB 1J10A 5C0CD 2JF1A 1M6OA 3O2DA 3GJEB 2AQ2A 5FV1L 1CF8L 5C9JA 5DA4A 5FM8A 3LZFH 3HE7C 5BVJA 3CH8A 3GSUB 4LHUA 4L9LB 2AVGA 5KSBE 1ZLWK 4L3CA 3G6JB 3ORJA 5J12C 3V7AG 3MLSH 4HH9A 4HDIA 3W82A 4TNVF 1PKOA 1K9TA 4Z77B 4ZD3H 1RZFH 3IDMA 1WICA 3BZFA 4XI5C 5BS0B 4Y4KC 3PGCB 3VA6A 1MUJB 4DZ8B 1TZHA 2BVTA 1NAMA 3V6FA 3B3IA 5J6GA 1I7TA 2FHFA 3O0RH 5T33L 3FQNB 1RJZB 3BOVA 1J1OH 5JXEC 4P2OD 3S8WA 1F3JA 3O45B 3B9KA 3OL2A 4ZOAA 2AKRA 2B8OT 4JZJA 5DRZA 5JUEL 5IHLB 1FSKC 4DKDC 4AIOA 1CFNB 1KN2L 2FB4H 3MLTB 4GAJH 4LOUC 4HC1H 3OKMB 5CEZE 4Z78A 1I4FB 4RGOH 5JPMB 5LCVL 4HXAL 3BESR 4X6BB 2V2XB 1TENA 3QHFH 2P7TA 1CGXA 3CSYB 2FSEA 4KTDH 3FFCD 3L3OA 1G7JA 4PJ5A 5K9KA 4QRTB 2HH0H 1IC5H 2BVYA 2F53A 3OKNB 2F19H 5T3ZD 4CU7A 4XVSL 1UZ6F 3FT3B 2ZG3A 3E0GA 4PJDE 2NY6C 1FCGA 4QRQB 3NH7L 5C6PB 5HHXL 4UNTA 4ZXBD 4M62H 4Y1AE 3MV11 3PDOB 2E9IA 4OGZA 4XAKD 2VAAA 3EYFA 3OXSB 3P11H 1VGEL 5SWZB 5CBEA 5HHPA 4M7LT 2W9LA 2HFEB 1CCZA 1IFHH 3QUXB 3SCMA 3J8F7 1A14H 3DPBA 3FQRB 4N5UA 4F33A 4MD5A 3X13A 3MPCA 3FFDB 3P4MB 3VXTB 4P3CH 1DBBL 1HN1A 1CD1A 5KSAB 3L5WA 1BVLA 3DV6A 3ULVD 1B0WA 4X4MA 2VC2L 4Y5XA 5ICXA 5EU4A 3LKRA 5FYJH 4OLZH 1WBZB 1T6VN 5HHME 4BSJA 5IFJA 3BHBB 1UB6A 4XGZB 5TDOA 3QUZD 5F9OL 3RY5A 4ORGA 3H0TB 5I1IH 5INDB 5CMAA 4HJJH 3ULUD 4ZDHA 2OL3A 2ZKHL 1WWWX 1K6QL 5DO2D 1GZQB 1LK2B 4WGVB 4M02A 1ACZA 4NDMB 1ZXQA 3FO1A 1JCKA 3H6JA 1K4CA 2YEZB 2NXZC 1IGCH 2BVEA 4XXDA 2IH1A 2DM7A 2HFFB 1FGVH 4N8PA 4YGAB 3TIEB 5EA0L 5I74B 5KS9B 2A77L 2RHEA 3QFJB 1FFOB 2BVOB 1GYAA 1JZ3A 4PRIE 1JWUA 4P9HC 1FO0H 1L7TL 4K3JL 2Y6SD 4U0RC 4KPHH 4OCMC 2BX5A 5EBMA 1JUFA 3ZO0A 2JB5H 4G7VH 1OTSC 1TJHL 3OKLA 2JB6B 3OQ3B 4BQ6A 4L8SC 4HIEA 4KHXH 1HKLL 4P2RD 3ARED 5ID1A 4OLVL 3BZ4B 4L4TB 4J12A 3HFML 3KHQA 1QBLL 1FL6B 3EGSA 1D7FA 1W72H 3LN4B 4H8WL 4DEPC 5F7FA 1WT5C 3O41A 1WWCA 4JFYA 1NGXB 2EDOA 2D03L 3OJVC 1P7KA 5I6XB 3MV9E 3MV8A 2KQMA 3RDTA 4M4RA 2NX5B 3T04D 5FB8A 2YC1B 2ADFL 4GRMA 4LRNH 1OTUD 1CDCA 4U6YB 5F9WC 3MCKB 3MXVL 4FXGA 3O2VL 1XGTA 4H1LA 1J9CT 5DD5H 2WAHA 2L0DA 5E8NB 5EU3B 3U7YL 2A0LC 2XZCL 4NSKB 3MRJB 3MRCB 3NCBB 1EAJA 1QLEL 2ITCA 3KYOA 4Q0XH 4E9LA 4U4BA 3VXRD 1INQB 4ELMF 3LY6A 2EDBA 4BQBA 1AGDA 3BPNB 3SGKA 1UJTA 5D93B 4AMKL 1J5OL 5EOQH 4I77L 3ZKXB 3ZSTA 4BH8A 3FQTB 4FQLH 1MCEA 4M8VA 1A3QA 4RNRA 2L7JA 4JG0L 3VDBA 4ODVL 4JN1L 3RWGA 3FB7B 2A83B 5GXBB 1S7XB 4ZUWB 1L9NA 3S6CA 2GTWA 1OWWA 5DTFA 3MRQA 5IB1A 2LVEA 3VXUA 4QO1A 2FLRT 5D71L 2A6DA 2BOBA 2X4QB 5CIPB 3JTSB 3SQOH 1R0AL 4ZPTB 1JYNA 2AJYL 3S36L 5CCKL 5A3ID 3EO9L 4KJWD 2Z8WC 4HZLA 4P46C 5D8JL 2APBA 4AZ8A 2AJXH 1G7QB 5FO7A 1A7OH 4P5TC 4UOW0 5EN2A 3EDEA 3ESUF 4QHUB 2Q76B 4U31A 1YECH 1ACYL 4HMDA 1WEJL 3B8SA 3NZ8A 5DGQA 4F7EA 2CMRL 1J88A 1EXUB 4ZS6D 4F9PC 2EH7H 3F7VA 5L7XL 2EDXA 1BD2E 5IP4A 4F3FA 1AHWB 3BPCB 4MD0B 2OJEB 2FBJL 4NN5B 4QRRA 1OWRM 1GCFA 2DWEB 5LBSL 1BP3B 5J1AB 1JFQL 3AM8A 3LB6D 1G6RB 4FP8L 4PS4H 1QA9B 2Z35B 1RHFA 5FUCC 3KR3H 2BSTA 2PTTA 4X6CA 3JXAA 5D1ZA 3E2HA 3I9GL 1LNUB 1YEJH 1A1MA 1A6WH 3S3JA 1EFXA 3VFTA 4WI3A 2ZPKH 4HJ0C 2XN9B 3D39D 2GIYA 3EBAA 4AYFA 3ROOA 1UC6A 2A6IB 5D7IF 5IWLC 1JI1A 1P5VA 3UZEA 4PJGE 1FIGH 5GS0L 3MUGB 1S9XB 4CMMA 4GAGL 1MCDA 1UWXK 4DKFH 4APQA 5C0NC 2HRPL 3HZYA 3SDAC 3JWDC 2NW2A 3MRBA 3AREB 5SX4I 4L3EA 3ZE0E 2R56L 3CDFA 5D7SH 3DVNA 4WUUE 5JTWA 2PN5A 1FFNA 3JZ7A 3CVHB 4K71B 2YXFA 4Q9RL 2FJGB 1KCVH 2GHWB 5GGRA 4GG6B 3MMEB 1FNSH 3SE9L 4HFWB 4JO1L 4J23A 5JA9A 4ETQA 1AY1H 4WFHD 2RB8A 1M7XA 1I8MB 1RZ7H 2ZOKA 2VLRE 4FTVE 5CILL 4OQTA 3SJVB 5IFHL 1KJ3L 5FGCE 1DUZA 4B7LA 4IDLA 2IPUG 1NC4B 2W65B 4JDTH 4OZGA 2FH6A 3QWRA 1H8SA 3QXUA 3FZUC 3GNML 1KENL 1IGTA 5C08E 1A1OA 5IK3A 4X4XB 5TE6L 3NBNA 4MQTB 2ZNWA 1AQKH 3BEVB 5FK9A 1LO3L 3I84A 1EK3A 1C7TA 4FXLA 1QKZL 2PCPA 3JTCA 2EO9A 2PR4H 1IAIH 5BRZD 2LTQC 3SPVB 2BJML 3ABZA 4NZTH 4RSVA 4ISVA 4Y4HA 4HS3B 5IHZB 1NAKH 2MOVA 3BP5B 1ZSDA 4BSWA 3LN5A 3SGDI 3MBEA 3V2AR 1YEEH 2AJUL 4JEGB 5DJXB 2VXSL 3IDJB 3ECBB 4M61A 2KPNA 2AXJA 1U36A 3LIZL 3PXHA 1NCWL 4HIJA 4O51A 1CXHA 1AXSA 3BGMB 5T3XH 3QHZL 3EZJB 2ICEB 4RA3A 3HNSL 5ID0B 1KLGB 2ZUSA 3CK0L 4P2QA 4XPTH 5D4QA 4WWKD 5IW6B 1F3DJ 4BKLA 4YHOL 4FFEX 4YPJA 1YEGH 3TNNB 1RZGB 2ERJC 5DMIL 5IBTH 3T3MF 1DDHB 3BE1H 2JJSC 4I13B 4M93C 4Q2ZA 4Z7WE 4HUXA 4ZTPH 3T1WA 1T66D 3BYTA 5IB5B 5EBLB 2IF7A 4E42A 2QTEA 3DRQB 4D8PB 4ELKB 4I0PC 3LEVH 4S1SH 5EUKA 4BELD 2AK1H 4I18C 1EHLL 2P5WA 4WV1A 3QNXB 2XTLA 1LP9F 4WI9A 4XH2A 4KZEL 4NZDA 3CLEL 3NACL 1U2HA 3P0YL 1QFWH 3I3EA 3MLWL 3W9EA 4LLAA 3GIZL 1CD9B 3VMPA 3GBNH 3IJSA 1RU9L 1MWAA 3Q6FA 1LEGA 3NFNA 5HI5D 1T1YA 4JVWA 1Q9LB 2UVFA 3RFZC 3CH1A 1XR9A 4NHCH 5EORH 3GRWL 1F4XH 5C9JB 4RMSA 3N85H 5CBAB 4DGIH 5LQBL 4XC3H 5BVJB 1YPZA 3BN9D 3I3DA 4LHUB 5TPWL 4GMTH 3RVWC 1JNLH 5E8PB 3TCLA 4G80B 3F7YA 1HSAA 3T4AB 3MACL 4MVBD 3GKWL 3BZFB 1QRNE 1F4AA 3RNKA 1CICD 2ICWI 5JQ6L 1TZHB 2I24N 1DQLH 3TBVA 3WUWA 1OAQL 2AI0H 3MV9D 2UWEF 2DQHH 2IAMB 3KYNB 4Z18A 2DDQL 1AO7D 4MXWL 2FIKA 4GSDH 5F6IB 2X1WL 2VTFA 1MH5A 3U2SB 2OTPA 4JKKA 4EUPH 2BXYA 1MF2L 1KPRB 5BZDB 4GH7B 4YBLC 3HS0A 1RIUL 3HC3L 4JZJB 3VXSA 4XCNB 1WIUA 2GJZA 3FJTA 4JRYA 2AABL 2B0SH 1F3DH 4KJYA 3JV5A 3KPRE 3VXNA 1J7VR 3NGBC 2GITA 1A1NB 1ZLSL 3VDAA 2ZUQB 4BH7A 4EBQH 4KHTH 3C5JA 3IT8D 3NMEA 3N1MC 4YK4B 1IKFL 3ARSA 5EU6B 1MIEH 4PJ5B 5FGSA 4LSQH 5BW7C 5H2BB 4QEGA 2I9LB 4Y5VC 5GZNC 4IRZH 3CSPA 1X4YA 1S7SB 1FCCA 2Z92A 1GZPA 3SKMA 5AAMA 3KS0J 3TPKA 3DO3A 5CD5D 2CXGA 4M6MH 4TSBH 1X7QA 5E4EC 2MQ0A 2EH8H 4PJIA 1VKXA 4ZFZA 2ZNXA 1J8KA 4CN4A 3KLAA 5AZEH 3SCMB 1WF5A 4KKAD 4F33B 3ERYA 1P6FA 4G6KH 4KUCD 3KYKL 1YJDH 1OGTA 1RZKL 1Y0LB 3L7EB 1D9KC 1FYTA 1YDPB 5CJXC 1EGJH 4P3WA 5SV3A 2NPLX 1FL5B 2CKBH 3UTTE 4NCDA 3DV6B 4O58H 3U79A 3C9NB 4R6UA 2UVEA 5EU4B 4GG8B 5FYLE 4FQHA 4JJ5B 5CGMA 3PWJB 4YX2L 1ZK9A 5GPRA 4N9GA 4QOKA 4NPYB 3W11D 4NHUE 2EDNA 3WJJC 4XBGB 25C8H 4KK6C 2PTUA 4MSWA 4XMLH 1IRAY 5CMAB 3TH4T 2Y07L 4KJPC 1DBJL 2CDEB 1FHGA 4M6NH 4V3DB 2OSLB 3I2CH 2AV7A 3FO1B 1CXFA 3TZVB 1K4CB 5KAQF 3GHEH 4PG2C 4NNXA 5E1AA 1LMKA 4XHQA 2COQA 3HZMA 5HGAA 2MHAB 1AD9A 1XCQA 3JV0A 1KYOK 5CP7A 4PGBB 3PQYB 4FRWA 4RAVA 2ADGB 1PKQA 1CXEA 4EOWL 2O93L 1Z0NA 1BBDH 1JWUB 3QCVH 2D31B 4JLRA 2Y36H 4Y2DD 1QSFA 2O5YH 4FQQA 3RVTC 4KXZH 4UIKH 2GTZB 2R2HB 4OGYH 3SN6N 4E41E 5I73B 3KS0H 1T2XA 5ICZA 3SY0B 1CR9H 1GHFL 3DUUB 5D6DA 1F6LL 4OD2A 1FZJA 1F90L 4J8RA 3LKOA 4JN2A 2EDRA 3RTQA 4LSSL 2EKJA 4OGXL 3EGSB 1NCDH 4PGCA 1K4DB 4ZUVA 2VXVL 3O41B 1MFEH 1LK3L 1UXWA 1W0VA 5HYIA 4GS7B 2NY1C 3ARGD 4Q6IC 4WUUD 1DL7H 2XRAL 3NTCL 3RBSA 3DURA 3GM0A 3MLVL 5DHXB 5KZCB 4F58H 3CFDA 1JGUL 4PJXA 3ARFC 3RWHA 4WEMB 5ADPL 3IETB 1SBSH 1FVDA 1X5GA 3TC9A 1HINL 1C5BL 5GGTL 1R3HB 4FTVD 3CFKA 2ZUXA 1HI6B 3QCUH 3DSNA 4UDUB 5D1XB 2KZ1B 4XP6H 3C6SA 2K1MA 2AERT 2DI8A 3N06B 3GJFK 4LPTA 4J3TA 2DQDL 1KJ2L 5C08D 4XVTH 1NFIA 4QF1A 3TEUA 3UAJC 3UCRA 4ZFFA 3U4EB 4HBCL 4U3XA 1ZT1A 4HKZB 4YFLF 1G9NL 4OZHE 5JIKA 4UV7H 4YQXH 3H9SA 5K59F 2NY7H 1NFDE 4JFEA 5KVGL 1RHHA 1WFUA 3SOBH 1PZUB 2B5IC 5MEPA 4ONGH 4G5ZH 4JGJA 3RGVC 4GKNA 4JHWL 3QDGE 3MRQB 2EIBA 3QFDA 2YPLD 5T5NG 2A6DB 2VDQL 3M8OL 4QCIB 4MD4A 2WWKO 4XVJH 4CADA 5IJVA 2BNRA 3CX5K 4UOJA 5EULV 2FR4B 1E0OB 4J3SA 3W2DL 1RZ8B 3FT2A 1JJUA 2DLIA 3DETD 1NGPH 5GGVH 3OX8A 3BT2H 1I7UA 1N4XL 3QULA 1E6JH 4P4KC 3HAEA 2BY0A 1BJ1J 1F4YL 3MYZA 5CZVH 5CEZL 5I76A 3RJDA 1JPSL 4AT6A 5HYSB 1HYSD 2NY4B 3TA3D 3NZ8B 1OL0A 3PABA 2A9NH 2R69L 4I9WE 5ESAA 2NY2C 1ODAA 2BXZA 2GJ6E 2MTPA 2CJUL 1Q0XH 2CLVA 2Q20A 3F7VB 4KRPC 5C0CA 4F3FB 1VA9A 3HUJA 2VMFA 1TITA 4GLRI 3U0PA 2HT2D 2Q8AL 2BSSA 2LAGB 2MCPH 3ZT7A 1NMBL 3W5NA 2NXYB 4ZFOA 4JFFD 4IOIA 1Q9OA 3SEPA 4K94H 3UO1H 5HGBB 2P8LB 2EXYD 1N6QH 3DLQR 5GHWH 3D85B 2PTTB 4PJFF 1T89A 1KULA 3K7UA 5D1ZB 3E2HB 2ZSVB 1G1CA 4W70A 3EOTL 3V7MA 2BP3A 4O9HL 3VFTB 4FOMA 3QI9D 5D7LE 4LASH 5F7EL 2R4RH 4C4KO 4NKIL 3ROOB 2FEEL 2XPGA 3JSSA 3ZKSD 3EFFA 2DF3A 1K5NB 1JPGB 4YAQA 2NY5L 2QR0B 4JQIH 4K9EL 4PJHA 4WO4C 2DM2A 4KMTL 5EZLB 3V52L 5GJTH 5EZJB 5JPNB 1MJ7H 4QHMA 1FNFA 3O4LE 4JFDA 2NW2B 5E6YA 3VXMD 3QIUA 1T5XA 4BZ2H 1V3KA 1VFBA 4ODHL 4JFQA 1KJMB 5F89B 4TSAL 1FFNB 1MREL 3DWTA 3MZGB 4CU6A 4RGMB 1D5BB 4GW4A 1BJ1H 3RVVC 3WS3B 4WIQA 1QHPA 3PGDA 4OF7A 4OZIF 1JPTH 2ITDB 5IW1B 4ZXBA 5DEFB 4Y19E 5D96B 3QEUA 3HE6D 3EO1B 4PJAF 1BFTA 1CFSA 4D3CH 2AJ3B 3P9WB 4LIQH 5L2KB 4GAYA 3GRWA 2R0ZH 1NAMH 4GRWF 5FGRA 5C6TL 5IK3B 5GS2D 3HE7D 4HGWA 1KOAA 1MFDL 2PXYC 4YR6A 4O00A 1IT9H 4LSRH 1RZIA 1PZ5A 4QTHA 3O2WH 5DQDH 4C4KT 2YHGA 2WY3A 3P77A 1RULL 3QT2A 4XI5D 4N0UB 4Y4KD 1JBJA 3Q5OA 5T1DL 4BFBD 3VG0H 3PIQA 3U4BH 2P5EE 3VH8A 3B9DA 1G9ML 5HVFB 1ES0A 2JCCE 4BSWB 2O5ZH 1AXTH 2MFNA 5CSBA 3MLRL 5JXED 3IFOB 4LSVL 1U8OB 4L5FH 5F1NB 4WU7B 3QJFB 1X6LA 3CIQA 2YPLB 4LBEA 2VISA 2G2RA 4LLVA 2VQUA 1LO5B 4FFWC 4YPGA 4MDIB 3P4NB 1RK0A 2XOTA 4O51B 2XFXA 3S4SA 5FYLD 2CRZA 4DZBB 1EAPA 3CFCL 1KNOA 3MFFB 4LOUD 3V5DB 3H2WA 4DN3L 3O8XC 1BPVA 1V7MH 1B0GB 4HIIA 2VN4A 4OLYL 3P4OB 4FN0A 5DT1H 2GFBB 4L8CA 5F7DB 1BQHA 1UCBL 4HUUA 4ZOCA 1QSVA 2J3SA 3MV7A 3CDCA 3E3QC 2I9TB 1HCVA 3RWJA 4E42B 5I1KH 1U8PA 3U30C 2R8SL 3QUMB 1BAFL 5AYUH 3EYVA 1MCNA 1JF1A 3S34L 4JDVB 3JVGC 3LS5H 4QRSB 1YEHL 3TBWB 2P5WB 3KPLA 3QA3B 4PTTA 2NY6D 1C5CL 4QLRA 2A74B 4ZTOL 3OR7A 2GK2A 3IJSB 4B50A 4MX7A 3QSKB 1J87A 1LEGB 3NFNB 1T1YB 3CH1B 2ILLA 4X9GA 1GGCH 1HHGB 1ZT4A 3L5XL 5F71A 3TO2B 4LDOB 4TRPH 1J8HB 3FCTB 1A0QH 1QPXA 1U8IA 1OB1B 1Z2KA 3VCLA 4PB9H 1I8LC 3WEXA 4LVHC 4WVRA 5IHUL 2P8PB 1MI5A 3CU7A 1I1FA 3TCLB 3F7YB 1HSAB 4UU9A 4YHML 2OL3H 1T83C 1UFUA 4LNRB 5MERB 5DHVB 2Q7YB 5E9DD 2B2XL 2GUOA 4M43H 1WBYA 4M9PA 3U9PH 4EDXB 1FFQA 5EWIL 4UT9H 5JA8B 3INUL 4X5WA 4MMXC 1MH5B 5DURB 3TM6A 1P1ZB 4PRDA 1S7WA 5FUOH 1QPPA 1T7ZA 2GJZB 3GMOA 5K93A 2PTVA 1LO2H 3QB7C 2NXZD 3JWOC 1BECA 3VXNB 3QUYD 5KOMC 5KG9B 2YUZA 3N1QC 2F8XC 5SWSD 4K3HA 1MCIA 1TZIB 5I1HH 2RIKA 3MZTA 1EEZA 1YN7B 43CAA 3O6KL 1RK1A 1OF2A 1FVCA 3WFBH 4NWUL 5IOPA 1FNGB 3T0BA 1OTSD 3VRLF 3HPLB 4FQIL 1RZJH 2F8VA 3VJ6A 1N7MH 4OLEA 2A9ML 3WSQH 3LEXA 4YHIA 3C09C 1NUGA 1VFOA 4JPWH 4NQTA 4ZODA 3WN5B 1FZMA 2EDHA 4K8RC 4OTXH 5KJRH 1BVKB 4UQ3B 4R2GB 3ETBF 1TETL 2X9WA 2OR7A 4ZFZB 5AAWA 4H1LH 5TE7H 2AK4D 4HS8H 3TO4B 3HI1A 1A2YA 4CVXA 2HWZH 2H32A 5AZ2H 4NN6C 1LO0H 1P4IL 5I1CH 4PJ7B 1CIDA 2J8UA 1FRGL 1SJEA 5D5MF 1CE6B 3GSNB 4XTRC 3S88L 2YK1L 5DZNA 3T09A 4DFHA 1PYWA 1IAIM 2UZIL 2A73A 2APXA 4OD3L 4Z5RA 1V7NL 4GBXA 2A0LD 1M7DA 2UV3A 3PV7A 4LLMA 4UT6H 2GJ6D 2YMXL 5HYFA 3V0AC 3MLYL 3L6FA 4ORZC 4XPGH 5HGGS 3D39A 3W0WE 3VDCA 1BM3H 3CXDL 4M1DL 1HKFA 1PAMA 2B1AH 2XTJB 5KSBA 4MYWB 1CK0L 4KU1A 3VW3H 2EDKA 4NNXB 5E95B 1KLUB 4WHDA 1F13A 3U7AA 4I3GA 5DUPL 3FB5A 3BXNA 1V5JA 3HZMB 5HGAB 1AD9B 2DQGL 4YC2C 3QIBA 4YHPB 5CP7B 3DSFL 1KG0A 3IXTB 5I66A 2ADJA 1F97A 4JZNB 4NQEE 5MEQB 3QQ3B 2X4SA 3MREB 1MHEB 4F80A 4OD1L 5IMLA 1QSFB 1J18A 3LH2L 2H3NA 4IIQC 4TVPE 4D9LL 3B5TA 4PJEE 2AEWA 3ISWA 5E8DH 1OAUH 5GJSH 4ZO8A 5IG7A 3RY6A 4P46D 1FZJB 4J8RB 1ROWA 2D0FA 4XBEH 4L4VD 3FB6A 4LFHG 2WWMC 3QAZC 4PGCB 1XIWB 4P5TD 1QFWM 1BEYH 5IIEB 4XNXL 2R29H 1SJVA 1A3RH 1UXWB 3HPJA 3SDCB 4UNVA 2HKHH 1U8HA 4MQ7B 5HGDB 3ZSSA 5DRWA 5ACZA 4MJ6B 4ZO6A 2JJUA 1D5IL 5FO9A 3FO9B 1LP9E 3PWPB 4HGMA 3TBTB 3RWHB 4MAUL 4XWGL 4FXKA 4C55A 4G8GE 1PLGL 2VDMH 4J1UA 4G6MH 4QTIH 4FNLH 4PJDA 2DJ4A 3CFKB 4ZQKB 2Q86A 3GB7A 4RBPK 2F5AL 3VRJA 3IFPA 3PDDA 1Q1JH 1VSCA 3KPOA 3OJ2C 2APWA 3C6SB 1MAMH 2F8OA 1WAAE 5BRZA 3QDAA 3G04B 3G6DL 5B38A 3A6CH 3HMWH 1JF5A 4UB0H 4F2MA 1OOAA 5B39B 4HG4K 1DVFC 1X6NA 4HJ0D 4ERSH 4HAFA 1MVFA 3GSOB 4M7KL 4QF1B 4P99A 3OWEA 5TDNB 1BHGA 2VIRB 3VGHA 3VMNA 5BV7C 4XX1E 1F11A 5SX5K 3O6MH 3TVMC 3VXOB 1EV2E 2YD3A 1XGYH 5CZKA 2YR3A 4X6DF 1JIBA 1QLFB 2X1PA 3H9SB 4O4YL 1CXLA 4U1MA 1UA6L 4C54A 2DLHA 4AIZB 4JFEB 4L1DA 3S37L 2IANB 1ORQA 1FNAA 4S2SA 3S96A 2D9QB 5C0ND 1QR1B 3SDAD 5FXCH 4CNIB 1H3UA 4WWKA 4OCLC 1XGPA 4OQTH 4HGKC 3M1BA 3M17A 3EYSH 3WD5H 1B3JA 4DEPB 3TF7A 3N1FC 4UINH 4EI5C 1FYHB 1ZGLM 2F58L 3FT2B 4UMGA 2H8PB 3BPOB 1G7PB 4M5ZH 5BZWA 3ZLQC 4C56D 3UTSD 1AIFA 3RWDA 4IS6A 5GRJL 4OCYL 1FV1A 4LVOC 4NFCA 1AKJD 5DR5H 4KVNL 2FATH 2E6PA 1NLBL 3U83A 5ESAB 4PRIA 4LCCC 4FQJL 3FZUD 1C7SA 2EYTB 3HUJB 5C86A 5MP6L 5T33H 2C1PA 3J7HA 2LE9A 4GW5A 5DJ6B 4OBSA 4JCLA 1E4XL 4MVBA 2BVUA 4HPYL 4Z7VF 5F6HJ 2GK0A 2V7NB 5JNYA 4F7MA 3IAQA 2ZOLA 1CICA 3IFNL 4JB9L 1ZLVK 1KN2H 3L3KA 4QNPE 3UDWC 3O6FA 4KH2A 1GAFL 2H1PH 3MV9A 3OGCA 2R2CA 2EDQA 2ESVE 4KKCC 1AO7A 3VE0A 3I6GA 2X40A 2H2PC 5CD3A 5LGHL 2AXFB 3L3IB 3UC0H 4I3RL 3HC0B 1QZ1A 2XA3A 4KROC 2F54B 2NTFB 1F58L 5IMKA 3EYQC 1I7RA 4LL9A 4B5EA 1UH3A 3DUHA 2ATPA 2P8MB 5FYLL 3FRPG 4Z7UF 1AGBB 4QHMB 5MEOB 2XA8H 4JFDB 4M3KB 3QIUB 5C0DA 2Z8RA 1OP5H 1S7VA 1NUFA 2CDGB 1IAOB 3BWUC 3K8MA 1JK8A 4XVUC 2DQCH 1CZ8L 4A6YA 3T1FA 1FJ1B 4J3XA 1MWAH 2YD7A 4NYLA 3B2VH 2VO5A 4GW4B 3IDYC 2E7LE 1JHTA 2E6QA 2KKQA 1KTRL 4OM0L 1ZHBA 4I0PD 5D1QB 3M07A 4DW2L 3RWCA 3VGFA 4YDLB 4NC1E 2Z9TA 3GUTA 4CGTA 1T4KB 3FL7A 3RZCB 1XT5A 1EPFA 1CFSB 4M8QA 1BLNA 3IKCA 1WIOA 5C1MB 3CFIC 3NABL 4IJ3C 2VZVA 4JDZA 1A7NH 5EDXA 4PJBF 4JAMA 3GSWA 2BNQE 4ZAKC 4TTGA 5E6ZA 1QG3A 3MGAA 1TQBC 2Z4QA 3MA9L 1VERA 1BF2A 2YD4A 4QTHB 3RVWD 3B4NA 1KCUH 2GAZA 1D6EB 2ZKHH 4ODWB 5JDSA 4Z76B 1NBVL 1HIMH 3K4DA 3E6FB 5J6HB 1RJLA 3X14A 2OR9L 1S9WB 3IKKA 1HDMB 4YHKL 4PRPE 3QHTC 4I3SH 2PYED 4MLSA 3W39B 3FQUB 4IMKC 1EUTA 4OIBA 4UIMB 3KLSA 1BD2A 5ITFB 2EICA 5H37H 4OJFL 1DZBA 3D0VA 3T0EB 1I3GH 4O2CA 4PFEA 4X9FA 5HYSG 4LLVB 3ZDXF 5JHDB 1KIQA 1RK0B 4M5YL 3OAZH 2X9YA 5T1LD 3WO4C 4ZUTA 1KNOB 5ITBH 5IM7A 1EO5A 4FHBD 4HIIB 4LDLB 4L8CB 2APFA 1PQZA 1ZEAL 4H8WH 4NWTH 4Y2DA 5EB9A 2X4PA 3ZYIA 4RWHA 4HWZB 3RWJB 2IFFH 4KI5E 4EIGB 1T80A 4HLZH 4YDIL 4NQXA 4XPBL 2HKFH 5C2BL 2EIEA 3WNNA 5GZND 1FNEB 3BKML 1HZHL 1T7VA 4PJGA 3I6LE 4P5MB 4MXVE 3RAJH 1E4WL 4JPKH 3VXPA 2CDFB 3VFSA 3BZEB 4HX1B 1YN6B 3WXWH 1UJ3C 5HD8C 3ARGA 4WUUA 3QDJB 4JY5L 2IPKB 3LQZA 1DQQB 4TVPD 5FM5M 3GZKA 5LGKA 2WBJC 1NC2D 2XZCH 4QXUH 1QFHA 4TSCH 1JHKL 1D9KD 3WEXB 2FX9L 5IMMB 2R23B 3W5MA 2A1WL 1MI5B 4KGLA 1I1FB 3RHWF 1JZ5A 2YA2A 4FTVA 2BVPA 4EDWL 1M7IB 3DMMB 3MBXL 3OJDB 1KXVC 2AS5M 1GIGH 4M1GH 4X5LA 4AMKH 1J5OH 4I77H 4XNZC 1C8PA 4YXKL 1G0XA 2G5BB 3QWOA 5E0QA 2HTKC 1KBGL 4KK6D 4XCEB 2X9XA 5C08A 4AH2A 2J88L 2FWOB 2PW1B 5FO8A 2MMXA 4JN1H 5EO1A 1KTLA 1A6ZB 1QD0A 2X7LA 2H2SC 4LSPL 3X12B 1UXSA 4KJPD 3PHQA 1MFCH 2N1KA 3GMOB 2CO7B 5T5FH 3VFVA 2E7MA 2APTA 1HNFA 2D7TL 4F8QA 3MRKB 1NGZA 1TJGL 2E7BA 2YKLH 4MAYB 2FL5B 35C8L 4XXCC 5ADOL 5I30L 2OTUA 4NC2B 4KY1L 3PHSA 4HJGB 4PUBL 3S36H 1DBML 3QDHA 4NQSA 5CCKH 3EO9H 4P5KB 4BYHA 3VFWA 4WW2B 32C2A 3UYRH 1HH6A 3PV6A 1DBAL 1REIA 5DJZA 7CGTA 1B6UA 2VLJD 4OLUL 5IOPB 5HHQA 2CMRH 1TQCC 1KCRL 3FQWA 3D0LA 4XP4H 3S5LB 2VLMD 1PY9A 2VDLL 4PGZA 3BPLB 3LZFL 4H5SB 1JPST 4MCZA 4M6AA 5DYOA 1Q94B 2I60H 4V1DB 5I2IA 4R0LC 1R3KB 3HRZA 3HN3A 3MLSL 2NY1D 2UZXB 3HZVA 3TA3A 5JW4M 1B4JH 3PF2A 4ZD3L 1GGYA 1RZFL 5EFIA 1A2YB 1XF5B 2HLAA 4WEUD 4XNMB 2Q3AA 3ARFD 3PXJA 1R24A 4NKMA 2W60B 5C0EB 1XMWA 4X98A 5JHLH 4JFFA 4PLOB 1HILB 2X4TA 5DEGB 4PJCE 2ZCKH 3MA7A 4MNQD 3R0MA 3KXFE 4CUCA 2CUHA 5CP3A 5EO0A 1CQKA 4GBXB 3BH8B 2H6PB 2FB4L 1KJ2B 2R1YA 5A16B 4GAGH 1U3YA 4GAJL 2HRPH 1ONQB 3CGTA 3DOSA 3QI9A 4I4WB 3UAJD 2IBZY 4RGOL 5D2NC 3EDJA 3G6JF 3BP7B 5EOTA 5KSBB 5CHNA 3QHFL 3O9WC 4KTDL 5C0AB 3O3BA 5E5MB 3EJZC 2HH0L 1IC5L 2F19L 3QIBB 5DQJA 1N3NA 3K3QA 2YPVL 3VXMA 1A7QH 5I66B 3T2PA 1EEQA 3BQUC 3RGVD 3HAEH 4I0CC 2ESVD 5IMLB 4M62L 3KPSE 1OAYH 4YUEH 4H25A 1EJ6A 1N5YL 3BH9A 1JZ7A 1G7IB 2K7PA 2NMSA 3P11L 4NBYB 4CW1B 3GNMH 3U0TA 2MPAH 2P46B 3WFHA 1IFHL 1A14L 1NDMB 4MNHB 3VFPB 1K85A 5D2LE 3ILPB 3FOMA 4P4KD 3FB6B 1U58B 4I2XE 4P3CL 3IS0X 3LQAH 4WI4A 3OKKA 3HPJB 4BFIA 4PJ9C 3HE6A 3CC5A 1J0YA 2MSPA 3D87B 2NY2D 1W8OA 1HQRB 4KRPD 2IBZX 5FO9B 4H88L 2E7HA 3G5XB 5CJBA 2QV2A 1DANU 3HE7A 1B0RA 3V7AE 1MJJA 5ABDE 4J1UB 5IVXE 3ARYA 3CU1A 2AJUH 2X2YA 2DLTA 4Q58C 5CSGA 5I1IL 2VXSH 4HJJL 1MFBH 3KPQA 4Y1AB 5IMOA 1JL8A 1L4IA 4Y4KA 3LIZH 3RUGF 4HUVA 4R3SB 3RP1A 3PL6C 3NN8B 3C60A 1G6VK 4F2MB 2DMBA 3NIDF 1YMMB 2Q6WA 3X3GH 1IGCL 1JGEB 3E8UH 5JXEA 3CZFA 1HEZA 1FGVL 4YHOH 4JHZA 5HPMB 2IH3B 3QNZA 4L8BA 5T5NF 4KJQC 3RIAK 3UTTA 1FO0L 1NL0H 4LIQE 4WO4D 4KPHL 4ZSOA 4YE4H 2NW3A 3B2UC 3D3VB 4G7VL 3NZHH 5T3ZH 4NHUA 5HHMB 4KHXL 3TYGL 5DMJB 5LVEA 4K7PY 4XC1H 3OGOE 4W6WB 1U95A 2BC4A 1IC7L 1ZVHA 3MLWH 2ADIA 1L9MA 5JXAH 1W72L 3LRGA 3KPNB 3UBXB 2HAZA 3BUTA 3REWB 1HHIA 5FKPA 1R5VA 3HI5H 5E8OB 4EQ2A 1WZLA 1U91A 3RVVD 5BZWB 2J4WH 1RUQH 5IBUB 3DV4B 3RWDB 1VHPA 1KB5B 1RUMH 3KVQA 5LQBH 1XZ0A 2MQCA 5C92A 4LKXA 1IEBA 1CLYH 4NT6B 2D7QA 3TYFA 4L9LC 4NP4H 3ILQC 4NRYA 4S1RH 3ULVH 1YYMH 3O6LL 4LCYA 1D5MA 4PRIB 5L0QB 2QSCH 5DD5L 4KI5D 2F53E 4JO2H 1KC5H 3BVNB 1P53A 2B4CC 4FQ2H 2C4FT 2PXYD 4KK5C 4D9QD 2HG5A 1U93A 5BO1H 4UTAH 3ULUH 2FGZA 2GK0B 5JNYB 3QDMD 2VDOL 5E9DA 1ITBB 2VDNH 3BKJH 4K7PX 1RFDL 3DJ9A 2BCKA 4YXLH 4WHTB 5EOQL 1A9EB 3QRFM 1TTUA 5F1IA 3OGCB 2K9UA 4FQLL 2B5IB 1UG9A 1ZLSH 5MENE 4R4NC 2C3HA 4EXKA 1IKFH 3LD8B 2D0HA 5IMKB 3BRFA 4FFWD 1I7RB 4H26A 5JIPA 2DRUA 1RD6A 3CUPB 1X44A 2ATPB 4NQCB 3OF6D 3HNVH 4EN3A 3SQOL 5DF0A 5DZOA 3QUYA 3QR2A 5C0DB 3O8XD 4WFFD 4FQPA 4X7EC 4XNQB 2HFTA 3QYCA 5SWSA 3K4AA 4MS8C 4NUGH 5L8KB 2AJXL 1AI1H 1A7OL 4EXPX 3Q48A 1YECL 3C6LA 1X5KA 4OZHA 2R2BA 4A2MA 1KB9J 1F2XK 4ODXA 1ZHBB 4PLNC 4WI5A 5IV2B 2EH7L 3QUXC 3FT4A 5B39G 3DO7A 1RZKH 5FCUH 3WHXA 4G9FB 4MWFA 4N0FA 3GGWA 5KSAC 1HHHB 4RGNE 1WT5A 3C8KA 5F3HA 5KTEH 3QCTH 5ENWA 2AK4A 1L6ZA 3MGTB 3WLWC 4PS4L 4YX2H 2VDKL 3SKNA 2HJLA 5JW4R 3KR3L 4JDZB 3S35X 1OPGH 1E28A 2J7LA 4HT1H 1YEJL 3QXDB 1A6WL 1IM9D 4MCYA 2X4OA 1FZKA 2ZPKL 5TH2A 1SVCP 2V5MA 2GAZB 1C1EH 2DS4A 5JDSB 1JV5A 5C6WH 4HUWA 1ZWIB 5DC0A 1UCTA 4N0CC 4HFUH 4W4NA 1FIGL 2DQFA 2GJ6A 1R3IH 2F5BH 1FFPA 5ICYB 1BD2B 5IJKC 4N8VB 4DKFL 5K9JH 4XCCH 5HYJD 3WL9B 2DLGA 2M26A 2Z91B 5I74C 3UEZA 5D7SL 3MNZA 4PJ8B 4PD4J 1CDIA 2DMCA 1KCVL 5FHAH 4YHLH 1FNSL 3ZYOA 2XI9A 4LRIC 3RGHA 3S3PA 5DMGC 1AY1L 2ATKA 2RFXA 1RZ7L 1X5AA 5CEYB 4X4YB 4YLQT 4XCYB 3WLBA 4OGXH 1OLZA 4DAGH 3QJHB 5E6IB 1XGRA 3ZTJH 5IB2A 1RAMA 4JDTL 3CPLA 5A40E 4KQ3H 1J05B 2UY7A 4KC3B 1KV3A 4OKVB 5I6XC 1JGUH 1SY6H 3SDXF 1XF2A 2F74A 4P46A 1GC1H 2HVKA 5F8QC 2CIIB 2OZ4A 4L4VA 3O4LA 4K8RD 4YGVB 4P5TA 1MLBB 3SE3C 1ZA6A 1LDPH 4WU5A 3QUKB 1OHQA 4MJID 3GSVA 4XNUH 2PR4L 1IAIL 4OF3A 5I1LA 5F70A 3IVKA 4F9PA 4NZTL 5ACLA 2ZCHH 4TNWK 1NAKL 5IR1A 1INDL 3R06A 4GKZB 2VLRB 1FAIH 1W0WB 1R5WA 3Q5TA 4XTRD 1YEEL 4HBCH 1AJ7H 4P2YA 4LLDA 1G9NH 1U8QB 1H3VA 5FGCB 4ZS7H 1I8IA 1SM3L 3BPNC 1BZ9A 1IVLA 5D93C 1A5FH 5K33A 5EIQA 5KVGH 3ZKXC 4OFDA 4OZFB 5L88H 4XWOC 4AH2B 1EO8H 3C5SB 4XPTL 1MFNA 4ALAH 4Z7VE 1DQJB 4TNWF 1TFHA 5IWLA 5IBTL 2R2EB 2R0LL 2VDQH 3M8OH 2AEPL 4R7DB 3BE1L 1HHJA 4ZTPL 4GRLB 4AEFA 2DIBA 1NBZB 3HA0A 5HYQA 1MFAH 5J9PA 4HUNB 4Y7MA 4NQSB 3LEVL 3I02A 2P5EA 3ARBB 4S1SL 1IC4L 1WCBB 1R3LA 2AK1L 5HDOA 32C2B 3SBWC 2JCCA 1TVHA 5C07E 2I27N 1RIHH 3ARTA 3PV6B 4HK0A 5DJZB 1QFWL 4N5EC 5IKCA 3WIIH 2VOTA 1OQOA 3QO1A 3GBNL 3WS6A 3UTZB 2HJFA 1P9MC 1KGCD 4HWUA 3KWWA 3NIFE 3RVXC 1I1AB 5LKNA 2O61A 1UB5A 2IQAA 4JFZH 3D0LB 3ZYZA 4NHCL 4C56A 2EDWA 3UTSA 4PGDB 5ANMA 5EORL 1UM6H 1AHWC 1F4XL 1V05A 4L3EE 3N85L 2Q8AH 4DGIL 4XC3L 2WWMD 4NN5C 4MCZB 5DYOB 4AG4L 2GSIB 5FYJU 4GMTL 1TNMA 2G75B 5I2IB 1JNLL 2VQ1B 2YS4A 3O3EB 4NQVB 4ELMA 1AKJA 2G9HA 1CGTA 3I50H 3L1OH 2CXKA 2BY1A 4Z7WB 1CT8B 4OFIA 4OAWA 4KDTC 3MX0A 2CLZA 5JIHA 1D5XB 1DQLL 3BO8A 3WMSA 3BUYA 2AI0L 4MA1B 1DUYA 1JPFB 4NKMB 3VD3A 2DQHL 3MROA 4OZIB 1BIIB 5HYJB 2VL5A 4GSDL 2J6EH 3D69A 4X7SH 2PO6B 1Z9LA 2FO1A 5I17B 4OF5A 5EO0B 5I19H 5D7KD 1HE7A 2VJXA 1KFAH 5DVKA 1T0PB 4WI7A 2B0SL 1VDGA 2YD8A 4GRWB 2FRGP 1UM4H 3RWIA 1DVFD 1BFOA 2R1XA 5LWYH 4EBQL 5C0BD 4LCWD 4QRPD 4KHTL 5FFLA 5EOTB 1IEAA 4F57H 1MREH 3TVMD 1JF6A 3IU3B 1OCWH 1FO0A 4PB0H 2UUDH 4K71C 2J8HA 2Q87A 1QRNB 1LE5A 1MIEL 3DVFA 1EVTC 4LSQL 1PSKH 3KLDA 1LEKB 1KCKA 5TF1H 3B43A 4ETYA 4IRZL 1EHNA 1MOEA 3G5VA 4GXUM 1IE5A 2EDJA 4XNYH 2APVA 5JR1L 1SJXA 4U1GC 5MEND 1N26A 1CFVH 3ZDXE 4M6ML 8CGTA 4TSBL 4RMQA 3BH9B 2EH8L 4EI5D 1AC6A 3P30L 5FA4A 3U0TB 4LCUA 1JNHA 3KPRB 4G6KL 4PR5A 4TUJA 4P2QE 4I18A 1YJDL 4ZUUA 2WUBH 3ZMRA 1EGJL 4O2EA 4BFIB 2CKBL 4O58L 3CC5B 3DX7B 7FABH 3TJHC 3EDFA 4ZNCD 3MLZH 4P4RB 2DQEH 3B9AA 1YY8B 3PWNA 1B0RB 3AB0B 1ITCA 25C8L 2CIKA 2WINA 4XMLL 5MHSE 5GRUH 3KPQB 5IMOB 3OR6B 4M6NL 3I2CL 4RGND 3DX8B 1KSRA 4DKEH 3C60B 1VESA 3GHEL 2PYEA 4XCFH 4JRXD 2C5DC 3S5LG 3MLUH 3WNPA 4HKXA 1EMTH 5DJAB 1CFTA 2Y4SA 2H2PD 2D4FA 2XZAH 3ARQA 4IEFB 3UTTB 1ED3B 1H3GA 1BBDL 4KROD 5ISZD 3QCVL 4A6YH 2Y36L 3EYQD 4YNYB 2O5YL 2YUVA 4IIQB 1XF3B 2AXGB 1R3JA 5JW4N 2YRLA 4UIKL 3V0VB 3V6ZB 5T1LA 1XFPA 4LEXH 4HKJB 3GIVB 5FV2A 1ORSB 4NHUB 5H94A 3HLAA 1MPAL 4JFPA 1CR9L 3HR5A 3QAZB 1HHKB 4XVUD 2VERN 1NCDL 4MLIA 4PREA 3MRGB 3DHJA 4X83A 3VXSE 4JRYE 3WDJA 4ZMAT 5C70A 2P49B 4PRHE 1DL7L 1MCCA 5BW7A 3L5XH 4Y5VA 4Z0XA 1CGSH 4F58L 2FJFB 3MRIA 5F7NC 4JJHA 5B22A 5DJDA 1T20A 2OP4H 5JOFB 2R15A 1A6PA 1IEBB 1SBSL 3DBXA 4NRYB 5H35B 4NQEA 1IBGH 1D5MB 1EZVY 4WGWB 3V95A 1P5UA 1NANI 2VR5A 3ARVA 1YUHA 5F7MC 1C08A 4XP6L 4X4ZA 4ZAKD 4LGPB 4E41B 4PJEA 1F45A 1H9VA 2CK0H 1D9KA 3AXLA 5CJXA 2IAMC 3ZZ1A 3O3UN 4HS6A 5F6IC 3RU8H 1B2WL 1TXKA 1SYSA 4F7CA 1J86A 5DS8B 5C0RH 1XR8A 4NQDD 1G7HA 4JZJC 1LHZA 3MGOA 1DLFH 4UV7L 3H7LA 2NY7L 1JYVA 1AGFB 4U1LA 1A4KA 2WUCH 4X6FA 5DWUH 2P4AB 4G6FB 1FYTE 3WJJA 2AV1A 2FDBP 1UT9A 1LP9A 1BX2A 3OG4B 4ONGL 4G5ZL 4KAQH 1GVIA 1F8TH 5KSUA 2OK0L 2XQYG 3O6KH 4YK4C 3WKMH 9CGTA 2X1OA 4UDTB 1DJSA 1IEHA 4B7IA 5DJ0B 4PYGA 5I1AB 3ARZA 4XVJL 4QOKE 5KW9L 1BOGA 2Z31B 3DVGA 3OHXA 4PG2A 3MRLB 4XPAH 1NMAH 5HDBF 1WAAA 2OI9A 2DYPB 1U8LA 3KYMA 1KCGC 1NGPL 2EXWC 3BT2L 3TBYA 1E6JL 4LLWA 2DIAA 4X80L 1U3HA 1P2CA 4LU5H 5CZVL 2WK2A 1ZE3C 2VLJA 5C7XH 3C6LB 4OI8A 2MNUA 4OZHB 1TJIH 2R2BB 2XWTB 2A9NL 4N0YH 3H9YA 4RAUB 4ODXB 1ZGLP 1N2RA 2H41A 3SCMC 4D0BA 3ZTNH 3IF1A 1NFDB 5DJCB 15C8L 1S5IL 1PKQE 4N0FB 3GGWB 2MCPL 3V4PH 1XCTB 2ZG1A 3EYUH 5J56B 1IARB 3CFJB 5C07D 3S88H 3GSXA 3QDGB 5HD8D 4K94L 4U33A 4AJ0A 3PP3H 4NUJA 3QQ9C 5ENWB 2VZTA 5B8CB 1MHCB 3LS4H 2UZIH 5GHWL 4IRSB 1V7NH 2XNAA 4MJ5B 4G42A 2WBJD 5D6CB 3ARFA 3ZT5A 2BHUA 1FC1A 4MCYB 3MLYH 4WHCA 5F88B 1FL3A 1TMCB 1T1XA 3OKDB 4LASL 2R4RL 5I8CA 3PNWA 3E1F1 5C71A 5IVZA 4M1DH 5I71B 3OKEB 3UBXG 1CK0H 1MCOH 2WLYA 5KSVA 3ARDB 2FEEI 3P9LB 5DJ8B 5J57B 4JQIL 4R90H 5I9QC 4PJXE 5DUPH 5IQ9B 3D2UD 3QZWA 1CD8A 1FFPB 4X8JA 3QEQD 2DQGH 3H9ZA 5E56A 5IBUG 1MJ7L 2HTKD 1CU4H 1JYXA 3LV3A 1QUNA 3RL2A 3P9MB 4BZ2L 2PYFB 2H2SD 4WCYL 3X11A 3ULSB 1RMFL 3HG1D 3LH2H 4D0CA 3O11A 2GCYA 4RFNB 5SWZE 3TT1H 1U8MA 4PRAA 4HK3N 5DHYB 4KMLB 1BGXH 1Z3GL 1VEPA 4X6CF 3UBXI 5A43C 5I73C 2ATKB 3VXQB 1VENA 1P84K 3MUY1 2XKNB 1YEFH 1HQ4B 3R8BB 2W1NA 5FECA 3RGVA 5TGBA 6FABL 1JPTL 2ESVA 5D7LB 4YHNB 4M9OA 5CLWA 4ZYKA 5I16A 5IB2B 2XXCB 4GS7C 3CPLB 4X6DB 4D3CL 5DFTA 1ADQA 5GGUA 2QBWA 3W9DA 4LIQL 1EERB 1D5IH 3EDKA 4P23B 2XKUA 1BFVH 2R0ZL 1CFQA 2DQJH 2HVKB 3QXAB 3RDTC 2FZ3B 4NO2A 3WJLA 2FBOJ 1WZ1H 3IFLL 4LSUL 1A4JA 1T21A 4FQ1H 1QSED 3O2WL 5DQDL 4WU5B 43C9A 1QLRA 2IALA 1RUKH 5CP3H 3QWQB 5D1XC 4PGJA 3U4BL 4JM2A 5L9DL 1TPXB 4R7NA 2E7LA 3U46A 2C4XA 4TTDC 5KN5A 2O5ZL 5KS9E 1AXTL 4NKDA 4L5FL 5IB3B 4LLDB 2EO1A 5GGSB 3LKPA 4XB8A 4Y19B 1OSZA 2EDYA 2B39A 3MRHB 3IRPX 2V5YA 5C0CE 1IM3A 4U7SA 1NCBH 1XF4A 4CMHB 5T1KB 2W0PA 4U1JA 2ICES 4G8FB 4RQQA 5DJYA 4NO5B 1V7ML 4NO3A 4OIAA 2C3WA 5DT1L 1E4JA 5CGYC 4XRCB 1EFQA 1FG2B 3O9WD 2R0KH 1JWMA 4K07A 3OB8A 2BMKB 2Y7QA 4WO4A 3RIFF 1ZGLA 3DXAB 3E6HA 2ZSWA 4W68A 5I1KL 3VWKA 1DLHA 3EJZD 2NX5E 4OBRA 5C9KA 3I02B 5HSFA 2P5EB 3S9DB 4UILH 5DDHA 3LS5L 3BQUD 3VGGA 3VFUA 4G6JH 3TESA 5DMKA 4O2FB 5C8JA 2EKSA 3QO1B 1UJ3B 1F6AA 4PGEA 4XP5H 2NY4C 2HJFB 1FLRH 1BZ7A 4PJHE 4DVBA 2VLKD 2L7UA 12E8H 1UB5B 4FQJH 2O61B 1GGCL 5SWQB 3BYYA 4TRPL 5MP6H 1A0QL 4LLYB 4OQ1A 5GS2H 3RWFB 3D25A 4NNYA 4N8VG 1EGJA 4PB9L 2NXYC 3UJJH 4URTB 2CKBA 4X5XB 4PJ9D 1DBKL 2MWCA 5F9JB 1I75A 4X7TA 1E4XH 5EO9A 4CL7A 2ARJQ 5HHOD 3FFCE 3DVIA 4UAOB 3DX9A 3U6RB 3V5HB 2V5SA 2CLZB 3P40A 5T3ZE 1Q9WB 1U92B 2V17H 4M43L 1NGYB 5D1ZC 3E2HC 1JP5A 1IGYA 3T0DA 1SEBA 1ZS8B 4WHYH 1DUYB 2PW2A 3U9PL 4QHNB 1WC7B 1ZLUH 2JLLA 1X3DA 1IGJB 3QQ4A 3Q3GB 4UT9L 3O3DA 3D69B 3GSNH 3GJFA 4XAKE 2AAVA 4YZFE 3BEWB 3TN0B 3QDMA 4XMPH 1AH1A 5FUOL 5DVMA 3VGBA 3ARPA 2OXGA 3FO2A 3PL6D 1LO2L 5FYLH 3RWIB 3BW9B 3NCYS 1NJ9B 1Q9KB 5J4MA 4BZYA 1VACA 4MZ3A 1YPZF 5DFWH 3ULVE 5I1HL 1HWHB 3GHBL 4FQXB 4KJQD 2Z8SA 1FO0B 1EEYA 1U8KB 1Y6NR 3K46A 5EOCJ 1F5WA 5GSVA 3WFBL 2JKXA 3OF6A 4RGMC 5LXGL 3B2UD 2JK5A 2DQTL 4LARH 5AG8A 1RZJL 4DOHE 1N7ML 3WSQL 4NRZB 4JPWL 2FEDC 4HLJA 4U49A 3D6GA 3ULUE 4RMTA 3F5WA 1W72B 4OTXL 2W0FB 3E3QA 5D96C 3LSOB 5TE7L 3WIHA 4I1NB 4HS8L 1UH4A 3GDBA 4YBHA 2HWZL 1JNHB 5GS1B 5AZ2L 3JVGA 4OZFG 5I1CL 1GOGA 4Y5YB 1XGQA 3NFPA 3A6BH 3ILQD 3L95B 5JW5B 2D7MA 2Y06H 3CVIH 5DRXB 1HH9A 3FONB 5EZIH 3KPMB 1RIVL 5BS0D 4OSUH 3MR9B 1S7RB 1I1YA 3TNMA 2DL2A 1GGIH 4Y4HC 4P2RE 3PWNB 3REVB 4ENEC 4KK5D 3RJQB 1IM9A 3ZE1F 1I8LA 2JIXB 4XPGL 2VWEC 1CTOA 3VFOA 2ZJSL 4DTGH 1BM3L 4RFEB 3P73B 4IHOB 4GG6E 5DUBA 4PJIF 1Q8MA 5LGJB 2B1AL 4NBXB 2EDDA 5DD0H 1PDKA 2X4UB 1II4E 5D7JB 2QQNH 5DXWA 4DGVH 3FMGH 1H0DB 2ORBH 4OCXH 5EOCH 3SGEI 1AR1C 1T04A 4TULH 4R4ND 1ZEAH 2OQJB 1JMZA 4P9HH 1MRFH 5D9SA 5AUMA 4M7ZB 3TPUE 4GXVH 4XPBH 5KVMC 2BY2A 3GMNA 5E8DL 1OAUL 5GJSL 2OTWB 4PBVC 2NLJB 4XBEL 1QBML 1UQSB 3VXRE 3W0WB 4F9LA 1QACA 1BEYL 2R29L 1A3RL 5HHOB 3LDBB 3IU4H 5EBWA 2I07A 1C16A 3B6SB 4JY5H 4LSTH 5GSRA 1SYVA 1ZLWH 1T1WA 5SWZD 5J89A 4PTUA 1DEEB 3QUXD 3H42L 1YYLH 4OF0A 1NKRA 1JMXA 1T20B 5FYKE 1QEWA 5KSAD 1CG9B 3P0VH 1NEZB 3DBXB 4QTIL 4AQOA 1QFOA 4G6ML 4B41A 4NQEB 4FNLL 4DWHA 4XPHH 1J0IA 3WLWD 3CMOL 4PV8A 4MJIA 1YUHB 2VDRH 1NBYA 1MAML 3B5HA 4PRBA 1AP2A 2IADA 5MI0B 3KNBB 4PJEB 3O4OB 3A6CL 3HMWL 4PP2B 3PWLA 1ZHLB 4WFGD 3L3GB 4ERSL 4GXUN 4I2XA 4NNPL 5DK0A 1N6VA 3DGCR 3V4UL 3O6ML 5FA3B 1XR8B 1XGYL 3BIAX 4J3VA 3FO0L 1PG7X 3MRRA 1RJCA 1N8ZB 4N0CD 2X4RA 2HP4A 4G8EA 3OAYK 2QHRL 4R97B 4NM4L 2J8UE 4PUBH 2AV1B 1EEUA 1E27A 1BX2B 4JZOA 2JJWA 5KSUB 3QFJD 1HXMB 1VGKA 4G8GB 5IVXA 5HJ3A 3WD5L 3IDUA 3JV4A 4UINL 3OHXB 4Y16B 4MDJA 5IVOA 5J06A 5DSCA 3K74B 5FUZH 2OI9B 5DMGD 3QEHA 4M5ZL 4G8IA 4OZ4A 5DJ2A 5CEXA 1ZV5A 3D39E 2WIIA 3D18B 3D9AH 2VDLH 2V2TB 3T0VA 4LLWB 2OZ4H 4L4TD 5IFAH 5I1EL 5EU7C 1U3HB 3WN5C 1P2CB 1JI2A 4HQQH 2IWGA 3AU1A 4R2GC 4NKOB 1EJOH 5DR5L 2W38A 1IAKB 2FATL 2Q7NA 3QG6B 3TO4C 1NGQL 5GRZA 1A6UH 5F97E 4D0BB 3SE8L 3L7FB 2NX5D 4NKQB 3RWEB 3I6KA 1MCFA 5FOJA 3UZVB 1CGVA 2HYMA 2N56A 1KT2A 4AM0A 4TUOB 2GJJA 2IFGA 3T65B 2XNAB 4GW1B 4WFHE 1JRHI 1XAUA 4HUMB 3SGJA 4P57A 4MNGE 4IMLA 3STLB 2H1PL 4GFTB 1FL3B 1M71A 3U7WH 3LRSA 1MY5A 2P47B 3WDHA 1TCRB 3IDGA 5I8CB 8FABA 3UC0L 1JZ2A 1XH3A 5C2UB 3MYJB 1MHHA 2QEJA 5KSVB 4IRJB 2XTJC 1CBVL 4YXHL 3ZE2E 1HSBA 3JUYA 4R96A 4XBPA 2FX7H 4NJ9L 3QZWB 4QXTA 3HUJF 2XA8L 1DVFA 4XWOD 3IRZA 2YPVH 3JWDH 3LV3B 3AY4C 1RI8A 5C0BA 3ES6A 4MJ2A 1YNTB 1OVZA 2H26A 2DQCL 4D0CB 4N90D 5B3JE 1U8JA 4F7TA 3T4YB 1N5YH 4GQPH 4PRAB 1HXYA 2I26N 5BRZE 3RUGB 1MWAL 1NDGA 1WBXA 3B2VL 5HI4C 2P43B 4WJ5A 1PW3A 1YQ2A 1SQ2N 2HLFC 5EG6C 5TGBB 4P3DA 1EUUA 3G9AB 4DFIA 1B9ZA 3FB8B 5MENA 1XIWC 4N5ED 3G08A 3V4VH 4U6HB 5I16B 2DLFH 3SDCC 2GYSA 1OT2A 3WFCH 4UQ2B 3LKQB 4EI5A 1Y18A 3RVXD 3AMLA 1C12B 1E6OH 4U6XA 5DC9B 1KELH 2ZUVA 3QXVA 5FF6A 4H88H 1A7NL 1FVEA 1IKNA 4ODUA 4LKCB 1Q72H 5E7BA 2K3TA 1G7MA 1A4JB 1KCUL 2Y5TA 1U6AH 2VNCA 43C9B 3VI3E 4FZEH 1QLRB 1HIML 1K2DA 4U1HA 1VPOH 4JM2B 4GMSH 2ZUTA 4I3SL 1TVDA 1KJVB 4RIRB 3WO3B 4NO0B 4BSVA 4DCQA 3BRGC 5TQ2H 4JY6A 2XN9D 5TDPB 3BWAA 4Z7NE 4EUPB 3HZKB 1I3GL 1WQVT 1DQMH 3GK8H 2XACC 2HVJA 4NCC2 3Q0HA 3HTLX 2VABA 4MHHG 5BVPL 4JFXB 3GMQB 2ENSA 4J7RA 4M1CD 5BJTB 5GS0C 1T3FA 3BDYH 1A64A 3L5HA 3V79C 4HPOL 2BNQB 5ITBL 5DJYB 3TYGH 4NO3B 1ZVSA 3VMOA 1JNNH 4AEHH 1IC7H 2RAMA 3EOAA 2OJZH 1ND0A 5ISZA 4KKLC 2YA1A 4NWTL 4LGSB 4EEEA 2IFFL 1FZOA 3CLFH 2JJTC 3IDIB 3MODH 2ZSWB 2HKFL 3VWKB 4PRPB 4NM8H 3WYRA 4MHHI 1P7QA 3BPOC 4PV9B 1I1CA 1AO7E 5A2FA 2QQKL 3X17A 1DP0A 3RAJL 2X1QA 1CYGA 1AFVH 3IDXH 4JPKL 3SJVD 2RQ8A 3I75A 1IGIL 3O6LH 5CGTA 1KIPA 3WXWL 3H3PH 1NC4D 4QT5A 4I48A 4KV5F 3C5ZB 3QNYB 2NY0B 3PWUB 4X99B 4ZUSA 1T0NA 3NIGE 2VE6A 3D25B 4FZ8L 4QXUL 4TSCL 2CKBB 3IXAA 3HR6A 1OD7A 1MY7A 4I5BB 3EYOA 5J3HC 4F7PA 2A6JB 3GMLA 5FM5O 2VDOH 3TJHD 1SJHA 4R26H 2HJKA 1GIGL 2LAAA 4M1GL 1B90A 1S7TA 1RFDH 4WTXA 1SEBB 2HTLC 3PUCA 4OLWH 2PW2B 4UTBH 1OGAB 3L3HB 5JO5B 1MCRA 1FBIL 3BP6B 5FYKD 2CO6B 3NFSH 1A22B 4K7FB 4UUJB 4Z95H 2YPKA 1MFCL 5IB4A 1A21A 1DQDL 1LILA 5T5FL 4NN7B 2QLVB 5HGHB 2YKLL 2H9GB 2VUYA 4HIHA 3OKOA 4HZAA 5CSZB 3QIUC 4WDIB 5IVNA 3UJTH 3UYRL 3GSQB 3V8OA 4DUXA 3T3PE 5EH1A 1SVZA 5EUOE 5GSVB 1TTGA 1KTDB 3MSPA 5EIVA 5F3BB 1WGOA 2MJWA 4OUUA 2V7HB 4XP4L 5D1QC 4G3YH 3EJJX 4QHLA 1U8NA 4YDLC 3OB0K 4LP4A 1I85C 2I60L 3RZCC 4AIXA 3OMZA 4Z7VA 3HI6H 2P24A 1B4JL 3TCXA 3BIKA 2LVCA 2F15A 2VDKH 1ZHNB 3QO0A 4TVPH 1MNUH 5E5UB 1IQDB 4UI2A 1QOKA 2IC2A 4WW2F 3NFPB 4LHUD 3MJ9L 5JHLL 5C07A 4CKVX 2ZCKL 2C1OA 4NC0B 5C0IB 3DRTA 3K4ZA 4QRUA 4PY7A 4Z7UA 2B7DT 2WBJA 4Y0GA 2CLRB 2A6KA 3SDXB 1T1ZB 4YDJA 5ILTH 1LEIB 4QHKI 2IAMD 1ZT7B 3GMRA 4LFHD 3STZA 1WK0A 3VFOB 2BNUB 1MLCB 5IEHA 3T0EC 5IESH 1ZA3A 1I7ZB 3CMGA 2YSSB 5C09B 3ZDZF 4ESKA 1FN4A 2FO4B 3VWJB 3LOWA 3PJSA 5I8KH 4RMUA 3D2UA 3WFDH 4LVNB 5IGXH 3SKOB 2NNAA 4OCSH 4U3CA 4Z7QE 4JQXC 5ERWB 1A7QL 4TQEL 3PHOB 1MAJA 4U1GB 1I8KB 3G5ZA 5FGBC 2D7PA 4PJCB 3QIWA 3V5KA 1OAYL 4YUEL 5EU6D 1N5AB 3KXFB 4PJ5D 3GMNB 4XXCA 4JG1H 1UADC 4LLQA 3MRPA 4ONHB 4G9DB 2DI7A 2MPAL 4YO0A 2EXWD 3UPRA 5JORB 3MRNB 3EOBB 3GMMA 5BMFH 4KWUA 3T08A 3LQAL 2ED8A 2VITA 4ZFOL 3MRDA 1X9QA 1A6TA 3MXWL 5KSBF 4Q9CA 1G0DA 1JYWA 2I07B 1J1XH 2YBRA 1T5WA 5GSRB 1SYVB 2R1WB 1JN6A 3QRGH 3SCMD 4B53A 1VFAB 2XQYK 2VWEE 3FN0H 3LQMA 2M2DA 2EYRB 3AAZA 1INDH 5T1MA 4AQ1B 1LD9A 2YPLE 1QSEA 3C87A 4R0LA 5E2VL 3QQ9D 4WNQA 1MRCH 3DMMC 1MFBL