1BZOA

Three-dimensional structure of prokaryotic cu,zn superoxide dismutase from p.leiognathi, solved by x-ray crystallography.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolutionary constraints for dimer formation in prokaryotic Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
molecule keywords PROTEIN (SUPEROXIDE DISMUTASE)
total genus 35
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1bzoA00
3ECVA 2C9VA 1SXAA 1B4TA 2Z7ZA 1OEZW 3H2PA 2AEOA 2LU5A 1COBA 1TO4A 3KM2A 4B3EA 1Z9NA 3KM1A 3ECUA 3GZPA 1EJ8A 2E46A 1MFMA 1BZOA 3MKGA 2VR7A 1SOSA 2GBVA 3SODB 3CQQA 5CU9A 1XTMA 4MCNA 3F7KA 1B4LA 2WYTA 2AQRA 2JLPA 4BCYA 2GBTA 2ZKYA 1RK7A 1SPDA 4U4IA 2Z7UA 2GBUA 2NNXA 4BCZA 1F1AA 1YAZA 1F1GA 1P1VA 2Q2LA 1ESOA 1F18A 1XSOA 1PTZA 1YAIA 5KBMA 1PZSA 3RE0A 3S0PA 1YSOA 2WZ0A 1U3NA 3CQPA 3HFFA 2XJLA 3GZQA 3H2QA 4A7GA 2JCWA 1IBFA 1QUPA 1E9PB 2V0AA 1Q0EA 3HW7A 4N3TA 1N19A 2APSA 1UXLA 4N3UA 3HOGA 1JCVA 1E9PA 5KBLA 1Z9PA 3QQDB 4A7QA 4A7GF 4A7SA 1CB4A 1L3NA 2C9UA 1SXSA 1AZVA 2C9SA 1E9QB 1E9OA 2ZKWA 2ZKXA 1FUNA 2ZOWA 2AQPA 3GTTA 1PU0A 1SXCA 3KBFA 1SXZA 1E9OB 1IBDA 2XJKA 3ECWA 3KH4A 1KMGA 1SDYA 1UXMA 1SXBA 3GQFA 3K91A 4L05A 4A7UA 2AF2A 1CBJA 2WWOA 2K4WA 3F7LA 2VR6A 1OAJA 4BD4A 1OALA 1IB5A 2VR8A 4A7VA 2WYZA 3L9EA 1TO5A 3GZOA 1HL4A 2Z7YA 3GTVA 3PU7A 3CE1A 2AQNA 1IBBA 1HL5A 4A7TA 3KBEA 1IBHA 2SODB 1DO5A 3T5WA 3L9YA 2R27A 4FF9A 2WZ6A 1S4IA 1SXNA 4OH2A 1SRDA 2AQQA 2WWNA 5KBKA 3LTVA 1JK9A 2WKOA 1F1DA 1OZUA 2E47A 1OZTG 1DSWA 1E9QA 2AQTA 1N18A 1JK9B 1SDAB 2WKOF 1EQWA 4OJAA 4MCMA 1BA9A 3KH3A 2AQSA 3MNDA 2WZ5A 3QQDA 1XTLA 2Z7WA
chains in the Genus database with same CATH superfamily
4EZJA 3VXRA 2X28A 2Q87A 2VL5B 1Y1DA 4WNQA 3F5WB 4LL9A 2WXLA 4KNSA 1ZLEA 5JXEA 5MI0B 1EBAA 1D5ZB 3FQYA 2W9LA 3PIQB 4R7NB 3RWDA 5JDSB 5D71L 1KB3A 1XD0A 1BZOA 5DMJB 1QFWL 3QORA 4FG6D 1P7QD 3GUFA 3HPLA 4O5LH 1HDMB 1FYTD 4FI6A 1JZ4A 2RB8A 4GXVH 1D9KA 4Z7OE 1NBCA 2G9HB 2WMPB 2QSCL 3BEVA 1HVXA 3IMVA 2CKBH 1IJNA 1L9RA 1XZWA 2OMYA 2V9RA 3HCVB 4XAKE 2R0WL 1HKLH 1XGTA 2EILB 1RZJH 3CFKA 2D4FA 1EA9C 5FYKL 2GJZB 4WJ5A 1FL5A 2APSA 4AQ1A 4CNIB 3ASNB 2DLGA 3QUMA 4QHLA 4XHJD 2KLSA 1DCLA 3DDGA 5KBLA 5E6IC 5ERWB 3NIFE 2QSTA 1ORSB 4NKIH 2Y2TA 5LVEA 4EPSA 3VRIB 5C07D 2WUBH 5FW8A 4ZUSA 4ZX5A 4NO0D 1QTYT 3WNJA 2ZKWA 1C08A 1A5FL 3NESA 4G3YL 1VERA 3HS0B 3BT2L 1E30A 1S7TA 4FYQA 4HJSA 4PLKC 5C0JA 1JHLH 5GZNA 4Y5YA 1BGXL 1VFUA 3PL6B 1U30A 3GBML 2VR9A 3O2VL 5DRXB 3DWTA 3W0WD 4G8FB 2YBRA 1N6QH 1H3UA 1A3LL 4O51B 3B34A 1RUPL 2QFPA 3MLTB 4E41A 3KYKL 2D7MA 2YBGA 3D6GA 2OZ4L 1E28A 5EIIB 5HYJE 1MHEB 3CG8A 3BQUB 5I17A 4JGMA 5E8PA 1RZFH 3WJMB 5DHYB 1LQSR 4P2RD 5DZAA 1BQKA 1LO3L 2GYSA 4WHYG 2VC2B 3JWOH 2XQBH 1SEBB 3UBGA 2YPKA 4K3DL 4RISL 2IDFA 1L7TH 3NFSH 3GSNB 1Q0YH 2MCAA 5TGBB 2A6DB 2WZ6A 2J20A 4N0CC 5HJGA 1I9JH 4PLOB 5GGVH 4B41A 1EJ6A 2A0LC 3FT2B 3C5SB 3F84A 4HIHA 4NO5B 3V4VB 2GUYA 3H9SD 1EBPA 3PAUA 1X5XA 2EDJA 4WTZA 1U41A 2IOMA 4AEIL 4LSQL 1DQVA 4X6CB 1RCYA 3QDGA 1F97A 3S88L 2ESVA 3HC0B 4LCUA 2IPUG 3AUWB 5ESVB 3RFRA 1DVFA 3DX8B 4C56B 3VGBA 1IM3A 3DSFL 4XN7A 3N0PB 4CU8A 3HS9A 3KPPA 3QUHA 2Z93A 4ZFFB 3C2SA 3C09C 2Z64C 1T20A 4U2ZA 3U1SH 5JHDD 1B0RB 4ICXA 2HJLA 2P43B 1Y0LB 3VFUA 5DFWH 1LP9A 1XL4A 2OZ4H 3NPZB 4HJJH 1JRHL 1JXJA 1CXIA 3FUKA 4YDJB 4OF7A 3GBNL 5IHWA 5F7EH 4GINA 1G87A 4I8DA 4UOW0 5H2BA 1FVCB 2HN7B 1Z5YD 2VLKB 1FL3A 3VGFA 3PHOA 3FTYA 4PI0A 3VQMA 2VDPB 3ARPA 1I1FA 3BT2H 3KPTA 4JLRB 5DS2A 3SD2A 4KFZC 4KZEL 3W5MA 4TQPA 3MPCA 3U0TA 4Y9GA 1CTOA 1T6BX 1UURA 3HFFA 2ZXDA 1OGAE 4XMLH 3O4LE 2ADFL 3PWUA 2F8OA 2MQGA 4NJAL 2X1WL 3FTXA 4OKDA 3LXBA 5E4EB 5BRZB 3ULVF 1N67A 4LRNH 5IW1A 1IM9A 1EO8L 4JFTA 1PQZA 3QWNA 5TFSL 2VXSL 4ABVA 2OR7A 1CR9L 1OGAB 2CALA 2CCVA 2HLAA 3EUUA 3GBDA 1ZLVK 5JIPA 3APDA 2QSCH 3C5ZC 2WQVA 4JAMA 2YOCA 3RILA 4B95C 2W92A 1A6PA 3N42F 4PB9H 4XMPH 3V8CA 3Q9PA 1NKOA 4K7PH 4XMVA 5LXVA 5G4OA 1BIIB 1J1OH 4WQOA 1OP3H 4MQTB 4MZ3A 3DURA 5E2WH 3P73A 4XNZB 1W0YT 4P2QE 3BSGA 1OP5K 2ZXEB 1H5BB 3R0MA 4CVXA 1CU4H 4KO5A 4LHUD 4FFYH 4WWKB 1MY5A 3GZOA 1T22B 2YD7A 5KOMC 1G7MB 1KB5A 4JHAH 2GUOB 4XT1C 4KVNL 5CSGA 3W5NA 2W80C 2HWZL 3TA3C 2NY6B 2R83A 5BVPL 3ARSA 3JZYA 4X6CE 5GS2H 1HEJC 2ENJA 3CMOH 3QJOA 2VXUH 1YNTF 4MKTA 4BKSC 1UZ6F 4KMTL 4LF3B 1NOLA 1ZMYA 3DXAB 3ERXA 4UAHA 3L3GA 1CTMA 3L4XA 1HCVA 5FW7A 1OZTG 4GKLA 2X2HA 3SZ6A 2NX5A 1DQDH 2J1YA 3DV4B 5LXGL 5BV7L 3EFDL 3GHBH 2WLKA 4IRZA 3ARBD 2ADIA 4Q9QL 1IJ9A 5K69A 2PP8A 4HHAB 1GAFL 3I9GL 2PPCA 1M3JA 3IDIB 1YEHH 4GXUM 4FKHA 1P5VA 3M7OA 4G8AC 4C4UA 3UGUA 3U0TB 5K93A 5KEZA 4AMKH 1JPGA 4M1CD 2P7TA 1G94A 3NZHH 2P26A 3K4ZA 1CMOA 1CGXA 2VOTA 2H26B 2X4OA 1UEYA 2F8IA 1D2PA 4NWTH 1YRKA 1WP6A 5H2BB 5JXAH 3HI6L 2COVD 3I50L 1JZ6A 2XTJD 1NCDL 4BKLA 3O3UN 2WW8A 4DGVH 3MRFA 2NY6C 4X7FC 3V10A 3HC4H 1ZLUK 3O45B 4JY6B 5ID1A 1QRND 5DI8A 2OLDA 4GQQA 4C57C 1Y0LA 4NQSA 3VFUB 4M02A 3K5RA 2HSIA 4KDWA 1T20B 4NIYE 5IESH 3EYQD 4FJZA 1CICA 2A73A 2FB4H 2NY3D 4W9DC 3EADA 5E8NA 1E2WA 4AX3A 1NMCB 2JCWA 5CGBA 4AVKA 4BWWA 5I9QB 1BZ9A 4UV7H 5LQBL 2W5PA 3C08L 4ANWA 1HS6A 3U79A 4PLJD 4LSTH 2ESVB 3D9AH 2EC8A 2JELH 2R1XA 3C5JB 1S7VB 1UB6A 4X6CA 4Y2NA 1FG2A 3EOAA 2GSIB 2UX7A 1TQBB 4J3WA 4KWUA 5C2BH 1PDKA 2HRGA 2TRYA 4BELD 4CBPA 3CFBB 4YSDA 5C0NC 5HHQB 5E08L 1BOGA 4YMPA 2JE8A 1G7QA 3RY6A 1FDLL 3EYSH 3N2JA 5IOPA 5CEZH 3LVTA 5TGBA 1I8UA 4XPHH 2BOLA 2OTWB 4NOBA 3LV3A 1UM5L 5AVTB 1J0YA 1JV2B 1OF2A 2MPAH 3TBWA 3U9PL 3VH8G 1SVZA 3AB0B 1NMAH 1BECA 3BP7B 3FHEA 3K7UA 1PIFA 4L29B 1FV1A 1OPGH 5FV2A 3FCGA 3CH1A 5JHDE 1F2QA 4P9HC 5E8PB 5D1ZB 1AG0A 3VO0A 1MHEA 5IWLC 1E28B 2YHGA 2DLEA 4J6IA 4X50A 3SKMA 3NYKA 1IBHA 4NZTH 4G8FA 1A9BA 4BUQA 2ITEA 1F3DJ 3K46A 5D4HA 5ABZA 3CZNA 1XBRA 4MVBC 2WNKA 2R59A 3H3PL 4ZOCA 4YWGH 1C08B 1IBYA 5I28A 1ZA6A 1Y6MR 4HQQH 1DBML 3K0WA 3S5LA 4JFPA 2DQ6A 4MJ6B 5FC9A 2ED8A 2P8LB 2QTVA 2R4RH 3OG6B 1ORSA 1S9XB 3WFHA 3CSFA 3U6XS 4N2HA 3HE6B 3Q8EA 1QEXA 3IU3B 4FL4B 4X4XB 2CIIA 3SZKC 4DO6A 1AR1D 4MA8H 4NM8H 2AAAA 3COOA 4OVUA 5F21B 5BW7A 1ZAGA 1SGKA 3HCVA 1SBSH 2HFFA 1MIEH 2RJMA 2WBKA 3QG7L 3WMPA 5KVFH 3IXAA 4IKKA 2WMPA 4WF7A 1MUJA 1KGIA 1WIUA 1YEEH 3H9SA 2GBVA 4NHUA 4UF7C 3QXUA 1OT4A 4UOW1 2FCBA 4QUOA 4AIOA 5SWZE 2ZOOA 1TFHA 4G72B 3ZQ9A 1L0YA 3E0GA 3K6FA 2Y6SD 3OKYA 2P80A 3PDGA 5T3XE 2V7HB 4WDIB 5CGYD 5TQ0L 3PIQA 2WTPA 2AI0L 4HDIA 4RZCB 5B1KA 2JTYA 1TCMA 4FRWA 3U36A 1EEQA 1OHQA 4I3RL 3RWGB 2W9DH 4PGDA 3KW7A 3P02A 3GNMH 3QR2A 2I60H 4LASH 1FO0A 4WUKH 5HI5C 1JZIA 3SO3B 2EIEA 4AV4A 8CGTA 3GSQA 1I8MA 2G0KA 1QRNB 4PPTA 3S36L 3BPLC 4XTRD 3VI4B 1MI5D 4PHZA 4PJXE 4CVZB 1AFVL 3L5IA 2I5YH 2WCPA 5DD3H 4K3EL 3VSUA 4Y89A 4KK6C 1AXTH 2GTZA 2QVKA 4GUPA 4AW4A 3DBSA 4NQCA 5EU6B 4RH4A 2VR6A 3OSVA 3NRPA 4JZNB 4R8WL 2HMIC 4MQ7B 3KLKA 4DO5A 4XRCA 1M7DB 4ZPVA 1M7UA 4KJPC 3T1FA 3CBJB 3FUHA 3OWEA 4OM0L 5HY9B 1HSAB 4RMBA 4XBPA 2W07A 4G42B 5HHNB 2BSED 3SDCA 4PJFE 3GTVA 1NBVL 3LKPB 1VB9A 1IV8A 1FIEA 1NFAA 4GAGL 4U1KA 4ODSL 5E5RB 5I6XB 5H8DA 1ACXA 2KPNA 1KPVA 2EH7L 3O8XA 2X0VA 4RZKA 3AADB 4P23B 3HR5A 3V4VL 5IHLB 5T1JA 2FEEL 5DJXA 3FJTA 4U1IB 5ETUB 1FFNA 4KKCD 4NKOA 5FO9A 4PJ7B 4ODBD 4OR1A 1UOWA 5JQHC 2PO6A 1QWHA 4Z18A 3IXTA 4J1UB 5CINH 4LSUL 4X5QA 1G7HA 4PD4K 4QHNA 3VI3A 1N6VA 2DQCL 4LHUA 4XGZB 4HT1H 4DO4A 2D9QB 1FGVL 1KJ3L 3N85H 1T0NB 4MCYB 3SKOB 5DT1L 5AW0B 2OYLA 4U3SB 2EYRA 2PW1A 5CINL 2GSMB 1TLKA 3QJVB 3KXFB 1N12A 3KGSA 3AG2B 2WBJA 4Q9QH 4TTDC 3RQ3A 4H26B 1HT6A 1N8ZA 1TVHB 4JMXA 2OXGA 2E9GA 1EEUA 4UT6H 2DKMA 3W2DL 1SOKA 2E6QA 1DFBH 5CLYA 1ZHBB 5MP6L 2YXVA 4F7EA 1A6TB 3OR7A 4Z7QF 4I89A 1V3JA 4P46A 5E94B 4WHYH 2YPLE 1UD5A 5HGAB 3H3BC 1TJGL 5E6ZA 2HWZH 3EH3B 1BHGA 3IS1X 3UPRA 2FJSA 1MG3C 3D39E 4Y2LA 4ZW6A 3RNQA 3HLKA 2HB0A 3MGOA 3O4OC 1ZGLA 4P57A 3DX7A 1AIZA 3RL2B 1HI6B 1EVTC 3CLEL 4ZFGH 1YEIL 1T6WA 1X9LA 3FN3A 4ZUWA 1Z9PA 2ZYSA 4RIRA 4YK4C 4YDLB 2B15A 4IGBB 5IHBA 1U8OA 2GVYA 2CH8A 2Q76B 1EPFA 1OB1B 3Q7JA 1OAYH 1I9RH 4ZW8A 1EAOA 3RY6C 3X17A 3BVWA 3G6JE 4NN6B 1VZGA 3B9VA 2R7EA 3DRQB 3IJYB 4Z3IA 4NWUL 3JBG7 5MEOB 2PN5A 5CJXC 5E4EC 1A2YA 3SY0B 1CO1A 1I1AA 4U6VL 2IADB 2YFOA 1HYSD 3O3AA 1FN4B 1I8IA 2R9HD 2FT7A 1X44A 1E27A 4NZRH 4BQBA 4HBCH 3F7RA 3VCLA 1NDTA 1GC1C 1CLYL 2ZUQC 4J3BA 3G5VB 2DM2A 5AAWC 3A0OA 2VZUA 1KXVC 3B9KA 5HJ3A 2DQGH 2ZXAA 4U0RC 2YAMA 2DW5A 4KUCD 1S7WA 2XRAH 3HBQA 2AK1L 2PCFA 4M1DH 4OF5A 4XNZC 4X4ME 3V55A 3B8YA 1YPZE 3K6OA 3QG7H 2UY7B 3VFTA 4G82A 2X4RB 1DLFH 3HZ3A 5KANG 2YGNA 4H4NA 1AXTL 3X12B 3T2PA 5D7JB 1FZKA 4NKMB 3SQBA 2ZF9A 3GRGA 1BX2B 3B5HA 3V0VA 6PCYA 1LNUB 4WHCA 4Y5XA 3FF8A 3HRPA 1W0WA 2R4RL 3GSRA 3NCWA 1IBGL 3NZSA 3QIWB 1RZKC 4XVTH 3VFPB 1KENH 2J55A 2F0CA 3ILDA 4LVHC 3LH2L 3OKDB 4FGMA 4ZX3A 3AU0A 4U1JB 4ODHH 4X5RA 3UZEA 1W2KT 4HOMA 1ODUA 3VGAC 3CK0L 4ELMB 4C54A 4PSPA 5HYJD 4LSRH 1S8DA 5LBSL 3S35L 4NPKA 1OQOA 2I9TA 1AMYA 2ZOUA 2X4NB 1X5HA 2CDFA 3S37H 2FD6L 1R34A 4AYBA 1VEPA 1U8CA 3IU4H 3PWJA 5D1QB 1BFTA 3AG4B 2AJVL 3PJNA 1CGVA 1H6EA 1PCSA 1QBML 5ESAB 2LE9A 3TT1H 5L0QC 3QVAA 1TSHA 1E5YA 5ESAA 2OXHA 3VAEA 2UXTA 3H9YA 4TXVB 2ZOKA 4PG2C 4K2UL 1A6ZB 4L8SC 1XQ4A 4JPKH 4O02A 1IGFH 2V3DA 4I0PC 4G5ZH 5LCVH 3HBGA 3BIBX 1U8CB 3P0VH 2PF6A 2V5YA 1XF2B 1ZVYA 1NMCC 3TWYA 1IKNC 3TBVA 4N9OB 4IOIA 4BH7A 1DVFC 1P0SE 2AK1H 4X8GA 4Y2OB 1KG0B 4PBDA 4RFEB 2ALWA 2A1WH 3QUXD 4Y2DC 4OI9A 3P0YH 3Q05A 3IAQA 2HRLA 1HC1A 1P53A 3O3DB 3W38A 4PEEA 4CW1A 3GTNA 3BN9C 3O6KL 2BK8A 3ZIMA 5KYWB 4GI6A 2WLIA 4BSJA 3IN0A 2MTAA 3FOLA 3GYRA 1YMMD 3PREA 1SMDA 4JKWA 2EKSA 1OF0A 4H1LH 5KBNC 1SJEB 4GIOA 4HFUL 4JDZA 1OAZH 4Y5XB 4KY1H 5ILTL 1NWOA 3W82A 5CLTA 3VWKD 2HKHL 4XPAL 5HP5A 3VXNB 5T5FL 5TE7L 5CN3A 3A24A 5C6TH 4MGXA 2CO3A 2JB6B 4G8IB 3IGAB 3GIZH 3NZHL 2VC2L 4X9YA 1NFDF 5FFGA 1LE9A 4L8SB 4UDUB 4LGPB 4KTGA 4HHWA 2NNAB 1WA0X 2EEBA 4JY4B 3IJ8A 4HK3N 2I25N 2UY7A 4ZAKC 1R3JB 4JFEB 1ET7A 3CAFA 3EYSL 1JV5B 4HIJA 3BPOB 4H0IA 4CMHB 4X7TB 5GGRB 1B4JH 5DA0B 3MREB 2A74C 4X7CC 5KSAA 1DSFL 4OLVL 3CC1A 5LNEA 1C5CL 3MRKB 1QAWA 4W9CC 5JW4R 1OEZW 1ZVSA 3HFMH 4LBEA 4GPVA 4P4KA 3E3QC 4HJGB 5EWIH 4OLEA 2OL3B 1HHHA 4ONHB 2DIBA 2LVCA 1I1AB 1RHHA 4QTIL 3V7MA 4R3SB 1A2YB 2D31B 2EIKB 3SY0A 3OZ9H 3E8VA 2GIYA 3C87A 2JJSA 5D7LB 3OKNA 5B1CA 3D7PA 1JGLH 4ZAKA 2NY5L 3NT0A 3P2DA 2ZUVA 1R47A 2XG4B 2FX7H 4M4RA 3WEBA 4XXCC 1PZSA 5KS9F 1E3ZA 1MH5A 3QFGA 2BY3A 2NOYA 35C8L 3UBXB 3D4YA 4DW2H 1UXLA 1HI6A 2VDLH 4OCMC 4Y7MA 4OZIB 1R24B 2IBGA 2RQEA 4DGIH 4TSBL 4ZJ9A 3IE4A 5DYOB 1QW8A 4TNWK 2VZ1A 4K8RC 1F8TH 3D85B 2YSSB 4N0RA 3PXHA 2J44A 2DQDL 3I9GH 4PIRF 3ARBB 3TC9A 3WI9A 5IKCA 3WTUA 3DHJA 5CWSA 3X3FL 5J13C 3C60B 1TCRB 4KKLD 4IJTA 5TFSH 3U2JA 1AGEB 4K71B 4O2CA 5K9KB 3QP3A 4KZCA 3LQAL 3SO3C 2WWOA 2DZEA 3PWVA 2EH8H 4GAYA 4N2LA 1LWJA 1MHPL 2EDDA 2V3FA 1AYRA 1OALA 3RVUD 2VXQL 4NC1E 1LWHA 4FMFA 1GS6X 1KCRL 1VRSA 5T1KA 1TT6A 4F37K 4YGVB 1ZSHA 1A6VL 3OQRA 3ZMNA 2MOVA 2JMRA 1NFIA 3SPHA 1MW1A 3DI3B 5B21A 4LEBA 4AH2B 3KBEA 3ARGA 2FNWA 5AVZB 1RAMA 1E5UI 4YE4H 3NCYP 2AABH 5LNGA 5EN3A 1JVOA 1LK3L 2HLEB 2ITDA 3IDNA 1IZJA 5EB9A 3VI3B 4TVPE 4KMQA 4EDWL 1WFNA 2AZAA 2D7QA 4AIXA 1Y7VA 3QFJA 4AC4A 4K4KA 5HBBA 2DYPD 2NXYC 4JKMA 5KUMA 2J72A 5K1JA 3T8VA 4ZUUA 1U2HA 1JK9B 4PWFA 2A3TA 2VGLM 3BH8A 3GM0A 4X8CA 3IAGC 2IWFA 2C5DC 4ORGA 4WFFE 4LEXL 1J9SA 1DUZB 5C7XH 5JXED 4XB7A 3ZVVA 3BE1L 1WS7A 1J48A 2PYEA 4L5FE 2FATH 4XNMB 5CUSL 4FA8A 3VFVB 1OGAD 3CVIL 2O30A 1P84K 2YK1L 3LKPA 4KGJA 3EYVA 4GBXA 5F7DB 3TH4T 3H54A 3RYMA 1RIVL 3CC5B 3LEYH 1Z9NA 5BV7B 5L2KA 4PAZA 1BVLB 3KNBA 3T0EB 1PW3A 1GZHA 2IPTH 2P5WA 3FB7A 1HQ4B 1KSRA 1UOLA 3P4NB 3QCVL 1I8KA 1BP3B 3C8KB 3ULVE 4YN3A 5INCB 3WOVA 3LQZA 1B88A 2V5RA 4N4YB 4CSSA 3QUZC 2X10A 2Y0SA 3D50A 4MMXB 2J73A 1FL6A 3MFFB 2VCOA 5DRZB 3NZ8A 2AXGA 1E4KC 1P5UB 1GVIA 1INQB 3SYCA 3T65A 3GRWL 4R90L 1J7VR 5CLZA 1M7XA 3S36X 2FSEA 5FGSA 4EAEA 3VI4A 1UJ3B 3OPZL 4B9YA 3U83A 3WNMA 4FQLH 2ED7A 4QPEA 1CLOH 1IFRA 3S4SG 1D5MB 2DYSB 4YH6A 4I48B 3CZSA 4MWFB 2VIRA 3WD5L 5I66B 3C6LA 4NSKB 1JHLL 5KVDH 2K1MA 3GBEA 3MJ7A 4HEPG 2G3NA 4HV8B 3NCMA 4OLYH 5A2CA 4HJEA 4X80L 3LS4H 3RY5A 3FU7A 1P7HL 4OV5B 4PJ5B 3ZZLA 4CGTA 2HG5A 3P3YA 4PLJC 4TOYL 4AQAB 15C8L 5GRWA 3O3EA 4PJIB 5IIEB 3DPBA 2WCSA 3FK3A 3GXMA 5E0QA 3GLAA 1AR2A 3LIZA 3D25A 2GEEA 3DHPA 5E1HB 3F62A 3WS3B 1JS4A 3H9SB 1FHGA 1K6QL 4MSWB 43CAB 5CEYA 1G5GA 4OUUA 5AZ2L 2D3JA 1M2VB 5DJDB 1EZVX 1AQDA 3E1F1 3WEXA 2AMUA 5IG7B 3W39B 4A38A 2VN5A 4OUUB 3ARFD 1JNJA 2NUPA 1YHPA 4N2MA 3NSDA 3MDJA 3L7EB 2JKRM 3ZL1A 2ZCHL 1MCIA 4MSWA 4WTWA 1GZQA 1E5BA 2JKIS 3NFSL 1OP5H 1S7XB 5D6DA 1HILA 3ZHNA 5I0WA 2PABA 5I5JA 3NIFF 2DYRB 4QKXB 1YQVH 1BSIA 4EOWL 5IIEA 5F2FA 3X1EA 2P8LA 1CL7I 5F0JB 4MJ6A 1ZE3C 3JUYA 4AQEB 4LCIL 5JHLL 4YDNA 5CCGE 2OSXA 4E68A 1OANA 5E08H 2F8XC 3BZ5A 2YS4A 4OJAA 3GBMH 2J8UE 2WV3A 3GI8L 3EHBB 5ANME 2VIRB 2X9YA 4U0RB 1IAKA 1NFDB 4I48A 4N5EC 5JHLH 3KYNA 5D7SH 1WCQA 4ZUVA 3H4FA 3RWEA 1E67A 3MBEB 2ICWI 3O41A 1B3JA 3ABGA 3GZPA 1QLRA 3BP7A 1INQA 3QUML 1QBBA 2FNBA 1OF2B 5E4OA 1U36A 1NDMA 4QXUL 4P48A 1HWWA 4AIZA 4GQ9H 1YY9D 1AJ7L 1AZRA 3BCFA 1D5BB 4LDOB 3OGCB 1JBJA 2ATAA 1ZVNA 3C8KA 3QEHA 4G80B 3WKMH 4WWKD 1BOGB 3HG4A 3CDCA 1PDKB 1OIOA 4KKRA 3S3CB 2C4XA 3JV4A 1MWAL 2YPLA 4ZNCD 3PJSB 1WGOA 3I75A 3RTQD 1WV7T 4GEIA 3C5JA 5JLZA 3BPNC 4W1TA 4G6AD 1PYWA 2NY4B 4HZ1A 5HXMA 2XTSA 2DWDA 5HJBA 3LNEA 3TPUB 2NZIA 2EE3A 2ATKB 4ILDA 3BO8A 2EEAA 4BFIA 4HCFA 3ATBA 4BFNA 2EVIA 1GC1L 4MA7L 2FWLB 4ZS7L 3VXTA 3AG1B 1XR9B 2KHAA 3IK2A 3LRLA 2NY1C 2AJUL 4FERA 1NEPA 3JVGC 4TQ8A 3K6SA 3BWUF 2IAMA 3QUMH 1QHPA 3VFNB 7CGTA 3MVSA 1NOAA 1WAAE 5HDBF 4YHYC 5EZOH 5F93C 5LN4A 4HPOH 6FABH 1MSPA 4ZFQA 1CFSB 3JWNC 4LVOC 2CZNA 3GSUB 4JUSA 3IDNB 3ILPA 5M94B 1X3DA 3AXLB 3D4GA 2VISA 3RVWC 2H26A 3APNA 2A6IB 2YN3A 4UQDA 3ULSA 1EFXA 1TG8A 1U4EA 2RQ8A 4XWGL 5EZLA 2LU4A 4YGVA 3P9LB 5IT2L 3UIZA 2X4TB 3U1PA 3WIAA 2A9AA 1O7VA 1P5VB 4Q9CA 5J11C 3VG0L 4N90D 4BQ6A 3HAEH 3L4ZA 2CJ3A 3NCFB 4WCYH 4YDKL 1S7RA 4DP0X 4LCIH 2O6EA 1LO2L 4IMKA 4HHAA 1F02I 2XQYG 3WJLA 1L9NA 5MEQA 4ES8A 3JWDH 4WI9A 4QOKA 2Y1VA 2NX5B 1MCJA 4HETA 4YHOL 5I75B 1TPXB 2Z0BA 5J0BA 1A4KB 1JPSL 3NACH 3ARBA 1DBAL 3OB8A 1YPZA 3L4WA 3O6FD 2C7UB 4I88A 1SUJA 4JFUA 5T3ZH 1TYRA 1SF5A 2RFXB 4BZ2L 3V0WH 1DQQA 4FABL 3KAAA 1UFGA 3ULUL 3BZ4A 2A38A 3VFRB 4O4YL 3DVGB 4I18B 4PRIB 1EO5A 4RVBA 2Y25A 4OZIA 1K6QH 2HTLD 3EOYG 3U48A 5KW9H 1GOGA 1PG7L 5LGHL 5BS0E 1JD9A 2EO9A 4NRXB 2X05A 1T80A 4YFDB 3AY4A 5I74B 1LTXA 4GMTL 1ETZB 5CP7B 5L4JA 1KTCA 1XF3A 2IH3B 5F1NB 1IAOB 2Q0ZX 5LNDA 2JI1A 4ZAKB 5GPRA 1JNHA 3X1NA 1SOSA 3E1ZA 1UWEH 1IGTA 2YA0A 1X4XA 1I7TA 3BZEA 5TE4H 1CUOA 1KLUA 2BS8A 2BVUA 5CKAA 5IFJB 2OZ4A 3J7HA 2V17H 3NCJH 2VKWA 1F5WA 2R29H 3PWLB 5HYFA 4FQHA 4FXTA 4GO6B 2DIJA 1OGAA 2NY4D 4GG8A 4Q7DA 2R1WA 1UACH 1A7RH 4K07A 5HYIA 2YUWA 3NBNA 3QNYA 3TTSA 2BZDA 5L2KD 2RBLA 3P9WB 3ZYZA 1HEZB 1X9RA 1ZV5A 2FSDA 3GJEB 3BP4A 3OPUA 4PJDB 1XH0A 5I26A 3D39B 3EJYD 4MAUL 3H7BB 4XPFH 1TR7A 4QYOA 2P8PA 4K5PA 3TWCL 4HKZB 2HJKA 3B2MA 5I1CL 3E8UL 1JPFB 1URLA 1XH3B 1WIOA 3DX4A 1FL3B 4JFED 5MEPA 2GTWB 5D7KD 5J3HC 3RWCA 3V4LA 3VDAA 4KH2A 3WN5C 1XIWD 5E7BA 4YDKH 4HUUB 4ENZA 2F68X 4MASA 5JTWA 1Y18A 4BUGA 2A4EA 3RTLA 2VXTH 3DARA 1SN0A 5J9PB 3FCTB 2VB5A 5CAYB 3EJYC 1FE8H 4DGYL 1BW8A 3T04D 2BIMA 1IM3B 2C1PB 3QUKA 5KYXA 1JHKH 4C56A 3L6FB 4RFEA 5LHDA 4NZUL 3SDAB 2R9HC 1F6FB 2TRHA 4Q6YA 3GMOA 1AI1H 5FYKU 4FXGC 1YC8A 4LXFA 5J1AB 2FX8L 1U8PB 4OLVH 1KBWA 2XWZA 2CLZB 1LO0L 4RMUA 2L8AA 2PPEA 4NO5A 1CDIA 1RV6X 3U9UB 3V4VA 5HVHB 2PTUA 4ZFOL 1G1OA 4Z7UF 3EOTL 4HBQA 2ERJC 2WZPA 5I2IA 5F7AA 3DHUA 3ARFA 5D7EA 4YFLF 3ZPDA 2NY2C 3DX6B 1II4E 5IQMA 2JJVA 1IGCH 1S3KH 1QFHA 5C9KA 1ZHKA 4GAAA 3K4DA 3VW3H 4WNJA 5D1QA 5D7IA 2Q86B 2GC4C 1QWNA 4P2OB 1EEZB 3TBBA 43C9A 4GP5B 2IF7A 2HT2C 4ZUTA 1JP5A 1UZGA 1K2DB 4EXKA 3BJLA 1G9MH 2LLNA 4QXGL 1JVKA 5T1DH 4GY4A 4XP1L 4DN3L 3HS0A 2VLLB 1TQVA 4TNEA 1HOCA 1G1YA 1KTBA 1YAZA 4I1PA 4ODUA 3EGDA 2VWEE 4EMZA 4PY8I 3DVFA 2R0ZH 3O2DH 3QIWA 3VFPA 3ZTNH 1C7SA 2QT6A 1BZDA 2YUVA 4FHJA 5HVHC 2MQ3A 5DD6B 1LNUA 3GEWB 4PRHB 2ERJB 4B0MB 5KTEL 1V7NL 4IRJD 4UTBL 4DKTA 3KCPB 3TA3A 3G9AB 3B9AA 1KACB 1WC7A 3MUGB 5EC1A 1X7TA 2WQXA 1CCZA 4WW1A 1RIUL 4XPBL 1P5UC 1MN4A 2JQZA 3PGDB 1H5BC 4HS8H 4NLAA 4QJ5B 4PP2A 4W9KC 3VYNA 1SJXA 1U93B 3TT1L 1BEYH 1JXDA 4ECNA 4RAUB 1WWCA 4P2OC 4Z3EA 5A40E 1XDTT 2GJPA 2O5XL 5KJRL 5HJ3B 3AY2A 5EF3A 2ZG1A 2X89D 1QFWM 1FAKT 2WNGA 5M95B 3WIFB 2QKIC 3CBRA 3HHSA 2NY1D 3GKZA 3MLYH 4K8RL 3LPPA 1I8IB 1ANUA 2BIQA 4N5ED 3GSNH 4OLUH 3OHXA 1KYAA 1OSYA 3GC3A 3CPLB 4GFXA 3F85A 2BFVL 1HXYA 4MCZB 2J2ZB 3Q13A 3DMMB 2XZCH 1CI3M 2VMEA 2EYSB 4WW2F 5C6TL 5C09A 1A1NA 5C0GB 5T3XH 4HKXA 1NIAA 4OFYA 2X4PB 3FB5A 1SN5A 4PJHB 4RGOL 2BSCA 3ESUF 1SVBA 5J4MA 2LGNA 3MV7B 4HFUH 1W8NA 2GQHA 4LCYB 2AEQH 1P7KB 1OB1A 4IEFA 4IHOA 4QXUH 3V4PB 4BFFA 2B59A 2IH1B 2Y22A 1CDCA 5DC2A 3HNVL 5ISZD 4XO3A 1J05B 1FNHA 4XH2B 4MJIE 5F70A 5L7XL 4KHXH 2MNJB 3SDDC 4WTXA 4P57B 1HTYA 4FULA 3MGOB 3DRTB 1N6UA 3HUJF 3IMRA 4Z0BL 3RNQB 1LK2A 3GRWA 3ARUA 2XPZA 1CZ8L 1A6UH 3T2NH 1OM9A 1WG3A 1JGEA 1IGJB 3VXMB 3OF6D 1MCBA 3MBWA 3FH5A 3VXPA 3WLBA 1TSRA 2QPSA 4NCC1 2JF1A 2NY7L 3LS5H 1GW0A 4PGCA 4PGJA 3S3DB 3F00A 2ISDA 3B4NA 4JO2H 3SKJH 1PZDA 4UQAA 1Q38A 4DKAA 3WU1A 5I8KL 4N26A 4AUJA 2YGPA 3WIIL 3VWJC 3BKYH 3NA9H 3EBAA 4PJAF 4JG5A 5C0IB 1VGEL 1OM3L 3W56A 4FQIL 4J3UA 2W0KA 3PFQA 1IT9H 1XSOA 2OMUA 4QRPA 4AITA 5I5MA 2F53A 1VLXA 2F6AA 4YHKH 4OSUL 4HMEA 3B83A 3FU9A 1YECL 2HVJB 1T0NA 2X2JA 4JJ5B 1RK1A 3QEGL 4PJGB 5I82A 4PJ5E 2PWFA 2OW6A 4JFXB 4JB9H 3KPRE 4PCKA 4R6UA 4P3CL 4BQCA 4DAGL 3OKMB 2CUHA 3O9WB 5E1IA 1KCUL 2IOOA 3HJEA 5AVVB 1JXFA 2UVFA 2ZTBA 5I1IL 4U1HA 1E9QB 3IXTB 1F13A 1WT5C 2OK0H 1IZKA 1JGDA 5D1ZC 2YGQA 3ZMEA 5EIIG 5DZLA 2N56A 4YE4L 5AOMA 3WY2A 1BG1A 4GUQA 4F24A 1MEXH 1VCAA 2BMKA 3IDXH 4HWBA 4UNIA 5FWQA 2FBJH 5KVMC 4FADA 3DJZA 4ZMQA 5IVXE 3GXIA 2GC7C 4J3SA 4IU3A 4C4KT 2BO0A 3L16A 2BZCA 2UY6B 3G08A 3B2UC 5HYQA 2PWEA 5JW5A 1KY6A 2F19L 1ZLSH 2AMGA 1X6NA 2IC2A 2QQLH 4EVNA 1KBGH 2E9WA 4JE4B 3VYOA 5DMKB 2R2EB 4Z7VF 5AL8A 4YPGB 2MHAB 3LQAH 3VG9B 1GGBH 1AYOA 4YL4A 3PF2A 1MCOH 4UDTB 3VD0A 4ZD3H 4PSRA 1SRDA 5HGHB 2XCMC 4XP6L 5D2LA 4ENEC 3Q9QA 1IC7L 4F8NA 4UNUA 2YD3A 4UM8B 4AEHH 1RZ8A 2OX5A 2Z1PA 3HZYA 5A1AA 4L4JA 1NBZB 3QCTL 3MBXL 5GGUB 2EDRA 3GXTA 3ALPA 2LAGB 3WFBH 3QCVH 4P5TA 3RBGA 4JFFE 4R5XA 4JY5H 4DP5X 3BCDA 5E2TH 1ADQL 3QI9C 4NQDA 2A74A 1HAUA 1U8NB 2VDOL 9PCYA 3CDZB 4TSAH 4DVRH 5I8OH 4U6VH 2RGSA 3GO1L 1KB9J 1SHWA 5H37H 3MXVL 3WKQA 3WUWB 4BFBD 5JIDA 1FG9C 2ZG3A 4L9LA 3U36B 2V7NB 2CBTA 5I1DB 1IFHL 5AW6B 1SBBA 2XWTA 3MRDA 5I0ZA 4JPWL 5DD0L 2Z91B 4PS8A 1K4CB 5GRUH 3VXQB 1U3ZA 2VDKB 1I9RL 2BVOB 2BVQA 3KPNB 4YQXH 2NY0C 4DKDC 4LRIA 2Z8WC 2XTJE 1QP1A 5AD0B 3HB3D 2ZXQA 3S5YA 4FTDA 3BUQA 4DZBB 2FBRA 4Y7OC 4Z95H 2HRPL 1TVDA 2Z8RA 3IXAB 3P0VL 1DUYB 2Z8VC 3H0TB 3ZHLA 1ZXKA 2B14A 1TJHL 1VFOA 4FQ2H 4AZ8A 2ILLA 1YY8A 1B2YA 3IFOA 2X3AA 4FXKA 4M1CC 5CIPA 1ZWIB 4KX9A 5I1AB 5D1QD 5IMKA 1HZHH 3TF4A 4PWIA 1V10A 3MNVA 2XA3A 3CFCL 3NCXA 1XF5B 4U6HA 4NAMA 2QHRH 2P52A 3QYCA 3O0LA 2VXVH 3SKNB 3WSQH 3S9DB 1G9MC 3RZCC 1SJHB 3FBQA 3SSGA 1BJ1J 3P2TA 4I87A 5I6XC 3T6QC 5C07E 5J5EA 5BS0D 4QRFA 4TPRL 4K7PX 3QIUC 5DEGA 1OAKL 3OMIB 3IJHB 5F3FA 4DN4L 1WTGT 4LFHD 3D2UB 3CWGA 5CN1A 3X3GH 5JUEH 4OIIL 4PJXA 1AGCA 3X2QB 5GZND 1T04B 2N0KA 4UBDC 1F42A 4B3VA 3KVPA 4JM2C 3UTPD 3VWKA 1MDAA 4XP6H 1A7PH 1KYUA 3KPMB 3OL2A 4PY7B 4E41D 2A1WL 1TQWA 1ZPUA 4TNWF 5SX5H 4N2NA 3LV3B 1MNNA 2KH2B 3BVTA 3JWOC 3WN5B 2CBOA 2DWYA 1G7QB 1IRAY 2BC4B 1JGLL 4PRAA 4EQ3A 1I3GL 1PY9A 3D69B 3CFBA 2QR0A 1IGFL 2XTJC 3M07A 4N8UA 4Y4HB 4UOJA 3OXRA 4ZYKB 4FQPA 2BNQD 2Y06H 4ZW7A 3F65A 1N2RB 3BUYB 4XPGL 2FIRT 2R1XB 1MEXL 4UCFA 2Y7LA 4CC4C 1JZEA 3U0WH 1MQKL 2Y1ZA 2NNFA 2WIIB 5I15L 4R4NC 3GGWB 4XC1H 5LGYA 5IEHA 1F2XK 5SX4H 5KJ4A 4K3EH 4EN3D 4WEBL 5IUCA 3BQUC 5FCUH 3SDXB 1R19A 3MRHA 2GTQA 1C12B 1EIBA 3G5YB 1MRDL 5H94A 1IUZA 4M4PA 4CGUB 1HN1A 3B56A 3O45A 1LO5B 2H5UA 4JY6A 1A64A 1ZA3B 4PJ8B 1RZJC 4Z7IA 2DLFL 3SPCA 1D6EB 1NSNH 3NOIA 2NY2B 3FZUC 4APQD 4L3AA 2YD1A 3QS2A 2E5EA 4FLQA 4HS3A 2W9DL 2YA1A 4K7PY 1XCQA 4D3CL 4TUKL 2XOTA 1DVTA 3JQOB 1R5IB 2C3WA 1AHKA 2EIBA 3DO7A 5AWNL 1NLBH 4G83A 5E4IA 3FU8A 5F89B 5I1KL 4MD0B 4R84A 3K1DA 3DOHA 5CFAA 1ZEAL 1WK0A 4Q4IA 1MHHB 5I15H 1FA4A 4G1EA 5D4IA 2M26A 2DQUL 5AW7B 3OXSB 3REVA 4YO0B 1QSZA 1N59B 2JSFA 4UI2A 5TF1H 3QJFA 2FLMA 1CD0A 5H35A 1MIMH 5KVFE 4C4BA 2Z3FA 4LB8A 2NW2B 1KLFB 3DIDA 1ZDSA 5JOPE 1GY1A 3FCSB 1TXKA 3L3GB 4UV7L 5LQBH 3C09B 3VWKC 3FQUA 2COQA 1OT1A 4FTVB 4WTZG 4V11A 4R0LB 3AUVA 1GPOH 4EUPH 4HU2A 3O6ML 1M7IB 3A67H 1VZHA 4IDJH 2FIKA 2Y1YA 3QQXA 1R17A 2XA8H 3FQNB 2Y69B 4XMTA 1J86A 1NJ9B 4AKPA 3ARGD 1W72L 4LQ1A 2DQIL 4N0CD 2WXMA 3ZHFA 1JDCA 1WBZA 1KBKA 4PJBE 4MJ4A 1EDQA 2BXYA 2JCCF 4RRPM 3RPIB 3ZKMC 4ONGH 4NHCL 2IQAB 5DJAB 2DEWX 3ZXAC 2E27H 3DVNB 3OJVC 5CEXA 3BFQG 5K9OA 1QOKA 1Z5LB 2FDBP 4NWUH 3UTTE 1ZT1A 1MY7A 1RJLB 5I6KA 5LLIC 3SEPA 1CVSC 1DVUA 3PV7A 3LTVA 4TPRH 4JAMB 5LGKA 3MBED 2KUTA 2NUTA 3SGEH 4XVUD 3WGVB 3AXIA 4QRQB 2X0WA 2XNAA 1JZ8A 3ROLA 5GHWL 3CXFA 4HC1A 5DYFA 2G2NA 3LRSA 2HLAB 1S7QA 3MRIB 4XC1L 4XNYH 1LEKB 2H9GB 4D94A 5CD3A 1QA9B 1NAMH 2QVIA 4R0LC 2Z65C 4X4KA 2KDGA 4GG6A 4U49A 2EH7H 2ICCA 1QSFD 3QEQD 2YAHA 2UWEF 3H2PA 4ZQTA 2R2BB 4JFEE 2LU5A 1WEJH 1KYDA 2WP3O 1MLCA 1NUNB 2AV1B 2N4IA 2VDQB 4FQ2L 5C0CB 2MKWA 2OR8A 3U0PA 4XNQA 4KVNH 3WN6A 4DKFH 2AJ3A 1DLFL 4HUXB 4J27A 3THMH 4FQJH 3MODH 3D9AL 3U7WL 3R0NA 5IROC 2F53E 2X88A 3IJEB 4PJFA 5HHVH 1HHIB 2R0ZL 2GITB 3D52A 3TONA 1P4IL 4QHUA 1QPPA 4ADGA 3KPOB 3KDPB 3WUWG 5I6LA 1PX8A 2NY2D 4XXDB 1DSYA 1P4LA 3SDCC 3AQYA 2F58H 4I0PB 1G7PB 1MREH 3J2PA 4RNRB 3FB6A 5GISH 5E2VH 3G04B 5A2AA 4BFRA 5CLWA 4ZFFA 1F18A 3FQWB 3HMXH 1WFOA 2H6PB 4PJBF 4H20H 1DVFB 3DX8A 4Z5RA 4DWHA 2WVVB 1UGNA 5ESVA 1KJ2B 5KVGL 1E9PA 3TEYA 2L7QA 2YPVH 5TPWH 1GCYA 3ENEA 3B6SA 3IJ9A 4UU9B 2QJDA 1NFKA 2F7QA 1LQBC 4PB0L 3DNKA 4NB7A 2ZCLH 2VXVL 3WSQL 5DEZA 3HE7A 4FNPA 4Q2ZB 2D4DA 2OTPA 1N64H 2YZ8A 5A6IA 2CLVA 3ARYA 5IB2A 4X4YA 2AJSL 5DUPL 1RJYB 1IC7H 3QWOA 4XP5L 4TLTA 3L3JA 3MCLH 4FI8A 1RMFL 1JWSA 2V3EA 5A2BA 2IALA 1EHAA 4FYSA 4V33A 3KVDD 4X6DF 1FVDA 4NRZB 5D1ZI 3IFPB 3ME0B 3K2UL 4XN2A 1HHGB 5EU3A 5FW6A 5C3TA 2ZAHA 1W16A 2GJRA 3DX9B 2CO7A 3HAEB 3LXCA 4FNSA 5AW3B 3LNGA 5TF0A 4XAWH 4MAYA 1NKRA 4ZSOB 4CSPA 3N1QC 3ZE1F 1KN2H 1PG7W 2QDWA 3D4CA 4KI1A 5F8RC 5AW2B 1XB3A 2CNYA 2KI6A 4M7ZC 5J12C 1JZ5A 4YXHL 5C6WH 3SE3A 3BYYA 5DJ8B 4RMVA 3ILEA 2V37A 4ZFOA 1F3DH 1DBMH 4JFOB 5BW7C 1JUFB 3LD8C 3C9NA 4N28A 5F9WC 3VRIA 3W2DH 4ZX4A 2VDOB 3HN5A 1CU4L 3QQ4A 4JFVA 3QBTB 3VDBA 1OPOA 1X9QA 2AQSA 5F9OH 4QLWA 5ERWA 4K23L 3VFGL 1EXUA 3QUMB 3H9HB 3EJZC 1WA2X 3J07A 2JJUA 4R5TA 2VDOH 4CNIA 2ZWZA 2Q6WB 3GSOB 3AWEA 1VENA 1F4WH 2I32A 4LRIC 5HHPB 2Z7ZA 3MXWH 1XGTB 4GKOA 3WFBL 5D5MB 1OKEA 3JYCA 3LH8A 2CQVA 3JWDC 1F0LA 5GRVL 3WS6A 5CHNB 1Q0YL 2G9HA 4N68A 1ZS8B 5E95B 3W57A 3WV0A 3E9TA 3GHEH 3DX1A 3GMLA 5EUOB 4LP5A 3P4OB 1J0KA 4S1RH 4ZD3L 1H6UA 1UACL 4NDMB 4OZHF 4XC3H 4JZJB 4TTDD 3T0EE 3LN9A 3A23A 2B16A 4M43L 3WKYA 3KYKH 2XN9A 4JO2L 1O7DC 2X4UA 5JO5B 4YLQT 3SN6N 5DO8A 3ZTJG 2CE6A 2P80D 4PJDE 2ICWB 3BVDB 3C60C 3SD5A 5HSFA 4QRPE 2B1OA 3V0AC 2NY0B 4RX4D 3MUZ1 3FONA 3TU6A 2D73A 4G1MA 1BZEA 3FCBA 2YKKA 2V2TA 2IOIA 4CN1A 3G6DL 1NGZA 1YEDA 4BE5A 2IANA 2PLTA 4NN7B 2EDWA 4JQVA 3KJ6H 3BSZA 3FQXB 1TZHB 2WJ7A 4EN3C 4BV1A 4KKNA 4W9HC 5CGYC 2NCMA 4WIQA 1UTDA 2GG1A 3DJTA 5DSCB 1YUHA 1ZEAH 3P9MA 2QELA 3N1GC 5ICXB 5SWSE 1KJ2H 4XWOC 5C0DB 1E9OB 5ITFB 3UAJA 3EFOB 3MUUA 2B1AH 1ZVHA 2NY4C 2R0WH 4B50A 4LEOB 2NMSA 1MFEH 5DVPA 4BINA 1GGUA 1KNOB 3MCYA 3TBTB 3L95B 2APWA 1UM6L 5DRWB 3O3BA 5HHMD 1A6AA 1U92B 1X5AA 2PW2A 2PXYD 3CDYA 4IIQA 2Y2WA 5F88A 2NXYB 1ZJBA 5CILL 3DJSA 4M48L 4YHYB 1K8IA 1P6FA 1QFPA 4G43A 3BKYL 4QOKD 3L2MA 2KMWA 5FFOA 1BMGA 3AU1A 5C97A 2XU9A 1MRDH 1W72A 5ELIA 3MO1A 1LO2H 4F93B 3SYOA 1FGNH 3O4LA 1C16B 4EBQH 1U8JB 4AL8H 3HS8A 3QDJB 4MNGB 3OKKA 2G4GA 2ZQKA 2YZ1A 2VDQH 4HWUA 5KJRH 2WKOA 4UTBA 4P5MB 4XWGH 4URTB 5D55A 1DEDA 3NIDF 4UWQB 4PVBA 5ID0B 3VFSB 2G5BA 3LH9A 1PD1A 1HQRB 1SEQL 1O7DE 4ZW3A 3UYRH 1AY1H 2IBZY 2CG9X 2E76C 1U3YA 1FNEA 1MFBH 1OCZB 1QYGL 3QFJE 4MMXC 3AJ7A 5J6HB 5MHSE 4JFQB 1V54B 2IFFL 2O6CA 2X09A 5C0AD 5IB3A 1QZNA 1NMBL 1HH9A 1KCSL 1IARB 5HHMB 2XHNA 5IV2A 5JHLA 3N1MC 1BD2A 4UQCA 4P5SA 5AAMC 1RFDL 4LLYB 5TE6L 4AMWA 3Q01A 3TESA 2DICA 2CIKA 3RGVB 3E7JA 1HL9A 1T89A 1INEL 1A22B 2X7LB 2VLJA 1U58A 1A02N 4WFGE 2BY1A 3SGDI 3IMBA 1ACCA 3TNNA 5C08B 2WUCH 3HMWL 4PV9B 1TJIH 4CDGC 2OMWA 2FHBA 4P9HL 2MNWA 3TM6A 1RZQA 4PJ8C 1X5MA 1LE5A 3TH2T 1MCSA 2LTQC 1MFAH 4NAQA 1NEZG 4EUPB 3ALWA 4G7YL 5D9SA 1R3HB 2R2HA 3DHMA 2WWMD 4O58H 5EMYA 3RJOA 1C1EH 4KKBC 4ELKB 5IVZB 4JM2D 3L3IB 2ZSWA 2X42A 4LKCB 2MOQA 3MROA 3PS6A 5E8EB 5D7SL 5GXBB 3CDGB 4N2AA 3DK0A 2X2IA 4OLXL 1IL1B 2EVHA 5TQ2L 1OW0A 2JKLA 4OJFL 4U6TA 3NH7L 2CSPA 5AZEL 5JPMC 2EVFA 5GS1A 4S1QL 2P45B 5BO1L 3S7GA 4BZ1A 5SWSB 4BH8B 1JYVA 5CM1A 3ZDZF 1CLZH 4QF1B 5IQ7L 4MHHG 2BIPA 4PCYA 5I23A 1VFAB 1CDBA 1XGRA 3SPGA 4OI7A 2OSLB 4H8HA 1MW3A 1GA2A 4W4OA 2FB4L 1BQHB 3HE7D 3UG5A 1CTNA 3L3OA 4LLQB 2VITA 5EF1A 5DGQA 4YVUA 5HVFB 4OGAC 2VSKB 1PD0A 5EC2A 2CGYA 1NCCL 3NK4A 4P3DA 4YDLC 2WZPD 1AO7B 1DBJL 2BM3A 3DV6B 4G8EB 5EBWA 5C86A 2UZPA 3PQYD 1LVEA 3B3IB 2FYYA 1ADQH 1N0LB 2Q1EA 4ZFZA 3GJFA 1IU1A 1QFOA 3LXUX 1F4XH 1U8LB 1FCCA 5C0FA 3PL6C 3NEOA 1PY4A 3ECBB 2APBA 1KIPA 2FJGA 3SGKA 2BERA 2VUYA 2HJFB 5T1LA 3QA3A 3RDTA 4FXGB 2J71A 4HJ0C 2GIMA 4PJ9C 1BBDL 4XP4H 1SYSA 4CKQA 3W0WB 3DO4A 2J6EA 3QZWB 1TU2A 2UX6A 4QHKI 1FSKC 4W9JC 4E42A 3BPNB 4U05A 4LLDA 1DEEB 5GSVB 5J6GA 5C07A 4NZUH 3MRLA 3VJ6A 3PPEA 4IBUA 4KRNA 1P1ZB 4RCAA 4ZOAA 1AC6A 3FRPG 5AOIA 1GZPB 4PJEB 5FYJL 3ZBMA 4ANVA 3MLSL 3NQIA 3AAZB 1E8WA 4UV4L 3QRBA 5HYJA 2JI2A 3VD2A 1A5FH 1LEGA 3AMKA 4G3YH 3INUH 3JTTB 4RFOH 5CJOL 3NIFB 2I7OA 1CE1L 3Q6GH 4H5SA 2WZ0A 2VTFA 1T1XB 3FT4A 4F57L 1JL8A 3VE0A 4ABUA 3E38A 4FI7A 5EA0H 2OK0L 5CBAA 3T3PB 4P2RA 3IE9A 4CC0A 1J9CT 2VZVA 1HZKA 5IJBC 4MD5B 4N8VB 4GP8B 4HIEB 4RBPH 1T7YA 1CGSL 4O4YH 5DJ0B 2WQSA 1BVOA 1S6NA 4TMPA 2B0SL 2XPGB 2ZWNA 1PY0A 3BT0A 5KG9A 4Y5VC 1FUNA 2MCG1 5I5IA 1OARH 3Q8FA 5CZXD 1E43A 1HHJA 2YC1B 3TT3L 1WBYB 4X6CF 4L05A 3V5HA 4UT7H 4RISH 1JNNH 4HGWA 2V4LA 3NTCH 1NANH 4QCIA 3VVVA 2UZYA 3STBA 1QFWH 1OGTB 2YEVB 4GKSB 2P1YA 4X98B 3QNXA 4DZ8A 2OI9C 3WHE0 5DUML 4LLUA 1QG3A 4GAJL 4EIZC 3FFDA 3TN0B 3BHBA 3TFKC 4YLBA 4ALAC 3I9PA 3L81A 4GMSL 4GSRA 3S8FB 2YMXH 2F54B 2VO8A 3BXNA 4PFEA 2A9ML 3RKDC 1I7RA 3C5ZD 5HDWA 4EI6A 4Z78A 2WSPA 3EYUH 2VDKH 1UWEL 3RG1C 3S2CA 1QATA 3BH9A 1UA6H 1DDHA 1KCRH 4JO3H 3NN8B 1T1YA 2EZ0C 5I74C 5ANMB 4LNRB 3HJ0A 3EO1B 3FQTA 4G6KL 1L7IH 2X70B 4HPOL 4F7PA 1KCBA 1RK0A 4JDEA 4UZUA 3OLGA 1QLFB 4D0DA 5KYUB 4FTVD 5B3NA 2CDGA 2FR4B 5EORH 4EE2A 1MJUH 2AITA 3SDXE 4HG4K 5CJXA 1JTPA 2BSTB 4OCLC 1QR4A 1U8QA 3GBLA 4HUMB 4LGSB 4Y8AA 2ICWJ 2DLTA 3RB5A 1MJ7L 5SWZB 5T3XL 3MJ9H 1FFPB 1TZIB 1J8HE 1OK8A 3CFQA 5KSAD 1K9TA 1JPSH 3NACL 4S0SD 2B8OT 4DKEH 3ZRSA 3SDDD 3QPQC 3M1OA 1REIA 4AE1A 1WAEA 3HN3A 3TN0C 4B9CA 3A4AA 4JDVA 2VQ4A 1RVFH 4QRRE 3SBRA 4Q97A 1XB8A 2J43A 4OLZH 4S1DD 3SCMC 2AKRB 1UXSB 3UP6A 3LX9A 3VFMB 4D9QE 1AP2B 4G8GA 1Q9KA 4WCYL 3ZE0E 3KPLA 4J3VA 4NQVA 2J21A 3KWWB 4OZFG 3LNFA 4B53A 1D6VL 3TO4B 4CADA 4MDJA 4AM0Q 2F7PA 5A2IH 2Q2LA 1NH6A 3S6CA 2AXJA 5I0YA 1N70A 1KT2A 3GXDA 4R2GD 2ADGB 1PAMA 4Z7UB 4AGPA 2P3YA 4K73A 4OTXL 4BFKA 2BSDA 4PGBB 2LVEA 5B8CA 1ZV2A 3QH3B 4Q9RH 3M17B 2J1ZA 1I7ZB 3I3BA 4PJ5D 5ACZB 4JO8A 4KNUA 2H2PD 1WICA 1RIUH 1YN6A 3SY6A 4P5KA 1JMXA 4RA3A 2XVLA 5AZEH 5CR8A 3K3QA 2EC9T 4KK5C 3ZDZE 2X1QA 5TDNB 1EFQA 5FIEA 5LB1A 3RWHA 1JPST 2OMVA 4NFDA 2EE9A 1E0OB 1GGCH 2XZAL 4P4RA 4WRLA 1WIPA 2ENPA 3P3RA 5BZWB 2ATPB 3WDIA 4W9GC 4YJZL 3WTSA 5LBGA 2K4WA 3FPXA 1JF1A 3BWSA 5C0EA 2EYTA 1RURL 5K39B 3CUPA 4EN3B 4F58L 4N2IA 3FH7A 1QHQA 1T1ZA 3OAUL 3CZJA 1YO4A 3L9EA 3QDJE 4MNGE 4F2MA 4XP9H 4FLHA 1SOXA 3MJ9L 1OP3K 5IFHL 2ZXWB 2B5IC 5C71A 1IEBB 2X41A 4Z3JA 5EEWA 4LLWB 2B1AL 3TIDA 1NBYA 4FX5A 3L3HB 3AWGA 1G7IA 2J4WH 2ZPKH 2B9AA 2JKSA 3ESMA 4L4TD 3T6XA 2Z34A 3GUTB 2X4SA 1WZ1L 2BWQA 4NQDD 4PRPB 1IGIH 3VM5A 5J06A 1T3FA 3KWXA 3HRZC 3HI1B 3WNLA 5AB9A 2XWEA 2OCFD 1CE6A 1FH5H 1CLZL 2FYVA 3HE6D 5GJTH 4X80H 5BVJA 4X99B 2C3XA 1FZOA 4X2UA 5DD5L 1QABA 1NCBH 5CD5C 3V4PH 4LPUA 1YVLA 2IG2L 1KCVL 1R1CA 2Z31B 4N0FA 4XBMA 3REWB 1BMZA 3CU1A 1IGYB 2QKSA 3U6RA 2VL4A 4F2EA 4V2BA 3EG9A 4Q9BA 2XIIA 2WLLA 1QYGH 3MCKA 4OJFH 1Q8MA 3QZBA 5BVJB 1RD6A 3ZR5A 1XWVA 3HG5A 5IB4A 1KTRL 5T33L 4S1SH 3U2IA 5FKAB 1UH2A 4JPQA 3GRWH 4R90H 3CXHK 5BS0B 1QR1A 1XCTB 4N85A 1H0DB 2Q7NA 3ARDB 1MZYA 3GUTA 2LU3A 2VXTL 3TTYA 3N9GH 4HOWA 4KXZH 5B8CC 4J8RA 1XGZA 4XBGB 3GB7A 3TIDB 1KULA 4PREB 3AACA 1PLBA 4X4MA 1T1WA 1R9FA 1S9VA 2WXQA 4KXZI 2WXOA 4MNHA 2OA9A 3U7AA 3FC8A 5D1XD 2E8ZA 3FO9B 1PFOA 2R23B 4DVBB 2QL1A 1WH0A 4FNTA 5I0XA 5CD5D 1VFMA 3Q44A 3RFZB 1EHNA 5D1QE 4GRWF 2VDRL 3BVNB 1BPLB 3ZE1E 3K72A 1KXQA 4LCWD 2ZYRA 4M8UA 1U3JA 2R69L 2ZOTA 3VXOB 2A9NH 3FO2B 4LP8A 4DPRA 3A4DA 3E6FA 3UJIL 4MBOA 3HB3B 4F15C 2DJUA 4XAWL 2R56L 5KSBB 5GGSB 1ONQB 1OCWH 5DK2A 4P5KB 1BWMA 3DMMC 4IBWA 1K85A 4FQXA 2E7LC 3JSSA 2NQ3A 3WKPA 3ZMRA 5D70L 4AE0A 1RH8A 2HVKA 1UXWB 4H25A 4FFTA 3QUZB 2CJUH 3RP1A 3FO0L 4PR5A 2VKXA 3UTSB 1AGDB 4IHBA 2XV6B 4QRUB 5TE4L 4UQ3A 3U82B 1JRHI 3V79C 5DFAA 3FRPB 2Q20A 3ATDA 3CZEA 2YXMA 3MCLL 2Q8AH 3D05A 4X6EB 4MDJB 3MGTB 1CGWA 2JKTM 2K6YA 1UA3A 4M7JH 4NQVB 2E9IA 5FB8B 1Q9KB 1BQUA 1P9MC 1S4IA 3SDDB 2QEJA 1YEWA 1OAQH 1FFRA 2F9BT 2DRUA 1H9VA 2D03H 1J10A 2FUTA 1TTBA 3D18B 3MOBH 4MA1C 1F56A 4JDVB 3WFEL 5LJYH 2IMNA 2G5UA 4AG4L 4LCVA 1SHMA 3ZTJH 4J5VA 4WU5B 3MR9B 1OGSA 1BLNA 1NCTA 2ENYA 1ES0A 4D8PA 3X3FH 5D96B 4B7IA 4NQEE 4IBVA 3Q2VA 2YXWA 4JRLA 4EZLA 1QKZL 3AT8A 5D5ME 4AK1A 1T83A 3GMMB 2P8MB 1DJWA 3FOMB 4KX7A 4JM4L 4LVNB 5C7XL 3K71A 4YBLC 1GY2A 1RZIA 3ECVA 3MA9L 1TZ8A 2C9VA 4AJ0A 5B7FA 1TQTA 1FI8C 2H32A 1JYWA 4YHLH 2AC0A 3X14A 2PUQT 4JRXB 1A6WH 2WTOA 5J56B 4MA3A 4A68A 3HNTL 1MCEA 1ADWA 1KJVB 1AQKH 1L6XA 5EH1A 2X70A 5HHOE 1LWRA 4MDRA 4N87A 2DY2A 4LFHG 4HP5A 4FQJL 2AABL 1DDHB 1MLBB 2EEXA 1KELL 5DK0B 3EO9H 2FJFB 2AK4D 4RWYH 5E99H 4PJ9B 5I76A 1JZ2A 3MLSH 4DCQA 3BDBA 4QRRB 5BRZD 3Q5TA 3QFDA 3RVTD 3FFDB 4DH2A 2H1PH 2WM0A 2I9LB 5EZJA 4DZ8B 3TZVA 1RI8A 4GKSA 4X98A 1IBZA 2CDEB 3U46B 3BUIA 1QNZL 4HGWB 2VRAA 2A4ZA 4GQPH 1MFNA 2FGZA 4W6XB 3N40F 4NUGH 4XP4L 5LWYL 2VN3A 4XP5H 5GJSL 1FFOA 4D2NA 4YXLL 2HFEA 3I02B 2W81C 4EDXA 1KFGA 5I16B 4Z1PA 1DZBA 1NICA 4P49A 5DJ0A 1TIUA 1VEMA 3CSGA 3OMAB 3SPIA 3VI4E 4NQEA 4OCXL 4KV5E 3V6ZA 3UAEA 5D5MF 1OE3A 1XF4B 3EYOA 1RFDH 4U6XA 2YXFA 5FO7A 3ISRA 4QTHB 2FQEA 4EO5A 4IBQA 3VFWB 1T1XA 3FT4B 2CBMA 2YQBA 4WGVB 5F9JA 1NMBH 1Z3RA 3T0VA 5F7NC 3CDFA 2O5YH 5DQ9B 1SHSA 2WQRA 4IDJL 2HUHA 3JTTA 4KK6D 3QPKA 4LAQL 1LEGB 4M7LL 4K5OA 1N5YL 3HG1B 1DP0A 3NJLA 2JH2A 3FW6A 2WSDA 4P0DA 1KN2L 5M7QA 1DE4A 5IMLA 5AAPA 5IQ7H 5JHDB 4YDIL 4PCSA 4PRIE 4IBLT 1OE2A 1MIML 1F11B 1F1DA 5CU5A 2LW3A 4KVPA 3F7VA 4WWKC 4E42B 3FULA 2XC8A 3CFEA 2R2CA 1FNSL 1QSFA 3QEQA 3LSOB 5EBLB 1R5WB 3AG3B 8FABA 2RCSL 5DHVA 3HTLX 3GWJA 1ZJAA 4HSAC 2K4AA 4OD1H 3ZKMD 4FXGA 1S78C 4JGNA 2ZUTA 4BSVA 1OT2A 2HJFA 1JJUA 2I5YL 4HK0B 1AFVH 2VERA 3BW9A 3NABL 4V1DD 1A66A 3GINA 1L9SA 3BLKA 3S36H 1BXUA 1HXMB 3CLWA 4TVPL 4OGYH 2JIXD 1Z9SA 4W9LC 5FKPA 3P4MB 1PZ5A 3KBHE 3NDYE 4WKXA 3KHOA 3FTUA 1AO7A 4QXTB 1K8DB 3SYAA 2G75B 5E5MA 4OM1L 3V5DA 4UQBA 4WEMB 5C0BA 5EO9B 2DMBA 3QDGE 1SMOA 4G6MH 5DFTA 3V6BR 2A83A 1MHCA 1JPEA 1BQHA 1M1XB 2GT9B 2ITCB 4WGKA 2I7SA 3MACL 4H20L 1HHKB 2EABA 4KV5F 5IROA 3RIFF 4YR6B 3MRRB 1XGRB 2VLRA 1SDDB 2EDOA 3RZCB 1JXKA 3MX0A 1P6WA 1T0MA 4FQQB 4QWWC 1UQSA 4C58B 2O61B 5D7LE 5FF6A 4KDTC 3T0BA 2VLRB 2W8CA 5CBEB 3PL6D 3U4KA 5JYLA 1ROWA 4I18C 4TTGA 2Y06L 4R7XA 2XFGB 1XGYL 4F3FA 2A77L 3IJSB 4CSTA 1WZMA 3PGCA 2UUDH 5AW8B 3OJDB 2EEFA 1PBYA 4MX7A 4XX1G 4ZTEA 3D06A 4BGDA 1T21A 1E3XA 1DJXA 2ZOWA 1PU0A 3UMTA 1SLVA 3MROB 4U31A 4S0TD 1HXMA 2CHDA 1KFAH 2XQYK 2WKLA 5JIMA 3H53A 3DOSB 3TBYA 1RIHH 4CSZA 5D9SB 1LDPL 4HQQL 4K94H 1BG9A 3IM1A 2FAUA 3KYOA 4HIIA 1XH2A 4Y4HC 3LPFA 4MAYD 4XNYL 1JGUH 4O02L 1R5WA 1TQBC 2H7WA 1CIDA 1QSFB 3QEQB 1BFVH 5D1QC 5EBLA 3MJGX 3FAXA 4X9IA 2HPOA 4OUOA 4NZTL 3QO1A 2QFRA 3MRJA 4JFDD 2VLJB 2A4CA 3DUSB 5LBSH 3KG5A 2L7EA 1TF4A 2NRDA 5TJWK 1OAUH 1GIGH 2P5EB 4JN1L 4LQFL 1TQCB 3OZLA 2QHRL 1HJCA 2YAQA 3N1PC 3BUTA 4FQXD 2E27L 4HJ0D 1XGPB 1XIWB 2MPAL 1NC4A 3LRMA 2ZP9A 3FFCB 2ED6A 3TEXA 3LZPA 3KLSA 4A2HA 4YHZL 3X11A 5F9JB 2GFBA 4H8QA 2JLLA 3A6BH 3TBSA 3NFPA 2H45A 5B3SB 4PJ7E 3QZOA 1W8OA 4QYAA 4U6XB 4ODXB 4UZGA 2NYKA 3WLWD 1OO2A 5E2UH 3CN2A 3W9EA 1YEIH 2YRBA 2ZOLA 4HJIA 3S96A 2IFGA 4U3HA 3OAZH 2QQQA 1NAMA 2FL5A 3E6HA 1GPOL 2D9CA 5IBLD 2BRRL 2K6WA 3IFNL 4K8RD 3V0IA 4BQ9A 1F3JA 4XNDA 1R5VA 5E6UB 4WHTA 5IEKA 4PLNC 3RZWA 2DKSA 2P44B 2HFEB 3QNFA 4G5AA 1BXAA 1YZZA 4N5UA 4OD2A 5GRZA 3T3PF 3BOVA 2XN9D 3S5ZA 4Y5XC 4ZO6A 5I24A 3BRDA 3ZX1A 5JR1H 2EUXA 1S9WA 1I3GH 2LFEA 2NXYD 4G6JL 2D3VA 5L4FA 3O4LB 2W91A 3PAYA 2YMTA 1QSVA 3JTSB 4YX2H 4M43H 1UCTA 2B3RA 2HLFD 3MXVH 3Q2LA 2OJEA 4G70B 2NR6A 2VQUA 5JOPD 3WEMA 1RPKA 4XC3L 5PAZA 1NCDH 5IF0A 4ZXBD 2EXSA 4QY8B 4DCQB 4N3TA 1Y1UA 2CKNA 3ZE2E 5DT1H 3VI4F 4YC2C 4TN9A 3HMXA 4D0CB 1KNOA 3QQDB 3RKPA 4LSPL 3B2DC 5FYKE 4W9IC 3U7YH 1OCRB 2N7AA 3D33A 3B7SA 5IQ9B 1DO6A 5F0PB 4O9HL 1E9OA 5ITFA 5FDWB 4Y1AB 2VDLL 5ICUA 3TA3D 4MXQD 2LQRA 3VXRE 2APTA 2F2HA 3P9MB 5E8OA 1KJVA 1F86A 1UH4A 2A2QT 1JPTL 4JRXA 4LMQE 4KKAC 4LARL 3OAYK 4ERSL 3R1GH 5CZKA 2VLMD 1I1AC 3CN0A 3P11L 2EICA 4PJ8D 2YKLH 4QWWD 3MKKA 3SDXF 1T7XA 3BP6B 3STZA 1F58H 1ML0A 4NN7C 4E5XB 1KIRA 3TCLB 3QHZL 4NERA 5DEFB 2EUWA 5HYSA 3BPLB 1HZHL 2F19H 4OW6A 3D5OF 3GXUB 2B77A 3GMMA 5EU4A 3CFUA 5GGTH 4YSQA 3F6IA 1JTTA 1ETA1 4QKTA 2ROYA 2X89A 3BH4A 4L8BA 2ALAA 1QFUL 2E0PA 2Z92A 4D8PB 1AKJD 3UCRA 2CO1A 3EO9L 3Q2WA 4QJ4B 3RWIA 3N44F 1IILE 4OIBA 1S5HB 3ALXA 4MAYC 2DM4A 4NDMA 2WO3B 3WFZA 3VXUA 1IQDA 3L08A 3PNRB 2R39A 1IGMH 5EFIB 3MGTA 2H41A 5C09D 3LIZL 2P24B 5CHNA 4JFZL 2B7DT 3UOAB 3ZZ1A 2I24N 2OULB 5CZVL 3RJQB 5EU5B 2APFA 4RMRA 4PR5B 4YHKL 3GSVA 4ADIA 1AXSB 4KH9A 2UZIH 2BOBB 3PRZA 2HVKB 3MNZA 4OZGF 2V8MA 2VLME 3PWNB 3WAKA 4FQXB 3EW3B 3H4HA 2XKNB 4NHCH 4QGTA 2D7OA 4G7QB 1SQ2N 4P06A 4WI0A 3T6VA 1D5XB 1FYTA 2E8YA 2QMJA 3KLAA 4OCSL 4U1SB 3WJJC 2BWDA 3TYFB 1ITCA 1G5AA 3O2WL 1JN6A 1I85C 1CXHA 5IW6B 1MNUH 2CKBB 4LVNC 2Y5QA 3QZNA 1W80A 2FWUA 4GKNA 4LHJB 4FNUA 3BVNA 1A7NL 1I9IH 1UD8A 2IAAC 4MAYB 3SE9H 2Q8AL 4JFYB 3ULAB 1TKWB 1GW6A 2ZWYA 3NAAL 1FNGB 2AS5M 4BFEA 2NQDA 2R23A 5KSVA 3D8MA 2BH0A 5IFAL 2BCKB 4Z7QB 4YNYA 4TNVF 1HHGA 2W60B 2ARJB 5F7EL 4I5BA 3LKRA 1S9VB 1ZKAA 2NT1A 4FKEA 5CGMA 1AGBA 2HRPH 3HW7A 1NGQH 2WN2A 4NFCA 3PAVA 4ZMAT 5E2UL 5C08E 1VHPA 5T1KD 4ZMWA 3GSWB 3KE0A 2R56H 4YL9A 5L9DL 1RJYA 4V1DB 3BN9D 3PAZA 5FDYA 5JMRA 3II1A 5C09E 4ICWA 5GIRB 2AW2A 1H15A 2O4EA 5IW3A 3KLDA 1F41A 3KR3H 5C9JA 4ETQA 1PLGH 2AEIT 5ACLA 4P2QB 3FSWA 1Q9OA 1YYML 1BDYA 4ODWB 5HDLA 4JFFA 2ADJA 2QSVA 3QJRB 2WLLB 3QFJD 2XFXB 3GDCA 4Y19A 4XX5A 4NT6A 5T5FA 1Z3GH 3VACA 3REWA 4BHUA 1J8SA 4M7ZB 2I07B 5J12B 3N43F 4HCIA 4KTDH 1FZOB 2XYCA 4N1HB 5DR5H 4M7KL 4FA7B 3NIGF 2X6AA 2GABA 1CE6B 4RA0C 2DOCA 2WN3A 1MFUA 1MCRA 3WJJA 1WHPA 2QV2A 1G7PA 2P5WE 1RJZA 4XXDA 2APXA 1EDHA 1XR8A 4QT5B 3ULUE 1BJMA 4FQIH 4Q58C 5FV1L 2OL3H 5JPMB 8PAZA 4X5PA 4APXB 4LLVB 1PZ3A 3UTSD 4PJFB 3SE8H 2P5WD 3RX5A 2EUZA 2XKSA 2XBZA 4LLWA 4AJWA 4NUJA 1DZ0A 2XA8L 1GKEA 3SKJL 3V0GA 2AQTA 5T1LD 3VRLE 5JHMA 1ZANL 2C1OA 2E9BA 3KPSA 4H8UA 4GYBA 4LLMA 5C0CA 5HHXL 3RNKA 1DBBL 3RUGF 2R2BA 1BZ7A 2JKWA 4YDMA 1YPZF 3KPQA 7FABL 4NX0A 1KLGA 3MRCB 3PHQA 3TFBA 1VKXB 2WXIA 1CQKA 3HA0A 3KYMB 3G5WA 2ATPA 5E70A 4MJJA 3CLFL 4PMFA 2V5TA 3VX1A 1YMME 2OMVB 2WANA 3LRSB 2MMXA 3H3PH 1ZTXH 3QZWG 3QUYB 2XQYA 3ROLB 1H9DA 4BE6A 4LLAA 4FMVA 5GS0L 3ZO9A 5D1XC 4ZMXA 1BVKA 3F6LA 3VH8A 5JMOC 4H1LB 3RPBA 1HKLL 5AW9B 3V0DA 4D7PA 3Q5OA 1MQ8A 1Z5LA 4XN8A 4XCNA 3QH3A 1Z2KA 4HWZB 1QWUA 3BAJA 5F1KC 3FB8A 2X6VA 4NQUA 1LEIB 2O1AA 3EIFA 4LBAA 1T4KA 3ILQC 4WGWB 5T1MB 4OLUL 4U3CA 5EUOF 4JPIA 2OYKA 3NA9L 3BLBA 3FQNA 4HLEA 4YXLH 2KPWA 3CZUB 5E6SB 1M05B 4HZLA 2KT6A 2AV7A 3BEWB 1G9HA 1OSEA 3WELA 1PJ9A 1GTNA 2HZHA 4WVRA 4W9ZA 1UGKA 5E56A 3FQUB 4KK8D 4U3XA 4LSDA 4Y4FC 3MFGB 2QSQA 4MLSA 4WSJA 4LSTL 4QO1B 1SDYA 3FKUS 3HZKA 3QRGL 3FRUB 4J28A 1KOAA 4L1SA 2VXUL 3OXSA 4HS8L 4Y1AE 2YMOA 1U8QB 5AUMA 3CCHB 1F4AA 2ICES 2ZG2A 2DF3A 4YQXL 1SUHA 2JK5B 4OZGB 3ZLQC 2QQKH 3QHFL 3BFOA 4JG1H 5ICYA 4L4TB 3FSZA 3PGFH 3C5ZA 3B7RL 4D0DB 3MAWA 5FA3A 3FL7A 3U1QA 4OZ4A 1T03H 3RBSA 2BP3A 3FTGA 1ZGLP 3GMNA 2WQAA 3GO1H 4XXWA 3PY9A 1LP9E 4HLZG 5BQ7A 1VACB 5JXAL 1OAXH 4FFWD 1ZLWK 4YHLL 2DWEB 5KBKA 1ZSDB 4RMTA 3ZTEA 4NC2B 5IB5A 1NEZB 2YSTA 4KOBA 4DKEL 3POHA 1EAPB 4PJ8A 1CFNB 2OMXA 3L1EA 1FGVH 2X4QA 3AT9A 4XN1A 2VT0A 4QXWA 1CVRA 5H94B 4LSPH 3EZ8A 3ZYJA 2P42B 1HKFA 4K3JH 1SDAB 3UDWC 4BZYA 5IEHB 1U8HB 2K45A 1U91B 4ATWA 3UAAA 3UG4A 2BNQB 4E0RA 1FZJB 2Z7WA 3DSNA 3QIUB 1QNZH 1AKJA 1MCOL 1YEFH 3BKJH 4NGHL 1T0OA 3GJFH 3V5HB 1TQCC 4LCWB 1OAQL 3OWRA 4XMLL 1HHJB 2BNRD 4NLHA 4ONOA 3NJFA 3MJ8A 3EOBA 4TM9A 1T7VA 4ODSH 1CFNA 1Q1JL 2IH8A 2OMXB 2CLRA 4Z7NB 3BVVA 5FCSH 4CMHC 3WTVA 3GI9H 2DWEA 2BC4A 1CGTA 4D0BA 3PP4L 5CJ5A 1A65A 2CRMA 1USQA 4P2RB 3WXWL 4PJEF 4JHAL 1PG7X 2E6PA 2J8OA 3AQZA 4EKXA 4HOZA 5I75C 1KTLB 4UNTA 1NC2A 3PDOB 1P1VA 1ZS2A 5ADPH 1A6WL 2BVTA 2FGWL 5I1LA 3SYPA 2DIEA 2DI9A 2JK5A 4J23A 4M8QA 3CCHA 2G3MA 1Q94A 4G9FD 2W65A 3IJHA 5C07B 1DQJA 2J7LA 5CNHA 5D4QA 3D0VB 3TO4C 1AHWB 1M4KA 4XMKL 4PJDF 4LASL 4QLRA 4QDGA 1SJHA 1FZMA 3ZQXA 3UROR 1J1XH 2IH9A 4KTEH 4PYHA 4HPYL 1P4BL 3AS2A 4N2EA 1H3TA 2AV7B 3BEWA 3OV6A 1RXLA 5DJCA 4F57H 2P46B 1KIPB 3MBXH 5I1AA 2C9AA 1T2QH 3BIKB 1U8LA 2X12A 5C0FB 2V5SA 1G9EA 1RZGB 3B3IA 3UERA 1HYRC 5AKVA 2F1EA 1TETH 2P49B 3H0TA 1PLAA 1XZ0B 4HUNB 4MB3A 5EBWB 1AG6A 3KGUA 5FK9A 3TN0D 1DO5A 1VEOA 3L4YA 4PGEA 5CEZD 1XAUA 2HKAA 1NZRA 1IE4A 2QQLL 4U1NA 3CMGA 3L3OB 1BVKB 4JFFD 3QNZA 4MJIB 2L7JA 2FLRT 3U1SL 4ELDA 3KPNA 3F01A 2BVQB 2ZNXA 1AHWC 4AM0B 1WDAA 5FA4A 3VXQA 3CPUA 1GC1H 4MA7H 4LPYA 3K8LA 1RUKL 3KH3A 2VM4A 1Z32X 3NJJA 2J25A 3MV7E 3TZVC 2JVUA 1ZLDA 2ZIDA 3KLHC 4GUOA 4L8DA 5SWSA 1IGIL 1KLGB 3MRCA 3PCYA 5LGHH 4B0MM 1LP9F 5I6NA 4WI8A 2DTSA 3NJVA 1KEGL 4HPYH 1U3HC 1QUNB 3LN5A 3ZY7A 2DDQL 4KZ0A 5I8EA 5I1CH 3UGEA 3HUJA 1UHVA 1AOHA 2XWJB 4NUJB 3RAJH 3MJ9A 2OX5B 3HZYB 1ND0B 2WOBA 5FUCE 4APXA 2MOGA 2ZYHA 4BDVB 1KXQE 3WL9A 4U0QB 4JHBA 3ZDYE 1B0IA 1T4WA 2R0KH 4NS0A 2MHAA 2YAFA 2NNCA 4N2KA 3NABH 4DIXA 3MV01 4KJWC 1MFVA 1IAIH 4MZIA 3GI8H 3VB8A 2IPKA 3QDMB 4UM9A 5A6MA 1EEYB 4GW4A 5CMAA 1N19A 3RTQB 2K6ZA 4Y9CA 4LPWA 3TASA 4GJTB 3B2VL 5I71C 4NT6B 4ACTA 2X40A 3KWTA 3SGEI 2O93L 2Y07H 4UAOB 1P2CB 3RGVA 3VDCA 2BMKB 3MV8A 2ADJB 2PTTA 1M6OB 1NUGA 1MCLA 1V7ML 4XZUA 1MPAH 4IBTA 5DLMH 3US1A 4TUJA 1PS3A 1ASPA 3O9WD 2ZCKL 4M00A 5FYLH 5KZCB 1S3RA 1WWAX 3C08H 4KC3B 1RKRA 4MXWH 2G2PA 1A1MB 4GS7C 2H6OA 1CFTA 4IIQC 3HNSH 4DK3A 4URKA 1QRKA 2P5PA 3MV11 2J1WA 3RFZC 2CXKA 3OKMA 3BMVA 5J6HA 4NN5B 2I85A 3FMGL 2F8VA 2BPBA 3GSWA 4HC1H 2Z4QB 3BDYL 4JFXA 5SX5K 1EZSA 1RSFA 1U21A 4KJQC 3KGTA 1A14L 4NM4L 4XMWA 1HEHC 4BKTC 4Q6IC 3UZQB 5C0RL 5HGBB 4K3JL 3UZEC 1GRWA 2ARJA 3GK8H 4OLZL 1OSPH 3OKLA 5EBMB 4FS0A 1YJDL 1FNGA 1YNTA 2WBJC 5HGDB 3K2KA 2YN5A 5INDB 4A55A 1TOXA 3K2MC 5D7JD 1L9TA 2EQDA 3HC2A 2PO6D 3DTXB 3QPXL 4NFBA 3KGRA 1WS8A 3JWDL 4GKNB 4RDBA 4Z6AT 4CJ1A 3OZKA 3GK8L 2IDSA 4NYLA 3W9DB 3ESPA 3WO4B 1IEAA 5D71H 3HKZA 4PGCB 3SE4C 1LO0H 4LEEA 4YFEA 1BV8A 4H8WC 6CGTA 5D2LF 3MBWB 3VXPB 1YDPB 2PETA 3HRZA 3LKQB 4OGZA 3MMEA 1ILSA 5DDHB 3UTZB 5LXGH 2UXVA 4IIQB 1Y6KR 4ZODA 2WBJD 3NJGA 4F37F 1ED3A 3O3BB 5I1GL 1AOZA 1D7BA 1VDGA 3L95A 3BVXA 1EANA 4MA1B 2DJSA 3MV7D 3IETB 1J05A 1QZ1A 4JCWA 2IO5A 2QKIB 1U9KA 4L9DA 2MIZA 1BF8A 2MPVA 2HT4D 3L9RA 1UWYA 2YO3A 1PVHA 1GOFA 5JNYA 1OP4A 4AI7A 3M7FB 2K3HA 3B2VH 4GMSH 4PTTB 4LCYA 3L5WA 4QEGA 1EHLH 4AWJC 4A39A 1TZHA 4ZS7H 1U3HD 3AGWA 5DMIH 1A1NB 1NLDH 4QTFA 1I3VA 3DMMA 4MS8C 1U8KA 5LAPA 3UBHA 3NEXA 5E2WL 2J2ZA 1BZQK 3A21A 1MCDA 3Q2NA 3CVIH 1TTAA 1YAIA 2QPUA 4Q0XL 3SDYL 4MMZA 4PMEA 2ICEC 4PRNB 3HHSB 5KBMA 3T4AA 2WXPA 4QRSA 3ZRCC 1KXTB 2CHWA 4PJIF 3K80A 4XHQA 1U8KB 2B0SH 3OKOB 1IIIA 4QR7A 4E5XA 3VSTA 3BP6A 5K9KA 2BHYA 3OJMB 4GIPD 5C2UB 3GMLB 4WENB 1FVEA 4FYTA 3UTQA 3WFEH 4PTTA 3KWVA 2XWXA 4JANB 5HYEA 5IB1A 5FDWA 2B5IB 1K5WA 4TOYH 4PV8A 3WNIA 4TYUA 1XEUA 3BESR 2R15A 3QULA 4LMQI 1THAA 3EOTH 3K91A 4FJYA 3DUUB 2GAZA 3LS4L 1G84A 4N25A 2CK2A 4JG9A 5BZXA 3OAWA 3QXTA 5C3LD 1EXUB 5CF3A 3S4SB 7PAZA 4F33B 4QY8A 3ZHKA 3QDJD 4HF5L 2JV6A 2NZ9D 3HRZB 3LKQA 3LXAA 4KKLC 5DDHA 3UTZA 4KKQA 4FQLL 3C9NB 2VABA 1KUMA 1IAIL 1UD3A 4PJXF 5D70H 3BI9X 1EVUA 3JTSA 5KW9L 4GXFA 1N10A 4L48A 4TSCL 1WITA 4YGAB 1DCEA 1IAII 4NBXB 3V7AG 1H3WM 4MRBA 2ENQA 4IKJA 4N0UB 1HK6A 5IGXH 4KX8A 3I6KA 1J0HA 5E1AB 4KJYB 1YNTB