1BZOA

Three-dimensional structure of prokaryotic cu,zn superoxide dismutase from p.leiognathi, solved by x-ray crystallography.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SUPEROXIDE DISMUTASE)
publication title Evolutionary constraints for dimer formation in prokaryotic Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
total genus 35
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1bzoA00
1RK7A 5KBMA 1B4TA 1EQWA 1YAZA 1TO5A 1UXLA 2NNXA 1SXAA 4N3TA 2WKOF 1OAJA 1JK9A 1E9QA 2ZKYA 2C9SA 1SXSA 2AQQA 2XJLA 4A7QA 1SOSA 1OEZW 2WZ6A 4A7GA 1U3NA 3H2PA 1SXNA 3KBEA 1E9OB 2C9UA 2APSA 2Z7YA 3RE0A 2GBTA 3QQDB 2WKOA 2JCWA 3L9YA 1YSOA 1DO5A 4L05A 4A7TA 3GZPA 1KMGA 2VR7A 2AQPA 4FF9A 1BA9A 2JLPA 3GZOA 3LTVA 1OZUA 3ECVA 2WZ0A 3SODB 3KBFA 1FUNA 1F1DA 1E9PA 1IB5A 1S4IA 2AQRA 4BD4A 2Z7UA 1L3NA 1MFMA 2C9VA 4U4IA 1HL5A 2VR6A 2Q2LA 1CB4A 1AZVA 1IBFA 1JCVA 2K4WA 5KBLA 4A7SA 3CQPA 1Z9PA 1E9OA 2WWNA 1UXMA 2LU5A 2AQTA 2WYZA 3HOGA 2Z7ZA 1P1VA 1XTMA 3F7KA 3KM1A 1E9QB 4A7VA 4A7UA 1F18A 2WWOA 1SXCA 1B4LA 3KH3A 2AEOA 1EJ8A 4N3UA 3CQQA 2ZOWA 1SXBA 3GQFA 3HFFA 1Z9NA 1PU0A 2GBUA 4BCYA 2WYTA 2AQNA 1N18A 1PZSA 1F1GA 1IBDA 5CU9A 1TO4A 3GZQA 3MKGA 1N19A 4A7GF 3F7LA 1OALA 1SXZA 1E9PB 2XJKA 3GTTA 3KH4A 3MNDA 3QQDA 2ZKXA 4MCNA 4OJAA 3PU7A 1SDAB 1JK9B 1SPDA 3ECUA 1F1AA 3S0PA 4MCMA 1XSOA 2R27A 3T5WA 2E47A 2SODB 2GBVA 4B3EA 1XTLA 2VR8A 4BCZA 1ESOA 1Q0EA 2AF2A 1DSWA 2Z7WA 1IBHA 1YAIA 2E46A 1QUPA 2AQSA 1SRDA 1IBBA 2V0AA 3GTVA 3H2QA 5KBKA 1CBJA 1BZOA 3K91A 1SDYA 1HL4A 3ECWA 2ZKWA 3KM2A 1PTZA 3CE1A 3HW7A 1COBA 2WZ5A 1OZTG 4OH2A 3L9EA
chains in the Genus database with same CATH superfamily
3T2QA 3ABMB 3LN9A 2XA8H 3TA3A 1ASOA 1YECL 1YEJH 2IANA 4QAMB 4H26B 3LKQA 1OXYA 3BP7A 2VZOA 4MKTA 1TJXA 2LQRA 5HGDA 3TBVA 4YHIB 4F7MB 1WK0A 3X1GA 5TE7H 4X6DE 2VXVL 1XXDC 3P0YH 1QVOB 1QLRA 3B4NA 5CNHA 4PUBL 2Z4QA 3IDNA 5HVFB 5DJ8B 2NY0D 4WNJA 1CGSH 3O2DH 1RZ8B 3RDJA 1XX9C 1GMIA 2A83B 4OF5A 2KI6A 3DK0A 4ENED 3B7YA 3O6FB 3KLQA 2D8KA 4XBMA 4EBQH 1X4YA 5CHNB 3QXUA 2F7RA 1QSED 5KVEE 4ZBJA 1LE5B 2X4TA 3L3HA 4LSSH 3ZHNA 1GW6A 5KSAC 5GSRA 3JV0A 5AYQA 2XQBL 3DYPA 1IAMA 1X9RA 1P4BH 3LXUX 1JPGB 2XKNA 3FFDB 5JW4Q 1F00I 1FNFA 4NNPL 3PWUA 3UAAA 3D50A 4FKKA 1HEZA 2DQEL 5KJ4A 3G5YB 3GMMA 1MCLA 2O72A 5AVTB 3CQPA 2BVYA 2CHXA 5GS2D 4CJ1A 5HVHC 2ADJB 2WLMA 4MMYB 4DO5A 1AQKH 3MRLA 4LARH 4PMEA 3WNLA 3UC2A 4JFTA 4PWHA 3CFDB 1G43A 2I7SA 4X4ZA 4N0CC 3WTVA 1CYWA 2Y7QB 5HHMB 3AXHA 5D1XB 4DGIL 3L2MA 4MA3A 3T3PB 5D2LB 1UA6H 2C3XA 4S0HA 1T3FA 3OTTA 1WS7A 3RB5A 1KJMB 3TTYA 2ESVA 5I16B 3F83A 4QNPE 1O75A 2V7HB 2DMHA 3GMOA 1KTLB 4U4BA 1CDHA 1MLCA 3UJIL 3IU4H 4XNDA 4LOUC 3PV6B 3I75A 2R69A 3SDXA 2CNZA 4XNXH 4HKJB 3O9WD 5FGRA 4RA3A 1U8CB 3BESR 4UM9D 1EHLH 1A6VH 2F61A 4A2FA 3FH5A 3LMJH 1UZGA 4JO4H 4N9GA 4B3EA 5D1ZI 3GPEA 1G7MB 5CO1A 5DZOA 3VWKB 2FQFA 3KPSA 1EO8H 1R3KB 2PF6A 5FLUA 4N8VA 3ZIYA 1X9UA 5BQ7A 2MOGA 2YMTA 5HGHB 5E24E 3L6FB 4EIZC 1NUNB 4X80H 1IAIM 2ZOLB 4MB1A 1T5XA 3EFFA 5KZCB 4U1HB 4OD1H 3MA7A 5CSZA 2XVKA 2IBGA 5EUOB 4QRUA 5D1XE 1GIGH 2CIKA 1ZGLP 1KGWA 1YEFH 1N3NB 1Z3GL 4NQCA 5D2LE 3T3PE 3RKDC 1QA9A 2D03H 4YS4A 2VXSH 3RTQC 2OYPA 3A6CH 1AHMA 4NKOB 3MZTA 4B9ZA 3QUZC 3H1ZA 5HYSA 3BZEA 4W9EC 1SLWA 4KZDL 1ZA3A 4KJPC 1H0DB 4FLQA 4G6AD 2HJKB 3BAEL 2R8SL 4OLZL 2VNCA 4WWKB 3T77A 4A7GA 2VW7A 2QDWA 1I8IA 3A67L 4MNGA 2CWRA 1LE9B 4WW1B 5EC1A 2YWZA 4D8PB 1A1MA 2N0KA 4BK8A 1IKNA 4WW2A 1DO5A 1K2DB 1S7VB 1U95A 3T0EC 3SJVD 4L0ZA 2XV6B 4HXAL 3W9EA 3KD4A 4AW4A 3SDAA 5C0NC 3R4DA 4LEXL 1NANI 4BFRA 3QXWA 1J1XL 1I1AC 1W0WA 3FRPG 3II3A 3LZOA 3NPSB 4NRXB 4KJQD 4Z95H 4L2LA 1HHGB 3D3VD 3JXAA 2BVOB 4Y5VC 4AJVA 4YFEA 3M17B 4Y9GA 3SOBH 5F9AC 4KNTA 1UENA 5J6GB 2Z91B 2NZ9C 5C1MB 2V2TB 4K94H 2JK5A 5LXGL 2VIRA 5EUOE 2UZIL 4U3SB 2VXUL 2J73A 1DLHB 2L8AA 1OPGL 3GSNH 3GT6A 1LMIA 4HUXB 1H3XA 4CDHA 3ARZA 1OHZA 3DMMD 2F68X 2NNRA 3VXMD 3BEWA 3DGDA 2BNRD 2ZWSA 3MODL 4J7RA 3DBSA 3EOAB 5DRWA 4UAHA 2L7QA 4XN9A 4WJ5B 4Y16B 4LIQE 5F1IA 4IRJB 1QR1B 4Y9BA 5H37G 3GSVA 1KGIA 4NJAL 3U36A 5A7EA 5FB8B 43CAA 2V37A 3CFEB 4R90L 5I6XB 8PAZA 2FE0A 4F7EA 1CGWA 1F4XL 4KKBC 1KLGA 5ILTL 2HVKB 1RZKC 5AW9B 3ZE2B 1T03L 5A2LH 3GMPA 3V0HA 1V3KA 1Y0LA 4LAQL 3DV4B 3JWDC 5T3XH 4HUUB 4HH9A 1NIAA 3QDMD 5C08B 3D12B 4JDZA 4OZGB 4K23L 5H35A 2OYMA 2WO3B 4GQRA 3OG4B 1LD9A 1KJ2B 1IGTB 5EIIB 3EYVA 4XN8A 3VNZA 4M48H 4ERSH 2MRYA 3KYKH 3QJQB 1TDQA 3ULSB 1TNNA 3GBMH 4NQED 2VDQB 3SY6A 4LE8A 5DJYB 2PCYA 1IAOB 2Y2WA 2YA0A 1NCBL 1GCFA 1U8JB 1IGJA 5CWSB 4DEWA 2X12A 2XN9A 3AQZA 3FB8B 2CK0L 3IFOA 1QABA 3MRJB 1HYRC 3VUAA 2HA1A 5ETUA 1JI2A 5EU4A 4PVBA 3GO1H 2YGNA 4FEMA 3G7TA 1PY0A 3MRGB 1OW0A 4MMXA 3SKMA 1YUHB 1SXNA 1LXMA 4HIHB 4OI8A 2ZKMX 4PJ5D 3ZR5A 1WFIA 5IEKA 4LNRB 4ZMOA 5EBLA 1U3HA 3G08B 5E9AA 4Y19A 3WJJC 1IGML 2ZOUA 4PJIF 2OMZA 2B4CC 1W0VA 3BE1L 4G6MH 3P2DA 3DJTA 2Q9OA 4TL4A 3ARGD 3ULUL 2A9AA 3LZRA 5LCVL 3UFIA 2EE9A 4KK6C 1P6FA 1QEXA 4OZGE 3WNIA 1XB8A 2J6EH 1ZXQA 1TQBB 1X4XA 3IDGA 5F0PB 3CSYA 5E9DB 3SEPA 1YQVL 4BIKA 5IWLA 2NY7L 2PWGA 4X9HA 2OCCB 5AOIA 4KI5C 5LLIC 3V4PA 1JD9A 3A4FA 1XR9B 2BZCA 1AR1C 4JFED 5DJ6B 1GJIA 1NIFA 4JDEB 5AKTA 5SWZD 3FB5A 2R29A 1AI1H 3E6HB 1GOHA 2IAMA 5H2BA 1IC7H 3HA0A 1JF1A 3VB8A 1U8KB 2AVFA 4YBLC 2J88H 4BK5C 1S6NA 2QPSA 1OAYL 2X4RB 3LKPA 2CGYA 4HKZB 4HZLB 4ZPVA 3KDMB 1EZSA 1XD0A 2CR6A 1LO3L 1NPUA 2VWEE 1ORSB 1KBGL 4X5RA 3WDIA 5F1KC 4AY0A 3IGUA 2P8MB 1XCWA 3EYQD 1Q0XH 1E67A 1YCSA 4WUUB 3P4NB 4N26A 2MSPA 3GKWL 3MRFA 4L18A 3BGFB 4IS6B 3SCMA 4XWOC 1UM4H 1XH3B 2ZOKB 2ENYA 2YBGA 1R5VB 2D0GA 2C26A 1RPKA 1S78C 2YBRA 5MENB 4R5VA 3ETTA 1O6VA 2AJ3A 3LRSA 3WFEL 2MKWA 4ZUUB 1ZGLM 4D0BB 5FHBL 3H9HA 4J1UA 4IBVA 1FNLA 1FNEA 4UT9A 2CPCA 1UB6A 3BSZL 5E99L 2VERA 3FO1A 5D7JD 3FT1A 1RQ5A 2PTTA 3LV3A 4YSQA 4ZUVA 2Y1VA 1SF3A 2ZWZA 4MDRA 3CMGA 2E27L 3WO4C 1HCVA 1B9ZA 5E8EA 3MRIB 5JO5B 5G5DB 5DJCB 2DM3A 3V9FA 4ELMF 5IESL 1TTUA 1TQWA 3CHPA 3S5LG 2NTFA 2XICA 4CILA 3ULVF 1OPOA 4GRWB 1ETJA 1XO8A 3I2CL 5ERWB 4GRLC 1GC1L 1F4YH 1ONQB 3A4EA 3UO1H 1PAMA 3APMA 3DETC 4HHWA 1A6AB 3HKZA 4HJGB 1KTDA 1WH0A 2UVFA 3V4UH 3I85A 2O93L 2E9JA 4W1TA 1FL3B 4LDCA 4KZ0A 4I88A 3BP4A 2E7MA 1KNOA 5HHOD 5F7MC 3L13A 5IB3A 1MFCL 3IF1A 1J9SA 1I9RH 1EFQA 1SN2A 2ZT9C 3VW3L 1A21A 1KN2H 2DLFL 4V33A 3KLAA 2XBZA 3OKKA 1KCKA 2BHZA 1T7VA 4P07A 4KXZH 3VGEA 6FABL 2RQ8A 4Z78A 4YHPA 4BKLB 4JHVA 1HXKA 5DFVD 2WNKA 3CXHJ 4Z5RB 5L2JB 3L54A 4PJCF 1NGWB 5DO8A 3J27A 3C6SA 3E2HB 1ZJBA 3B9VA 4HAFA 4K3GA 3STZB 4F27A 2K1MA 4HS8L 1GYVA 4ZOCA 5GGVH 5DZNA 2QVMA 3U4AA 3FO2B 2X5PA 3QO1A 1M6UA 2DYSB 2VZSA 1CZ8L 3S36H 3QPQC 1C5BH 4HEME 3MOAL 1JNLL 3FQ4A 4F9PC 5I6LA 5IVXE 4DW2L 4L3AA 1NCTA 4L4TB 3B7TA 3SDXF 1EA9C 4R3SB 25C8L 4U6XB 3W2DH 4KO9A 2P24B 1NFIB 4WTXA 2ZCLH 3DX9A 4NC0B 1LQSR 4NO0B 2KLSA 4WHTB 1IC1A 4JN1H 3TASA 3ZOAA 1W72A 1IILE 4YDVA 5DHVH 3VD7A 5DJ2A 5EO0B 4E41E 2Z8WC 4Z3GA 3IGAB 1INQB 3D39D 2JSFA 1EERB 2H0FA 2FLMA 3L1FA 2X4SA 2R2EA 1F56A 4U1KA 2E6PA 5J89A 2A9DA 2BP0B 2FB4L 2Z7WA 2MCG1 3SE9H 3U7WH 4J3OG 1CFQB 1R19A 3EBIA 4H8VA 1VA9A 5D1XC 4DP1X 4LRIA 1ZHKA 5AAWA 1FV1B 2BIQA 3Q6GH 4LVHC 4NQQA 3LZFL 4Q6IA 4A66A 5J1AB 1ZK5A 4B5EA 3L4YA 4MX7B 4GLRI 4O02L 5EO1A 4L4TE 1CTNA 4GIOA 1UQSB 4OIAA 2EECA 2IJ0C 2Q6WA 1AQ8A 5EUKA 2DPKA 2ZSVA 1O9VA 5INCA 1T5WA 2Y36L 3GWJA 4H8WH 5I5RA 5I8OH 5BJTA 2VGLM 1UYWL 2Z9TA 2BRQA 4KXZI 3HC3L 1S7XA 1EBPA 3CJJA 3EDDA 4Z7QE 1XGQA 3T6QC 3V0VA 1CDIA 2AQ1A 3KWUA 3ROOA 4NRYA 3DTDA 3VQ2C 2BOBA 4NM4H 3EXJA 3B7UX 4DFIA 2LV4A 5H94B 5FWQA 1Y18B 5DO2D 3FTXA 2X87A 1PY4A 4MNQA 2DEWX 1E8YA 1Z32X 5IT2H 4ONFL 1T0NB 4IKJA 2JB6A 4WK4B 3N43B 3QG6A 3OHXA 1GGUA 4AKQA 1Q8MA 5E6ID 2R23B 4HDIA 1JFQL 1QNZL 3FTSA 1J05B 1S5HA 2RQEA 3LH8A 2DY2A 3MFFA 1S9XB 3QIWA 4ZOEA 2DWDB 4LQFH 4U1JB 1IAKB 4WY7L 4HA1A 1EV2E 1KXHA 4NN6C 5FCUH 3ZKMD 4YDLC 1VFBB 4P57B 3CZGA 3QJHB 4M5SA 4AGLA 1WIPA 3KXFA 3GMLA 1EUUA 5JPNB 2FQEA 3WFCL 5ICYB 1SJMA 1DVSA 4FTDA 2MQ0A 3FT3B 4L37A 4R2GD 1C7TA 1I9JH 4K3DH 1OAQH 2EIZB 4BBWA 1L9RA 4UV7L 3EYFB 4G9DA 1G9EA 4JFDE 1KYAA 1DFXA 1XD1A 2C7FA 3H9SB 1SXZA 4GW5A 5L7XH 1M42A 4YUEH 4XNAA 5LQBH 2WAQA 2HXAA 4C56A 2VR9A 3U6RB 1IC4L 4L3FA 4LGPB 1UGNA 5C71A 5INDB 2MHAB 1KCUH 5EB9A 1TFPA 3B2VL 2VN7A 4MMZC 1JXFA 2TRHA 5C86A 1CK0H 3LN4B 1WA1X 1XSIA 4NI6A 1I7UA 1S7QA 5AZ2L 3MNWA 1LEKA 4BFJA 4GO8A 1E50A 1AHWA 4HLJA 2PCXA 5KANG 1MOEA 1WAAA 4WV1A 4IRSA 1AO7B 1TOXA 2F5AL 4GW1A 4P23A 1NC2D 1Y6KR 4BA0A 4P4RB 1YY8B 4AEEA 4M6OH 1A66A 2YA2A 1C08B 4EN2A 5DJAA 2ITDB 4KO6A 4RMRA 1CFNB 4HS6A 3OZ9L 4KTGA 4L23A 2XBDA 4JPKH 4G7VL 3V6ZB 3EZ8A 2ZXEB 2EINB 3J2PA 3QFDA 3VFOB 4JFOA 4XWGH 5DJXB 2WINB 4F37F 4YX2H 2FEEL 4P2OB 1XV8A 4B0MM 5T1KA 3QARA 5F3BB 4U1IB 3H9SE 2BCKB 4KH2A 4FFYL 4ZMTA 5JDSA 4BDVB 2VLLA 4LU5H 2JCWA 5GGUA 1V54B 2OXGB 2YIHA 3PRZA 3W38A 3MUHL 4OCNC 4X6CE 5AENA 1F11A 3GMNB 2JJVA 2WZ0A 2BNUB 3FQXB 4MB4A 4OGQC 4XBPA 5TQ0L 4EJ1C 4HOMA 1Q1JL 2GTQA 2V7NA 1EGJL 2Q76A 3LS4L 5GRXG 4BD4A 1WFNA 2BZDA 4YPGA 2UX6A 2V4LA 2X53A 4FS0A 2DWEA 3C12A 5HYEA 1RZPA 5E4IA 3QUKB 1K8DA 1IJNA 3AG2B 1F4WH 4N24A 4ZS7L 3K0YA 1E8XA 4GUPA 4A63A 2ZP8A 4PV8A 3Q5OA 2YD8A 3MRMA 4TTDC 1UM5H 2WBXA 3OKYA 3WY3A 4BZYA 2X42A 4RISL 5D7KE 5EO9A 3NFNB 1UACL 5FK9B 1XXFC 5CEYA 3UROR 4CSZA 1WQVT 3QNXB 4M03A 4RFOL 1P4IH 1CU4L 5EF2A 2GK0B 1NM9A 3O3EA 4PBDA 4XZ4A 3B2PA 3DX2A 4MRCA 2Y5QA 4AK1A 1GPOL 4TLKA 4OQTL 2FJHB 4HC1A 5CCJA 4P2RA 1KXQA 4ACPA 3CVIH 2QLVB 3I3DA 2KKQA 3QDAA 4OLVH 2MMXA 1OSZA 1H8SA 2I60H 3GB7A 2JKWA 3LNFA 4P48A 3ZHLA 2QVFB 1UEMA 3CDZA 4Y4KA 3INOA 5L88H 3D7PA 2I5YH 1EFXD 3KH4A 2Y5TA 4FADA 4M6NL 2HLAB 4U6VL 3SKNB 5EF3A 3U1QA 2MNWA 2R69H 3REWA 4APQA 3DVFA 4P3CL 5B38A 5SWQA 2QTEA 3KPQA 1R0AH 1E0OB 3LZNA 2WVTA 5D7LD 1ND0A 1YDPA 1J11A 3HNTH 2W0PA 1JZ3A 3D69A 3G5WA 1XGTA 2H6UA 1KENH 1U8MA 3B9DA 4I2XA 2YARA 1MREL 2X70B 4HJTA 2CRIA 2V9QA 5JXEA 2C4FU 4OLYL 2FSDA 4D2NA 4GSUA 4TSAL 4WI3A 2HTLD 1V3JA 5C0CB 3QQ4B 3L3KB 2RIKA 4WFEE 4J28A 5CN1A 4QRSB 5ABDE 1IC5H 5HI3C 2QHLA 4R0LC 3K71B 3C5ZA 4GKZB 3NCJH 5JIMA 3V52L 4AYEC 3MLXH 2BWQA 3GBNL 4Q2ZA 4PJDA 1CL7H 3BKYH 3QS3A 3IU3A 2WZ6A 4DN4H 4ZAKC 4TNWF 1WEJL 3PJSB 1OCWL 2VZ1A 2NDFA 4YMPA 4ZYKA 3R06A 4YGVB 4PCYA 1I53A 1ZS8A 4N2EA 1T80A 5LAXB 4XVTL 3IRCA 3HBQA 2V9TA 3CH1B 1JPFB 1M2VB 2YAFA 1A6ZB 4KXCA 1RUPH 2Y6TE 2DQGL 2BVPB 3B7SA 5FGBC 2WQAA 4NQTA 1M1XA 1OAZL 1JBJA 2OTWB 5D8JH 1FLTX 3T8MA 3W39A 1U3YA 4ONGH 5F9DC 2X4OB 4OCLC 2EUZA 1P7KA 1U92A 2AEPH 5C07B 4H1LG 1CPUA 2WLJA 4JRXE 2BSSA 4W9CC 2H1LM 4BFOA 3GM8A 1L9PA 2BIOA 2JKNA 4UU9A 2OK0H 3MJ7B 2H32A 1N67A 4P2AA 1NAML 1ZT4B 4QTHA 5I1KH 3HRZC 4XBEL 3MV9A 4JJ5B 4NSKB 4HSAC 1S7TB 1P5VA 4Z7WF 1X7QB 4M6MH 3RJOA 1FVDA 1JJUA 4HPOL 4XP9H 4ANUA 1I82A 1I1YA 3US0A 4ZW8A 2R4RH 4E9LA 4DK3A 2NYKA 2LLGA 2V2WA 4XNQA 3VFPB 3QJFA 2O6PA 4J8QA 5FO9A 4W9DC 1FZKB 2AABL 1K72A 2F7PA 1JUFA 4PS3A 3IGFA 4OLEA 2XFXB 2ISDA 1MCWW 4PRHB 1NCNA 4Y1SA 4FQXD 2I9TA 2H3XC 1B0RB 4JPVL 4N28A 1BOYA 4WEEA 3R8QA 1UEYA 2CZNA 3KMDA 4ZSOB 3VCLA 4UI2A 3V5DB 1MCPH 1HHIB 5HXMA 3O45A 1N8OE 5DRNA 2AV1A 1CTOA 1F58L 4TNEA 4FXKC 4MD5B 1DBML 3N42F 5IB5B 3E2HC 1NLBL 2GC4C 4FZEL 2VLJD 3EHBB 2Y2YA 5JQIB 3ZRCC 3MJWA 4NDMA 2J2ZA 3EYSH 2BDNH 2WQXA 2OYKA 3MV7D 4A04A 4XMLL 1FJ1B 4HUVA 1A3LL 4OCWL 4IBZA 1LVEA 2DH3A 3NCYP 4ODTH 3DTXB 3ESMA 3W0WB 3SO3C 4XVUD 1EJOL 4JEGB 3MBEA 4JFZL 3C87A 4N5ED 4JMXA 1XZWA 3VFWB 2C3GA 3HNSL 2H1PL 5BRZB 1FF5A 3HMXA 4C4BA 3WU1A 3MLTA 1DBKH 3L1OH 4FA7B 1JDCA 2NMSA 3ZRSA 3UYRL 1Y7VA 1D6EB 2P5WD 4O02B 5F7DB 1E8WA 1JWSB 3IJYB 2PXYD 5HHNB 4NQXA 4FNLH 1LEGB 4KUCF 4L3EA 3V6FA 5KYYA 3RX7A 2EIJB 4PJGB 5AYUL 2QKIB 3PWNA 4N86A 2YN5A 4NWTL 3WD5H 3EFOA 2JIXD 4F7PA 5JHLA 3TN0B 3L17A 2D4DA 3TBBA 1LP9B 4GI9A 1RZ7L 4M5ZL 3P3SA 4HW6A 1U2HA 2JKRM 3QCTH 1R47A 1IVTA 1QRND 5AW0B 1UA3A 4MJIB 5GGRA 1QFUL 1UWYA 4Q52A 3ASWA 3ZT5A 4OCRL 2A9ML 5BV7L 5JHDD 2LVEA 2EUXA 4Q9RH 5IB2B 4PCTA 5TDOB 1CB4A 2JF1A 2VO8A 4RH4A 5DYOA 1HIMH 3UTSE 3W1ZA 5I30L 1SJEB 1YMME 5HY9A 2N7AA 3OJDA 4FNPA 2FZ3B 4GFXA 4JG1L 3V4PH 1IGYB 1DDTA 5AG8A 4DVBA 4RAVB 1A1NB 1REIA 1YYLL 4G7YH 4Q6YA 1XH1A 5C8JB 3HZ3A 2KZBA 1MVFA 2R29H 4OF8A 4LGRB 1IKFH 4HPYL 2NLJA 1J1PL 2FWLB 4R4NC 4WHCA 4HKXB 2BOCB 1KCSH 1CFMA 4P5MB 4WNQB 2DLGA 1U4EA 5B21A 1XEUA 4UNUA 1UJ3A 3ARDA 3RZCC 5JTWA 1LWRA 2RH0A 1FYTA 1A3QA 1KBWA 1M71B 4PJXA 5DHYA 5AW4B 2Z6FA 3BUDA 4WEBH 4R83A 4JE4B 5E8PA 3HPLA 4LCCB 3ATFA 3ZE2F 3QEHB 4GJTB 5L8KB 1SM3H 4MJ5B 5DWUL 4WFGD 2C9PA 1KV3A 3IYLW 4N1EA 1E5CA 2EILB 3RBSA 2DV6A 4DERA 2BIPA 4FD0A 5HJ3B 3TT1H 2WWMD 1BWWA 2BMKA 2VTFA 5EZLB 1OO2A 1QBMH 2NXZB 3FUJA 3OKOA 1WSST 4RRPA 1EEYA 1A1OB 1QW9A 1P5UA 3KNBA 3SQBB 3VQMA 3ZUCA 4ZMYA 3NCMA 3ZO0A 4PJHE 3WTYA 2R27A 1QNIA 2QBWA 3PHOA 1AC6A 2DBLL 4MD4B 4ADGA 2UZYB 2R59A 4KX9A 2GSMB 4H5SB 5J4MA 4LKCA 4UT9H 1J12A 3UCRA 2YXMA 2DQMA 5AVRB 4UDUB 2FATH 3EBHA 1SJVA 3OL2A 5I5JA 1GGCL 4GKOA 3X12B 1L6XA 5DD0H 1A14H 2A77H 3GJFB 3HHMA 5D5MF 2WKLA 3WOVA 4ANXA 5J1SC 2XN1A 1IAIH 4X8CA 3O6ML 5I66B 2H8PB 2NOYA 3B1TA 3H4HA 5IHUL 4Q97A 3KPPB 1EO7A 4DPBX 3ARUA 5J3HC 4EUPB 3GXPA 4PJBA 5KSUA 5GS0H 3CFIC 2EDMA 3LEVL 3DIDA 5F7AA 2X88A 4CSPA 3O41A 4XXCC 2G0LA 2H2SD 2WJ5A 3L9BA 4PV1C 1T04B 4JQVC 4GXUN 4P4KA 4XPGL 2DMBA 2JJTA 4R8WH 1PZ2A 2ZUXA 4KMTH 5C2UB 1K4DA 3BPLC 4KHTH 4WI0B 4ZJ9A 1P6WA 3HG1E 1B2WL 1GH7A 1JV2A 1I8KB 4ONHA 3BRDA 2AJXL 2NR6D 2X89A 4GSDH 1WISA 2G2RA 3DVGA 4KOBA 4AMKH 4KITB 1FFNA 4F9LA 5CD3A 5KJRL 3AU0A 3HZVB 4BCXA 1IEHA 1FNSL 4J6RL 4HZ1A 1IEBB 4KQ3H 4DH2A 3KLKA 2E3VA 4K15A 1E5ZA 1ECZA 5AVQB 3BRGC 4PP1D 2NY2D 5DD1L 4Y2NA 1FL5A 4ODWB 4A7SA 2IDQA 3QQ9D 3UP6A 1IFGA 2ZXDA 3QRGH 5GRVL 2C1OB 4G80A 4KQ4H 2WD0A 4OT1L 5IGXH 4XPBH 3P4MB 3C9NA 1ROCA 4H20H 3U46A 1SHXA 3WJMB 5F89A 3OF6D 4NFCA 3KLDA 4KKLD 2YD5A 2OQJA 1MCEA 2AXGA 1KPRA 4IW4C 4HUNB 4DQAA 2SEBB 3DJSA 4DZ8B 2OMBA 5BZWA 4CRPA 2YFNA 5EC2A 2J1WA 2HLFD 1PEWA 3ZL4L 3D9AL 3S35L 1BJMA 4HMEA 4CADB 3S8GB 4OTXH 1ZT1B 5CCGE 4L0YA 2R2HA 3MV01 2DWXA 5KYWB 2FL5B 2G9HB 2GUOB 3OWRA 1PKOA 4NLAA 1G9MC 3U2SB 4GQQA 5IJVA 1RLWA 1W72H 1IAII 5T1JA 4CSTA 3WNOA 1U8OB 1BVKB 3KJ6L 3DO7B 5AAPA 4QRTA 4KK5D 4L1TA 1VFAA 2M26A 1RP9A 1SLVA 3F58H 3TWYA 4NPYB 1NC4D 3NIDB 5C2BH 3MBXH 4QO1B 2BXYA 3VSTA 2L7JA 3PIQA 3SDDA 2NX5D 4FI7A 3RBGA 1HL4A 3EGXA 4H8UA 5ITBL 1RK0B 1RZJH 4X5QA 2Z92B 4X5PA 5D2NB 3RVUC 3RNKB 1A8ZA 4LSTH 4AQAA 5JA9A 3IGKA 5EOCH 4LASL 3KW8A 3SJVB 3PXLA 2X09A 2IFFL 4EI5C 2XJLA 1RUQH 2N7BA 3RX9A 3WAKA 1QASA 2F19H 3HB3C 3PGDA 5FYJU 3KLHC 3WN5B 3EO1A 4LCIH 4JANA 1DJIA 3GJFK 2G5UA 4XAKE 1FGNL 1UT1A 3DROA 2WUCL 4PWIA 2D9QB 1HCYA 4FLSA 1F2QA 4YO0A 1FE8H 4YGAB 3G6JB 3ZQXA 4E42B 1PQZA 3HUJA 3PWPD 3WFDL 5ANMA 5B1JC 3ZL2A 4FI6A 3II1A 3U4BL 4YE4L 5CD5D 5LGKA 4LLMB 1XF4A 3ARBA 2XWBA 2EIDA 1I8MA 3DMMB 1YJDL 4PJEB 4L4VE 4P5TD 4JO1L 5AW5B 4TL5A 15C8H 3S3DB 2BNRB 1AAJA 2R1XA 5IROD 1NDTA 4OV5B 2VDRL 4IRZL 2IWGA 2W91A 2FSEB 1FFPA 4KVCL 4K55A 3FFOA 1HSAA 1E9OA 1EEUA 1RERA 4LLDA 3VM5A 1NPJA 2MCAA 3WENA 3VJ6A 5I0WA 4JM2D 1C5DA 1VDGA 1P1VA 3VXUA 5DK0B 5KVGH 3ZZLA 4LF3B 2V17L 3OKNA 4Z7OF 2K8MA 1CVRA 1NCCH 2XOTA 4GAAA 4HGWA 1NAMB 2YC1B 3PWVA 4P9MH 1MCIA 4TMPA 2DM4A 4G5ZH 1CXHA 3UADA 3VTTA 3R18A 4ODVH 3VXSA 3FJTA 2KT6A 4QTIH 4K8RC 3SGDH 2CBOA 5EZJA 4OAWB 3QDMB 5HPOA 4FFVD 2EVFA 4UB0H 2QQNL 1QFHA 2X4UA 3LPOA 1JZ4A 2EXYD 4PV9B 2IPKB 4PJEE 2DD8L 4KBPA 4RGOH 1OAXH 3I6GA 3TVMC 2XIIA 3CPLB 4FFWC 3WGVB 3GK8L 3N44B 1QFWL 5B4MC 1DSFL 3LZLA 4IJTA 3KYMB 4NQEB 3H42H 1IQWL 3TO4C 2CR3A 3NGBB 5IHZA 3ARWA 1VF5C 1I7ZB 4S1SH 1YAIA 4HIQA 3WHE1 4ZQTA 2N0MA 1AMXA 3OB0H 2YAOA 4O51A 1IBBA 4XE5B 4XMPH 3D07A 4QDGA 2JTYA 2IO5A 1VADA 2FECI 1S7SB 1AKJB 1BVOA 4I3GA 3NRQA 4PJ5B 2O61A 3FQUB 1U93B 3MROB 5KVFE 3C5SB 4KAQH 4U31A 4BA8A 4X99B 5KYUB 1WF5A 4C4KT 1A02N 3F6LA 5FDWA 3C75A 3L9RB 3ARGB 3EYUH 5FF6B 3FSWA 3BW9A 3MO1A 3OLEA 3NCXA 3FHQA 5J57B 2VLME 3AT0A 4NCC2 3QNFA 4MLIA 4KTDL 4UILH 4CN1A 3FHEA 5I0YA 3QQDB 4N0FB 1IIIA 5I0XA 4ZFFA 4HEPA 2HMIC 3SBRA 3G5VA 3EH3B 1QSFA 4DKEH 1UADC 1MJ7H 3S5YA 1NKGA 2CXGA 4Y5YA 1OE3A 4AYFA 4HUMB 4JFEB 4DKFH 2WXGA 4IGBB 4R7DA 4ZQKA 3TBTB 4FMFA 2XVGA 4XP1L 3VD9A 2ALWA 3AUVA 5FO7A 1WBYA 3VXNA 1CXKA 2CU9A 5I6OA 1JV5A 1XGYL 5T3XE 5FOBB 4LHJB 4N0RA 3SN6N 1YRKA 1F90L 2HG0A 2HUEA 4Y2DD 4LFHG 4X7CC 5BOZG 3SGDI 3ZKQD 2OSLB 4WTQA 1VFUA 4JJOA 3MLSL 4XC3H 1LO2L 1XGPA 5KSAA 4Q6KA 5IV2B 2QQKL 5BV7B 1RHHA 2F53E 4YSTA 4M9PA 4M3KB 2X2IA 1WA0X 2OJZH 5I1JL 5KVDE 1P4LB 5BUAA 4BH8B 4M4RB 3P4LA 2P28B 2F5BL 2GIXA 1A3ZA 2HRLA 4X9IA 1MI5A 2P26A 4LSQL 4PRNB 2BSEA 2EXWD 2H3NB 4HC1H 1S7WA 1OF2A 1G4MA 1BXUA 3WSQH 3BN9D 1KFAH 2QR0A 1HH6B 1DBBL 4A6YL 1QLFB 2IGFH 3CMOL 2HVJB 2BZ7A 1ZLUH 4WTZG 2NY5H 1V8HA 1QSZA 4CU7A 5D7JB 5FPIA 4QHMA 4DPCX 2VW6A 3GIZH 1ODUA 4H0LC 3QG7L 2L3BA 1XSOA 3OR6A 1GHFL 3NSJA 4FLRA 3HI5L 4F15B 3DJ9A 1Q0EA 5KAQF 1KGCE 3HZKA 4MZIA 2HYMA 3PAYA 2H3KA 4OM0H 5K93A 4OLWH 1IZKA 3ETBF 3X1BA 2EVHA 2VDML 4NZ8A 2E9BA 3ESVF 3OMNB 5KBKA 2G4GA 4PJFB 4BEIA 2X6CA 1SBSL 5SWSA 1N59B 5HHQB 4UAOB 1L7TL 4GPVA 1NFDA 2QT6A 4HSCX 5HHOB 1VGKB 4HXBL 1UT2A 1BECA 1H3PL 1PX8A 1FH5H 3LH9A 5DD3H 3OAUL 2QV2A 1MPAL 2YMXH 1BQHA 2DQJH 3NACL 4BFFA 2ED7A 4R9HA 4LKXA 4NT6A 3MRDB 1OTTC 1XZ0A 1G94A 3CHQA 1HQRB 1RUMH 4IBWA 4BINA 4NNXA 4AJ0A 3FF7A 4MA8L 4MXVE 4X7TA 5L6YH 4M62H 1EBAA 5CIPB 4PPTA 1NGQL 3LRLA 1EXGA 2W07A 3ZSSA 3ULUF 1F1DA 2COQA 4AVKA 4FP8H 1BF5A 4YHMH 2JFCA 3PGFL 2Y3AA 1HXMA 5T3ZH 3BWUC 4FG6C 3K0WA 3ARQA 1A3RH 1ZANL 4K7PH 3LRMA 3M88A 2G9KA 2PO6C 1U8HB 3IRPX 3I02A 5E95B 5HDBF 4PEEA 2YPLD 1JN6B 3NESA 1UWGH 2NY6D 4YLQT 4BUGA 3LD8B 4G1EA 3GBDA 2H32H 2DQIH 3O8XD 2AK4E 2EKSB 4HSQA 1XR8A 4R7VA 3RJQB 1BP3B 3LOWA 4XX5A 1I1AA 1R24A 1JHTA 3ME0A 4ORZC 4XB7A 4CVZA 4Y5VA 3T0DA 1Q94A 2NW2A 1XT5A 2OR9L 2K70A 4FFZL 1FVCA 3BUYA 5DJ0B 3VG0L 3I74A 3FUKA 1MY7A 1TYRA 1CXLA 2AQ3A 2G2NA 3HC4H 4QI3A 5DQJB 2HG5B 3M45A 4NEHB 4G7QB 5T5NG 5C9KA 3QEQD 2W9LA 4JM4H 4U0RB 3RKPA 3BDYH 4GINA 2FUTA 3D39B 1ZCRA 1IQDA 4F58H 1HN1A 3DURB 4GKNA 4AKPA 1X5LA 1ZLSL 4XN4A 3WNPA 2GVYA 3BQVA 3ATDA 3QUXC 1QUNA 2XKSA 1JHLL 3MGTB 2BOLA 4FULA 1ETZA 2W94A 5KSBB 3D2TA 1JZJA 3MRRB 4GW4B 5E00A 2A0LC 1UXWA 4QXGH 3TNMA 4WZ9A 2ZG2A 3HR5A 1AE6L 4M8QB 2GJZB 3S5LB 4FQJH 5E0FA 3JTTB 2EYSB 1PIFA 4LLAA 4DGYL 2BVEA 4WF7A 4NZTH 4WVRA 5E6SB 3NZSA 5J6SA 3EO0A 1SRDA 1CN4A 2YGPA 4YEEA 1YN7A 2V0AA 1TUPA 2WW8A 3RWEA 1PZ5B 3SPIA 7CGTA 3WXVH 5J9PA 3ZVVA 3WFZA 2A6IA 4LGSB 2OMXA 4Y1AE 1ORQB 4KK8C 1JZGA 1A4BA 4XI5D 3IFNL 3RVWC 3TBYA 3VO0A 1UASA 4AYDC 4L8SB 2JCCA 4MQXD 2WMPA 3KL0A 1AGFA 1TJIL 1A7PH 4MJHA 2AJSL 2X9YA 5CZVH 3HMXH 9CGTA 4WFFD 1DL7L 4UT6A 5E4OA 1GYWA 5F7WC 4G5AA 4BE5A 2E7LC 2Y23A 1AGEB 1SEBA 2D7PA 1T22A 3ATAA 4LL4A 5KSBE 4Z7NF 4BWUA 4NGHL 3R7QA 3QS2A 1QBLL 2YO3A 3DGGA 1DLFH 3QXDB 3K8LA 3TWCH 3UL4A 4ZXBD 5JHLH 4P5RA 3BCDA 1U4FA 5HHPA 3Q6FA 4WK0B 2WXJA 5A2JH 2E5EA 4G9FA 4HG4J 4X9GA 2B3IA 2ZWKA 1RIHH 2VQUA 1ES0B 2DQHL 5FFGA 3QR2A 3PGCB 2ZE0A 1CLOH 1WC7A 2IWEA 3P11H 4QOKE 4MDIA 2MJWA 3WJJA 1TZGL 2O5YH 4NQDA 2YQ2A 1CI3M 2J4WL 4U1MA 2FR4B 2H4EA 3A4DA 3KS0H 2X7LB 5DUPH 3BISA 5ICXB 4PVLA 1YMHB 4GT0A 3F7RA 4BWTA 3MLUL 5KN5B 2NW3A 4R2GB 1FVEB 1NMBL 1XCXA 3BPNC 3IKCB 4F33B 3K5RA 5J12C 3GLAA 3ZMEA 3GPSA 5IHWA 3RVVC 4X4MA 3IDJB 3CK0H 5ISZD 2VDRB 4KROD 3UDWC 4JRFA 2UWEF 2QELA 3V4VL 4LDEB 3FUNA 3BPCA 1WO2A 3FOLA 2W60A 5E6ZA 5C3TA 3DVIA 3ZL1A 4AT6A 5J6HA 4G8EA 3IDYB 3MUZ1 4OZFA 2YRLA 4PS4L 3VI3A 1A22B 4LEBA 3QIBD 3MACH 1KTKE 4J3XA 3JQOB 4EZJA 5JUEH 4DJMA 2FIRT 4BK5A 3T0AA 4NKIH 1HILA 1A5FH 1BQSA 1N4XH 2VUOA 3RA7H 4H8HA 4E9QA 1NC2B 1PYWA 4L3CA 4Y4FA 1YHPA 1FO0L 4E9TA 1V5JA 4HX1A 1ESOA 2B0SL 3P54A 2OR8A 2IH3A 1MY5A 1XB6A 2H6OA 4JREB 3MRNA 4NHCH 1FN4A 3D48R 1WFMA 4Q56A 1KYOJ 3P77A 3KYOB 2HJFA 3T8XA 1MRFH 3V2AR 3CBRA 2B1HH 3QQ3A 2WQ8A 2VLRA 3X3GH 1FL6A 3RWGB 3DUUA 4AM0A 4MLSA 1D5XA 2IXQB 4MD0A 2B2XH 4YSEA 2ORBL 3QGVA 4MAYD 5TTRA 5D9SB 1WUZA 2W8CA 5EHFA 4L1LA 1Z5YD 3QUMA 2CA4A 2KMWA 2I24N 4MQSB 5DGRA 5ACLA 1QP1A 2HKAA 3LNIA 3LS5H 3GSXB 4HHAB 1D5IH 1PX3A 1CD0A 1IGFL 1CLZL 2GJRA 4N25A 1LP9F 1TETH 5MEQA 4FLHA 3IJ8A 4QEGA 4ZX3A 3S5ZA 3Q05A 1RZGB 1OP4A 1RVFL 1ZHBA 1CD1A 3D0VA 3KEHA 3NABH 3CN3A 3FQRB 3TZVA 4JFQA 4NN7B 2Z31D 3GNML 3H4FA 4R7NB 3ASNB 4X6DA 3TIDA 4OUOA 2EDFA 3NIGB 3EJQA 3MJ9A 2X4NB 1JXKA 5GIRA 5CINH 1ACYL 3S96A 3DUSB 1N0XH 4K7FA 5I18L 3SQOH 2MCMA 1CDGA 3L4UA 3HE7C 2YK1H 4KTEL 2D7TH 3B9AA 1T21B 3QZPA 2FT6A 2ZPKL 3MXVH 1WD9A 1IBFA 1WZ1H 2CHWA 2GBAA 2XRAH 2XTJE 4P9HH 2E74C 4LP4A 2AITA 4F57L 2FGZA 3RVXC 2AQ2A 1DN0B 4PB0L 2EQDA 3LEYH 2KH2B 3TURA 3FCSB 3NTCH 4XP6L 1UCBH 5F88B 1AZCA 3T4AC 3TH4T 1E6OH 4RDBA 1LO0H 4HD5A 3RY4A 2AC0A 3KHOA 1EFXB 2WSDA 4OCYL 1EX0A 2VXTH 5IY5B 3ZHDA 3WTWA 4QRPE 4F7MA 4YHIA 3ZRFC 4H2CA 1E27B 3JVFC 1WIOA 3E9TA 3NIGE 4IGBC 4I85A 5D7LB 4WI6A 1AANA 1IBGL 4XPFL 5DJ8A 4HJ0D 3K72A 1NCWH 1RZ8A 3GJEB 4F9PA 4W4OC 4HP5A 2A83A 3GEFA 5JR1L 2OSYA 3O6FA 5E1QA 2WAHA 1LE5A 1LDPH 3CFKA 4HFUH 4NOFA 3VGHA 4A6YB 5DF0A 1O6SA 5BV7C 1OM3H 4FQIL 3LJ3A 2A99A 1JPGA 2ARJB 3FFDA 3X14B 1CFVH 1CXEA 1AP2B 4QKXB 2VN6A 3ZMNA 4WRLA 5I1HL 3G5YA 1G7PA 1PSKH 1OE1A 3L5JA 1BYOA 5I23A 5T33H 3HAEA 3CDGB 1FPTH 1AHKA 3ECQA 1SDDA 2G60H 2WLNA 3CU7A 3RDTD 1DQJB 2XWEA 4TOYH 2ILLA 2VDLL 2VDMB 1ML0A 4PJ9D 3CFDA 5IFJA 3PDOB 5DS8A 4Z1PA 5JORB 4UWQB 1K6QH 5GXBB 2HN7B 1CDYA 3ZKND 1HCFX 5HSFA 5D1XA 4FQLL 4LHUD 3VFUB 4FQHB 5D2LA 1AD9B 4MCZB 1KPVA 1B88A 1ROWA 4YSUA 4LSUH 1GZPB 1PLBA 4M3JA 2H0PA 1KJMA 3N85L 3U0TB 4DESA 4NKQB 3I9PA 4G8GB 3K7UA 5I16A 4PGCB 5HYJB 4P3DB 1QKZH 2VQ1B 3QT2A 1KTLA 2ESVE 1FCGA 1Q9OB 4X4XB 2VM9A 5CJQL 1E6JL 3SODB 5L8LB 3K4ZA 4X0NA 4YC2C 4ZMWA 3RU8H 3D1MC 4PU2A 4X8JB 4WGVB 3L16A 1D5BA 1HKFA 1U8CA 1UXSB 2AVGA 5GGRY 4AGQA 4BQ8A 4HJEA 1XFPA 1H6EA 3ML8A 4GAGH 1EO5A 2YOCA 1MHHB 2BY0A 4PLJC 1WE5A 1KF9B 3N6YA 3O0RL 1LGVA 3HI1A 4HWEH 4N2HA 1MIEL 3KBHE 1DVYA 4Z76A 1G7LA 2H9GB 4JY4B 3L6FA 4M7KL 4OGYH 1CE1H 5DHMC 4E0RB 2H26B 2LU5A 2W9DH 4IHOB 5H4ZA 2ZOLA 1R9FA 1BMZA 4U1HA 1A7NL 2P43B 4DFHA 2X1PA 1HI6B 1TTGA 2CJSA 4FQXB 4QYAA 5EUOA 3RGHA 1G7HB 3UBFA 4N2NA 1LTXA 1N3NA 2I27N 3CUPA 4W6XB 4UQ3B 3OR7B 1OIOA 3KL5A 4KZEL 2PWEA 3MRBA 4S1QL 4NQCE 4G8GE 4S10A 2PW1B 1E42A 3L5WB 5SX5H 3TBWB 5HYJE 1XMEB 3VGAB 1N5AA 2VLJB 3HZYB 3CQFA 5F7LB 2P5EB 3LIUA 4LMQE 1RJYB 1VJSA 3TFKC 3U0WL 5D55A 1AD0B 4KK9D 3NQIA 1OSPL 3L5HA 4WW1A 4KKZA 4D8PA 1LE9A 3MV7B 3UX9B 4PJ7F 4AGMA 1MSPA 3MNZA 1K2DA 1NFKA 4C83B 3ECUA 4RZKA 3EO9H 5AALA 3LD8C 3NIDF 4AZ8B 4HOWA 4LOFA 4PSPA 1HKLH 2BFGA 3HBGA 3H3PL 3TS8A 5GQBA 1BDYA 4W81A 5D72L 4DZBA 4XCEA 1U2YA 3RURA 3WEMA 1JHKH 4AGOA 4WSJA 2OXHB 3RB7A 3QZWG 3M17A 3CG8A 3MN8A 4JFFE 3E1ZA 2GT9B 2BIMA 5J6GA 4Z7AA 2Q87A 2V2TA 1MF2L 5C09D 3HS0B 3N06B 4U3SA 4WCYH 3GM0A 3HW7A 2HP4A 3CHSA 3NK4A 4OFQA 4CMMA 2H5UA 1AH1A 2PXYB 4ORGB 1BZQK 4MMZA 1BMWA 2OCJA 4HUXA 4PRID 1E90A 3I50H 5TD4A 1YY9D 4OGAD 3AT8A 4WUKH 2KPWA 5SV3A 4TLSA 2ETWA 2AJZA 4AIOA 2P5EE 5MI0C 4ZK8A 2DBJA 3X1EA 2QSCL 2J8UB 4WJ5A 4PBWD 1QRNB 1QR1A 2APSA 5E1AB 2CDGB 5FB8A 4E9SA 5JHDB 4H1LB 4L05A 1EJ6A 2EE3A 4XCFL 5GZOC 2AQPA 3GUTA 3QHTC 4IU3B 3PLYA 3FFCE 3UC0L 1AGCA 3HE6C 5DURD 2HVKA 2WBJC 1G7JA 5DRXB 3KPLA 1TZOA 1FYHB 3DV4A 1PZUB 4HUUA 4AH2B 2M2DA 4L8SC 3IXAB 2E9WA 4URTB 5FYKH 2B9AA 2WVUA 4F24A 1MNNA 2J5WA 1HZHH 4JG0L 4OZGA 3KHQA 4W4NA 4HK0B 3ET9F 1X4ZA 4MA7H 3O2WL 5EIIA 1IGTA 5D7IF 1FZJB 2O5NA 3BD3A 4RX4D 3DX6B 2A6KB 4OZHE 1N5YH 3TYGL 3ULSA 4KXAA 3WIIH 4FX5A 3IMUA 1OAUH 1G6VK 4NYLA 2WWOA 4R96B 3SB3A 5DJYA 4ZFZA 2H6PB 3VM7A 1A8JH 1IAOA 3E8UL 1BBJA 3UAEA 1SF5A 4KHXH 3Q2NA 5CWSA 2XA8L 1WAEA 3QRFM 2VCOA 2EO9A 4FN0A 1YEJL 4U0QB 2W59A 5DC4B 5FUOH 3O4LD 3GMRA 3WLWC 4CBZA 3MLPA 2C4FT 2A4ZA 3ARED 2XN9E 5E08H 3KYNB 3T3MF 5L8JB 2F54D 3NDZE 4JZJB 2ZG3A 4B95C 1YN6B 5JA8B 3P0YL 3JWOC 1YUHA 4HIHA 3V4VB 4OLUH 3UP1A 1RUAH 2E9IA 1CGSL 4H25A 1KIQB 3G08A 1O5DT 5A3ID 3IETB 5HJBA 1VCAA 1AYRA 3U0PB 1F1AA 4DKAA 5FEBA 5FOJA 1ZE3C 4X6EB 4Y19E 5IM7B 1HFUA 5DD6B 5BCAA 4WI8A 2DL2A 3K6OA 4LSSL 1R3HA 1YJDC 3NCWA 3EG9B 5E6RB 4AEFA 4O9HL 3SOTA 3TA3D 1P4BL 1TKWA 2C7UA 3IGLA 2YR3A 4TQHA 2FUQA 1X5ZA 4FTVE 5AOZA 1A7QH 1R33A 3Q48A 1FO0B 1AQDB 1VIWA 2OMWB 4U33A 1Z5HA 4Z0XB 5IVZB 5DJ6A 4AUYA 3VSVA 4JDEA 4OZIF 4HKBB 3NOIA 5KEZA 4MNHB 1GZHC 4JN2A 2DDQL 3E6HA 4ZPTB 3RWCB 1YEDB 3SKOB 3ULVD 4TSBH 4LARL 4K4KA 4TNVK 4XP5L 2JQMA 3S3PA 2I25N 3PJLA 4XN5A 6CGTA 4JFYB 3ZT7A 4A2EA 1OTUD 2C9SA 2X4QA 3IWUA 1O0VA 5IF0B 2QFRA 4XAWH 4HZLA 4J3OC 2X4RA 4HKZA 4L8BA 3SYOA 4AQOA 4DOHE 3K4DA 2H2PD 4ZMNA 1ORSA 1UA6L 3B9KC 4IOIA 2YSSA 3PP3K 5I5MA 2YAEA 2DI7A 2R56L 3NJHA 5DVMA 4MB5A 2OMVB 4AYID 5MEOA 3QCVL 2DLHA 3VAEA 3UERA 3GHBH 4IS6A 2F1EA 2X3CA 2A4EA 1XH3A 2ZOKA 3A6OA 2JKSA 2EDLA 3RIAF 3UAJA 2PTUA 4Z3JA 5IEHB 3IDMA 3R1GH 2FO4B 4PY7B 5MENA 2XTJC 4EZKA 1TJMA 4YHKL 3HLAA 3C2SA 3D09A 3E0GA 4ZUUA 1HL5A 2VXQL 3RWJB 4D0BA 1A6VL 3IE4A 3LMJL 1HZKA 5D1QE 4WAFA 4L1SA 4M93C 4Q9QL 2ADFL 3IFLL 4FLOA 1T1ZA 4QHNA 1UOLA 5CAYB 4MQ7B 2R1YB 3JV6B 5FGBA 1HSBA 3HBZA 2VN3A 4X80L 3WS3B 3WKML 1W8NA 4P5KB 1D3CA 5G5DA 5DJCA 2ICWA 3WKPA 4D9QE 1OP5K 1RURL 3UJTH 4HAGA 1YEFL 4XNUH 4GP5B 1T1XA 1QFPA 2HT3C 4Y0GA 5ERWA 3U79A 1U21A 2VXSL 1XF5A 1ONQA 4F3FB 3IAPA 1ET8A 3UYOD 1QACA 2FCBA 2ZONA 3NSYA 1A6AA 5T8IA 1SHMA 1IGIH 2CKNA 5HYIA 3I84A 1YNTB 4HEMA 1HH9B 1MIMH 4BFIA 3WY1A 1E40A 4ZUSA 5IVXA 3PDDA 1LWHA 3BUQA 1T0MB 2X9XA 2K7QA 2MPAH 3QR0A 4YIQB 1TTRA 2AXWA 3KPSD 2F8IA 3R0MA 1P9MA 4JDVA 2UZXB 4LPVA 1OAKH 1ZLWH 2XNAA 1RSFA 5HGBA 4N2IA 2GJ6B 2NX5B 4Z3TA 4J5VA 4JAMB 3QWRD 1QI3A 4PJFF 1KEML 1FRGL 3F7YB 4JCWA 1A9EA 5E2UL 2GW5A 3O11B 3F3HA 3OAZK 1MFAH 3FUMA 3PG2A 5DUJA 5DVNA 4Z95L 2ZJSH 3FT9A 5DYFA 4E41A 5KS9B 3ESPA 4NB7A 5MHSD 3ZTJH 1BFOB 2R9HC 1JGEA 3IEAA 4K94L 4Z5RA 1RZKH 1NGWA 2HAZA 4ZRGA 4RSVA 1DE4B 2XG4A 3JWDH 4JO2H 1ZA6B 2WVVB 5CN3A 3RL2A 4I18B 4K9JA 3FO2A 4J3UA 3JWNE 3G5XA 3W11D 1G9HA 2PMZA 4UT6H 1PCSA 3PWPB 2WIMA 3VACA 4BFNA 3UG4A 4L4TA 2D3VA 5EOCJ 3L3JB 2HVBA 4MB3A 4R3SA 2XPGA 5TGBA 3RE0A 3S6CA 2GJ6E 2VDLB 3MUJA 1YSOA 12E8H 1Q0YH 4MS8C 4KRNA 4P5TB 5LN8A 4ZS6C 1NFIA 2EJ1A 2E59A 1LL1A 1ZIAA 2W65B 2ZWLT 3SE3C 3ZYZA 5BZXA 4ZUTA 4TVPE 4WHTA 1S7RB 4NUJB 5K59E 4PREA 3QXTA 1FG2B 5EO0A 5FUZH 4NO5B 2FJGB 5I1CH 4JM2B 1HWWA 3LKSB 5AW7B 3RYMA 3QJZA 2EEDA 3X3FL 8FABB 4NC2B 1QZ1A 1D7DA 2B4CH 1TIUA 3FO9B 4H8PA 4FYTA 3F65A 4QRRD 3K6SB 5K9OB 4A68A 2Z1KA 1CFQA 4RMTA 2XSKA 5A2CA 5LB1A 3APFA 4M48L 3UTTB 1FV1A 4FQ1L 3ZUNC 1OTSD 4A7VA 3A24A 5ALBL 2G5BB 3O0LA 2UYLB 1HQ4B 1L0YA 4NCDA 4OKVA 4A39A 2EH7H 4BHUI 1C16A 2BP3A 1NGXB 1R3LB 1GGIL 2XV2A 4WSKA 3WL9A 3WUWG 1MQKH 1QW8A 3BAKA 3DNKA 4PS7A 1BVLB 4PW9A 4PTTA 3E8VA 4X7EC 3TCLB 1CCZA 3WV0A 1OD7A 2CMRH 4OZFH 6TAAA 3TEZA 4G6KH 4NRZB 3IN0A 1OANA 5JHMA 5B8CB 3RZCA 1V7MH 2E75C 3WNKA 4A2GA 3HRPA 4X4YB 4IOFC 1EZVY 4AEHL 3SDAC 2OR7A 1Y18A 4JFDA 3G6AB 1T66C 4DK5A 4KRMB 3FMGL 2X1XR 4OCXH 1AY1H 4FGMA 3NJMA 2I69A 1QOKA 2ZCZA 3BOVA 4MRBA 4IIZA 4CKVX 5IUSA 1WFOA 3UTTE 4PJAB 2EEAA 3DECA 4JFPA 5IP4A 1ZWIB 2KBGA 2XX1A 4G6JL 3ECWA 2R23A 3SKJL 1J05A 4U7SA 2VM3A 4E9XA 1S9XA 3PNRB 2DWDA 3VGAC 1N9PA 4U1JA 2X40A 4AJWA 1WWWX 1IAKA 4FXTA 2ERJB 1AI1L 5C6TH 1FNAA 1U3HD 2P7TB 3OKMB 3QUMH 4P57A 1EXUB 3QJHA 3LXBA 1IC7L 1IE4A 2GFBB 3VG9C 1A7RL 3H55A 5CP7B 4U7KA 1TYEB 5ICYA 1U3NA 2XA3A 5JZ7C 3EOYG 4FQPA 1LK3H 3KXFE 3GF8A 4GT7A 3BIKB 2PYEB 3HC0B 1G6RL 3NRPA 4YSSA 2AEQL 2VITA 5C6PB 1Q0XL 1JZ5A 2ZTBA 3TOPA 1CUOA 4YHZH 5C0IB 3S37X 4Y2DB 4IBLT 5I19H 3H9SA 4D0CB 3KJ4C 5J7CC 1UM4L 1JPSH 2A6DB 4XXCA 4M7LH 4UMGA 2R15A 1WTGT 2IDUA 3DSFH 3IDIB 4IIQC 4JQVA 3U6RA 5F9JB 4X6CA 5INDA 2C9VA 2IAMD 1SZNA 1F13A 5KVEH 3LN4A 3OKLB 3UBXA 3MTXA 4NKMB 5B39G 3DOHA 3FSVA 4AL8H 2W9EL 3NAAH 4AOFA 3QI9D 4Z18A 3VI4E 1ANUA 4KX7A 2I07A 3F7KA 1BD2D 3KM1A 1E9QB 4P4RA 1YY8A 3SY0B 3V9EA 4Y4HC 1NEZG 1TG8A 2HRPH 3MJGX 2XZAH 2Q10A 2D3JA 2ITDA 4G43A 1CFNA 2VSMB 2ZOWA 2ZUYA 3SCMD 3V6ZA 5AOMA 1NGZB 1E28B 2PYEE 2KQMA 5CCKH 1YPZB 4XOAA 4DP9X 1LNUB 3ARYA 3VFOA 1MZYA 1OARL 5LDUA 1PZSA 5DJXA 1J9CT 3FCGA 4P2OA 1FNHA 3V4UL 5F3BA 5DA0B 4DKTA 2ICEB 3QHFH 1MDTA 2FK9A 2Y06H 5EU6E 3STLA 2CR0A 2AI0L 3EJYC 1MCFA 2OXGA 3SKUD 4K9EC 4NIKB 3GMNA 2MNUA 2BNUA 1I9RL 2DI8A 1OP3K 1EAQA 5DUBB 1KN2L 4C59B 4AIZA 5F96H 3QVAA 3QFJD 3C5XA 5IWLC 2R83A 4WKXA 2CLZB 2XT1B 3NIFB 5GS0D 5IB1A 3VRIB 1PG7L 3QUKA 5LCVA 1RFDL 2QPEB 3CE1A 2WZ5A 5E8DH 1HEJC 2UZPA 5DDHB 3HAEH 1JGUH 5C0BE 2WQSA 1BGXH 2P47B 3L7FB 2KLRA 5GGVL 1YPZE 1KGXA 2LAAA 5KOMC 1KBVA 3MRCB 1HK6A 3L3IB 3ZJAA 2GK0A 2HKFL 3S36L 3TT3L 1C5BL 2Z93B 1A6UH 3GLZA 3LKOA 4EDWH 4IU2A 1CT8A 4D9RD 3FSAA 1AGBB 2L7UA 5CGBA 1ZVHA 4G6FB 4EAEA 3W2DL 2IADB 3OKEB 4F2FA 5JNYB 1TQCB 1KXQE 4Z7VF 2XN2A 1VZIA 1H5BB 4XO4A 5EDSA 2YPLB 1PLCA 2YAMA 2OTUA 3MCYA 4JJHA 2CO1A 2NY6B 3W5NA 2IALB 5DLML 4CU8A 4EN3B 3NVQA 1G5AA 3SKNA 1M7UA 4G7SB 3RUGE 2X6MA 4YR6B 2L7EA 2V2XA 2PW2B 5D1QC 3F5WB 3NIFE 2PWFA 2FHFA 4I0KA 4JL1A 5EZOH 5GZNC 1QPPA 3AB0B 3MLZH 5CZXC 1Z9PA 1ZHLB 4JHBA 3QEQB 5ADPH 4LP8A 5B1JA 2MQ3A 1PNCA 3PUUA 1BEXA 5DMIL 3U7WL 3KPRE 2WO4A 4JRXA 1XTMA 4JHWH 3L3KA 3Q6GL 4ZMLA 4RFEB 3IVKA 5FYKU 4QRSA 4X7DC 3NJLA 3RNQB 2V8MA 1MFDH 3K71A 2YD0A 5EEXA 4QHLB 2Q0ZX 2WYTA 2O6CA 3Q2CA 4QRQB 3OXSB 2GITB 2FO1A 3SZKC 4B9CA 3LXAA 3AQYA 2ZXGA 1B0GA 5CJ8A 1AIFB 2VL5B 4LIQH 4HPHA 1MH5B 4MXWL 1RJLA 3BAXA 2DYPA 3NSDA 5DQ9A 3S8FB 3VH8A 3ILDA 2CIIB 3CH1A 1M2VA 5E4EC 1TZIB 2OX5B 5C0AE 4PRPD 1JPEA 2XC8A 2BVPA 1TJHH 3OX8B 1JI1A 3KWXA 5T1LA 2OTWA 3ELQA 2ZNXA 1CICC 1F97A 2CO6B 5IQNA 4I9WD 2DAVA 1LO5A 2UY7B 5C07A 4JPWH 4MDJB 3ZKXC 5AUMA 4J4PD 2Z1PA 2PABA 3MRHB 4OFYA 2FX8L 2IH9A 3LQAC 5DR5H 3Q06A 2IDCA 3MJ7A 4AYBA 1BIIB 3PQYB 3TVMA 1BOGB 2Z8VC 3JWNC 4FABH 3EXLA 1HJBC 1Z2KA 4JJ5A 2NY1D 4M3HA 2VR5A 4LEOB 3L95A 3VE0B 2WV3A 3TO4A 4BUQA 1EAPB 5FCUL 4DCQB 1X7QA 3KZ8A 3G5ZB 4N8PA 3KVQA 5EPMA 4ZXBB 4RGMB 5I0VA 1F6AB 3QA3B 5FV1L 5SX4H 3KVDD 4QYOB 4MNQD 2WYHA 1UKQA 2VH5H 2XWRA 3BKCH 4JE0A 1RKRA 1FZKA 2LU4A 4JKLA 1S9WB 1U58B 3CNKA 1I9JL 2X10A 1OAQL 3CX5J 4A7TA 1P7QA 7TAAA 1W0YT 3EF7A 5IW3A 3QAZB 3VNYA 2Y07H 3EOBB 2WCSA 1B0RA 4O4YH 2DWSA 2APVA 5BOJA 2VYRE 1HHIA 3H54A 4YUEL 2ARWA 4WFHE 4BRJA 1M6OA 5E23A 5IB5A 2EVJA 2X1OA 1CLYH 4NBZB 4XVOA 5I74C 2HTKC 5AYTA 2XZQH 3RX5A 1KCUL 4B9JA 3NUKA 5ISZB 5TE6H 4KROB 3PQYE 4YSAA 3EOTL 4ELDA 3QB7C 3QCUL 3EJZD 2B59A 2WCPA 2CGRH 3DTXA 3U4EB 4OLXH 4RMQA 2Z7ZA 4I8DA 3CSPA 1R6VA 1HWHB 1C8QA 3FYEB 4M6OL 3WKYA 2VDQH 3EJJX 2ZAGA 2DIAA 3QIBB 1J5DA 3ALWA 3BH9B 3GRGA 1DVXA 5D4IA 3VFWA 1S3KH 3DOSA 4AXWA 1RZFH 5BRZA 4RQQB 1UZ8B 3RX8A 3ROLB 2O5ZL 5A2FA 2WUBH 4AQ1C 4C56D 4AW7A 3BMVA 4YX2L 3LH2H 1HOCA 1YEEH 1DEEB 2IEPA 2MPVA 3NZHL 1D6EA 5F7DA 5DHEA 5HHNA 3POHA 2F7IA 5IQ9B 2Y1YA 2QGCA 2EYTB 3RHWF 1W6WA 3F00A 2ZKXA 4PD4K 4PJGA 5D7SH 3ULVL 1ZT7B 4PGEA 2ODHA 4FE9A 4IBSA 4IRSD 1S8DB 4P23D 3DDFA 4A2LA 4S0TD 4HWUA 3SSGA 1E2VA 3QDGD 4MAYB 1SMOA 3D4ZA 4XRCB 5BZDA 1IKOP 3PL6B 3T6XA 4WO4C 3MLRH 5SX4I 1KCBA 3S4SA 2D3NA 5TDOA 1A6WH 5AOKA 1GGBH 2AK1H 4UQ9A 2N01B 1SJEA 3IAGC 3DBXB 1YEKL 5T1KD 2CPUA 1A1NA 2J8UF 1UKTA 3R8BB 1UM5L 5C8JA 2EE6A 2IDTA 1XBRA 4HKXA 4WNQA 4Z77A 4HLZG 4ZI8A 5KG9A 3VFGH 5B8CC 4KDVA 3HCVB 3N1GC 5D6CB 1S9VB 3PUCA 2VMEA 5K5YA 1KJ3L 3WE1A 3PJNA 4M7ZC 4HUWA 3ETBJ 3ARFD 5JQ6L 4KU1A 4ZOAA 4KRLB 3ZR6A 1LO4H 2ATPB 5FECB 4MCYA 2WB1A 5HJ3A 3T65B 3H9ZA 1UOVA 5JW4M 2FX7H 3HPJB 5EZLA 1G6RB 3C5JB 5J56B 2VMCA 3NJIA 1A1OA 3BKMH 4M29A 4UBDC 2OP4L 3SQBA 2FJUB 3LX9A 4N90E 1FLRH 4MD4A 4EKXA 5IFAL 1R0AL 2UZYA 3B8YA 1A4JB 3HNTL 4H5SA 4F8NA 2PWHA 5BRQA 5AVZB 4I7ZC 3TCXA 2B8OT 4ES9A 1FIGH 2RFXB 3K4AA 4UDUA 1K5NB 4DEPB 4P2RD 3VXTB 3X12A 4LLYA 1G9NC 2DI9A 3IXTB 4U05A 3BP5B 2NSMA 3GJFA 4HH8A 2CHNA 4YL4A 3Q1SL 2QSVA 3HN5A 5F8RC 2PO6A 4Y4KD 5DSCB 3CLEL 3P3TA 1IC5L 1KWKA 3FT4B 2VLKB 5AB9A 5L2KD 4GRWH 5T1MB 3M1CA 3NCJL 3IMWA 3V5KB 2WPGA 3MLXL 4APQD 5J06A 1KJVB 3UEQA 3TA4D 1CL7L 1ZSDA 3BKYL 1T04A 4DN4L 1I3GH 3FTGB 1YECH 4MJ4A 4UTAL 2C9QA 1EK3A 3CFJB 5PAZA 1OWRM 2FAUA 3MAWA 5IG7A 4RGND 5J5EA 1GOGA 2NCEA 1I8KA 1TU2B 2FD6H 1RV6X 2V8LA 3WE6A 2J8OA 4JLRA 2SODB 5I76B 2YLHA 4PUBH 2PPEA 2HFEB 3C09B 4FFYA 4FZ8H 3QDJD 2WXNA 3RDTB 3TBSB 1TMCB 2XQ0A 4NS0A 5EN3A 3C5ZD 3RJDA 2V5SA 3T4YB 4PJ9B 1C5CH 3QUXA 4HIEB 2AEPL 3IS1X 2A5UA 4ZNEA 1HT6A 4POYA 1RK1B 1KIRB 1KB5L 5JMRA 1OGAE 2WHVA 1EGJA 3JT2A 2OK0L 2H47C 2VLKE 2Q1EA 3KDPB 3CHXA 3MRPB 3KLSA 4BRVA 5I1KL 3SBPA 2C1OA 4X42A 3P4MA 1AGDA 3WJMA 4M6ML 4LLQB 5C3LD 5D1ZC 3V7AG 2R4RL 3FTZA 1D9KC 4PB9H 4I5BB 4JMNA 5F7EL 5T3ZD 4KUZH 2RAMA 3FN0L 3BAJA 3GXMA 1J10A 4XO5A 4LNVA 2WNXA 4FDWA 5EWIH 2WANA 4C47A 4CADA 4LCUB 1ZT1A 1GSKA 2AP2A 3CFQA 5DJZA 5I82A 3MUGB 4I4WB 3ECBB 1AXSA 1SJHB 1TMQA 4S1DD 2FL5A 2G9HA 4LCWB 4O00A 3U2SA 2QFPA 4WHYH 2E7LA 5CLWA 3GHEH 4AYSA 1XIWD 3MREB 5B1BB 3MV9D 2PCPB 1GVIA 2F18A 2LLNA 1BVKA 1KIPB 4GH7B 5GISL 4G8FB 4ZX5A 3UTQA 1MCCA 5I28A 3NJGA 4Z0BH 1JK8A 1C12A 2K9FB 4YDMA 4KKCD 1LQBC 3EYSL 1OWWA 1J8SA 5JXEC 4NPYA 5DHVB 4Q9CA 2KQNA 2ZKHL 3PNWB 4L4VA 1PCXA 4ODTL 3TIEB 1RK0A 2Z92A 1SMAA 2CD0A 2GAZA 4HLEA 4N6RB 4C57C 4XMUA 5A2IH 5IW6B 3BQUB 3O4OB 1MRDL 4DGWC 3VGBA 1VKXB 1EMTH 4YXKH 4KXDA 5AG9A 4JPSA 5FFOA 1FFTB 1PBYA 1U8IB 4EN3C 5IBLC 1DBKL 3QIUD 4E9YA 3L1OL 3ZLQC 1DUZB 4L29B 5IMMA 5IREA 5TFSH 1CIDA 4WU7B 3WN5A 2YKKA 3GZQA 5J11B 1Z3GH 2BSRB 3D85B 4LCWE 4F91B 1E9PB 1JZ6A 4FNLL 4JKPH 1JYWA 5E6YA 1A6TB 3L4VA 3UDWA 4WSGA 1SDAB 3WD5L 3V8CA 3BAEH 2R8SH 2FX9H 1T5KA 3CZFB 2ZCKH 3U2IA 3MBED 1ILSA 3GGWB 1HC1A 3QCTL 3VGDA 1NOLA 1J48A 3GUFA 4KV5E 4PRIB 4LPTA 3IJSB 4O2EB 4TULH 5KAQG 3EJCA 3DMMA 4XXDB 4PJEA 5EA0L 1G4RA 4HXAH 1NJ9A 3MDJA 4Q9RL 4IYKA 2BVQB 4GBXC 4K2UH 2BJMH 1HIML 4UZGA 4APXA 3M86A 2DKSA 1J1XH 4HIIA 3V4PL 3HHRB 4G59C 4L9LB 5GRZA 3NCEB 2CO3A 5I2IB 2NY3C 1SY6L 1MW2A 4L3ED 1IKFL 4X83A 2LTQB 5DK0A 4LF3A 2XX0A 2VXUH 2P8PB 5I75B 3L4TA 3VXUE 3QWQB 1NAMA 5DURB 1HZLA 5MERB 5D6DC 1OPGH 1NCJA 1R3IH 4MQTB 2GBTA 2Q5BA 3K6IA 2FH8A 4GQZA 2NSQA 1T6WA 4JRYB 4MJJA 1SM3L 4BSJA 4OAWA 3MODH 3LTVA 4EF3A 1RP8A 3DYOA 5I73B 4L1DA 3TT1L 4WK2B 4MVBD 2QPDB 4OW6A 2IPKA 4GKSA 4JS7A 4GG6F 5IJBC 1RHFA 5IMMB 3RWIB 3RVTD 4NJAH 3CPLA 3BGAA 3C8HA 3NSCA 4HZAA 4R90H 3QNZB 1NEUA 4NQEA 1T89C 3K6DA 4IBTA 3TEYA 3ARDD 4HAKA 1FYTD 1JVLA 5ILTH 1TLMA 2IQAB 2O1AA 4OD3L 3Q8BA 1WZMA 3AREB 3C6LC 4TVUA 4YNYB 4PJIE 1YUKB 2OA9A 4PGZA 2F54B 1A14L 2A77L 2EABA 3FB6B 1AKJA 1PG7W 4R97C 3NN8B 2MH4A 1IAIL 3KH3A 1KCRL 3FQUA 2AEOA 4M1DL 2WQUA 3C5SA 5DMGD 1A25A 1I8LC 4X99A 3VXRE 2WNGA 4F80A 4LLVB 5KYUA 3NZUA 4OVVA 5HTSA 4JRYE 2F53A 4HOZA 1BFVL 3LRKA 1FZOB 3L9RA 3ARGA 5LUMA 3BXNB 5FF6A 4XN1A 3AW5A 1L5GB 2ZXWB 3VWJD 3FRPA 1FNGB 2DQTH 5HI4D 4DKDC 3T2NL 1JYNA 3ZDWA 3QZWB 4R8WL 3TA3B 3FH8A 2CK0H 3QQDA 5EOQH 4JFHD 4XZUB 3RZWA 3T4AA 4E9WA 5HDQL 4ZW5A 3G04B 1ASQA 1SEQL 3LKQB 3BP7B 4JVPA 4KHTL 4PJHF 2N59A 4PJAF 4MCMA 4GSDL 1BZ9A 3ZBMA 2R2BA 4J3WA 2YXFA 4ODHL 1FAIH 4ELMB 4JFEA 4AMKL 1SVCP 1CC3A 1HNYA 4IGBA 3IDNB 5I9QC 4QRFA 4GSRA 4XNMA 3TBTA 3V5HA 2H45A 2JKIS 1R5WA 2YMOA 4YHOL 1HL8A 1NGPH 4KC3B 4LZKA 4KQ3L 2CJUL 3CFBA 1PD0A 4W4OA 2NY4C 3LRGA 4LPXA 5FOBA 3OQRA 1G9MH 2FEDD 4YDJB 2KLTA 1N64L 5LCVH 1T6BX 1OD9A 3L3HB 3TJHC 2ZZUT 1QPKA 5GSRB 3OJVC 2OSLA 4MZRA 5H37A 1JF5A 4P4KD 3BEVB 5IV2A 1Q4NX 4ZFGH 5ICZB 2XKNB 4KQ4L 2CBPA 3J8F7 2NY7H 5FYJE 2ZKYA 4XPBL 4YBHA 1UJ3C 1HEZB 2X89D 4H20L 5K9KB 1C8PA 4BH8A 1QG3A 2HZHA 3GHPA 3CFTA 4PRNA 3H3KA 3SO5A 2H3NA 2FBOJ 3LVTA 3L1GA 1MI5E 4XTRD 3MRLB 1HH6A 4UCFA 3RWDB 4UV4H 3S2CA 5LJYH 2R0ZL 1JMXA 4CSSA 4OTXL 3PL6C 4ELME 4PYHA 3PPEA 4PJCB 5GS3A 4JQIL 5D7JA 4MA3B 2V33A 1ODAA 1GZQB 1S4IA 3DSNB 1J9QA 1PGRB 3ULVE 4YLCA 1I3UA 1UZ6E 4IBYA 4IEFA 1P5UC 2EKJA 2WLZA 2HPOA 1GGTA 2EZ0C 4F1ZA 3BWUF 3MNMA 3CCHB 3B3IB 3GMOB 4P8QA 3RG1C 3X13A 4OF3A 2N1TE 3RGVD 1BFTA 1S9YB 4DIXA 1MJUL 1OT2A 1Q9WB 3TU6A 3VXPA 5C2BL 3SDXB 1KFGA 3E3QE 3EH2A 4IBUA 3PAUA 1AOZA 5AKSA 4PRAA 3OGOE 5DEJA 1UURA 5HHQA 1RZJL 1O7SA 2MQCA 4N9GB 3I9IA 3OD3A 1K4CB 4P2QB 1VGKA 1HDMB 4Z7UF 3HTLX 1NFDE 3KWWB 4N8VB 5EOCL 2FNBA 2R2CA 3LNHA 5JW5B 1L0PA 3KPMA 5EZIH 3VRLF 5CEZE 4DUXA 2WC7A 1T5XB 2R1WA 3EFFB 4RMUA 1RUQL 2ZXCA 5CSZB 4PJCE 3MRDA 2JJTC 1IGCH 4LCIL 3O3DB 4XNYH 3I2CH 4ZUWB 4JO3H 2VZ3A 4JKKA 4ELKB 4PIBA 3CHOA 2H7WA 1E4XI 2P4AB 2FECL 1G87A 1JE6A 4PRBA 3GXTA 3UOAB 3BZEB 3SDDD 2X6AA 1IFHL 2IPTL 3KCPA 3TJEL 2Y9RT 5HGAB 5J1TC 3T77B 1A4KA 2WBWB 4K8RH 1MAKA 4HCRH 1I8IB 1OGPA 4IMKC 1MUJB 3Q44A 5AW2B 3FN9A 1A1MB 3WBDA 4LL1A 1U8HA 3FONA 3TO2A 1PIGA 1U95B 3W9EB 4AYMC 1BZOA 4MA1C 15C8L 2FYVA 4QIRA 2P80A 3WN6A 2QQQA 3WKNA 4R4FH 3VD2A 2DLFH 3AS1A 4P2QE 2EKSA 5CZRA 1ACCA 1OVZA 1W0WB 2E0PA 1PJWA 1SOKA 3L3GB 3QZMA 2GKIA 1YO4A 1JK9A 5FGCE 5GRYA 4UANA 2B39A 1KB5B 1NCOA 1SYSA 1U9KA 2YPVA 2JK5B 3E1F1 4Y1AA 5DJ0A 1KGYE 1IJ9A 4L5FE 1JDAA 5DQJA 3V0AC 3ILEA 4Q89A 5KSVB 3K2KA 1J1OH 5IHBA 2J43A 2XETA 4G5ZL 5AEAA 1R17A 4KKRA 3QULA 1MFBH 3D39A 4QT5B 3ARBD 1CZ8H 3C09C 3RFRA 1SUHA 3L1EA 3MOAH 3SHSA 4BQCA 5E03A 2GTZB 1A4AA 4OJFH 4P46C 1RIVH 1UWEH 5DRWB 1TFHA 4QRRB 4F7TB 3MGTA 4N2GA 5H4YA 5KSBA 1AXTL 5AW1B 1J8HB 3CZKA 25C8H 1MG2C 2N56A 4URKA 3GSVB 5JYLA 1MFMA 3U36B 43CAB 3MJ6A 3CIAA 4M8QA 4NQUA 2GJZA 2DQFB 4RNRB 3VSQA 2GSIB 1ASPA 3JTTA 2EYSA 3OC5A 5F3HB 5GZOA 4BZ2A 1KCWA 2NQDA 4JB9H 2FWSA 1KLGB 1KELH 4S1SL 2FYYB 3U9WA 2YUWA 5CBAB 5LXVA 3GMPB 2WLIB 1OF0A 1PZ5A 1Y0LB 3JUZA 3VXSD 2WBJA 4WU5A 5ABZA 2CM5A 1KEGL 4V1DE 4HH9B 4WWID 3RL1A 4L8SA 3WLBB 1II4E 4ZMVA 5C0GB 2J25A 1B9KA 4OY9A 3T2LA 5JOFA 1AZBA 4KAQL 2ZP9A 4QCIB 3RY5A 2V9RA 4BCYA 3UZVB 2XWJA 1DJHA 1W91A 4PBXA 4I0PC 3LZFH 2IQ9L 1AKPA 5CLTA 3ZHFA 2BP8B 3WKQA 3ZE1E 1IGJB 1E5BA 1QRKA 1J8HE 3LDBC 4MCNA 1YYMH 3PU7A 3IFOB 1NMAH 4KFMA 2X38A 2Y36H 1DVFC 3QXDA 1WBXA 1B6DA 5ETUB 5EU4B 6PAZA 1AG6A 5F7KC 3FAWA 4TF4A 3QEGL 4DKEL 1ZMYA 1CLCA 1RU9L 4K5MA 1VESA 4GMSH 2CBQA 3ZZSA 4YBQD 3SKMB 3D18A 4DKFL 1N8ZB 5FO8B 5IEKB 3FULA 2G3MA 4X98B 5F72S 4ZMXA 3KWVA 3FCTA 3PGCA 3BQUC 1KTBA 4NUGL 5EBMB 2FEJA 2OMZB 3DX7B 5EFIA 4X4KA 2CALA 4PR5A 4DP7X 2FR4A 5KN5A 1YMHA 2IPUG 2YLKA 1CD9B 4N8CL 1XGRB 1G1KA 3PWLA 4ONFH 3UGEA 1FVEA 3IKCA 1QYGH 3BWZA 3IDGB 3L2NA 1DVTA 1J18A 4K71B 3PCYA 1XF3B 2IDFA 5GJSL 1JXJA 1QSFD 1CGXA 1QNZH 1V10A 2FJFB 4NI3A 3V4PB 4R26L 3IDUA 1IEAA 1Y07A 5G4MA 1CGUA 3FH7A 3FB5B 4HC1L 1WFTA 3WSQL 3P02A 1KFAL 4ZFOL 1GZHA 5FYKD 3OBAA 1JF1B 2NXYB 3MV11 3WFCH 4I87A 2CLRA 3UTOA 2BHFA 4OSUL 4TLTA 2CHZA 2DOCA 1QAWA 3QI9B 1X3DA 5FWRA 5KSAD 1KB9K 3VFNB 3B9KA 4UV7H 3SDCC 1BD2B 2N7SA 4L9LC 3VDAA 2VR6A 2ZOOA 4YAQB 4UYPA 2ZX9A 4EI0A 4ZD3H 3ZE0E 3HN8A 1P53A 3SCMB 1JNNL 3GS7A 2ZF9A 1TVHB 4BSWB 5HD8C 1CG9A 1INDL 4O5LH 3KYOA 4PJ8C 4GI8A 4M6AA 4ZO7A 1IC4H 2YBRB 1A2YA 2H0JA 4F92B 5KBNC 3WEXA 1MXGA 2IXQA 3B2VH 3GJFH 3OJMB 3D51A 5ELIA 3ESNA 4JFSA 4J3SA 2BIHA 3H9HB 4J1UB 1RY7B 1TCMA 1GSMA 1FNEB 4LBEA 3I6LD 1DCEA 4N0CD 3FO1B 3HFFA 1TVDA 4HT1H 3BYYA 3CSFA 3VVWA 1T83C 3LV3B 5AVSB 5I73C 1LM8V 1DQKA 4HISA 3GSXA 2WN3A 4HHAA 2EDRA 2YMXL 1HXYB 1TT6A 4FRWA 4DPAX 4KY1L 2VDPL 1ZLVH 3MJ8A 4AV0A 5JOPE 3OZ9H 1F86A 1SLUA 2Y0SA 3FQRA 3QFJB 4G7VH 3F84A 4PRDB 4QRPA 2W81C 4WJG3 4R7NA 5L6YL 4M62L 1BD2E 4LOUD 1RMFL 1EXHA 4D3CH 2VR4A 1KXTA 1KTDB 4DF9A 1NWOA 2F7QA 4Y5YC 4J27A 5LG1A 5BVPL 5SWSD 4ZDHA 1MVYA 3QSKB 4FP8L 5F7FA 3DJRA 3BP4B 3EH1A 3NFSH 4YHML 2GSGB 4FFYH 1DBAH 1PKQB 3LQZA 1KNOB 5T3ZL 1I3RA 2QADC 3BWSA 5KBPA 2AHIA 4K7PL 1XCQA 1G7QB 1T21A 2FVNA 3U9UB 1NBVH 1JZDC 2QKSA 3B9EA 4YH6A 4KGJA 5E6UB 1L9NA 3MQIA 5I17A 3UJJH 1EGJH 5DXWA 2DQIL 3TLRA 3KLAB 2Y25A 1TQSA 2XWTB 3OGCB 4K0OA 4N3TA 1HTYA 3P0VL 1MHEA 3US1A 1BZEA 2PP9A 3MFGB 2EDBA 3DHJA 4NP9A 3RKDD 4A2DA 4G3YH 3FZUC 5F88A 3RTQD 1IIKA 2VM4A 4JGMA 4P2CG 3H0TB 3KGRA 3QUZD 4BK4A 4N2DA 4AQEB 3C6SB 3HC4L 4KJPD 2ROXA 1B6UA 1UACH 3L3DB 4JM4L 4QGTA 3RGBA 4TKWA 4MXVF 1H6FA 4PM1A 3BDYL 1E27A 3OMZA 5CBEB 4UIMB 1VERA 1KMGA 4F58L 3AQXA 5DMKB 1ZKAA 5C0FB 2DICA 5A16B 5AZUA 5B39B 4Y1TA 1WYJA 2HT4C 3T0ED 1GPOH 1F2XK 2BRRL 1HCZA 5C0ND 3NEXA 4DGUA 3GS4A 3SE8H 5E1IA 3AABA 1I1AD 2IH8A 4WHDA 2D7QA 1RZIB 1NLDL 1NEZB 4Z7WB 3VTAA 5LGJB 2DS4A 3APDA 1TVBB 4LPWA 4L2YA 4NO3A 2X0VA 3ATEA 3V0GA 4FQJL 3E3QC 1AXIB 2NZ9D 1CI5A 2X2UA 2ADGB 1FSKB 2OMYB 2ARJA 4M6NH 2ADIA 3SE3A 3VFMB 3X14A 4W9GC 4M43L 4NZTL 1AP2A 4GUOA 3MLYH 2IMMA 4FL4C 1L4IA 4ZT1A 3WXVL 5E2WL 2X4SB 2WBKA 1BAFH 3CDGA 1BAGA 2R0WH 1UUNA 2APTA 1DQJA 3H6AA 2BWDA 5JXAL 1U8QB 3HMXL 2R4SH 3MOBL 3PDOA 1P7BA 3HG3A 4TSAH 5IOKA 1ZHKB 3N42B 1KY7A 1QO3A 4PRPB 4Q6IB 1LDSA 5DLLA 1VFMA 1AD9A 4WENB 4HJJH 4Z3FA 2NZIA 2OSXA 5HHME 5EO1B 1GZPA 4PYGA 2Q6WB 4I1PA 4W68A 4G8GA 2ZSVB 5HYJA 4P3DA 4KKBD 2VQ1A 4UDTB 3ZDXF 4PI0A 5M95B 3QORB 4ZX4A 2XWXA 5BJTB 3RAJL 2WQRA 1Q9OA 3ATBA 3Q1EA 4X4XA 4Z7WE 1YEGL 1FHNA 5JHLL 5FUCE 3N5AA 4FA8A 1S7XB 3JV4A 5A2BA 1OCWH 5G4OA 5T5FL 2NY1B 4R6UA 4X8JA 3V0VB 1RIHL 2MQGA 1AQMA 4K07A 1BQLH 1CF1A 1XAKA 2HCZX 1FC2D 1MHHA 3GTVA 5CJXC 4ZTPH 3DVNA 3L3OB 3P11L 4GS7C 3PWJB 4M1GL 4X9FA 2XG5B 4MNQB 2PYFA 4AGNA 5DUPL 2H9GA 4JY4A 5C0EB 1ERNA 2DRUA 2WOBA 4JFFA 5LNEA 1KBBA 3BYTA 4IHOA 2JB6B 3P3YA 4LVEA 3H56A 1EHXA 3A3YB 1HI6A 4IDJL