1BZOA

Three-dimensional structure of prokaryotic cu,zn superoxide dismutase from p.leiognathi, solved by x-ray crystallography.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
b'QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SUPEROXIDE DISMUTASE)
publication title Evolutionary constraints for dimer formation in prokaryotic Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
total genus 35
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1bzoA00
2C9VA 2AQNA 3SODB 2SODB 1QUPA 1UXLA 5KBKA 1OAJA 2E46A 4A7GF 1E9QB 1HL4A 2VR6A 2ZKWA 2AF2A 1JK9B 2JLPA 2Z7ZA 2WWNA 1F18A 1F1AA 1BA9A 4BD4A 2Z7WA 1F1DA 2GBTA 3K91A 1YSOA 1UXMA 1ESOA 1DO5A 3KBFA 3MNDA 4A7GA 3T5WA 2Z7YA 2VR8A 2R27A 1KMGA 3S0PA 2WZ0A 3F7LA 3PU7A 1SXZA 2AEOA 1MFMA 3HFFA 3HOGA 1SXAA 2ZKXA 3CQPA 1CBJA 2C9SA 3GTTA 4A7TA 1OALA 2AQQA 2LU5A 3ECVA 1PZSA 1IBHA 2WKOF 1Z9PA 3QQDA 1YAZA 2WYTA 1AZVA 4A7UA 4OH2A 4A7SA 4BCYA 3RE0A 3KH4A 1SPDA 1S4IA 1E9PB 1JCVA 1E9QA 3KM1A 1EQWA 1XTLA 1B4LA 1JK9A 2WKOA 3L9EA 3GTVA 5KBLA 2E47A 2GBUA 4N3UA 3HW7A 4MCNA 1SXSA 3KM2A 1COBA 1E9OB 2APSA 3CQQA 3H2QA 1IBDA 1Z9NA 3KH3A 2ZOWA 1B4TA 1IBBA 1L3NA 1SDAB 2JCWA 4A7VA 1EJ8A 1P1VA 2WZ5A 2VR7A 3LTVA 1XSOA 2AQRA 2K4WA 1RK7A 3GZOA 2ZKYA 2Z7UA 1IB5A 1N19A 2Q2LA 3GQFA 1DSWA 1Q0EA 1FUNA 1OEZW 1SOSA 3ECWA 1BZOA 1SXBA 2AQTA 2WWOA 2AQPA 3L9YA 1SXNA 1OZUA 2C9UA 4FF9A 1PTZA 1TO4A 4BCZA 1SRDA 2WZ6A 3MKGA 1SXCA 1E9PA 1OZTG 3KBEA 1YAIA 4N3TA 1SDYA 4OJAA 1U3NA 1TO5A 2AQSA 3ECUA 3GZQA 3GZPA 3H2PA 1E9OA 4L05A 4MCMA 1CB4A 2XJLA 3F7KA 5CU9A 4A7QA 1F1GA 1N18A 2WYZA 2XJKA 1HL5A 2GBVA 4U4IA 4B3EA 3CE1A 3QQDB 2NNXA 1PU0A 2V0AA 1IBFA 1XTMA 5KBMA
chains in the Genus database with same CATH superfamily
1WRFA 3SODB 5C09B 5JORA 3MRJA 4MMXC 2WBKA 1KZQA 2MPAH 2X4TB 1EVUA 1HL4A 2GSIA 4HLZH 4PVMA 1C08B 4BK4A 1DQKA 2E8YA 2WLIA 1ZTMA 4NHUB 5IOKA 4UDTB 3G6JB 1M6UA 1QFUL 2WWKO 3WKML 4OIFA 3EG9B 4KTDH 4ILDA 4QXUL 4GO6B 5CP3A 2DQGH 4K8RH 3N41F 1P7QA 1V55B 3CXFA 2BJMH 2ATKA 4PCSA 1JZEA 2X1QA 2ICWI 4FN0A 2HVKB 4PJ5D 4MD5A 4WHTB 3BYTA 3VFRB 4PJHA 4AEFA 3II1A 4BJLA 4CKQA 4F33A 3ARDA 3QI9A 5F44A 3ARDD 1HNYA 3QI9D 3VXPB 1RZFL 3GTTA 3RNQB 1AD9A 1BCIA 3MPCA 1G1KA 4N0RA 4AVJA 1UM5H 2FBJH 4PRHE 5LN4A 2EO9A 3HE7B 3VW3H 3ARFC 1FFQA 1IKNC 3IMTA 3P3TA 4D9QD 25C8L 5MENB 1L3WA 3LEYL 2WCPA 3QISA 4JFXB 4X9HA 1EVTC 2QDVA 3F12A 4I18B 4ODWA 3WJMA 3QDGA 4X98A 3QDGD 3D51A 3GSOA 3M17A 1OL0A 4RFEB 2ZG2A 4PU2A 1N2RA 4KRMB 4YK4B 1UKSA 4P5TC 4XN8A 2ZAHA 4ZBJA 2CLRB 4HFUH 2O6PA 2OL3B 2WZ5A 4I3GA 5FCSH 5E6YA 2GEQA 1E90A 5LAXA 4G6FD 3KE0A 4BV1A 1G5AA 1IC7H 3VJ6B 3IFNL 4O2FA 4NZRH 2KERA 5IMOA 2HT2D 1BWWA 2DMGA 1IAIM 2N3JA 1GS7A 1KPVA 4LQFH 4LSPH 3RGVA 3RGVD 4PW3A 2A6IA 5HHMD 1F97A 4EDXB 3EGDB 4GRLC 4TUOB 4D0CB 3H42L 1NCNA 2X89A 4L48A 2X89D 3QJRB 1YY8B 4O00A 4PTUB 4TQIA 1HFUA 5JHLH 3BO8B 2IBBA 3IDMA 4XOAA 1ZEAH 3KR3H 3MRCA 2B0SH 4FJ6A 3LQZA 4Z7QE 4P5KA 1MFDL 3TA4D 5H2BA 5EG6C 1CBVH 3WS6A 1FCCA 2G3MA 5SWSD 5I6OA 3CH1A 5K39B 4C55A 1AZNA 2EADA 1HL5A 4ZUSB 3QB7C 5GS0H 4XC3H 3U0PB 1OANA 3NJFA 4NIKB 3S37X 5KSAB 2AHIA 1JN6A 2NQCA 1A1OB 4X9FA 2CUAA 3IRPX 3HPJB 4RVBA 4M5SA 4PJFA 1NBVH 1LO2L 5J12C 1IBGL 3FTZA 3CN0A 1RUAH 1XH1A 1JNNH 3PREA 3LN4A 3SDCC 2FJGB 4L8CB 2EYTB 4YE4L 1OTSD 5HJBA 1AIZA 1UOKA 2OMXA 3MA7B 2IDSA 1FNSH 3G9AB 4ZO8A 4PIRF 2A6KA 1XWVA 2HFGH 3DX0A 3EKCA 1NANH 2H41A 5JO5B 1JTPA 3WY4A 3QE5A 3IDJB 3HC2A 2OMZA 3UTSD 4KUCF 4OLWH 1DO6A 1X7QB 1SBSH 4ANVA 3F8UB 1BIHA 2X41A 1ZT7B 3HC0A 4PRPE 3OPUA 4I3RL 4RQQB 3N42F 1G7IB 3QXAB 4A2EA 3VU2A 5CP3H 5KJ7E 2Z8WC 1CF1A 2DH2A 1NINA 2VERA 4R2GC 4JVUA 4F37K 4TVPD 3FTUA 2H1XA 1RK0B 4BINA 2J5WA 5K59F 4GOSA 1W16A 2K8QA 3FQ4A 1AIFA 5E00A 4PMEA 1K8DB 3EJSA 2XQYG 4R4FH 5KS9A 2HUHA 2OX5A 5L6YL 2BSRA 5CGYD 1QVOA 1IE5A 5IKCB 1PLAA 4PRDB 1OCOB 1NGWA 2YWZA 4MJ2A 4NAJA 4NXKA 2EZ0D 4N85A 4PP2A 1OTUC 2NNAB 5B1AB 5CIPB 3HS8A 2QHRL 3K1DA 4QD2E 4OJYA 1JPST 2IV8A 1ND0B 4C59B 1IBDA 1OIOA 1YYML 2CBPA 5TFSH 3BFQG 3VGFA 3C6LA 2Y6TE 3C6LD 1MFBL 2DMKA 4Y4HA 5C08A 4X6BB 4Y4HD 3RJDA 1R3LB 3Q2VA 4U33A 2I69A 2UY7A 1FQ9C 4PJIF 2C8NA 4M7JH 1E43A 1OV8A 3F62A 1BM7A 2NY7H 2VLRA 4ZW5A 2VLRD 2WZAA 4KU1A 4TSBL 2R0ZH 1SEQH 3QZWG 3DXAB 3NUKA 3DMMA 5FM5O 1S2EA 1WHOA 1JF1B 2X3CA 1B0GA 1FHGA 2X2JA 3DMMD 3HJEA 4H26A 4PGDB 4EQ3A 5HHVL 1AQKH 4G72B 4KZEH 4QKTA 3SGDI 2XOTA 4MA8H 4URTB 2VDOL 5IHHA 1M1XB 3S37H 3N0PB 3FO9A 1UD2A 4S1SL 1ZWIB 2YXFA 5D71L 5M95B 3FO1A 4LASL 3M7OA 3OKLA 1PX8A 43C9B 5KUKA 5LBSA 4QF1B 3VFRA 5EEYA 1NCJA 5F88A 4MGXA 5MERB 2HLFD 2FH6A 4LCIH 1BZ9A 4Z7WF 1XAUA 3B3BA 5IMMA 5LNEA 1IEBB 2R2HB 2IWEA 4PS4L 2BZ7A 3WKYA 3OR6B 3KLSA 4YDIL 4OF3A 1AS8A 5B1KA 1AXTL 1QLFA 4XVTH 3WXWL 2EDTA 3T8VA 4TVUA 1ACZA 5MEND 2VW6A 1YC7A 1QKZH 4YWGH 1MVFA 4DVBA 1AKJB 3GGWA 4CRPA 3VMPA 1UD5A 3W11D 4R8WH 2A9AA 1KV3A 2XG5B 3NPZB 1A64A 3QHZH 1JGLL 3GFUA 3K91A 3RPIB 3QXUA 2PF6A 2FHFA 3ZOAA 2Z0UA 3DHJA 1TU2A 1JGDB 3LHAA 1ZE3C 2GC7C 5D6CA 3JZ7A 4N68A 5LN8A 2V2WB 2FD6H 4LLDA 1FVDB 3KLAB 2JCCE 1T21B 2FJHB 3LH9A 1MFMA 1XH0A 4M3HA 1JPSL 1KOAA 4XOCA 5FHAL 3SPIA 2M83A 3KEHA 3TNNA 1LHZA 1DCLA 1J1OL 1OALA 1U95A 5GSVB 1B0WA 3JT0A 1T5WB 2AANA 3BLPX 1GA2A 4HS3B 4JVPA 3AG4B 1U8HB 3SIKA 3CAFA 4NZ8A 3R18A 4X99A 2XWTB 1EV2E 2VSMB 4TVPH 3OXSA 3QJUB 4AGQA 1X6LA 3V5KB 3INUH 4HHGA 1GTFA 4XXCA 1HILA 1JI1A 3CVHA 4Y1AA 5E1GA 3GEWB 5GJTL 4ZX5A 2NY2D 3ZE0F 2Q10A 3HG1B 3A4DA 2W95A 5E2UH 1K2DB 3SDDA 1KIPA 1GAFL 5I8KL 3K3QA 1OLLA 1RJLB 1QHQA 4M6NL 5CCKH 5IOPB 2FL5B 5L0QC 3HR5A 4MS6A 1PKQE 5DRXA 3IJEA 5C2BH 1KLUA 2FSDA 2K6ZA 1CDIA 5JPNC 2JE8A 4DFHA 4XHJD 1TUPA 3HUJF 3VDAA 3EXJA 1E4JA 1W2KT 3P4NA 3ZO9A 5KSAD 1R24B 2YQ2A 2ZCLL 2YZ1A 4LBAA 4TSAL 2AJYL 5FGRA 2C3VB 5IB5B 3GB7A 4Q9RL 5DRNB 5BUGA 1CT8A 3KD4A 4UWQB 1U36A 4HUVB 1ID2A 2XN9A 2D03L 2XN9D 5ICYB 3DX7A 2ZUYA 1JZ3A 1JZGA 1OE2A 4MMYB 1HOCB 4ODHL 2XXGA 2LOEA 2VQTA 5D2LB 1XGZA 3BH4A 2C3XA 3QDJA 2CDEB 3QDJD 3IXAB 1X7QA 3VXOB 1TTAA 4HT1L 1FJ1B 4GW5B 1FRGL 2BOCA 4QHKI 3HG4A 3PCYA 4ICXA 1JPTH 3F00A 2MIZA 3LYRA 1V3LA 4Z7VA 3FN0H 4OFIA 2XVLA 1IGJB 5FCUH 1TVHA 2P24B 5IMKB 2GBVA 5HTSA 3KYOA 4DP6X 2VN7A 1OM3L 2NQDA 3BP4A 4QI3A 5DVLA 2CU9A 1WO2A 2F1BA 2Y7QA 3NCFB 3M1OA 4NFDA 1WAAE 1ETZA 2HJFA 4XOEA 5HYSB 5LDSA 2SODB 1JYXA 1LP9E 3GUFA 5HBBA 3QPQD 5ECJE 3NGBC 5GS2D 3ECBA 1F56A 3QFJE 1GY2A 1JDCA 1MCIA 5GGSY 4PS7A 3CX5K 3CZLA 3ZKQD 1ZA3A 2FUQA 4CSSA 3MNVB 1I9IL 3FT9A 1HE8A 2JCCF 3BI9X 4OW6A 4M9OA 5B7EA 4JCMA 3H7BA 7PCYA 1OGPA 4PG2A 1G7MA 3OJVC 3L4WA 4TMPA 4RGOL 4U1LB 1NLBH 2J8UE 4MZRA 2QGBA 4U6YB 4DKAA 2FNWA 3P3RA 3SGEH 3KPSE 4DW2L 3AU1A 1WD9A 3BDXA 3RUGB 3WJJA 4JJ5A 6CGTA 4JFHD 4YHOH 3W5MA 2XQYA 3ARFB 4OF7A 4PLJC 2GIYA 3DXAA 1PZSA 2PW1B 3DXAD 3TL5A 4F7KA 4IOIA 2GC4C 4NLHA 4JX0A 3PE9A 4HQQL 4ZPTA 4MA3B 4JDZB 2QTVA 5CWSA 4PJ7E 1WBXB 3S36X 3CLEH 3MO1A 1FBIH 4K3HA 2Y25A 5JXAL 1I8AA 4M3KB 3THML 1TJHH 3IPFA 4UV4L 4ONFL 1LEIB 4PJBB 4LDOB 1DJYA 3BISA 5ID1A 1GRWA 1MCEA 2ADJA 1O9ZA 2KZWA 1ZT4A 2AC0A 1T0NB 5E9DA 1YEKH 3T4YB 2FZ3B 5E9DD 3KPOB 1Y0LB 3CVHH 1NKOA 3EO9H 3W0WA 4EO5A 2W9EH 3W0WD 2EVFA 5B8CA 2F8XC 2UZYB 3AREB 3STLA 1RZKC 4L3AA 5MEQB 3QZWA 1RHHA 3WDHA 1A3QA 3DETC 1ITCA 1VEMA 5E4AA 4K3DH 3IKCA 4R4BA 1IKFL 1OHZA 1KXQE 2RD0A 4OD2B 1E5BA 3CX2A 1QLRA 3KBHE 4NWUH 2AZAA 4XN2A 3B4NA 1M3JA 3H4HA 3FU5A 3PV6B 4TUKH 2YUXA 3QYCA 1OF2B 1UATA 3TBTB 1E50A 1NMCC 3RWEA 4M6ML 3O6MH 5C0RL 3VMNA 3F6JA 4FCAA 1NCTA 4XWGH 4UT6A 1PLBA 2WINB 4AQ8C 2PTTA 3LKQA 4ZUTB 5GRYA 2H8PA 4MNGA 3NAAH 1N70A 4Y0GA 1QR1A 1SHWA 2H32B 3QUXC 2IALB 4WWKC 4ZS6D 2Z8VC 1JGUL 4CUCA 5T5FL 2ZCKL 2W60B 4P99A 3OKEA 2FEDD 1E2ZA 2C4XA 3BSZA 4NXSA 5DQ9B 5AW6B 4MQSB 3SDCB 4DZBB 4K9EH 3TEWA 4I89A 4GEIA 4JKWA 3BW9B 1NSNL 2HKAA 4YBLC 5AL8A 1BF5A 5BMFL 3KXFA 4LP4A 3KXFD 1K4CA 3MOBH 1OPGH 2J57A 2HH0L 4AXWA 1OP9A 1T66C 1DANT 4GW4A 2R1XB 1HCZA 8FABB 2ZZUT 5GS2H 3HZYB 4ATWA 1HESA 4OCYH 1W6WA 3QR0A 4JFZL 2Q6WA 3S36H 2KZBA 4OCXL 2F0CA 2CJSA 2P5WB 4K15A 4FGMA 3ZTCC 3DI2B 5ID0A 4R2GB 1MEXH 1BEXA 3U0WH 2JKWA 3HLKA 1AZCA 1CFQA 1ZA6A 1VFAA 1YZZA 2FO4B 3JV4A 3DX9B 3JUZA 2UZIH 2LVCA 2H0PA 4Z7UA 2IV9A 5DUBA 4Y4FA 5A3IC 3LS5L 2AJZA 4Y4FD 1R3IH 2WQRA 5IM7B 1DANU 3L5WB 1AHWB 4CSTA 3R4DA 1I85C 3IXAA 4DESA 1CFVH 2IGFH 1E65A 1XF3A 2G3NA 3SD2A 1NCOA 3FYIB 1O5PA 4N2HA 4NZTH 4X6DE 1D5XA 1G7JA 4TNFA 2EXWC 2B15A 2PR9A 1TZ8A 2CGRH 3BQUB 4N2KA 2IFGA 4FTVE 3QJHA 5FLUA 2BP8B 5MP6H 3TT3H 2W38A 4JMNA 4HU8A 3UTTE 4CMMA 5EEUA 4LMQI 1MNNA 3G5YB 1BEYH 4GQRA 4PGEA 5SX4H 1NFDF 3GLDA 4CVWA 4CC0A 5GISL 1ETJA 3V9FA 2D2OA 4UNTA 5HJGA 1KWGA 2MRYA 1PG7W 3ISYA 4GXVL 4PJAB 5E0FA 4IIQA 3ZDZF 4PV9B 1G9NC 2A7BA 2XT1B 3EOYG 5E5MB 4KX8A 5IG7B 2X70A 5EZLA 5IBUG 2FYYA 3REWB 2UXVA 2G60L 2Q76B 3LQAC 1EWHA 4HS6B 3EUDA 4FNLL 4Z76B 4MCYA 1HAUA 1SDYA 3MLYL 1RIUL 3LVEA 5DHYB 4N25A 2DD8L 4HIJB 4R3SB 1S7QB 3RX7A 3VD9A 4AJVA 1HNGA 1DJXA 4HG4J 4RMRA 4ZTPL 4X83A 4MX7B 4YAQA 1G5GA 2LFGA 4KKPA 1BF8A 1F3JA 1KXHA 1NIBA 3Q5OA 4IRJA 4IRJD 4LKXB 4QRPA 4WU5A 2CHZA 4HCGA 4QRPD 1W0VB 3GNML 4AGPA 2BNRB 5DMYA 5TQ0L 4LKCA 2HVJA 3TTSA 4FADA 5LWYL 4B3VA 5BV7C 5ETUA 1VCAA 3DI3B 3QJXA 3S2CA 3HG5A 1UZ8A 3AW5A 1UWGH 1A6WL 4K8RC 1R33A 4CJ1A 1N59B 2LE9A 2D7QA 2NXZB 3G5VB 4L8DB 5FM8A 2F8IA 2G75B 4LEEA 5I8EA 5TH2B 1YPZE 1NM4A 3MLRH 4XH2A 5D5MA 3KWWA 1MZZA 5DQJB 2WCSA 3CLFH 4IMKA 1A47A 4LSTL 3UERA 2B9BA 3GUTB 3OJDA 3BLKA 1S9XA 5I73C 3EYQC 3FAWA 2FLMA 2YRPA 1ED3B 3ARED 1GCFA 3AT0A 4XE0A 4F8LA 1G0YR 3L08A 2I24N 4G8GB 4ZX3A 1DBML 2Z91A 4G80B 5GRJL 3P11L 1URZA 1M05A 3DRQB 1QUNA 1R19A 1R5IB 1Z9PA 2VIRB 5CUSL 5DMJB 4ZFFA 4JFDB 4QUOA 3PNWB 5EOTA 1I1CA 4FG6C 2PUQT 4MDJB 3LRKA 1T2QH 2ED7A 5E4EB 5AW4B 1IGTA 4JG9A 4PJ9B 4HSQA 1JL8A 1KJ2A 1GKEA 1YEDA 4XAKE 2FWOB 1CVSC 3NFSH 2C1OB 3QCUL 4WKZA 3U1SL 4D7BA 1EXHA 3S8WA 1XMEB 3GBNL 3VNZA 1CVRA 1UVQA 4GMTL 2Z92A 3PP3K 3QQNA 5DR5L 1HHJB 5C0DB 2ITDB 2PR4L 3NK4A 2XV0A 3MRQB 5AVWB 2CO6A 3GMOB 3I6KB 5IREA 3ALXA 3K6IA 3NABL 4RMQA 3APNA 1XX9C 1JBJA 4FLOA 5F7UA 2ARWA 2WXHA 1WZMA 4LBEB 1A4CA 4X7EC 3V9CA 2FO1A 1USQA 5FFOA 3V4UH 1QO3A 1FG2A 4PRAB 3QNYA 3TBWB 1T0MA 1N8ZB 1A65A 3PNRB 1F86A 4ZFGH 1DVXA 4XPAH 4E41E 2APTA 3GSWB 4G6KL 1I8KB 4X6CB 4GUPA 1O0VA 2WIIA 3BQVA 3DRTA 3BAWA 4YS4A 4YUEH 4BZ2L 8FABA 4TS6A 2DYRB 2ZWZA 3LB6C 3QAQA 2ENQA 4O02L 1LTXA 2G9HA 3RL1B 4FLQA 4OSUL 2AJ3A 4QKXB 1II4E 5GS0C 5IZ7A 4NO2A 1A4AA 3SE9L 2CM6A 2EDXA 2IH3A 1E4WL 4DKEL 5C3TA 5F1SA 2XV6B 5JZ7C 4I0KA 1OSEA 2BNQB 3WN5A 4KAQL 1PW3A 2FO4A 1B9ZA 2EEXA 5GXBB 1X5FA 3QORB 1IM9B 1INQA 3RBGA 5TDNA 4M1GL 1J8HB 3RU8H 1IBFA 1KPRB 1W72B 4KY2A 1Z6JT 3BIAX 4DP8X 1UFUA 1L4IA 3NGBB 5G55A 3IN2A 2AK1H 3TM6A 3E1ZA 3ECQA 4NENB 1ZLVH 4FABL 1FFOB 3Q9PA 4XTRC 1CGUA 4ODUA 5L2KB 1UOWA 3IDXL 5T3ZH 1PNCA 1PZAA 4PB0L 4BSWA 5EUKA 4E2OA 4KRPB 5FYKD 3MLZL 3T5WA 1UYWL 1QSVA 3NIDE 4N20A 3SE4A 5K69A 4Y9FA 5EUOB 5ESAA 2P44B 3Q0HA 5I1KH 1VDGA 4L1HA 2QZQA 3WLBB 1MCOL 4XNUH 5I19H 4MQ7A 1LE9B 2VW4A 4O9HH 3LHPL 4FLRA 4N8UA 4ZPVB 5A16B 3ZTNL 4M5ZH 5TF0A 1E8ZA 1W15A 12E8H 3LDBB 2OP4H 5CN2A 2H1LM 4OF0A 3N9GH 3ARSA 3UIYA 3JBG7 1I4FA 1ORSA 4HS8L 1X9RA 4AIXA 2VMEA 3H55A 2FCBA 4LLVA 3P4OA 4LLYA 1BDYA 1KB9K 1S7QA 5TGBA 1NC4A 3BH9B 4D7PA 1NC4D 4MNHA 1N8OE 3CPLB 2YD5A 1KYOJ 2AZUA 4P4RB 1G9MH 3MUY1 4ADJA 5GGUA 1HAWA 5EEZA 1QFWI 1KPUA 3I85A 4MWFA 2P5EB 5KVEH 5DVMA 4AH2B 3UZQA 5I75B 2MQGA 5FGCB 1KJ2H 3CSYB 4QHKJ 4HC1L 3I02B 4KZ0A 2GI7A 2QGDA 5EPMB 5A2JH 2ZKHL 4N1EA 1P9MC 3TURA 3UTPE 1EGJA 1G4RA 4J39A 1HU8A 1IAOA 3N5AA 3I6GA 1KJVA 2VXVH 3HMWH 2NLJB 4H2CA 1U8QB 2AXWA 4I8DA 3UBXB 1GSMA 5F3HB 4H8UA 1FUNA 3E80A 1RLBA 3RL2B 1WCBB 2NXZD 1XR9B 1A0QH 3LH2L 4G1MB 4YQXL 3PS6A 1WAPA 4LDCA 2UWEE 5F1NA 2YK1L 1A7PH 4FXKA 5HVWA 3MV01 5IESL 2VMDA 4N0UB 1QEWA 1DTUA 3IE4A 4EI5C 4LEOA 1BVZA 1XQ4A 4IU2B 4LQ1A 3KGTA 2R29L 5IF0A 2FLRT 5DTFA 5JDSA 5FW7A 1GZPA 5KVGE 3IMBA 4TTDD 3C2SA 2FATH 4N2AA 1MRDH 4G8GD 3IMSA 3QUXB 4WWKB 3GDCA 3ZHNA 4A7QA 1AMYA 5BRZE 4I2XE 5IBLC 4PRPA 2M2DA 4I7ZC 2PTUA 2IOIA 4MYWB 1ZIBA 2YBRB 2WN3A 1R3JB 3F65A 1JDAA 5D7HA 4U3CA 1OOAA 1UZ6E 1IGCL 1OCWL 1HWGB 2X09A 1QW8A 3G5ZA 4XNYL 4YBLB 3T77A 4IKJA 4BKSC 5EEVA 1ZVYA 3OLGA 4PJ9D 4FE9A 4W9KC 2OK0L 2JQAA 4WCYL 3ARRA 3U2JA 5JHDB 2YPLB 2IGLA 4MDIB 5EEWA 4QRTA 2Y1VA 1L9PA 5DK2A 2Z9TA 3BVUA 2DWDB 3UPRB 2CBMA 3VAEA 2OMNA 5EU6B 2GAZB 3ROOA 2WGXA 1YEGH 5C9JA 2X0VA 5ITBL 4R0LC 3PUCA 1NPUA 5TK4A 1BG9A 1KTLA 2YA2A 4NQTA 4CJ0A 3PWNB 1ZVSB 1S5HB 4EIBA 1HL8A 5ILTL 4D0DA 2AV7B 5F1IB 4JHWH 4GQQA 1TFPA 2J8OA 2VR4A 5CNHA 4WQOA 5C07B 3ZO0A 3FFDA 3HMXA 4FA8A 1LNUB 4G8IB 3Q48A 2Q7NA 2N7BA 3BD3A 2EZ0C 3FPXA 3C09C 2XWJB 5D72L 2EDLA 5EOCJ 4QRAA 4JLRB 2VISA 1L9RA 4U1NB 1BIIB 1MREH 2R0KH 1OXYA 2ZUWA 3KG5A 1MLCA 1OB1A 2BNQD 4GKZB 3LAFA 2PLTA 2A38A 1KJ3L 4O5LH 5IGXH 3J27A 1IM9A 3QORD 1IM9D 2FHCA 3F05A 5HDBE 3QH3B 1MIEH 5F89B 1J8HD 2OMBA 5AW8B 4B9IA 1A1NA 4XMUA 1CGWA 4ZFOA 4ANXA 3DMMC 2J2ZA 1SJEA 2UZXB 5KJRH 3BESR 2MCAA 4AZ8A 4EUPH 5C0IB 1EGJH 1OLZA 5J1TC 3JWOL 4X5LA 4DN3L 5L2KD 2XDHA 1M7XA 4P06A 1PDKA 1QBLL 1KIUB 2IWFA 2CUMA 3RVUD 4JRYE 2FGWH 3BUQA 4KRPD 1G6RL 2YFNA 1KN2H 5AVSB 4HMEA 5DC4B 2QQLL 5IW1B 3QQ9D 3MLTA 4JPIB 3F5WA 4KK8C 3H1ZA 2ZOKA 3TA3A 5FO9A 3TA3D 4FZ8L 1ORQB 1TSHA 5C0GA 3T8XA 3NP3A 5ICXA 1T80A 1LE5A 3LZLA 5BV7B 1TLMA 4FYQA 4BM7A 1JD7A 4X7TB 2BLFA 4U1IA 2EDDA 4PI0A 3HN5A 1KFAL 3KGRA 4JFQB 4NLAA 1BVOA 2O6EA 5DD0H 4NQCE 1PY0A 2YBGA 1WICA 5HHNB 2P8LB 2AMGA 4HWEL 2AQNA 4AEHH 4H4NA 4QJ3B 5JYLA 3FSZA 1QFWL 3OHXA 2JJTA 1ONQB 1Y18A 3GMQB 3CFNA 1XH3A 3CIAA 4WSKA 1V3MA 2XUWA 5JR1L 1JGVH 2G3ZA 1EAPA 2ZONA 3T8MA 4CL7A 5GGVY 4JRFA 3L9BA 3NEOA 1YDPB 4FQJH 1Z9OA 5IVZA 1UWFA 5CILL 4MVBC 4MFHA 4P9ML 3NIGE 2H4EA 4ES9A 2XTSA 5JPMA 3F7LA 1IT9L 3D9AL 4J3WA 3WE6B 5KZCB 2VQUA 2FRGP 4NWTH 3AY4C 4MXQC 1SXAA 5D7IF 5HHQA 2Z8RA 4BWUA 4ZUUB 4A7TA 1PKQA 1HXMA 4K5OA 5I30H 3MREA 4APQA 5JW5B 1C5DB 4W70A 3A24A 2QR0A 3HI6H 3FQRA 4OIIL 4ZZKA 3CU1A 2ZSWA 4QY8A 3UYPB 5CJ5A 4XXCC 5D7SH 3MV7E 4OKVB 5EU5A 2X4RB 2ZWKA 4NZJA 3RA7L 2NY2C 1E9QA 3ESPA 1CQYA 2VW7A 2AK4A 1K9TA 1LO0L 3CDFA 2AK4D 3D0LA 3HMXH 4NC1C 4BSJA 4C83B 3SDDC 4XXDA 3T65A 1J0HA 5I8CA 5I6XC 1OPOA 4B50A 2QT6A 1LK2A 4OZFG 3QUMH 3EW3B 4PD4J 1EA9C 2HTKD 2IDUA 2XA8L 3PXJA 5H4ZA 2YSSA 3WU1A 1XGPB 1ZTXE 2ZF9A 4LLQB 3AXIA 1PMYA 4X80L 3TEXA 1J1XH 5BVPH 3MI6A 3W82A 4H5SB 3APDA 1A7BA 1FCGA 4X6EB 4H20H 3DPDA 1F2QA 3IJSA 3Q2CA 2BWQA 2ADIA 1KELL 1PAZA 3IAQA 4JE4B 2JKRM 3GPEA 2MJWA 4FQCL 4BZ1A 1GYCA 1YJDH 1XZWA 3TJEH 5J6GA 2HP4A 2Z6FA 2A6DB 1PY9A 3BVWA 1WAAA 3UTQB 3EYFA 3FCGA 4MLSA 1LP9A 5EU6D 2BIPA 4RRPG 2V9QA 4OZFB 4DWHA 4IS6A 1WA0X 3QFJA 3QFJD 4WWOA 4QAWA 2Y7NA 3ML8A 2EINB 1Q0XL 4EOWL 1QNZL 3EGXB 4K9EC 1R5WB 1JDDA 3UTZB 1WS8A 4AIZA 1BXXA 3TVMA 1HKLH 2VOTA 2DLFL 2J8UA 1CLCA 5C07D 1CLYL 2RFXA 3KPSA 4GAYB 3MRFA 3NIFF 3QQDB 5EBMB 1E8XA 4B7LA 3OG6B 1NCCH 3MFFA 4U31A 5IFHL 5DJYB 3VO0A 1N26A 5HP5A 4L4TE 5A2IH 1KTDB 1OAQH 1RV6X 2VH5L 3TJHC 4K5MA 1JXDA 1YNLH 3C12A 3K5SA 2XU9A 5KBPA 4PG2C 3HIZA 4LSQL 5TK2A 4PJ7A 4Y19B 3KLLA 1EO8H 3EDEA 4Q89A 4Z3IA 1M1SA 1XF5B 2V7NB 4M93B 1YYLL 1JNLH 4LL9A 4PJCE 4YBHA 1J9QA 5EIVA 2AEOA 2JKSA 4KZDH 1VGEH 3VI3E 1X7TA 2ZKXA 4I4WA 4NRXB 4DPBX 5JTWA 4JO3H 3FNKA 2YD6A 1UGKA 2E9JA 4JR9H 3FONB 3WKQA 2AJXL 4DK5A 1RUKH 3CVIH 3ZDXB 4Z7OF 2TSAA 3P69A 4E42B 1EX0A 1RZJH 1KXQA 2XICA 5J1SC 1EQWA 1B4LA 1JK9A 2WKOA 2E47A 2IAAC 4WW2B 3SKOA 3CZNA 4XPFH 7FABH 4TN9A 1HVXA 4XP4L 1NIEA 1ZLEA 3AABA 4GSDL 4JPQA 3SHSA 1EAJA 1WHPA 3OXRA 2NNRA 2P5PA 5ISZE 1FNLA 3WIFB 4CW1B 1UJ3B 3K6OA 4PJGF 5GRVK 3VCLA 3QUZA 5CD5D 3QUZD 5KYYA 3OHMB 4MJJA 4JAMB 3G6AA 4ELMB 3GXTA 5CMAB 1JFHA 2CQVA 5IW3A 2DQCL 4Y2DA 3V6OA 1I1AA 2YLHA 4RAHA 1KYFA 3GMQA 1G7LB 5B38B 3L4ZA 3B7UX 2NX5E 3HZMA 5I1GL 4FULA 1RUQH 1NCDH 4OF5A 1LD9B 3WEMA 5G4NA 5J5EA 2XXFA 4IEFA 1YC8A 5ABZA 5LGHL 1GYWA 4EI5B 5F1KC 5I1IL 1P2CB 3B43A 2QVMA 3MOAL 4JRXA 4BZ1H 4JRXD 4TQEH 1PZ5B 5IB4B 1AJ7L 1IBZA 4OAWA 1ACXA 1XXFC 5FFLA 4N2GA 2VKXA 5HI5D 2Q3AA 3VXMB 2XJKA 3RNKB 5K9JH 1L5GB 3PG2A 1AGEB 2AEPL 1NICA 2WSDA 3F58H 1PFCA 4JQVA 2ZXCA 3WTTA 2R7EA 3BSHA 4HIPA 3BDYH 4L1SA 3H0TA 3T2NL 4GRWB 4NNPH 4L3EE 4MZ3A 1U3HA 3UMTA 1U3HD 2GY5A 4WW1B 4K5LA 2AW2A 3AXLB 3CZFA 2ZKWA 1DQDH 1F0LA 1FVCB 5I16A 4J3SA 2ZJSH 3EHBC 3FQWB 4KDWA 3WS3A 1GGIL 4YDVA 1BG1A 4PWIA 2F5BH 3FT1A 4O2CA 2ERJC 4PGZA 1KZYA 3L5HA 5CGTA 3L5XH 4R0LB 1Q1JL 4IJ3C 1U4EA 3FQ1A 3P2TA 4A6YL 3BH8A 3RJQB 1P4BH 4X6DA 4GS7B 5FXCH 3E6FA 3CQPA 3D2TA 3DGCR 4NNXB 4XC1H 1T0PB 4FTVA 1CLOL 2H3NA 4V2BA 5EB9A 2D73A 3PAVA 3FO2A 3NZ8B 1WFTA 5K9QI 4K7FA 4AVIA 1A02N 1AVAA 2AS5M 4ZD3H 4HH9B 2PN5A 1GOGA 2E7LA 2A6DA 5EA0L 2XRAH 2WOYA 2BZDA 1BQSA 2CD0A 3KH4A 4HIHA 4AOFA 5F9DC 1NJ9B 3R19A 5DD3L 2DQ6A 1TETH 2PKDA 3DUUB 1P1ZB 4OJFH 4PRBB 1JXJA 4YVNA 3ZE2E 3I3BA 3EJQA 4JN2B 3FB7B 4F24A 3BZ4A 4FQHB 3UADA 2IG2L 2WUBH 2CDGA 3QNZA 1KXTB 3O81A 3Q9QA 4P59H 4JN1L 2V37A 1EJ8A 1KJMA 5H35A 1CXIA 3S2AA 4BUGA 2O5XL 3ZZ1A 4PJEF 4F7EB 4JHUA 4Q52A 1YUHB 2DDQH 2VMJA 1EAQA 4IIQC 5EC1B 1TZIB 4FHKA 2DM2A 1A6VL 3WKMH 3UZEC 4YHLL 1URIA 1SJVA 4WI3A 3EYVA 4ZAKA 3MRGA 4ZAKD 1OK8A 2I9LA 1E4HA 3EF4A 5E8PA 4RRPA 1Q72L 3UGXA 5EU4A 4IRSA 4Y19D 1YNTA 4A2FA 5FWQA 2QZ5A 1TXKA 4WTXA 2DJSA 5JIKA 4P2CG 1RZFH 2OQJA 5I26A 3UACA 2ENYA 3ATEA 5LKNA 4BH8B 3GZQA 3DOHA 3G08B 2AQ1A 3UAJC 1YPZA 4OT1L 4PUBH 4PAZA 1JWUB 25C8H 4ACTA 1DDTA 5L2JA 4U05A 4Q9QL 2WLNA 1RZIA 4YHIA 5JXEA 1UTDA 2WYZA 5JXED 4Z0XA 3OPZL 1P5VB 1UB5A 3RWHA 5E1AA 2OXHA 3RBSA 3LCYA 1SEBA 2CPUA 4LOUD 3FT2B 3U82B 3U7WH 4NYLA 3WDIA 3VSVA 2H26A 4PR5B 3MNWB 5D1XB 3SDAA 1SY6L 5F0PB 4IMKC 4KXAA 2X1OA 1BBJB 3TPUA 4JKNA 1JIBA 4TOYL 1DEEB 3IFNH 5CJXC 4HD9A 4POZD 2VLJE 4HIXL 2DQFA 3DNKA 5GIRB 4XNXL 4TSCL 5GGVL 2ICWA 3T0DA 4XAKD 3EDJA 1WBYA 3OL2A 1EXUB 1SVZA 1UWXK 4LSUH 1VENA 4XBPB 5FYLE 5E8NA 5F0JB 4PY7A 4PWEA 2YOAA 4NQDE 1SGKA 5C0ND 4K71C 5C0EA 1U8MA 1NPNA 3ERXA 1J9CT 1T1YA 3HC4L 2EYSB 3D85B 4KMLB 3C8DA 1TYEB 4X0KA 2HWZL 1CFNB 3IJ8A 3QQXA 5E51A 1LEGA 4G7QB 1WGOA 4AV4A 2C9XA 4NM8L 3HBQA 4PMFA 4A7UA 4BFEA 1BQUA 4LVHB 1MFDH 4PS3A 1GGBL 2FQDA 4HKBA 1P2CA 4JRWA 1SF3A 1B6UA 5I82A 4ELKA 3VXRB 4HJSA 2ZXEB 4WHYG 3GK8L 1PZ5A 5IB4A 3RWIB 4E41A 1QSEE 4OFKA 4JG0L 5D8JH 2I85A 1FN4A 3Q6FA 4GRMB 1WA1X 4DQOL 4XO4A 4DEPC 4BXVA 4HHWA 3VXMD 1NBZA 1AO7B 1LO2H 4FFZA 4X5XB 5CP7B 2V9TA 2GJ6B 2HTLC 2VJ8A 1PZUB 4YE4H 1I3RB 5AVXB 2JJSC 2OMVB 5AD0B 2F53B 4KROB 1D7BA 3AS0A 1QMUA 2DEYX 2IBZY 4GG6F 2NY6B 2WXGA 2VDKL 2BW4A 1G9HA 2GCYA 1EFQA 3MXWL 4S2SB 1XVSA 1PQZA 3L3IB 4GG8A 3SQOL 5D6DA 1YQ2A 2FQEA 1IVLA 1OZUA 3HC3L 5F0MB 4I3RH 2B08A 2G5BA 2WZ6A 1TTGA 3CDZA 3DKHA 3FFCB 4XI5C 3AAZA 5GGRY 2ENPA 2ZWSA 4HG4K 4IGBC 5CLZA 2OR9L 5F6HJ 3WN5C 1R1CA 3MGTB 3RAJL 2ITFA 4ZSOB 3UH8A 3KGUA 2YGPA 5L6YH 1B88A 2VT0A 3Q1SL 3L1GA 4FYTA 1KGYE 4NT6A 1BBDL 4NP4L 3FU7A 4A39A 43CAB 1QPPA 5I1AB 2D2CC 1NMBH 4F8NA 3O3DB 3ZY7A 2ZUQC 3TFKC 3LV3A 5A43C 4R7LA 1CIDA 4BWTA 3U46A 3WJLA 3MAWA 1YYMH 5E6SB 1G7PB 3EFFB 3TV3L 1AGBA 3U2SB 4LCWB 4AUJA 4U6XB 1QRNE 2QKSA 4QNPE 5T5NF 3V6ZB 1I9RL 1MFNA 3KPNA 1NLDL 1R3KB 2VDMB 3R0NA 2OSLB 1GGCL 2X53A 1ZVHA 4WK0B 5I1JH 4LPWA 3VD2A 1W0WA 2WXOA 3HAEB 4HUVA 4G6ML 4JY4A 4EIUA 1RZ7L 1A4KA 4TSBH 5J56B 4X7DC 5DXWA 1P84J 3OBAA 5F3FA 3GIZL 4LLUB 1YUHA 1OWWA 4WJG3 4BDVA 1AZBA 4LEXL 2VSCA 3IFPA 4FL4B 4ERSL 2VDOH 1EO7A 5H94B 5AVTB 2QSVA 3MROB 5L4MA 5D71H 5J0BA 1YAZA 4LASH 3QFGA 1QYGL 1XB8A 4OQ1A 3UOAB 3NP4A 4BFIB 2CO3A 1JV5A 4D0BB 2PW2A 3GXFA 1E9PB 3IM1A 1CDUA 2VDNB 1CPUA 1N0XL 4U1MA 4MNQE 4YDIH 4F7MA 1SXSA 1KULA 2UWEA 5D1QE 3WXWH 2YJLA 3S4SA 2I9TB 3ZYJA 1SMDA 2OMTA 1TF4A 2TAAA 5CN1A 5LJYH 1DJSA 1FC1A 3II2A 1NUDA 1B3IA 4MBOA 2FUTA 1J5DA 3WEAA 4BWWA 4F7CA 4UUJA 3WLWD 4OZIE 4HEPG 3O0RL 5IUSA 4IHOB 2CO7B 4UQ2B 3IPEA 1EMTL 1Q9OB 5CR1A 2R4RL 3WUWG 1JGLH 4G6JL 3ZZLA 1W0YT 4FFZH 4G8FB 4AGLA 2D0HA 4X7FC 5BRZA 4L0ZA 5BRZD 5D1XD 2VABA 4Q4EA 3VFOA 5DLMH 1KACB 4WO4B 2QPUA 1MHEB 3IDGA 4N2LA 3CLWA 2CK2A 3GMRB 1GS8A 3VGGA 3MYJB 1CD1B 1DR9A 2IEPA 3RWDB 4UNVA 1U93B 2ADFL 3NCYS 1XGUB 1JWSB 1J1OH 3QRGL 4K7PL 3N50A 1X5LA 2BP0A 2CLVB 1KGCE 4TM9A 3F04A 1KYAA 1NTDA 4P5RA 1E9OA 1A5FH 4PPTA 4CBPA 4UAOB 5K1NA 1FO0L 4QIRA 1J5CA 1A4JB 4QRQB 3FRUB 1SLXA 1CDHA 1F1GA 3D85D 3C8KB 2R15A 4Y1TA 2NDGA 3R06B 1KNOA 1MHCB 1AG0A 4NC2B 3WEXA 5GJTH 3ETSA 3G3LA 1S7TB 4L37A 1RU9L 5DJ8B 1Z0MA 3ZE1E 1GAFH 3EHBB 4F92B 5SV3A 1TT6A 4M6NH 3GKWL 3OF6D 5ERWA 3IYLW 5GGQL 5GGTL 1M2OA 1U8IA 3WGUB 3DROA 2ZCLH 3AJ7A 4TSAH 3V7AE 1JPFB 1WFNA 2EDOA 1MCRA 3FDWA 1AO7D 3HBZA 3I50L 5CP7A 2C26A 4EN3C 5HYIA 5J1AB 2Z31B 2D03H 4KROD 3JWNE 1KCVL 4WI0A 2NY6D 2GB2A 2XZAH 3WTVA 1UFGA 5HYQB 3O6KL 1JWMB 3EFOB 3X1GA 1UM4L 4NSKA 1OAUH 3QRLA 1KCBA 1D2OA 1FRGH 3ULUL 5FAAA 1PGRB 4MCZB 2P7TB 4HIIB 2Z35A 5HYJB 5T5FA 5AL0A 1KF9B 4LESA 4I13B 4WKXA 3OSKA 3J8F7 1SHXA 4AY0A 4JRYA 1OM3H 4JRYD 1XZ0B 4Q8BA 4RIRA 3MRDA 1B4TA 1O6SB 5HXMA 4AV0A 4M5TA 5G5DA 3GRBA 3MV9E 3UDWA 1YJDC 5JW4Q 4HOWA 2D7MA 5E1HB 2BVPA 2ZKYA 4PJDB 1I9IH 4B9PA 4XP6H 5ESVB 1BFOB 4UOW1 4PB9L 5TE7L 5KVGH 1MH5B 1MUJA 1ZSHA 2ARJB 1ZHLB 2VN4A 3V6BR 4G9FE 1R3KA 4NQCA 3ULVL 4DW2H 4NQCD 1OE1A 1J1PL 3A4EA 1P5UB 3TNMB 2DQUL 3TO2A 1PJ9A 2IF7A 3ALWA 2OMWA 2ED9A 2A4ZA 5CO1A 1ASOA 3ATBA 3I3EA 3L3DA 3SGDH 1F6AB 2WSPA 4M62L 1A6TB 3B7YA 4YGVB 2XKNB 4HQQH 3G5XB 4BSVA 2DWEB 3STZB 4L8SC 2WY3B 1HSBA 1IARB 1YA5A 4U6HA 2ODIA 3GTNA 3H53A 3N41B 3AG2B 4AIEA 2IPKB 1I3VA 5JXAH 5TDPA 4O4YL 1NAKL 3HFML 4U4IA 5E6UB 3THMH 4UV4H 2NY0B 4ONFH 1TQBC 1KGJA 3ZU8A 2B1HH 1PX3A 3MRBA 4UM8B 5CSZA 3ILQD 2C5DC 3OHXC 3VG0L 3BCFA 2X4OA 4Q2ZB 4ZOAA 4WEBL 5H37G 3TV8A 3HCVA 3KPMA 5EO0B 5EU7E 2VC2H 4AYFA 4WGWB 2PWGA 3V0FA 3S3PA 3VSUA 1BD2B 1LDSA 1RFDL 1F1DA 1U8KA 3LD8B 3MV7A 5HYFA 3MLUH 1DVFB 3VFMB 4NO5B 4V33A 1IKFH 1OP4A 4ZMZA 3A4AA 1TMQA 3O3BB 4U1KA 1YN6A 1VSCA 3PU7A 1SXZA 3O3AA 3ZYOA 4C56E 2GK2A 5ES4B 1I8IA 1IGYB 2PYEB 1N0LB 1OOWA 4CU6A 3EH5B 4NO3A 1GHFL 3GEFA 4APQC 5IVXE 2YLKA 1A7OL 2IDFA 4PRIE 2W07B 3MA9L 5DZAA 4P2OA 3RTQB 4P2OD 5TE4L 3MR9A 1CE6B 4OLZL 5LXGL 5C0RH 2E7BA 3UEQA 5FR3A 2JIXA 1FLRL 4LNRA 3QIBC 4ZQKB 1AQDA 5DHEA 4U3XA 4YHKL 4QHUB 3WNOA 4EDWL 4C4UA 3MLPA 2FBRA 1EH9A 2K8MA 1D5BA 4DEPB 1JGUH 3Q8AA 5T5FH 5I18H 4HEPA 3BE1L 3C6EA 4ONGL 5C07E 5CZVL 4YXHL 3BGAA 1MFCL 3WEOA 2W81C 1WH0A 4QHLA 3WUWA 5FM4A 1Q9LA 2UUDK 1NSNH 3UO8B 5CZRA 1BLNA 2PYFB 1MCSA 3PQYE 1DUZB 1DBBL 1FGVL 5C0JB 1E42A 3ZBMA 1DQIA 1RZ8A 2V8LA 2VM3A 1R46A 3U7AA 5LB1A 4XMPL 4WUUE 5D4JA 4PWKA 4PBVC 5K1JA 4NN5B 3LZFH 4JFPB 3ZGHA 5CBAB 4JFZH 3G04B 3MRKB 3D25B 2VSDA 5EIQA 5I2IA 2YA0A 1M3IA 3U4EA 2XLLA 2E7HA 3VDBA 2N0KA 4IGBB 3WNMA 4Z3EA 1JPFA 3IB4A 5KSUB 1R17A 1WC7A 4IJTA 4CVXB 2ZUUA 2R59A 2VTFA 3QJQB 3KVQA 3ZZSA 5D1ZI 4X8XA 2Z31D 3TVMC 2ZP8A 1HHKA 4NM4L 3LS5H 3AB0C 2Q7AA 2OKMA 4ESKA 1UCBH 1KBGL 1ZGLB 5IB1A 1OGTB 1TJXA 1ZS8A 3EFOA 2WQ8A 4PJCA 1T6BX 3B9KC 3LKRB 1NDMA 4AYDC 4NHCH 4P3DB 3N42B 2YD9A 4KMTH 3VI3A 4HOZA 3P77A 3KBPA 5G2NA 1XAKA 4DCQA 2LQRA 2BMKA 3PPEA 3QO1A 5DJDA 2CIIB 1TDQA 4J6IA 4QXTA 3H6JA 4ZYKB 1HOEA 4YSQA 2WTPA 5JOFA 2X38A 3X11A 1BZ7A 1H8OA 4OF6A 3BRFA 2PPEA 4AGMA 1BA9A 1E2VA 3BKYL 4PCYA 2XNAA 4ZMVA 3MCYA 2MNWA 2ZUSA 3NPSB 2NZ9C 1F00I 5GISH 2H0EA 1O6SA 3L95A 4A7GA 1W80A 3OLEA 4HUKB 5GZNA 2VDLB 4GXVH 2QL1A 5ESQB 2WO3B 1U2CA 3EJYD 4PREA 4YPGA 5GZND 5HVGB 2W8CA 3DTXB 3MXVH 5TF1H 4BZ2A 2WPGA 1C7SA 4OLXL 3LKPB 4O02A 3U6RB 2RAMA 1Y6NR 1MXGA 3BVVA 4B27A 3FKUS 5F7EL 2G60H 3LMJL 2OSYA 5BZWB 5ISZA 4XNZB 5ISZD 1KIQB 5EZIL 3MLYH 2DD8H 1VLXA 3VU1A 5DJAA 2ZYIA 2ARJA 1T3FA 4J12A 2P8PB 3LPOA 4WSGA 5DJCB 2A0LC 4RGNE 4GLRI 4ZTPH 4FMKA 3MTRA 4PJIB 3M6DA 2A9DA 1ZTXH 4LGSB 1S4IA 2Q20A 1ZAGA 1YRKA 2MEJB 4NUGL 2L4OA 3GNMH 1U8LA 2NX5A 2JJUA 3B5GA 2GBUA 1A9BA 3RTLA 1L7TL 5LWYH 3JQOB 1E4XI 3N43F 2DWTA 4LVNC 4QYOB 5KYWA 2OYPA 1KTRL 3PJSA 4KC3B 3STZA 3WFHB 2ZP9A 2AQ3A 3OB0K 2J5LB 2EXSA 3QULA 4YGAB 1A6WH 4I77L 2JCWA 5FEBA 3X3FL 4XR8C 5DJZB 2Y5TB 1U30A 4PN6A 5GGSA 2LR4A 5KYXB 1ZGLP 4Y2DC 1I1AC 2XWBB 4GAGL 4N87A 1IB5A 4ICWA 4Z7WB 1Q0EA 5MEOB 3MRRB 3HRPA 1BFSA 3SBPA 4LSTH 3SKMB 2XWDA 3BD5A 1IEAA 2AV1B 1J18A 3SKNB 4ODVL 4PJ6A 1D5ZA 2XIIA 3P9MB 4O2EA 1D3CA 3ES6B 3MBXL 4L3EA 4L3ED 1DVFD 4K55A 3M45A 4HCRL 1OSZA 2HPOA 1DBMH 4X8JA 5GRJH 4FFTA 4JNXA 3WFBL 2BOLA 3P11H 4Y5VA 5KWYC 1OSPL 2X1WL 5CUSH 1GC1H 2WANA 2BSSA 5F7DA 5HI5C 3A6CL 1N0LA 3EOTL 2IAMB 4GB9A 5AW3B 1HTYA 4M4RB 3FSVA 1JVOA 5DHVA 3RTQA 3RTQD 3POCA 3T6VA 1T04B 2R4SH 1UXSA 1PEWA 5ACLA 4FQXA 4HC1A 1U3HC 3QCUH 3IPBA 3U1SH 2E6PA 1FAKT 3MFGB 1NIFA 5ALCL 1BHGA 4GMTH 4Z7NF 4HKXA 2E46A 4MRBA 2VR6A 5DR5H 2D0FA 2PR4H 3IJHA 4FNRA 2HLAA 1CLVA 4PP1D 3NABH 3RX5A 2ZUVA 4R96B 1I3GH 3GXNA 3SO5A 1X5JA 4R26L 1Y6MR 3EIFA 4QR7A 4EN3B 4KKLC 5DRZB 4ZMNA 4WEUD 1XCTB 2W9LA 3DSFL 5L8KB 4GI8A 3LEVL 4AEIL 1IGIL 3ZE0B 4BRJA 1EO5A 4G6KH 4WK4B 1UD8A 2R29A 3QWOA 1X5IA 4RLDA 4WSJA 4W9CC 4BQBA 3U1QA 3PWUA 4BZ2H 5LG1A 2YPKB 4O02H 3QUMB 5MHSE 3BN9C 4OSUH 3WY2A 2BS8A 3B2DC 1V7MH 4HKZB 5L8LB 4GAFB 1MDAA 5AUMA 5C7ZA 3GMPA 2A6JA 3OMAB 3VNYA 4DKEH 1XGTB 3FQUB 3MNZA 2OM5A 1QX1A 3L54A 1PF3A 4JHZA 4WENB 4KAQH 5E1QA 2AXGA 3QDME 5DFTA 4FI7A 4J4PA 1T1XB 3BZEA 3DURA 1HCVA 2QSTA 4M1GH 1VKXB 4GKSB 3C9NA 4L1DA 5DJ6B 2QQNL 2ZPKH 4HFWA 1CGSH 2V5SA 2A74A 3CHQA 5IB3B 5BO0D 5E7FA 1S7XB 3CSBA 4OCWL 4FQIL 3KNBA 3VVWA 1JZ2A 3IDXH 4KQ3H 2BSCA 3CH8A 1X9QA 3RVTC 4PB0H 1AS6A 2Y23A 3EF7A 1SOSA 2XIDA 3MLZH 4ZG1A 4JPKL 2Y07L 1S9VB 1UYWH 3NK3A 4FFVC 1RUMH 3MLVL 4IRSC 4B9FA 1GOHA 4O51A 1MCJA 1U8NA 2KT6A 4LPXA 4KKZA 1GKOA 4YSOA 5AOLA 1VFBB 2OCCB 4FEMA 5J3HC 4DGVH 4GMSL 1ZSDA 2IDTA 3MJ7B 4QRSB 3KL3A 4OJAA 4PCKA 1B0RA 2CRYA 5FKPA 5JIHA 3SDYL 3CSTA 5ACZA 3RZCD 2RGSA 1UCTA 4XCNB 4X4XB 3NQKA 4ZO6A 4AG4L 4Y8DC 3NZHH 2VZ3A 4L8SB 3GZKA 2QPEB 3I84A 5AB0A 3K6SA 4ZFZB 2JCCB 4AQEB 2BVOA 3H3BC 3MRLA 4HS8H 5F7YC 3PWPE 1DDHA 5CINL 4NRZB 2VLJA 2VLJD 3P02A 5LGYA 2JKXA 4LPVA 4WU7B 4MQXD 5D2NB 2PABA 1N67A 3V7AG 2BCKB 4NQDA 2A9NL 4P57A 2ZX9A 4NQDD 3SDAC 3CUPB 1E4XL 3U48A 2OA9A 5DHVH 5AOMA 3FTWA 3V0WL 4YXKL 5KSBE 3ULUE 1BLIA 3JWNG 5AKVA 3L45A 1IRAY 1XGYL 5FB8A 4X5PA 2ZKHH 5CZKA 3V4PL 2FWSA 1KB5L 1UACL 1NKGA 1IX2A 4WNSA 1DFXA 3T09A 1YN7B 2DTML 2QADD 3SDXE 3VWKC 1C12A 4QHMA 3VWJA 4Z7IA 3VWJD 3O6FB 3H9SE 1OP5H 1G6RA 1Z5YD 3S5YA 1BW8A 1INDL 3LH2H 1OT4A 3L6FA 5K33A 2N7SA 3CFBB 3D18B 4NDMB 3WL9A 1YY9C 1J86A 3FOMB 5C86A 1I7RB 2YK1H 4QRRB 1TNMA 1IU1A 5IESH 3JVGA 4Z95L 3HLAB 4NRYA 3X14B 1NMAL 1U8OA 4L29A 2R29H 5IT2L 5IV2B 3QUYB 3FAXA 3V0VA 2O26U 3ILPA 1UXWB 4GFXA 1EEZA 3ULVE 2VDPB 5DZOA 4P9HL 4MCNA 2BHFA 3AQXA 4NKOB 1THCA 2O5YH 3AMLA 4LOVA 2VDQB 3MC0A 2DBLL 5E6IA 4GAJL 4IK6A 4JL1A 4KTGA 1A66A 1QSZA 1E27A 2IAMA 3GMLA 2IAMD 2F54E 2ZOWA 4I9WE 3E2HB 3DBXB 1OCWH 4JJOA 3BMVA 2MTPA 2X4PB 3QEUA 4FA7B 3WHXA 4LCCA 5AWNL 2L7UA 4R7DA 3GDBA 5HGDB 3BT2L 3KW8A 2OK0H 4WCYH 3VXUA 1KLFA 3MRPA 3VXUD 3GM0A 4D9RE 1A1MB 1DLHA 3CXDL 5D6DC 2JB6B 2VLKE 1F4AA 1P6WA 3MBEA 1J88A 2B7DT 2OJ1A 3MBED 4MTMA 4OLYL 2EECA 3RP1A 4LU5H 2GT9A 2GTZA 2ZX5A 5ITBH 1WG3A 2CWRA 3CC1A 3UYRL 5JHMA 1IAII 4V11A 4L4VB 5DI8B 4Z5RB 1RIHL 5ILTH 3BVTA 3VSTA 5HGBA 3MJ6A 5GSRA 5FUOL 3Q8EA 3V0IA 1DBKL 2VNCA 4M1CD 3P1VA 1I7UA 3NACL 5IK3B 1F4XL 4KO5A 3BP5A 1AGFA 2WLKA 2GTQA 1XO8A 1HH9A 3DX4A 5FC9A 3B9KB 5D72H 1M71B 3W5NA 3IAPA 1VB9A 1BJ1J 2IJ0C 3SCMB 3HUJA 3WJLC 5E95B 1MJ7L 4N8VG 1T20B 4WI9A 4DPCX 3FO0H 3V95A 4EI6A 2EYRA 1SN2A 4UYQA 3Q8FA 4CGTA 2HYMA 3GIVB 5FYLH 4OBSA 1KJ3H 1FWXA 2O72A 4MHHI 4ZJ9A 4CC4A 3RIAF 3KEDA 3DBSA 4P46A 1VKXA 2NUPA 4LP5A 4P46D 3BIKA 3U9PL 4KNQA 2EDKA 1ODAA 2PP8A 3FB8B 4DJMA 4X9YA 3S0PA 2W9DL 3NTCL 4MNQA 1S7XA 4MNQD 4NNYA 3S3DB 3WE1A 3FCTB 4H8VA 4FJZA 1DVYA 5D1QA 1HYSD 4DN3H 5D1QD 2GFBB 4WTZG 4DK3A 1YLBB 1AD0B 2XV2A 5E2TH 1G6RH 3QS3A 1GYAA 2Q86A 4R90L 4E9VA 4OZIA 3BHBB 2QQLH 4RZKA 3RZCA 1D5MA 4PGCA 2JXMA 1NFDB 2YAFA 4JO2L 4FZ8H 4OTXH 4QMEA 5DEZA 1NFIA 1SPDA 3QWNA 3ZDZB 2YD8A 1HN1A 4LVNB 1DBAL 2AMUA 1UC6A 1X4ZA 2C1PB 2VUKA 5I0DA 5KAQG 2G30A 1ZLDA 3ZQ9A 3SE3A 1KFAH 3B56A 5AAWC 4QOKE 4FCHA 2BK8A 3BAEL 4NRZA 3BC9A 1JZ7A 4ENZA 2HZHA 3OGOE 4GW1B 3ARBA 1XGRB 4ZDHB 4HWEH 4Z77B 4ZMLA 4GIAA 4Z3FA 4YSDA 3DIFB 3KPPA 2XG4B 2N01B 4J3TA 3BP6A 2VLLB 4PY8J 4XBEL 4AYEC 1FVEB 2HSIA 4JO8A 4UQ3B 1MFVA 1LO5B 3L2MA 5CILH 2I60L 1YEEL 1ZY9A 2P1YA 5DHDA 4P9MH 1MFAH 3S35L 2BC4B 2WWOA 3OQ3B 5KVFL 1JP5A 3EO1A 1NIDA 4JPSA 1PZBA 4OCRL 1FH5L 1IT9H 1Q1PA 2G4GA 4S1QL 4X6CF 3VFSA 2V6HA 5C7XH 1DQJB 1AYOA 3DO4A 4NQEB 5FK9A 5DFVD 4JKKA 1QBMH 2YARA 2ADGA 3O3EB 1VZHA 1U42A 5HI4D 2OZ4A 3O6FD 4FI8A 4KQ0A 1FNGB 1OT1A 1ITBB 5BXFA 1NCBL 5FDWA 2GJZB 5BOPA 1J5OL 1CWVA 5FW6A 4OIIH 5D4HA 4BFOA 4FXTA 4F9PA 2FEJA 2F6AA 3N0AA 2DYPB 5B3NA 1AGCB 1VF5C 3A21A 1WZ1L 4PW9A 3RA7H 5JQHC 3W57A 3WFCL 2E27L 3HLAA 1TNNA 3VXTB 1KCUL 5DEGA 5BZDB 3NFPB 2DQJH 1UASA 1Q8MA 3EO0B 2ZXQA 4JFEE 1MCQA 3S5LG 2UY6A 5C0CE 1RAMA 5I76A 3TEZA 1CGTA 2AF2A 4Z18A 2P47B 4X80H 4LL4A 4LAQH 3FMGL 4HZ1A 1DO5A 4LXFA 2WD0A 1KEGL 4HZLA 1HT6A 3N85L 1DUYB 3FQNA 3CCHB 4KKAC 2C9PA 3WNLA 1Z3GL 4KHTH 4C4KT 3PABB 4ZNCD 2Y4SA 3UTTB 1YEFL 3BKCL 3CK0L 1F45A 4B9ZA 3MGOB 1NCUA 2EIZB 1LGVA 4FQCH 5LQBL 4WY7L 3VB8A 4MJIB 4G3YL 4JQIL 2A9MH 2X42A 1IAIL 3ZMEA 4PWHA 1FE8H 3UL4A 4OGAC 6FABH 3MV9A 2OV0A 1NBYA 3F6IA 5HD8C 4JFFE 3WHE1 2X9WA 3DVNB 4W4NA 5T1LA 3OR7A 1S8DB 4JPWL 4UINL 4EOWH 1QNZH 1ZOXA 5K9QG 3HKZA 4XVJL 1JNJA 5TE6L 4R7XA 1BWMA 4KV5F 3V8CA 5IHZB 2VDKB 4J7RA 3MHZA 3DJZA 4AENB 1K4DA 3BPCA 1AH1A 1OE3A 3FQXA 3PIQB 1FSKC 1CLYH 1BJMA 4G9FA 4M61A 4G9FD 4IHBA 2OL3L 2APSA 3U6XA 3VRIB 3KPRB 1TKWA 1Z5LA 3RWJA 4XCEB 4PSRA 1XR8B 3PPSA 3PWLA 3DARA 3VXSB 2W80C 5IFHH 3I75A 4G7YL 1CFTB 3MRNA 5C3IA 1OW0A 4OZGE 5DMGC 2ORBL 4H44C 3SCMD 3CNKA 2VH5H 5DS8A 3TBSA 4FI6A 2B5IB 1T1ZB 5BS0E 1PEZA 1TJGL 1KTBA 4OD3H 3HBPA 5BZXA 1HXYA 4LSQH 4A6YA 1O9VA 2ESVE 4Z3JA 1ILSA 2G2RA 2HN7A 5FECB 3CZGA 5DSCA 1YYLH 4I88A 4EZKA 3DV6B 4U1HA 1DQML 1U9KA 2C9UA 2DICA 3QCVL 1BGXL 5KG9A 4M6AA 3US1A 5T1DL 1PYWB 5ICUA 4W9IC 5F9JB 4ETQB 4W6WB 4PHZA 4C57C 5EBWB 1R5VB 1PBYA 2IXQB 2XN1A 3L5IA 2L3BA 4XPGL 3IDIA 2OZ4H 2FJFA 3T3PE 4J3OG 2YN5A 1H6TA 4N8VA 2R23B 3VI4E 3P4LA 2ED8A 5EV7A 4HK0A 4HX1B 1KBPA 1CTMA 1DQLL 4EVNA 1UA3A 2LU3A 2ROXA 4LE8A 3LIUA 1BVLB 3US0A 1JVKA 2YEZB 4RDQG 1OF0A 2ZX6A 4XP4H 3V5HA 5IVXA 1BXUA 4NUJA 3AMKA 3UBGA 3RDJA 2ENSA 4M8RA 3RIKA 2APFA 1RJZB 4P48A 5ENWA 5B39G 3NCYP 3JWNH 4UZSA 3HNVL 1L6ZA 1I1FA 2AAAA 3ZHFA 4E9WA 3BEWB 4DHLA 2V2XB 3VWKB 2NT0A 3QXWA 5DJ2A 1EDQA 3IFLH 1F8TL 5KN5A 1NL0L 1S7UA 1S78D 2Y3NA 1IAKA 4HF5L 1IQDB 3ZSSA 5KYUB 4XVSL 5T3XL 4WTZA 3ZL4L 2QDWA 5BQ7B 2W0FA 1FAIL 2R2CA 4ADIA 5I1GH 1C16A 2B77A 3L3OB 3JV5A 3P9LA 4N5ED 5LGHH 3HZVA 4ECNA 1NEPA 1NC2A 2WBXA 1Z3RA 1NC2D 1RH8A 2LTQB 1LJMA 5A6MA 2OS7A 3MOAH 1JZJA 1J9TA 4P5MB 4Q6IB 1YHPA 3D69B 3PQYA 4OGQC 3PQYD 1DQJA 3TZVB 1AJ7H 5GS1A 2QVTA 3A5VA 2A73B 2WVVB 4ONHA 1QASA 5I6MA 2HLEB 4LLMA 1CXEA 4WUUA 3MVSA 1KN4L 2A9BA 5EBLA 4JB9L 4MJ6A 3N04A 2BY3A 4ZW3A 2OMYA 2AEPH 1FNEA 1SY6A 1COBA 3OKOB 3VDCA 4ZNEE 3T2NH 5FOJA 3HE6A 3HE6D 2CDFB 2RQ8A 3TBVA 1UHVA 4K3JL 1U91A 2BFVH 2CXGA 3BN3B 3CMOL 5CJBA 3S98A 5AW9B 3KDMA 4HUWB 4KJPD 2NUTB 3LXAA 1MN4A 1VFUA 4Z3HA 2KHAA 3RLSA 3CZUB 5D7EA 2JH2A 5IJKC 4FXGB 1FZMA 2PPCA 3AFLA 1TCRB 3AUWB 4JFYA 3TIEB 5EF0A 1RSFA 1FYHB 1WT5A 4MKMA 5B1BB 2DEWX 1WD8A 3EJZD 5JIMA 4MAYB 4RZCB 3D2UA 2FX7H 5EZJB 1GC1C 1Q1JH 5D4QA 2VN6A 4YJZL 3QQ4A 3QJFB 4J1UB 1BZ8A 5DK0B 2CBOA 4UT7H 2VUYA 2WTRA 4DZ8B 5JLZB 3WTYA 4M5YL 3GD1C 1S9WA 1DQTA 1E30A 5EU3A 1DJZA 5EZOL 3ZTDC 5DVOA 3QWQB 2VR5A 5ITFB 4Y2OB 3W9DA 5F3BA 2EIZA 1ZLUH 4LCYA 4MJHA 4MJID 4QPEA 3F7KA 4L0PB 5EA0H 5CKAA 4LPCA 1LK3L 1ZHNA 1UQSA 5LBGA 2BVQB 5AG8A 5BRPA 4KH9A 4N2NA 5LNGA 1XCQB 4NKMA 2NY3C 2ZQKA 3S5LA 5DZ9A 2BIIA 5DRWA 4GQ9L 2IG2H 4XRCB 2BX5A 3M88A 4U7KA 1MI5A 1OAXL 1MI5D 2COQA 3ZTJG 2NTSP 2O5XH 3QG6B 4U49A 3DVGA 4UIMB 1DLFL 3L9RB 4YFEA 4JM2A 4JM2D 3IVKA 1KIRB 3MMEB 4K94L 2BWDA 3VXSD 3T1FA 2KLTA 1HHHA 5EMYA 4YHLH 2WLLB 2DWYA 1NGXA 2CO4A 4PJ5E 2R8SL 2CLZB 2VWEE 3S6CA 3BAJA 3EAKA 4WWPA 4B9GA 4AW4A 1TYRA 1G1OA 1Q72H 5AOZA 5T1KB 5E8EA 1MVUA 1BQHB 2MCPL 3MRMA 5FECA 3OQRA 1N6VA 2DKSA 3QW9A 4YHYB 5HDLA 2X05A 4D9QE 3Q2LA 2IH9A 1ZLSL 2XCMC 2FIRT 4GJTB 4QWWD 4OT1H 3HHSB 3OG4B 1F02I 1E7VA 2NY1C 4BA8A 4XXWA 5HHXL 2J6EL 1XB3A 4JO5A 3QDGE 5F7BA 1R5VA 4FNPA 9CGTA 1ZT1A 4TNGA 4HJGA 3OGCA 1QP1A 4PGBA 4YFDB 2CRMA 3LKNB 3OPZH 3I9IA 4N0FA 1NAMA 5J13C 1T7WA 5LXVA 2OJZL 1QQDA 3B8YA 2VAAB 3EJCA 4IIZA 1JHTB 3VH8B 1BYOA 2NY5L 3HI5L 1A7RL 1HHGA 1GZHA 4Z8FL 3NFNB 4OZHF 5AAMC 5EFIB 1H9DA 1EZUA 3WNJA 3GMMA 2FE0A 3C08L 4QTIL 4I2XB 1S9YA 1B3JA 4JGJA 1S7RA 1NBQA 2I07B 4Y5YA 3GWJA 5E2VL 3DX3A 1H5BA 5FA3B 3LH8A 1Z9MA 2HG0A 4X5WB 5HHME 4YBQC 1ET5A 3ECWA 4HIXH 2DM3A 3GHPA 4TSCH 2J88L 5DC2A 3LZPA 5GGVH 3ZIYA 3FUDA 4J28A 5AQ0A 2V3EA 2KZKA 2JKNA 2QMJA 4BA0A 1RMFL 1BQLH 4NQSB 5CJOL 1HJCA 1K5NA 4DAGL 1F4HA 1U3NA 3TCLB 3QIWA 1A6UL 3QIWD 3B6SA 1BFVL 1F6LL 5EO9B 1NOAA 2VKWA 2CIKA 2HWZH 1FNHA 3S3BB 4TTGA 2YAOA 1GSKA 4J3OD 4AQAA 3LRSA 2FR4A 2VC2B 5I17A 4NM8H 5SWSE 4PJXF 3N3EA 4MXVF 3LKOA 5C1MB 4FQXC 2XHNA 1A9EB 3DTDA 3ZDYF 3PJNA 3DX8A 3GK8H 4RAUA 4DOHE 2DF3A 4XMXA 3TZVD 3L3JB 1NWOA 3VFWA 3VACA 5B39A 1X5XA 4N0CD 2HRGA 3II3A 2GHWB 1IO4C 4G1EB 3FCUB 4UBDD 1GTNA 4J3UA 3RVVD 3VFNB 3K71A 5I1DB 2MKLC 4NUPA 3DOSA 2ATAA 2GQHA 4PJHF 3TBCA 4P23A 4Z3GA 3UTSE 1JZ5A 4Z78B 2Z7YA 3VMOA 4NPYA 4X0NA 3MXWH 3QDMA 3TWYA 2OTUA 3RVXC 4Y4KC 2X7LB 1JGEA 1QD0A 3IETA 3SQOH 4TUJA 2AI0L 1CGYA 2HJLB 1H3GA 3H9HB 3HC3H 4F2ME 1MCLA 4G5AA 1CBJA 2QVIA 1WIOA 1U3ZA 4GKNA 4MAYD 1U8PA 2CKBB 3DUSA 2HFFA 1FO0A 2CPCA 1TEYA 3FBKA 3ZHKA 2OR9H 4ZOCA 3UAEA 5JOPE 1JAEA 1AZVA 2YR3A 3L3HA 3OWEA 5I24A 4YZFF 3RAJH 5IJVA 3ZRCC 5E8DH 5DF0A 4J4PC 2ITCA 2EDFA 3GJEA 4Y8AA 4H25A 1FIGL 4UTAL 1BBDH 4QO1B 4KDVA 4HWZB 4F7PB 4TRPL 1K8IA 2A74C 2KLSA 1T22B 5GGTA 3VG9C 1I1RA 5FPIA 2J55A 4CSZA 1OARL 3HG0A 1MCNA 1NAMH 3TV3H 5IEKA 4P4KC 3IFOB 1J7VR 3QZBA 5CCHE 1IC5L 2GK0A 3F01A 3KYKH 2EH7L 2FH8A 3QG7L 1NLDH 4TNWF 3PWPA 5JQIB 3PWPD 1DSWA 5D55A 5C0BB 5C09E 2ZOLA 3KHOA 1KCRH 2DQEL 2UYLB 4NKIL 4XN5A 1YEWA 4M8QB 1MIMH 1YMHA 3FB6B 4G6MH 3COOA 5AB2A 1RZ7H 4JY6A 2HVBA 3NIFB 2EC8A 3G6JE 1PTZA 3HRZC 3GIZH 3WD5L 2HRLA 3RGBA 4ABUA 5KSBA 4FS0A 1D9KA 2MH4A 3V0JA 1D9KD 3QO0A 4UV7L 3ULUD 4V2CB 3DX6B 4G43A 4LSSL 5EIIA 3NN8A 1HHIB 5IHBA 4MJ5A 3WFDL 4AITA 1PZ2A 3SPGA 2WGNB 1REIA 5T1KD 5TTRA 1QYGH 3SDXA 1AY1H 3F7QA 1GZQA 3QA3B 4PJFF 4J3OH 4ZRGA 5FYKU 4YFLF 4XO3A 1U58B 5IMLB 1N0XH 1ZHKB 1BPLB 3KWXA 1AP2B 4HIEB 4HUUA 2ZCHL 2H2SD 5MENE 5B7MA 4BFRA 2VLME 5FGSA 4I1PA 1VEPA 2XIBA 3ZT7A 3VFPA 3WXVH 3OAYK 2EE3A 3GINA 4F2MB 3K6NA 4ZUWA 1P7KB 1SJXA 5ANHA 1A6PA 3L5JA 3O0RH 2R1WB 4Z7OB 4W6YB 2FT8A 4RNRA 1EMTH 1NM9A 4XOBA 5CD3B 5DZPA 4WWID 3UABA 2LFEA 4M43L 2NR6A 3C60A 1MCCA 3FU0A 2NR6D 3HHRB 4XP5L 1SUJA 3HS0B 2VN5A 2PETA 1CFSA 4PRNB 4DKTA 4PTTA 1PZCA 3JVGC 3CSFA 5KS9F 4I9WD 5J9PB 3EYSL 1JHKL 5T8IA 2V9UA 3CVDA 2NY4C 1BVNP 4FQQA 2ADFH 4PJGB 3KLDA 3AT9A 4ADGA 3C75A 3TLRA 4N24A 4KKCC 2Y7LA 3O2DL 4D9RD 1AHMA 1JERA 1RQ5A 4J8RA 1HQRB 1FO0H 3F6LA 1DVQA 1FL3A 1L9MA 5CZXC 3T0XA 5E6IC 5FYKL 2NQ3A 4DO6A 2WQUA 3F7VB 3RY6A 2Q9OA 2Y6SC 4J6RL 4MA1B 3UCRA 4M7KL 4F37F 4C8XA 1E3XA 4F15B 2VZ1A 2X4UB 4LCCC 2VR3A 2X4QA 1RU9H 3UEZA 4OUUB 2BSTA 4NFBA 5LGJA 1NCAL 4DTGL 1JF5A 2WN2A 3L4CA 3GKWH 1WK0A 4N9GB 3CFKB 2ZCZA 3O4OC 1GCYA 5GGQH 4CAGA 3D48R 2Y9RT 5GGTH 1CK0H 5AFAA 5D7IA 2Z7UA 3UC2A 3OKKA 2Q2LA 4KNTA 3IF1B 4XPTL 5SWZB 2OJEB 4L4TB 3DGGA 3W37A 5ACMA 1H19A 2J25A 2XN9E 4C54A 2X2YA 1VACB 3NEEA 3V52H 2OZNA 3C5ZA 3DUHA 3UJJL 3C5ZD 4K3GA 3QUHA 4M8UA 1KCVH 3KBEA 4M1CC 4ANWA 5KBDA 4JFTA 3NRFA 2WYHA 4W9ZA 1UKTA 5IY5B 4XNMB 3O6KH 1CICA 4GNKB 3SQBB 1CICD 2OMUA 1UM4H 1FL5A 3BXNA 3L81A 1V27A 3N40F 4L05A 1ZDSA 5CFHA 3BP7B 3RB7A 5AW1B 3ULUH 2HUEA 1U6AL 2BSEA 4QTHB 4Z7VE 2BSED 2XPGA 2K9FB 2NY3B 2X4NB 4R7NA 1ZV5A 4GP5B 4KO9A 1YMMB 4UIKL 3PHQA 2K7QA 3P0GB 2I32A 1CXFA 5DYOB 3CHXA 4JMXA 5I1LB 3CDCA 5HVHC 1ZLWK 3UBXI 3ATAA 4BKLA 3I2CL 4QRUA 4HVBA 4ZZFA 2YPVL 3VGAB 3CBRA 4P46C 5IWLC 3RY5A 5BO1L 1EFXB 2CK0L 3V0AC 2HX9A 3W9EB 1FA4A 5LLIC 3MODL 2SEBB 4YC2C 4NKDA 4YR6A 4ZW7A 2RALA 3JTTB 4KHXL 4U1JA 3IGAA 5E4OA 4J5VA 4PB9H 4HAKA 3IFOA 5CGBA 4IDJH 4B9YA 3U30C 4N6RB 3FH8A 4QOKA 4N1HB 3QXDA 4MS8C 3ULVH 1FC2D 3TT1L 3EUUA 4DF9A 1T4KB 1J1PH 4KJWD 4UDUB 5GGRA 2DQUH 3DXAE 2KQNA 1H0DA 2YD1A 2VXSL 2XX1A 5E2WL 1EZLA 4BZYA 4PJEB 3NZUA 3WIAA 3HTLX 4M62H 2NY1B 3D05A 1N5AA 4JDVA 3WY1A 5K9KB 5I66A 2G5RA 5PCYA 3O9WA 4W68A 3JV0A 4AEEA 4AM0A 3LRMA 2IBZX 1TQCC 4L9LA 4XWOC 3SE3C 1SDDA 4HDIA 5EN2B 3RFRA 3OAYH 3R8QA 4ZMAT 3VRLF 3ETBF 4O4YH 3UXFA 4BH7B 3PL6A 3PL6D 1MY7A 4I0PA 1FF5A 2IH1A 3ARBC 4I0PD 4NOBA 2NNFA 2V2TA 1JNHB 2H6PA 3SQRA 1NGZB 2GSGA 4HV8B 4NO0A 3VG0H 4DGYL 5FOBB 4AQ1B 3W0WE 3QCTL 4KFMA 3QRFM 4WEBH 3D4ZA 4UMSA 1J0KA 1I7ZA 1IVTA 4F57L 3ARGA 2X1PA 2K1MA 2J6WA 2EKSB 4QT5B 4LGRB 2HRPL 1RFDH 1EJFA 2KDGA 4DFIA 2Y7SA 1OAKL 1OTTD 1E5UI 2DH3A 4FKEA 1IIIA 5JIQA 1QOKA 3HB3C 2WBJA 3CZSA 5HI4C 2WBJD 1DYZA 4EZLA 4Y16A 4JFEA 1T89C 3AS2A 4OM1L 1GHFH 5C0CA 1C8QA 2IADB 1A7OH 4AC4A 3GMNA 3LNIA 4B5EA 3FF7A 4F9PC 4QCIA 5TE4H 5IIEA 4IKNA 4OLZH 1BX2B 4S10A 3A6BL 4W6XB 4X8CA 1N68A 2BO0A 3QYNA 1FV1A 4RGMC 4YO0A 4MNGE 3CFQA 3JWNC 1KB5B 1W72L 4YHKH 1GIGL 3VD7A 1F13A 1LVEA 3O41A 3H6AA 2X0WA 5HHOB 2VCOA 3WGVB 1IEHA 4YLBA 1YEIL 2DLHA 2LT9A 1JHLL 3IDNA 1HQRA 3WO4C 3BE1H 2EEDA 2WXIA 3IK2A 4ONGH 5IQ9A 2FIKA 1OAJA 3C5XA 1HL9A 4F2EA 2X87A 5IQLA 3BWSA 4HUCA 4YXHH 4JFFA 4JFFD 3HG1E 3FTGA 8PAZA 3RWGB 3ULSB 1FGVH 3DOIA 1DE4B 4KZCA 1PJWA 4KXCA 1BAGA 4Y4KB 1F90L 4AT6A 5L4JA 2DEXX 2ZG1A 3BUTA 4LLWB 4OB5L 1HI6A 3QC6X 4HCRA 2L8AA 3DX1A 3P4MB 3AITA 2DQIH 5CEZD 5MI0C 2ARJQ 3QDHA 4P2RB 3BGFC 4LHUB 2P46B 3BKJL 1CL7I 1FYTB 1HSAB 1VPOL 3LN5A 2X10A 3IWUA 4OCMC 3ZQXA 1KGWA 1KY6A 4L1TA 5SWZA 3W3BA 4OZGA 3TN0B 5SWZD 4Z7UE 4HJ0D 5KVMC 2BP5M 3FT3B 5AB9A 2WYTA 2PO6B 1HEZA 3L4XA 3LNFA 4RCAA 3VXQA 5BS0A 5BS0D 3N2JA 4ZI8A 4GG6B 3FH5A 5D2LE 3L3GB 3ME0B 4HETA 2QVKA 2ESVA 1X5AA 4NM4H 4OLVL 1Q94B 2ESVD 2C3WA 3B2UD 3X1FA 3KM1A 5K9OA 1KBGH 2EDJA 3BVDB 1OGAA 1OGAD 1NGQL 3SQBA 5IROA 5IROD 1U8CA 1F11B 4M03A 5I0WA 1IM3B 4E5XB 3TTYA 2XN2A 1Z9NA 3GSRB 1OW0C 1VA9A 5I5IA 4G82A 1QFHA 1XF2B 3KS0H 2OFQA 1Q9KB 3UZVA 4P4KB 4XCCH 4WV1C 1YMMD 3GZOA 2F8VA 4R5TA 3OAZH 4ZOEA 2R0LL 3BKYH 2WXKA 4BXSV 3ROLA 5CEYB 4LB8A 5HGHB 4HW6A 4XB7A 3VI4A 3JT2A 3PHAA 4XT1C 4EEEA 1IJNA 3HRZB 1M42A 3KYNB 2HKFL 4KKNA 3QPXL 1EPFA 4OLXH 3OAWA 4WJ5B 2V33A 5EU7C 1IZKA 2O6FA 2HA1A 1S6NA 3FRPG 3LMJH 3SE8L 5D1ZA 4HCIA 5EZIH 1J05A 3TF4A 3O6LL 1BPVA 3U7YL 2HCZX 4N6RA 2KBGA 5IQ7L 5DWPA 3RUGE 3FL7A 1IV8A 1EHAA 1MSPA 4QRPE 5EO1A 1M6OA 2ZUTA 3L7EA 5F7NC 2BRQA 3QVAA 1XF4A 2Q8BL 2Q7YA 1ES0B 4N90D 1EERB 3QIUC 4HALA 1RJYA 3F85A 2K70A 3MRIA 4PJEA 4BFBD 3QJSB 2VL5B 4U1GC 4X9BA 1L7TH 1KBVA 3F7YB 1JK8B 5HPMA 4LSRL 4X50A 2W65A 3D0AA 3K72B 1IC4L 5KBMA 5MEPA 1ACCA 4KK6C 1MXDA 3ZKMD 4L1BA 3GSQA 2R69H 2N7AA 4PJBE 4FZEL 1B2WL 3ZKND 3IAGC 2C9QA 1S78C 3WNKA 4MAUL 3SJVB 1QSEB 1EANA 3W39B 1HH6A 4P0DA 4GAGH 5SX5H 4KPHL 3MLXL 5AOJA 1HZKA 2K3TA 1A7NL 3BUBA 1TZHA 3OKMA 4WUKL 4LSVL 2JI2A 2XVBA 1BQ5A 3IJYA 3TO4A 4ZNEA 3QP3A 3X1NA 4HUMB 3PXLA 2VB5A 2C7UA 4K2UL 3MBXH 3UFIA 5J6HA 1CN4A 2P43B 4HCRH 5I0ZA 3IXTB 5E5LA 5GS1C 5HDWA 5HGAB 4FP8H 1NANI 4GP4B 5BUAA 1K6QL 2JKTM 1J10A 2GYSA 3SY0B 5H8DA 3QXTA 1QATA 1OSPH 3ZUNC 2CMRL 2NYKA 3A6CH 3QAZB 3EOTH 4IOFD 3G6DL 2WAQA 4KJYB 3QWRA 4BHUI 1B90A 4MMZA 4ZX6A 3PY9A 4XMVA 2O61A 4BFGA 1HDMB 3DHMA 5I9QC 2WJ5A 1WJ3A 5LCVL 3ZK0A 5SWQB 2BH0A 3V4PA 5A40E 3MLSL 4A7VA 5FHBL 4CADA 3O8XA 3O8XD 2A83A 2YEQA 1ZK5A 5HHOD 3N55A 3DDFA 1JXFA 1SNRA 1I82A 2NYZA 3D8MA 5DUJA 5E94B 3LQAL 1CYWA 5IW6B 4NBZB 1EHLL 1M2VB 3DSFH 5JQ6H 3DHUA 3RVWC 2ATPA 3LEVH 4AEIH 1IGIH 5F7AA 1U8JA 4QJ4B 5ICZB 1RULH 2GITB 2XTJB 3IMRA 3LRLA 3KCPA 4KVNL 4DUWA 2W5PA 3PGDB 1GMIA 2G3XA 1VGKB 2LLLA 1CL7L 4QRBA 4LLWA 2P5WE 4KFZC 4Q0XL 5BV7L 4P2RD 4LHUD 3ZKXB 4GBXC 4IU3A 4KTDL 2XJLA 1FYTD 4PV8A 4K8RL 4LCUB 2P52A 2F7IA 1HZLA 4Y5XA 5E8OB 4TNEA 4PJ5A 3HVNA 1SJHA 2WBWB 1SOXA 3PLYA 5F9WB 2EIKB 2B4CL 1TEFA 3G5WA 2OR7A 4JO1L 4F58L 4FXLA 5D5MF 5IR1A 1JYWA 4L5FL 4I87A 5BCAA 1KCSL 4RGNC 1UM5L 3CHOA 1TMCB 3RRQA 3ESVF 3VW3L 1QACA 4JM2C 4YNYA 3SYAA 4W9HC 4R97C 2OTWA 4YSUA 3PHSA 2EUVA 4YC2B 2BM3A 2G0LA 4N8CL 3ELAT 1IM3D 4FQIH 1NCHA 1M7IA 5FYKE 2V7HB 4G6AC 5L9DL 3D12B 3D50A 2VZVA 1I7TA 1BVKA 1MW0A 4KGLA 1V8HA 5GRVL 2Y07H 1IMHC 1HZHL 1OD7A 3MLVH 4XBGA 3CHPA 2WVTA 4JZJA 4GMSH 4PJAE 3KL0A 1DP0A 3WIIL 4HGKC 4HFUL 5AOKA 4N9OB 2X4SA 1QSFB 2AJUH 4WTQA 1LWRA 3D6GA 4HIQA 5CSBA 2NW3B 4YFLI 5A2AA 4XP9L 5JHBA 4AG4H 4XXWC 4EPSA 1KT2B 2KQMA 4ALAC 1YECL 4HGWB 2R1YB 4NZDA 4TULL 5JDJA 4WNQA 4NQXA 1AXIB 3P2DA 4GLRH 3CDGB 1TITA 3EOBB 4JRLA 3SPHA 5IHUL 1NDTA 2Y7OA 4I5BB 1GZHC 2XYBA 1Z5HA 4XZUB 2X5PA 4IOSA 2VE6B 4IOSD 3T2QA 3FU6A 2R51A 3V0WH 1ZEAL 3KR3L 4YXKH 2B0SL 4Y5YC 1H5BC 1XGYH 2AXFB 3MCKB 3NYKA 4ZT1A 1R3HB 4U3SB 2VGLM 2EXYC 5SWSA 1I8MB 3FUEA 3D06A 4EN2A 1UACH 3DSNB 4OZ4B 3V5DA 3E6HB 2DTMH 2ICEA 1TVBA 5CBEA