1C02A

Crystal structure of yeast ypd1p
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
STIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMQHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOTRANSFERASE YPD1P
publication title Insights into eukaryotic multistep phosphorelay signal transduction revealed by the crystal structure of Ypd1p from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 61
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1c02A00
4PACA 1WN0A 1OXKA 2LCHA 1FR0A 3US6A 1TQGA 1OXBA 1BDJB 4EUKB 3KYIA 3U3BA 2OOCA 1I5NA 1C02A 3IQTA 2LP4A 3KYJA 2Q4FA 1QSPA 3MYFA 4G78A 1Y6DA 2R25A 1SR2A 2A0BA 2LD6A 1C03A 1YVIA 1A0BA
chains in the Genus database with same CATH superfamily
2CNWD 4CS9C 2J9WA 1YZAA 4PACA 1WN0A 4IB4A 5AC4A 3HNLA 3CZ6A 1U6HA 4JTDB 4NTBA 4BJ1A 2UUIA 3O10A 3C18A 1NFOA 1YJGA 3NYMA 4YT4A 4GEHA 3LEVA 3RIPA 2DYSC 4OINF 5D92A 1FMVA 4WJ0A 2PX3A 3HTKC 1JAFA 1ORJA 3J06A 1MNDA 2YVKA 1XZPA 4JEBA 1TWCA 1L3PA 4XEFA 4LERA 3EH2A 3JRTA 5CI9A 3RVYA 3RFYA 2IYLD 3DJUB 1UG7A 3UGPA 3JSEO 1FTSA 2YLDA 3RYLA 1HE9A 4BG0A 1ST6A 4A2NB 1GS9A 4RD9A 1C17M 5DS4A 4YT8A 2Z15A 5L0GA 3X1OA 3EGXB 5KYXB 3S27A 1ZW2A 4DBRA 3NYJA 1JR8A 2YHSA 3QZCA 4W8KA 3S0XA 5KYYB 4ANJA 1SF8A 3M4BA 4AX2A 3RVZA 1R5ID 1RJ9A 1Q0KA 1ZHXA 2DB4A 3Q6MA 5BQHA 1JRAA 3GORA 4G7OF 2QTVA 4N06A 4C7OB 4A4AA 3GM2A 5JP7A 2YL0A 3K7DA 1I5NA 5A6BD 3U8VA 3TD7A 4EWCA 1O5HA 4W8PA 4YL3A 2XLMA 4N6CA 4EBJA 4I1MA 4YWQA 2OU6A 3PHF2 1BR4A 4Q7CA 5L0IA 3N24A 3U2MA 2YEVA 4AE4A 5E3AA 1KTMA 5EHHA 1N1CA 2GDCA 1ZHTA 2A6HF 3L8IA 2HKVA 2EPOA 3RQEA 2ETSA 1HMDA 1DOVA 1AEPA 2LK4A 1ZHYA 2MHRA 3SYNA 1E86A 3HJCA 3KKBA 3NKEA 1YA7O 1Z5ZA 1WGWA 5L0HA 1TWGA 1NBBA 4EHPA 3GM3A 3TJ5A 2XL4A 2C04A 4MTFA 4NY3A 3T6GB 1D0XA 1FFHA 3LAYA 4OIPF 2HV6A 2KGOA 2HJ3A 4KBLA 3SP1A 3G4ZA 4LACB 1ZZPA 1OR3A 3VF0A 1KNYA 2IXPA 1PD1A 2OJQA 4WGZA 4OIRF 1LM3B 3M79A 4UDVA 3PDMP 2QUPA 2UUHA 3EFOB 4WABA 3JCUQ 3DM9B 4DBQA 4FX5A 1BZ4A 2IXOA 2VB6A 3F47A 2QNLA 3O39A 3B0UX 4CIPA 1A7EA 4IWBA 4MVUA 2G62A 4PFPA 3U0CA 3T9OA 4CJGA 3BEHA 1K40A 2HSQA 2PP4A 3TK0A 3TJ6A 2H8AA 2RD9A 2AU5A 1U0BB 2R7RA 2LFFA 2XS1A 3FOPA 3HNJA 5GPGB 5JUAA 2W4BA 3RQGA 4JE9A 2R03A 1QPUA 5KYWB 2NUTB 2A6EF 4AE4B 1VOMA 3B29A 2B0JA 3LJBA 1YLMA 2PF4E 4OD5A 4YK5A 1YARO 3UR3C 3B9QA 1FAPB 1RKEB 2KYHA 4XWJA 1J8MF 3CSKA 5L0DA 1OQCA 4JTCB 1FNTc 2Q4FA 1MMAA 3RF3A 2L7AA 3GEEA 4YL0A 1IZMA 1NZEA 5TJ5E 5B3IA 4Q4ZF 2DI3A 3EJNA 1H7IA 1NLXA 1UFBA 3KPHA 1T6UA 1H9GA 2R7TA 2G3VA 4FESA 3MX3A 2Q7RA 1VYIA 2D4UA 3DWWA 4CDYA 2R7QA 1LI7A 4BEJA 2OG2A 2JPUA 3K1IA 3AG2C 3W2WA 1YYJA 4NQFA 2Y3GA 4I3MA 5FZTA 5F28E 3OA1A 3VM6A 3DE8A 1K04A 1TQGA 1BR1A 1WASA 2ICWG 3K66A 3QVZA 1W2WA 4HEAJ 3UMHA 4U5EE 4DRJB 2XLVA 2V3CC 3DI5A 1BBHA 3K1IC 3EPVA 2EIMC 2R9RB 4LDKA 4Q5SF 2M4EA 1NG1A 4XQ1A 3W8IA 3ASOC 3IQTA 3S90A 4G0HA 4JJFA 2EIKC 2Y3HA 3MLGA 1OCCC 4YN0B 1QSPA 2HS5A 3NYLA 5JVEA 256BA 1V74B 2HMQA 2WB7A 4ULWA 2J46A 2R25A 2KC3A 3CEXA 3FOOA 3JT1A 2XM0A 3ZQYA 4ZLCA 3T6JA 2W4MA 3L34A 4OD4A 3S9OA 4KC9A 4ONSA 1VYKA 2DYRC 2YL3A 3PCVA 1OW8A 1FR0A 1LI5A 2FGYA 2J9BA 1O3UA 3C8GA 5COMA 4JVSA 1YA9A 2GAQA 1J8YF 1ORSC 2OQMA 4I1OB 1BDJB 1JPJA 2ZPAA 3EG9B 4ULVA 2IOQA 2P0NA 4BJTA 4K7BA 2A0UA 2OOCA 3ASNC 3FAJA 4IARA 4F4BA 2QE9A 3JTLO 3H2VA 3GWLA 3AG4C 5L3QA 2KK1A 4J30B 4E17A 4E7ZA 4CX9A 3NDBB 2IBFA 3AGTA 4PJLA 1EA8A 1PV3A 1Z3IX 4H54A 4O79A 2NG1A 1OW7A 1LIHA 2JX0A 3TULA 4DVZA 2J45A 3I5QA 3ZQVA 1AUEA 1M6TA 4J32B 1C03A 1GQAA 1ZHZA 2XLWA 2IXNA 1CGME 4XEVA 1CPQA 4P6IC 2BE5F 3IEEA 1TKNA 3UNGC 5EGYA 3WHNA 1G4WR 4U5FE 1FFTC 5DLJA 2WL8A 2P1AA 1OCZC 5COGA 2GFHA 2XM4A 3FXHA 1LPEA 1OXBA 2EPNA 2YZSA 3L8JA 3O55A 4O6YA 2AWYA 1M57C 3JYHA 4QI0A 4KI2A 2XXAB 3Q7LA 1RCPA 2OCCC 1GM5A 1M56C 2J9UA 2H7VC 1B68A 3KMIA 4P9TA 3IQCA 2J7PD 2YL1A 4BJ5C 4MVQA 2YWAA 2WZFA 2R02A 3C8GB 3KYJA 3R2PA 3W2VA 1OCRC 1YDIA 1CGOA 1D0ZA 3KL4A 4BEMJ 2NUPA 3H65A 4LDRA 5T3TA 2CGEA 3LNMB 2BL2A 5B1AC 4LDQA 4JIOA 2P6VA 3RQFA 3SXMA 4CJOA 5E3CA 4ZLDA 1VLSA 3POVA 3E9VA 4XLNF 1YYXA 3AQCA 1LKXA 4R32A 1ZU4A 5DS6A 1NU9C 2NPUA 2F22A 2WVQA 1GGQA 3DM5A 3SNHA 4JRZA 4Z9IA 3U8PA 5CIVA 3QMKA 4MS2A 1E84A 3HKKA 5T3WA 5K0IA 2LSEA 3ZTZA 2V26A 4JC7A 3AJMA 4EBBA 4M63A 5D91A 4E7SA 3C63A 4JW1A 2WZGA 3EZIA 5EK0A 3A11A 1NSGB 3Q7GA 3S29A 2EIJC 2XLHA 3IHUA 4JCHA 3AG1C 1A7VA 4D4XA 1VTMP 1C02A 4FWVA 2YQYA 4PR9A 4XPXA 3MYIA 1E85A 2AVKA 1QZXA 1RJ9B 5HSWA 2OKUA 1Q0DA 2PFDA 2QY9A 5DVWA 3A9CA 3LESA 4NCQA 4C3BA 4GYTA 2Y3BA 4X0RA 2DGJA 2EPMX 4J7YA 3OWTA 1T9KA 2HMZA 4FAPB 4MTOA 2NUPB 1WATA 4DOZA 3G50A 3VAYA 3KH2A 3E70C 1M2VA 4PK4A 4CS7A 1MNEA 3K6BA 3DZAA 3GANA 3NMIA 3EGDA 2WVNA 2NSGA 3TOMA 1XWJA 4MQ9F 3SXZA 3QTHA 4JJGA 3ZTMA 3GM1A 3ZVRA 1QQ3A 2B0HA 3I5PA 1D1BA 3EZHA 4AL1A 1ZYRF 1TFOB 2VH3A 5COFA 4L6RA 2XRHA 1LE2A 3SXYA 1Z63A 2KJGA 2XLOA 3M4CA 1Z7Qc 4YL1A 3U9JA 5T1DB 2HJMA 2J9VA 2R7SA 2A0BA 3H2UA 1TR2A 4U9DA 4CIHA 2PNOA 1LS1A 1YVIA 3ZG1A 3U5SA 1T01A 3V7OA 2H7BA 5DQZA 3AOUA 3LLKA 3ZC4A 5JLIA 4RBNA 2Q9CA 1RMVA 5JRAA 1F1MA 2AP3A 1G8XA 3CQZA 4LLCA 1EQ1A 1H6GA 2W9YA 1EI7A 4D4NA 4CBEA 3QVYA 3WAQA 3JSZA 2OJED 2P7VA 2RSEB 3L1MA 3NMKA 3PMRA 2R7XA 1K05A 2KW3C 1A7DA 2I8BA 2W45A 2IM8A 4K0DA 1WOLA 2LIGA 1D0YA 2A68F 1Z23A 2EINC 2MYSA 1SZIA 3WODF 3DE9A 4O6MA 4MTGA 1NFNA 2R7WA 4I44A 3TOLA 4YJWA 5A69A 2FAPB 3ATPA 3F46A 2XLEA 3L0IA 1AVOB 1SR2A 2HFIA 3K33A 1QLEC 3M15A 3DKAA 3MFNA 4KNWA 4MVSA 4MVMA 4OIQF 3R7CA 4MVZA 3DD7A 2R7VA 2H7OA 4U5DE 3ZSUA 1V54C 1A41A 1D1AA 1FMWA 2A69F 2Y3DA 1NU7D 1MQVA 4E0IA 1LE4A 4DRHB 3FDQA 3EHNA 2VCBA 1OKKA 3IQ5A 4G7HF 4BPMA 2EPKX 2ASRA 3N2ZB 2HUJA 4NTAA 2CNWA 4K1OA 4RDAA 2GA0A 2X0CA 2O9XA 3X2QC 4Z9HA 2CYDA 5A6AA 2XXAA 4MVOA 4NC3A 4U5BE 2Y39A 4DRIB 1T5OA 1LS4A 2L6HA 3RW0A 1E83A 3EGXA 5KYXA 4QI2A 2LP4A 3CAXA 2Q00A 2Y69C 2J0XA 1I4YA 3SZRA 1CGNA 1VK5A 3LNRA 5B3SC 5KYYA 3JRMO 3U9MA 2YKZA 3FMSA 4IJJA 1ZW3A 1Y4CA 3UMIA 5E2QA 3LEOA 5AGFA 4C7OA 1Q0FA 4IGGA 1VMAA 2L6GA 3C8GD 4U5HA 2XS8A 1G5ZA 4GQHA 5JSLA 2XLDA 3QW0A 1SMYF 3B0VC 4N6HA 1Z6AA 2JD3A 4OIOF 1EKYA 3US6A 2KNHA 3GEIA 4BJ5A 4MVRA 4JURI 4YT5A 3V5XA 4ER9A 2XL6A 3DAFA 4EKWA 4MW3A 3KYIA 3W8HA 1S05A 2C03A 2L81A 4AK9A 1YZCA 1L7CA 1V4AA 1HY5A 1LVKA 3V5ZA 2VCAA 1H9TA 1TFKB 2ZXOA 5F5HA 1QKRA 3MYFA 2J7PA 3GODA 4G78A 1VB5A 5A6BA 2FFHA 1PD0A 2X51A 4PJMA 2BC5A 2ZD9A 5F5FA 2VASA 3FHDA 2YLGA 3EQLF 3JZ0A 2R05A 4JEAA 2LQGA 4CDAA 4CDVA 1M2OA 3GEHA 2R7OA 3W4YA 5DQTA 2Q3TA 3EFOA 2CDQA 1ZVZA 1WWPA 4U5CE 3VYWA 5A6KA 2LFDA 1VLTA 3C62A 5FCLA 5DS5A 3JYYA 3NKDA 4C3DA 2J0WA 4PJJA 4QDLA 2TMVP 2M64A 2OEXA 3NRHA 1TWHA 3ZIBA 2EPLX 1HE1A 5B1BC 1I4ZA 1KU2A 1OR2A 2E87A 3NMJA 4KNVA 3Q6NA 5L0FA 5KYWA 4XPYA 2NUTA 2L6FA 5BQGA 1O87A 3V5YA 1OW6A 2HSBA 3O6XA 5BUOA 1WTYA 1D1CA 2OEVA 3DJNB 3N0TA 4HFKB 4E0HA 2GWWA 1RKEA 1R4TA 1CPRA 1HW2A 2NSFA 1TWAA 2A1DD 1XZQA 3U2LA 2MWQA 5AC5A 4P9FA 1G4US 1OCOC 4G7ZF 3LS0A 5L0JA 1PCXA 3I4UA 5CI8A 3U3FA 3ZDLA 3LLIA 4EUKB 4DJ9A 2VCCA 1JOGA 3AGUA 3TQOA 1RXQA 4JZAA 3AG3C 1E2XA 1ZU5A 5L3VA 2KSFA 3ITFA 3DXJF 3DAGA 3T4RA 1DOWA 4DVYP 1V55C 2XSEA 2I15A 2ZXRA 4U5GA 2J8WA 4J7TA 2WZLA 2ZXPA 3BRJA 4NTFA 2P61A 3IPMO 2LD6A 3G4XA 4LLEA 3T6BA 4DXWA 2R7UA 2HV7A 2PBEA 1A0BA 1MMDA 1T6IA 4PJNA 4MNDA 4B6IA 2YLIA 1OXKA 2LCHA 3HNKA 2EILC 1YAUO 1S7ZA 4Z9JA 4EBKA 1ORYA 3C7JA 4JCZA 3WG7C 5KYUA 4IAQA 4BJ6A 3AQBA 2L9JA 4HE8D 3S28A 3FAPB 1U89A 5A6JA 2AWCA 3GWNA 3SXKA 4EIYA 5L0CA 3EH1A 4BJ6C 4JTAB 1RKCA 3ECSA 3ABKC 1BR2A 1M2VB 2VC9A 3MBGA 3ZWIA 3RKOF 1JMWA 2ZXWC 3ABLC 4YT2A 3EGDB 4H4KC 2CW0F 4MW8A 4CSAA 3DMDA 5JS5A 1Q0GA 4WGYA 3EG9A 4XEKA 3ABMC 3UGOA 3SEOA 4E18A 2YL7A 3QW1A 2D5RB 3VRCA 4C3EA 3NG1A 2PX0A 4U9EA 4IAOA 4O6NA 4XTKA 1IW7F 3C8ZA 5HV9A 4CSAC 2CCYA 2HZ8A 3B71A 1HMOA 3HNIA 3B0PA 5JT4A 2G3KA 4JKVA 2Q9BA 4IRUA 3M1CB 2WVOA 1HW1A 4HFFB 3U3BA 2XL8A 5IY5C 3UMKA 3IQ6A 3LS1A 2YRFA 4AL0A 3S84A 5KYUB 4XLPF 4CS8A 1T6QA 1ZHWA 3RH3A 4CS9A 5E33A 1MMNA 2IXMA 1SYQA 1Y6DA 1JPNA 3FVYA 1Q0MA 2KQ9A 3HLZA 3EHMA 3LUTB 4N4WA 4PFOA 1MMGA 2QLAA 5KYNA 3K1HA 4O7GA 1OKKD 4XPWA 5BQIA 2Q9AA 1APCA 3OEOA 4CS8C 1QVXA
chains in the Genus database with same CATH topology
4PACA 1WN0A 1OXKA 2LCHA 1FR0A 3US6A 1TQGA 1OXBA 1BDJB 4EUKB 3KYIA 3U3BA 2OOCA 1I5NA 1C02A 3IQTA 2LP4A 3KYJA 2Q4FA 1QSPA 3MYFA 4G78A 1Y6DA 2R25A 1SR2A 2A0BA 2LD6A 1C03A 1YVIA 1A0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAC A;  1WN0 A;  1OXK A;  2LCH A;  1FR0 A;  3US6 A;  1TQG A;  1OXB A;  1BDJ B;  4EUK B;  3KYI A;  3U3B A;  2OOC A;  1I5N A;  1C02 A;  3IQT A;  2LP4 A;  3KYJ A;  2Q4F A;  1QSP A;  3MYF A;  4G78 A;  1Y6D A;  2R25 A;  1SR2 A;  2A0B A;  2LD6 A;  1C03 A;  1YVI A;  1A0B A; 
#chains in the Genus database with same CATH topology
 2CNW D;  4CS9 C;  2J9W A;  1YZA A;  4PAC A;  1WN0 A;  4IB4 A;  5AC4 A;  3HNL A;  3CZ6 A;  1U6H A;  4JTD B;  4NTB A;  4BJ1 A;  2UUI A;  3O10 A;  3C18 A;  1NFO A;  1YJG A;  3NYM A;  4YT4 A;  4GEH A;  3LEV A;  3RIP A;  2DYS C;  4OIN F;  5D92 A;  1FMV A;  4WJ0 A;  2PX3 A;  3HTK C;  1JAF A;  1ORJ A;  3J06 A;  1MND A;  2YVK A;  1XZP A;  4JEB A;  1TWC A;  1L3P A;  4XEF A;  4LER A;  3EH2 A;  3JRT A;  5CI9 A;  3RVY A;  3RFY A;  2IYL D;  3DJU B;  1UG7 A;  3UGP A;  3JSE O;  1FTS A;  2YLD A;  3RYL A;  1HE9 A;  4BG0 A;  1ST6 A;  4A2N B;  1GS9 A;  4RD9 A;  1C17 M;  5DS4 A;  4YT8 A;  2Z15 A;  5L0G A;  3X1O A;  3EGX B;  5KYX B;  3S27 A;  1ZW2 A;  4DBR A;  3NYJ A;  1JR8 A;  2YHS A;  3QZC A;  4W8K A;  3S0X A;  5KYY B;  4ANJ A;  1SF8 A;  3M4B A;  4AX2 A;  3RVZ A;  1R5I D;  1RJ9 A;  1Q0K A;  1ZHX A;  2DB4 A;  3Q6M A;  5BQH A;  1JRA A;  3GOR A;  4G7O F;  2QTV A;  4N06 A;  4C7O B;  4A4A A;  3GM2 A;  5JP7 A;  2YL0 A;  3K7D A;  1I5N A;  5A6B D;  3U8V A;  3TD7 A;  4EWC A;  1O5H A;  4W8P A;  4YL3 A;  2XLM A;  4N6C A;  4EBJ A;  4I1M A;  4YWQ A;  2OU6 A;  3PHF 2;  1BR4 A;  4Q7C A;  5L0I A;  3N24 A;  3U2M A;  2YEV A;  4AE4 A;  5E3A A;  1KTM A;  5EHH A;  1N1C A;  2GDC A;  1ZHT A;  2A6H F;  3L8I A;  2HKV A;  2EPO A;  3RQE A;  2ETS A;  1HMD A;  1DOV A;  1AEP A;  2LK4 A;  1ZHY A;  2MHR A;  3SYN A;  1E86 A;  3HJC A;  3KKB A;  3NKE A;  1YA7 O;  1Z5Z A;  1WGW A;  5L0H A;  1TWG A;  1NBB A;  4EHP A;  3GM3 A;  3TJ5 A;  2XL4 A;  2C04 A;  4MTF A;  4NY3 A;  3T6G B;  1D0X A;  1FFH A;  3LAY A;  4OIP F;  2HV6 A;  2KGO A;  2HJ3 A;  4KBL A;  3SP1 A;  3G4Z A;  4LAC B;  1ZZP A;  1OR3 A;  3VF0 A;  1KNY A;  2IXP A;  1PD1 A;  2OJQ A;  4WGZ A;  4OIR F;  1LM3 B;  3M79 A;  4UDV A;  3PDM P;  2QUP A;  2UUH A;  3EFO B;  4WAB A;  3JCU Q;  3DM9 B;  4DBQ A;  4FX5 A;  1BZ4 A;  2IXO A;  2VB6 A;  3F47 A;  2QNL A;  3O39 A;  3B0U X;  4CIP A;  1A7E A;  4IWB A;  4MVU A;  2G62 A;  4PFP A;  3U0C A;  3T9O A;  4CJG A;  3BEH A;  1K40 A;  2HSQ A;  2PP4 A;  3TK0 A;  3TJ6 A;  2H8A A;  2RD9 A;  2AU5 A;  1U0B B;  2R7R A;  2LFF A;  2XS1 A;  3FOP A;  3HNJ A;  5GPG B;  5JUA A;  2W4B A;  3RQG A;  4JE9 A;  2R03 A;  1QPU A;  5KYW B;  2NUT B;  2A6E F;  4AE4 B;  1VOM A;  3B29 A;  2B0J A;  3LJB A;  1YLM A;  2PF4 E;  4OD5 A;  4YK5 A;  1YAR O;  3UR3 C;  3B9Q A;  1FAP B;  1RKE B;  2KYH A;  4XWJ A;  1J8M F;  3CSK A;  5L0D A;  1OQC A;  4JTC B;  1FNT c;  2Q4F A;  1MMA A;  3RF3 A;  2L7A A;  3GEE A;  4YL0 A;  1IZM A;  1NZE A;  5TJ5 E;  5B3I A;  4Q4Z F;  2DI3 A;  3EJN A;  1H7I A;  1NLX A;  1UFB A;  3KPH A;  1T6U A;  1H9G A;  2R7T A;  2G3V A;  4FES A;  3MX3 A;  2Q7R A;  1VYI A;  2D4U A;  3DWW A;  4CDY A;  2R7Q A;  1LI7 A;  4BEJ A;  2OG2 A;  2JPU A;  3K1I A;  3AG2 C;  3W2W A;  1YYJ A;  4NQF A;  2Y3G A;  4I3M A;  5FZT A;  5F28 E;  3OA1 A;  3VM6 A;  3DE8 A;  1K04 A;  1TQG A;  1BR1 A;  1WAS A;  2ICW G;  3K66 A;  3QVZ A;  1W2W A;  4HEA J;  3UMH A;  4U5E E;  4DRJ B;  2XLV A;  2V3C C;  3DI5 A;  1BBH A;  3K1I C;  3EPV A;  2EIM C;  2R9R B;  4LDK A;  4Q5S F;  2M4E A;  1NG1 A;  4XQ1 A;  3W8I A;  3ASO C;  3IQT A;  3S90 A;  4G0H A;  4JJF A;  2EIK C;  2Y3H A;  3MLG A;  1OCC C;  4YN0 B;  1QSP A;  2HS5 A;  3NYL A;  5JVE A;  256B A;  1V74 B;  2HMQ A;  2WB7 A;  4ULW A;  2J46 A;  2R25 A;  2KC3 A;  3CEX A;  3FOO A;  3JT1 A;  2XM0 A;  3ZQY A;  4ZLC A;  3T6J A;  2W4M A;  3L34 A;  4OD4 A;  3S9O A;  4KC9 A;  4ONS A;  1VYK A;  2DYR C;  2YL3 A;  3PCV A;  1OW8 A;  1FR0 A;  1LI5 A;  2FGY A;  2J9B A;  1O3U A;  3C8G A;  5COM A;  4JVS A;  1YA9 A;  2GAQ A;  1J8Y F;  1ORS C;  2OQM A;  4I1O B;  1BDJ B;  1JPJ A;  2ZPA A;  3EG9 B;  4ULV A;  2IOQ A;  2P0N A;  4BJT A;  4K7B A;  2A0U A;  2OOC A;  3ASN C;  3FAJ A;  4IAR A;  4F4B A;  2QE9 A;  3JTL O;  3H2V A;  3GWL A;  3AG4 C;  5L3Q A;  2KK1 A;  4J30 B;  4E17 A;  4E7Z A;  4CX9 A;  3NDB B;  2IBF A;  3AGT A;  4PJL A;  1EA8 A;  1PV3 A;  1Z3I X;  4H54 A;  4O79 A;  2NG1 A;  1OW7 A;  1LIH A;  2JX0 A;  3TUL A;  4DVZ A;  2J45 A;  3I5Q A;  3ZQV A;  1AUE A;  1M6T A;  4J32 B;  1C03 A;  1GQA A;  1ZHZ A;  2XLW A;  2IXN A;  1CGM E;  4XEV A;  1CPQ A;  4P6I C;  2BE5 F;  3IEE A;  1TKN A;  3UNG C;  5EGY A;  3WHN A;  1G4W R;  4U5F E;  1FFT C;  5DLJ A;  2WL8 A;  2P1A A;  1OCZ C;  5COG A;  2GFH A;  2XM4 A;  3FXH A;  1LPE A;  1OXB A;  2EPN A;  2YZS A;  3L8J A;  3O55 A;  4O6Y A;  2AWY A;  1M57 C;  3JYH A;  4QI0 A;  4KI2 A;  2XXA B;  3Q7L A;  1RCP A;  2OCC C;  1GM5 A;  1M56 C;  2J9U A;  2H7V C;  1B68 A;  3KMI A;  4P9T A;  3IQC A;  2J7P D;  2YL1 A;  4BJ5 C;  4MVQ A;  2YWA A;  2WZF A;  2R02 A;  3C8G B;  3KYJ A;  3R2P A;  3W2V A;  1OCR C;  1YDI A;  1CGO A;  1D0Z A;  3KL4 A;  4BEM J;  2NUP A;  3H65 A;  4LDR A;  5T3T A;  2CGE A;  3LNM B;  2BL2 A;  5B1A C;  4LDQ A;  4JIO A;  2P6V A;  3RQF A;  3SXM A;  4CJO A;  5E3C A;  4ZLD A;  1VLS A;  3POV A;  3E9V A;  4XLN F;  1YYX A;  3AQC A;  1LKX A;  4R32 A;  1ZU4 A;  5DS6 A;  1NU9 C;  2NPU A;  2F22 A;  2WVQ A;  1GGQ A;  3DM5 A;  3SNH A;  4JRZ A;  4Z9I A;  3U8P A;  5CIV A;  3QMK A;  4MS2 A;  1E84 A;  3HKK A;  5T3W A;  5K0I A;  2LSE A;  3ZTZ A;  2V26 A;  4JC7 A;  3AJM A;  4EBB A;  4M63 A;  5D91 A;  4E7S A;  3C63 A;  4JW1 A;  2WZG A;  3EZI A;  5EK0 A;  3A11 A;  1NSG B;  3Q7G A;  3S29 A;  2EIJ C;  2XLH A;  3IHU A;  4JCH A;  3AG1 C;  1A7V A;  4D4X A;  1VTM P;  1C02 A;  4FWV A;  2YQY A;  4PR9 A;  4XPX A;  3MYI A;  1E85 A;  2AVK A;  1QZX A;  1RJ9 B;  5HSW A;  2OKU A;  1Q0D A;  2PFD A;  2QY9 A;  5DVW A;  3A9C A;  3LES A;  4NCQ A;  4C3B A;  4GYT A;  2Y3B A;  4X0R A;  2DGJ A;  2EPM X;  4J7Y A;  3OWT A;  1T9K A;  2HMZ A;  4FAP B;  4MTO A;  2NUP B;  1WAT A;  4DOZ A;  3G50 A;  3VAY A;  3KH2 A;  3E70 C;  1M2V A;  4PK4 A;  4CS7 A;  1MNE A;  3K6B A;  3DZA A;  3GAN A;  3NMI A;  3EGD A;  2WVN A;  2NSG A;  3TOM A;  1XWJ A;  4MQ9 F;  3SXZ A;  3QTH A;  4JJG A;  3ZTM A;  3GM1 A;  3ZVR A;  1QQ3 A;  2B0H A;  3I5P A;  1D1B A;  3EZH A;  4AL1 A;  1ZYR F;  1TFO B;  2VH3 A;  5COF A;  4L6R A;  2XRH A;  1LE2 A;  3SXY A;  1Z63 A;  2KJG A;  2XLO A;  3M4C A;  1Z7Q c;  4YL1 A;  3U9J A;  5T1D B;  2HJM A;  2J9V A;  2R7S A;  2A0B A;  3H2U A;  1TR2 A;  4U9D A;  4CIH A;  2PNO A;  1LS1 A;  1YVI A;  3ZG1 A;  3U5S A;  1T01 A;  3V7O A;  2H7B A;  5DQZ A;  3AOU A;  3LLK A;  3ZC4 A;  5JLI A;  4RBN A;  2Q9C A;  1RMV A;  5JRA A;  1F1M A;  2AP3 A;  1G8X A;  3CQZ A;  4LLC A;  1EQ1 A;  1H6G A;  2W9Y A;  1EI7 A;  4D4N A;  4CBE A;  3QVY A;  3WAQ A;  3JSZ A;  2OJE D;  2P7V A;  2RSE B;  3L1M A;  3NMK A;  3PMR A;  2R7X A;  1K05 A;  2KW3 C;  1A7D A;  2I8B A;  2W45 A;  2IM8 A;  4K0D A;  1WOL A;  2LIG A;  1D0Y A;  2A68 F;  1Z23 A;  2EIN C;  2MYS A;  1SZI A;  3WOD F;  3DE9 A;  4O6M A;  4MTG A;  1NFN A;  2R7W A;  4I44 A;  3TOL A;  4YJW A;  5A69 A;  2FAP B;  3ATP A;  3F46 A;  2XLE A;  3L0I A;  1AVO B;  1SR2 A;  2HFI A;  3K33 A;  1QLE C;  3M15 A;  3DKA A;  3MFN A;  4KNW A;  4MVS A;  4MVM A;  4OIQ F;  3R7C A;  4MVZ A;  3DD7 A;  2R7V A;  2H7O A;  4U5D E;  3ZSU A;  1V54 C;  1A41 A;  1D1A A;  1FMW A;  2A69 F;  2Y3D A;  1NU7 D;  1MQV A;  4E0I A;  1LE4 A;  4DRH B;  3FDQ A;  3EHN A;  2VCB A;  1OKK A;  3IQ5 A;  4G7H F;  4BPM A;  2EPK X;  2ASR A;  3N2Z B;  2HUJ A;  4NTA A;  2CNW A;  4K1O A;  4RDA A;  2GA0 A;  2X0C A;  2O9X A;  3X2Q C;  4Z9H A;  2CYD A;  5A6A A;  2XXA A;  4MVO A;  4NC3 A;  4U5B E;  2Y39 A;  4DRI B;  1T5O A;  1LS4 A;  2L6H A;  3RW0 A;  1E83 A;  3EGX A;  5KYX A;  4QI2 A;  2LP4 A;  3CAX A;  2Q00 A;  2Y69 C;  2J0X A;  1I4Y A;  3SZR A;  1CGN A;  1VK5 A;  3LNR A;  5B3S C;  5KYY A;  3JRM O;  3U9M A;  2YKZ A;  3FMS A;  4IJJ A;  1ZW3 A;  1Y4C A;  3UMI A;  5E2Q A;  3LEO A;  5AGF A;  4C7O A;  1Q0F A;  4IGG A;  1VMA A;  2L6G A;  3C8G D;  4U5H A;  2XS8 A;  1G5Z A;  4GQH A;  5JSL A;  2XLD A;  3QW0 A;  1SMY F;  3B0V C;  4N6H A;  1Z6A A;  2JD3 A;  4OIO F;  1EKY A;  3US6 A;  2KNH A;  3GEI A;  4BJ5 A;  4MVR A;  4JUR I;  4YT5 A;  3V5X A;  4ER9 A;  2XL6 A;  3DAF A;  4EKW A;  4MW3 A;  3KYI A;  3W8H A;  1S05 A;  2C03 A;  2L81 A;  4AK9 A;  1YZC A;  1L7C A;  1V4A A;  1HY5 A;  1LVK A;  3V5Z A;  2VCA A;  1H9T A;  1TFK B;  2ZXO A;  5F5H A;  1QKR A;  3MYF A;  2J7P A;  3GOD A;  4G78 A;  1VB5 A;  5A6B A;  2FFH A;  1PD0 A;  2X51 A;  4PJM A;  2BC5 A;  2ZD9 A;  5F5F A;  2VAS A;  3FHD A;  2YLG A;  3EQL F;  3JZ0 A;  2R05 A;  4JEA A;  2LQG A;  4CDA A;  4CDV A;  1M2O A;  3GEH A;  2R7O A;  3W4Y A;  5DQT A;  2Q3T A;  3EFO A;  2CDQ A;  1ZVZ A;  1WWP A;  4U5C E;  3VYW A;  5A6K A;  2LFD A;  1VLT A;  3C62 A;  5FCL A;  5DS5 A;  3JYY A;  3NKD A;  4C3D A;  2J0W A;  4PJJ A;  4QDL A;  2TMV P;  2M64 A;  2OEX A;  3NRH A;  1TWH A;  3ZIB A;  2EPL X;  1HE1 A;  5B1B C;  1I4Z A;  1KU2 A;  1OR2 A;  2E87 A;  3NMJ A;  4KNV A;  3Q6N A;  5L0F A;  5KYW A;  4XPY A;  2NUT A;  2L6F A;  5BQG A;  1O87 A;  3V5Y A;  1OW6 A;  2HSB A;  3O6X A;  5BUO A;  1WTY A;  1D1C A;  2OEV A;  3DJN B;  3N0T A;  4HFK B;  4E0H A;  2GWW A;  1RKE A;  1R4T A;  1CPR A;  1HW2 A;  2NSF A;  1TWA A;  2A1D D;  1XZQ A;  3U2L A;  2MWQ A;  5AC5 A;  4P9F A;  1G4U S;  1OCO C;  4G7Z F;  3LS0 A;  5L0J A;  1PCX A;  3I4U A;  5CI8 A;  3U3F A;  3ZDL A;  3LLI A;  4EUK B;  4DJ9 A;  2VCC A;  1JOG A;  3AGU A;  3TQO A;  1RXQ A;  4JZA A;  3AG3 C;  1E2X A;  1ZU5 A;  5L3V A;  2KSF A;  3ITF A;  3DXJ F;  3DAG A;  3T4R A;  1DOW A;  4DVY P;  1V55 C;  2XSE A;  2I15 A;  2ZXR A;  4U5G A;  2J8W A;  4J7T A;  2WZL A;  2ZXP A;  3BRJ A;  4NTF A;  2P61 A;  3IPM O;  2LD6 A;  3G4X A;  4LLE A;  3T6B A;  4DXW A;  2R7U A;  2HV7 A;  2PBE A;  1A0B A;  1MMD A;  1T6I A;  4PJN A;  4MND A;  4B6I A;  2YLI A;  1OXK A;  2LCH A;  3HNK A;  2EIL C;  1YAU O;  1S7Z A;  4Z9J A;  4EBK A;  1ORY A;  3C7J A;  4JCZ A;  3WG7 C;  5KYU A;  4IAQ A;  4BJ6 A;  3AQB A;  2L9J A;  4HE8 D;  3S28 A;  3FAP B;  1U89 A;  5A6J A;  2AWC A;  3GWN A;  3SXK A;  4EIY A;  5L0C A;  3EH1 A;  4BJ6 C;  4JTA B;  1RKC A;  3ECS A;  3ABK C;  1BR2 A;  1M2V B;  2VC9 A;  3MBG A;  3ZWI A;  3RKO F;  1JMW A;  2ZXW C;  3ABL C;  4YT2 A;  3EGD B;  4H4K C;  2CW0 F;  4MW8 A;  4CSA A;  3DMD A;  5JS5 A;  1Q0G A;  4WGY A;  3EG9 A;  4XEK A;  3ABM C;  3UGO A;  3SEO A;  4E18 A;  2YL7 A;  3QW1 A;  2D5R B;  3VRC A;  4C3E A;  3NG1 A;  2PX0 A;  4U9E A;  4IAO A;  4O6N A;  4XTK A;  1IW7 F;  3C8Z A;  5HV9 A;  4CSA C;  2CCY A;  2HZ8 A;  3B71 A;  1HMO A;  3HNI A;  3B0P A;  5JT4 A;  2G3K A;  4JKV A;  2Q9B A;  4IRU A;  3M1C B;  2WVO A;  1HW1 A;  4HFF B;  3U3B A;  2XL8 A;  5IY5 C;  3UMK A;  3IQ6 A;  3LS1 A;  2YRF A;  4AL0 A;  3S84 A;  5KYU B;  4XLP F;  4CS8 A;  1T6Q A;  1ZHW A;  3RH3 A;  4CS9 A;  5E33 A;  1MMN A;  2IXM A;  1SYQ A;  1Y6D A;  1JPN A;  3FVY A;  1Q0M A;  2KQ9 A;  3HLZ A;  3EHM A;  3LUT B;  4N4W A;  4PFO A;  1MMG A;  2QLA A;  5KYN A;  3K1H A;  4O7G A;  1OKK D;  4XPW A;  5BQI A;  2Q9A A;  1APC A;  3OEO A;  4CS8 C;  1QVX A; 
#chains in the Genus database with same CATH homology
 4PAC A;  1WN0 A;  1OXK A;  2LCH A;  1FR0 A;  3US6 A;  1TQG A;  1OXB A;  1BDJ B;  4EUK B;  3KYI A;  3U3B A;  2OOC A;  1I5N A;  1C02 A;  3IQT A;  2LP4 A;  3KYJ A;  2Q4F A;  1QSP A;  3MYF A;  4G78 A;  1Y6D A;  2R25 A;  1SR2 A;  2A0B A;  2LD6 A;  1C03 A;  1YVI A;  1A0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...