1C02A

Crystal structure of yeast ypd1p
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
STIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMQHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into eukaryotic multistep phosphorelay signal transduction revealed by the crystal structure of Ypd1p from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords PHOSPHOTRANSFERASE YPD1P
total genus 61
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1c02A00
4EUKB 2A0BA 1YVIA 1BDJB 3US6A 1C03A 1Y6DA 3KYIA 1C02A 1FR0A 2R25A 4PACA 1SR2A 1OXBA 3IQTA 2LD6A 1A0BA 2Q4FA 1TQGA 2LCHA 2LP4A 1I5NA 4G78A 1WN0A 3MYFA 1OXKA 3KYJA 1QSPA 3U3BA 2OOCA
chains in the Genus database with same CATH superfamily
3ASOC 3RQGA 2JX0A 1V54C 3E70C 3O39A 4FESA 4FWVA 2A6EF 4NTAA 4ONSA 3T6GB 1ST6A 4CJOA 2XXAA 3QZCA 4PJMA 1PD0A 5D91A 2NUTA 4CDVA 2YQYA 3UGOA 2HKVA 2Q7RA 4XEKA 2YVKA 2YZSA 4DRIB 1TWCA 3HKKA 3UMIA 1W2WA 4BJTA 1E85A 5B3IA 1F1MA 2M4EA 3N0TA 2PFDA 5AGFA 3K66A 4CS8A 2IM8A 2OCCC 2XLDA 3CEXA 1OW7A 2Y3DA 3GORA 2A68F 2J7PD 1WN0A 4I3MA 3T4RA 3ZDLA 4C7OB 1O3UA 1IZMA 3DE8A 4JC7A 1CPQA 3NDBB 2EPLX 5L0IA 2IXNA 3EQLF 1JPNA 3DD7A 3DM9B 1K04A 4JURI 1T5OA 4IB4A 2CW0F 2VCBA 4XEFA 3GM3A 5EGYA 3T6JA 4PFOA 2R05A 3V5ZA 1RJ9A 3U2LA 3NYLA 4L6RA 1RXQA 2YL7A 3MFNA 3U9JA 4BJ6A 4U5HA 4Z9JA 1YJGA 5DS6A 2Z15A 1OW8A 2V3CC 3SNHA 1LI7A 3ZTZA 3LNRA 1TFOB 4QDLA 1K05A 1OXBA 3DXJF 4NY3A 3JZ0A 1HMOA 2IBFA 1HW1A 2ZPAA 2J8WA 4C3EA 4CS8C 1H9TA 4KNVA 1LE4A 4AE4B 1OKKA 3K6BA 4ER9A 4E7SA 4N6CA 2YKZA 1FFHA 1PCXA 1A7DA 3B9QA 3E9VA 5DVWA 2BE5F 4EWCA 2J9BA 2L7AA 4U5BE 3TJ6A 2LIGA 3GM1A 2PBEA 3JRTA 4JCZA 4O79A 2J9WA 4MVOA 4X0RA 4YL3A 3U8PA 1FNTc 2IOQA 3U3BA 1KU2A 1QQ3A 2QNLA 3K1IC 4KBLA 2ZXPA 1LM3B 1MNEA 3FHDA 2IXMA 1FMWA 2EPOA 1H9GA 3NMJA 1Z7Qc 3TK0A 4EBBA 2XXAB 1NU7D 3CAXA 4JTCB 1Z5ZA 2HJMA 3G4XA 3EG9B 4XPXA 2J46A 2NUTB 5COMA 3HJCA 4JEBA 2P61A 3WAQA 3QMKA 1V74B 2L6FA 3C8ZA 4I1OB 4U5DE 1YYJA 1E2XA 1QKRA 2LFDA 3A11A 2EIKC 3I5QA 1D0XA 3ZQYA 2R7OA 1HE9A 1WASA 2EILC 2XS1A 1OCCC 2YL3A 4C7OA 2CGEA 5CIVA 1A41A 2R7WA 2VC9A 2L81A 4DRHB 2NG1A 2PX0A 2R7QA 3JTLO 3FDQA 3C8GD 1T9KA 2MWQA 4OIPF 4RBNA 4OD5A 5JT4A 2HFIA 2YLIA 2CYDA 2A0BA 2HSBA 1H6GA 3GM2A 1Z6AA 1ZW2A 1RJ9B 1YZAA 3OWTA 3UMKA 3ATPA 3L34A 3X2QC 2IXOA 4CJGA 2HMZA 3KYIA 5TJ5E 3I4UA 4JTAB 2W45A 2R7SA 2OKUA 3X1OA 3AG3C 3HLZA 4MW8A 3RIPA 4E18A 2Q9AA 3C7JA 5E3CA 3G4ZA 2P1AA 4MVQA 5T3WA 2TMVP 2JD3A 1NFNA 5JVEA 3EHMA 4JJGA 3DJUB 3LNMB 3OEOA 4OINF 1QZXA 1M57C 4AE4A 4CS9C 4EIYA 3S84A 1U0BB 2PX3A 1OXKA 4ULVA 4Q7CA 3L8JA 5KYUA 3IQCA 3SXZA 2H8AA 4N4WA 4OIRF 2XLWA 4JIOA 3ZWIA 1FFTC 4MVSA 3UNGC 4HFKB 4U5GA 2LFFA 3HNLA 1M2VB 1T6UA 1YVIA 3SZRA 4DOZA 4W8KA 5A69A 4MQ9F 5BQGA 1OKKD 2XL4A 4HE8D 4IJJA 3KH2A 3LUTB 3EG9A 4CIHA 4PK4A 2WVOA 3GEIA 3RVYA 5KYUB 3LLKA 3JYYA 4CSAA 2GDCA 5IY5C 2H7BA 1D0YA 3R7CA 3MYIA 2KNHA 4D4NA 1J8YF 2CNWA 3AGTA 1M2VA 3JSZA 3PMRA 2V26A 4G7OF 2R7UA 3N24A 2GAQA 3NYJA 1E83A 2NPUA 3DAFA 3HNIA 1E86A 1YDIA 4P6IC 2IXPA 2XLMA 5DQTA 1OCZC 5KYXB 2AVKA 5CI9A 2HV7A 1Q0KA 1VYIA 1YAUO 1ZU5A 4K1OA 3U0CA 3M79A 4NTFA 3NYMA 2WB7A 3V5YA 3ITFA 3Q7GA 1M2OA 1OCRC 3AOUA 4PFPA 1YZCA 1T6IA 1SF8A 2VCCA 4N6HA 4DBRA 5E2QA 2UUHA 3JYHA 2GWWA 2ZD9A 2Y3HA 5A6JA 1LIHA 3LESA 2LSEA 1UFBA 4XWJA 5HV9A 2D5RB 3FOPA 4E7ZA 1FMVA 3N2ZB 5JP7A 4DRJB 4E0HA 1LS1A 2AU5A 3FAPB 3K7DA 5KYYA 3C8GB 3NKDA 2R7XA 1TR2A 3HNKA 2KW3C 5T3TA 4BJ5A 4WABA 3ZTMA 1LVKA 2AWCA 3DKAA 1XZPA 3MLGA 2PP4A 2MHRA 4PJNA 2GA0A 3VRCA 1M6TA 5BQIA 1O87A 3US6A 3J06A 3EGXB 3W4YA 5L0CA 4RDAA 4HEAJ 2HMQA 2OEVA 1MQVA 3EZHA 2R9RB 1LKXA 1FR0A 5EK0A 3SXKA 2PNOA 1KNYA 3B29A 3SEOA 4IAOA 2CDQA 1CGNA 3C63A 1NU9C 2KQ9A 3O6XA 4P9FA 3EGDA 2Q00A 2ZXOA 4BG0A 4YL0A 2G3KA 1QPUA 3BRJA 1Z3IX 1JOGA 3NRHA 3R2PA 1TQGA 4D4XA 2KJGA 4A4AA 3EGXA 256BA 2QUPA 3RQEA 3PHF2 1NFOA 4ZLCA 2J7PA 3EH2A 1GM5A 1ORSC 4MVZA 1K40A 3NMKA 1I4YA 4U5EE 4W8PA 3W2VA 4NCQA 1RKCA 3BEHA 3U8VA 2XRHA 1MMAA 1ZU4A 2L6HA 1Y4CA 2EPMX 3OA1A 4IAQA 5KYXA 1VLTA 2H7OA 3S29A 1DOWA 2J9UA 2W9YA 3DZAA 3QTHA 4ANJA 3POVA 3VM6A 3M4BA 4R32A 1G4WR 2DGJA 3UR3C 1Q0DA 3CQZA 2ETSA 2R25A 5AC4A 4WJ0A 1HW2A 2B0JA 3TQOA 3QW0A 3Q6NA 3K1HA 2HJ3A 2Q9BA 1SZIA 1A0BA 4RD9A 1O5HA 2W4BA 3IPMO 1VK5A 3AGUA 3EJNA 2JPUA 3IEEA 3T6BA 5DQZA 1FAPB 4O6NA 3ABKC 5KYYB 1WOLA 4JRZA 4LLCA 3C8GA 2O9XA 3TOLA 4FAPB 2XM4A 1YA9A 1IW7F 1LS4A 1QSPA 4JCHA 2IYLD 2HZ8A 2X51A 2XLHA 2OJQA 3WHNA 1BZ4A 4JVSA 3LS1A 2KYHA 3IHUA 1VLSA 1HY5A 2KSFA 3U5SA 3VAYA 4CIPA 3B0UX 1Q0MA 1H7IA 2E87A 3GANA 1DOVA 4FX5A 2XSEA 2YRFA 5DS4A 3KL4A 1T01A 1WTYA 3EGDB 2Y39A 3KKBA 1L7CA 2A6HF 4NQFA 5B3SC 1OR3A 2RD9A 2I15A 2W4MA 2LCHA 4GYTA 4BJ1A 3S90A 1B68A 4PJJA 1OW6A 3H2UA 2LQGA 4J7TA 2XLVA 1CGME 3DAGA 4J30B 3FXHA 3HTKC 5A6BA 5A6KA 3MX3A 3TD7A 4A2NB 5L0GA 3SXMA 3TULA 3JSEO 1SMYF 4OIQF 3B0PA 4DVYP 1OQCA 4MVRA 3K1IA 5CI8A 5EHHA 2P6VA 3ZQVA 3KMIA 3RFYA 2HUJA 2XM0A 4JE9A 4KC9A 3S28A 5L0FA 1EI7A 1D1CA 1ORJA 2OJED 3EZIA 3GWNA 4KNWA 2A0UA 5HSWA 3UGPA 2NUPB 2H7VC 2J9VA 2R03A 3HNJA 1EA8A 4I1MA 4QI0A 4NTBA 2DYRC 3LEVA 1VMAA 4PACA 1UG7A 4YJWA 4YT4A 4Z9HA 3B0VC 2BL2A 1GGQA 4CDYA 4P9TA 4OIOF 3QW1A 4MNDA 4XQ1A 5D92A 5BUOA 3PCVA 2Y69C 1FTSA 2BC5A 1MMDA 2HV6A 1Z63A 2R7VA 1BBHA 2J0XA 3EHNA 2WZLA 1S05A 3DI5A 4BPMA 1A7EA 4MVUA 4UDVA 4Q4ZF 3NKEA 4XPWA 2WZFA 4EUKB 1BDJB 4YT8A 2P0NA 4IRUA 1RCPA 4HFFB 2NSFA 4ULWA 2VASA 2AWYA 4AL0A 2EPNA 5GPGB 4BJ6C 4F4BA 4YT2A 1ORYA 1RKEB 5FCLA 4LERA 3WG7C 1T6QA 5COGA 3RF3A 3FMSA 4G0HA 4LDQA 1WWPA 3NG1A 1NSGB 1A7VA 2LD6A 3GEEA 1M56C 2Q4FA 1SYQA 3JCUQ 1HE1A 2C04A 4JZAA 1G8XA 3LJBA 3EH1A 3AQCA 3GWLA 3MYFA 2EPKX 3CSKA 3EFOB 3M1CB 3DJNB 2FFHA 4DVZA 5L3VA 1D1BA 2L9JA 2OEXA 1VB5A 3LS0A 1BR2A 4U5CE 3S9OA 4WGYA 3ZC4A 3W2WA 1RMVA 2J0WA 1G5ZA 2YLDA 3WODF 4E17A 1Q0FA 1U89A 3EFOA 2NUPA 1R4TA 4YL1A 1VTMP 1MNDA 3A9CA 1ZZPA 5A6AA 5F5FA 4Z9IA 2ZXWC 3I5PA 1HMDA 3FAJA 3H2VA 4IWBA 4YN0B 2X0CA 4B6IA 5KYNA 2I8BA 1TWGA 2OU6A 3FOOA 2UUIA 1BR4A 2VCAA 3DMDA 4J7YA 1JRAA 5AC5A 1C17M 4U9EA 2PF4E 4J32B 4YT5A 1V4AA 4I44A 4JW1A 5F28E 2CNWD 2F22A 4MTFA 2XL6A 4LLEA 4EBKA 4XLPF 3EPVA 2YL1A 3V5XA 2R7RA 3G50A 2Y3BA 4DXWA 4EHPA 1EQ1A 2VH3A 5KYWB 1CGOA 4MVMA 4OD4A 1APCA 4O6YA 1MMGA 2QLAA 4O7GA 3RKOF 1R5ID 1RKEA 1Z23A 2YEVA 4H54A 4XTKA 1OCOC 3B71A 2M64A 4H4KC 2KK1A 2AP3A 3U9MA 2LK4A 3LAYA 1I4ZA 1ZYRF 2P7VA 4K0DA 4N06A 2YLGA 2FGYA 3SP1A 4BEMJ 3PDMP 4ZLDA 4GQHA 1J8MF 1BR1A 4JKVA 1GQAA 3RQFA 4MS2A 3VF0A 1TWHA 3GODA 1YARO 2WZGA 4LACB 1NG1A 4LDRA 2ICWG 4C3BA 4C3DA 4CS9A 5JUAA 3ZSUA 3L1MA 5JLIA 1L3PA 4CBEA 1ZW3A 1AVOB 4BJ5C 2GFHA 2MYSA 5F5HA 1ZHZA 2NSGA 1TKNA 5L0HA 3GEHA 4E0IA 1GS9A 2ASRA 2HSQA 3U3FA 1YA7O 1YYXA 1LE2A 3S27A 4EKWA 3O55A 1C03A 1Y6DA 1NZEA 2EINC 1XZQA 5JSLA 1C02A 1OR2A 3AG1C 2XLEA 3T9OA 1N1CA 2J45A 4WGZA 1U6HA 2B0HA 2OG2A 4CSAC 3C62A 1YLMA 2XLOA 3KPHA 4K7BA 4AK9A 3F46A 5T1DB 2DB4A 1WATA 3IQ6A 3M15A 3ZVRA 4KI2A 1PD1A 2DI3A 4IGGA 3RVZA 2LP4A 2ZXRA 4MTOA 4AX2A 4G78A 4IARA 3VYWA 1AEPA 2Y3GA 3ABLC 3W8HA 4U9DA 1ZHXA 3F47A 3AJMA 3IQ5A 2EIMC 2XS8A 1D1AA 4LDKA 1QLEC 2WL8A 5DS5A 1ZHWA 3MBGA 3DE9A 5E33A 4JTDB 5A6BD 3RYLA 4G7ZF 4Q5SF 5KYWA 4PJLA 1XWJA 2QY9A 3O10A 5E3AA 4XPYA 3RW0A 1TWAA 3SXYA 3U2MA 3JT1A 2HS5A 5BQHA 1CPRA 2R02A 2WVQA 2G62A 3Q6MA 4EBJA 3S0XA 5K0IA 2YHSA 3ZG1A 3L8IA 1JPJA 2YL0A 2FAPB 5DLJA 3M4CA 5JRAA 3Q7LA 1JMWA 4XEVA 4BEJA 2QE9A 1JR8A 2CCYA 3DWWA 3AG4C 4JEAA 4NC3A 4O6MA 5L3QA 1ZHYA 3SYNA 5B1BC 1E84A 2XL8A 3QVYA 4CS7A 2A1DD 3C18A 1QVXA 3LLIA 4U5FE 4DBQA 1AUEA 1ZVZA 2QTVA 2L6GA 4YK5A 3NMIA 2A69F 1EKYA 3CZ6A 1VYKA 3TJ5A 4DJ9A 4MW3A 1KTMA 5L0DA 3W8IA 2OOCA 2D4UA 2Q9CA 3JRMO 2Q3TA 1PV3A 4CDAA 5FZTA 2KC3A 3ABMC 5COFA 3FVYA 4GEHA 3AQBA 1LI5A 1MMNA 2OQMA 2EIJC 2DYSC 3ZIBA 3UMHA 1SR2A 2G3VA 3DM5A 4CX9A 1JAFA 4QI2A 3IQTA 4XLNF 1S7ZA 4AL1A 2RSEB 3AG2C 3LEOA 1VOMA 2KGOA 2WVNA 4G7HF 1LPEA 4JJFA 5B1AC 1I5NA 5L0JA 3ECSA 2VB6A 1D0ZA 3ASNC 2YWAA 3QVZA 3H65A 1TFKB 3RH3A 1NLXA 3K33A 2C03A 3KYJA 4PR9A 1Q0GA 1NBBA 1WGWA 4M63A 4MTGA 4YWQA 1G4US 3L0IA 5JS5A 3TOMA 3V7OA 1ZHTA 2R7TA 1V55C
chains in the Genus database with same CATH topology
4EUKB 2A0BA 1YVIA 1BDJB 3US6A 1C03A 1Y6DA 3KYIA 1C02A 1FR0A 2R25A 4PACA 1SR2A 1OXBA 3IQTA 2LD6A 1A0BA 2Q4FA 1TQGA 2LCHA 2LP4A 1I5NA 4G78A 1WN0A 3MYFA 1OXKA 3KYJA 1QSPA 3U3BA 2OOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EUK B;  2A0B A;  1YVI A;  1BDJ B;  3US6 A;  1C03 A;  1Y6D A;  3KYI A;  1C02 A;  1FR0 A;  2R25 A;  4PAC A;  1SR2 A;  1OXB A;  3IQT A;  2LD6 A;  1A0B A;  2Q4F A;  1TQG A;  2LCH A;  2LP4 A;  1I5N A;  4G78 A;  1WN0 A;  3MYF A;  1OXK A;  3KYJ A;  1QSP A;  3U3B A;  2OOC A; 
#chains in the Genus database with same CATH topology
 3ASO C;  3RQG A;  2JX0 A;  1V54 C;  3E70 C;  3O39 A;  4FES A;  4FWV A;  2A6E F;  4NTA A;  4ONS A;  3T6G B;  1ST6 A;  4CJO A;  2XXA A;  3QZC A;  4PJM A;  1PD0 A;  5D91 A;  2NUT A;  4CDV A;  2YQY A;  3UGO A;  2HKV A;  2Q7R A;  4XEK A;  2YVK A;  2YZS A;  4DRI B;  1TWC A;  3HKK A;  3UMI A;  1W2W A;  4BJT A;  1E85 A;  5B3I A;  1F1M A;  2M4E A;  3N0T A;  2PFD A;  5AGF A;  3K66 A;  4CS8 A;  2IM8 A;  2OCC C;  2XLD A;  3CEX A;  1OW7 A;  2Y3D A;  3GOR A;  2A68 F;  2J7P D;  1WN0 A;  4I3M A;  3T4R A;  3ZDL A;  4C7O B;  1O3U A;  1IZM A;  3DE8 A;  4JC7 A;  1CPQ A;  3NDB B;  2EPL X;  5L0I A;  2IXN A;  3EQL F;  1JPN A;  3DD7 A;  3DM9 B;  1K04 A;  4JUR I;  1T5O A;  4IB4 A;  2CW0 F;  2VCB A;  4XEF A;  3GM3 A;  5EGY A;  3T6J A;  4PFO A;  2R05 A;  3V5Z A;  1RJ9 A;  3U2L A;  3NYL A;  4L6R A;  1RXQ A;  2YL7 A;  3MFN A;  3U9J A;  4BJ6 A;  4U5H A;  4Z9J A;  1YJG A;  5DS6 A;  2Z15 A;  1OW8 A;  2V3C C;  3SNH A;  1LI7 A;  3ZTZ A;  3LNR A;  1TFO B;  4QDL A;  1K05 A;  1OXB A;  3DXJ F;  4NY3 A;  3JZ0 A;  1HMO A;  2IBF A;  1HW1 A;  2ZPA A;  2J8W A;  4C3E A;  4CS8 C;  1H9T A;  4KNV A;  1LE4 A;  4AE4 B;  1OKK A;  3K6B A;  4ER9 A;  4E7S A;  4N6C A;  2YKZ A;  1FFH A;  1PCX A;  1A7D A;  3B9Q A;  3E9V A;  5DVW A;  2BE5 F;  4EWC A;  2J9B A;  2L7A A;  4U5B E;  3TJ6 A;  2LIG A;  3GM1 A;  2PBE A;  3JRT A;  4JCZ A;  4O79 A;  2J9W A;  4MVO A;  4X0R A;  4YL3 A;  3U8P A;  1FNT c;  2IOQ A;  3U3B A;  1KU2 A;  1QQ3 A;  2QNL A;  3K1I C;  4KBL A;  2ZXP A;  1LM3 B;  1MNE A;  3FHD A;  2IXM A;  1FMW A;  2EPO A;  1H9G A;  3NMJ A;  1Z7Q c;  3TK0 A;  4EBB A;  2XXA B;  1NU7 D;  3CAX A;  4JTC B;  1Z5Z A;  2HJM A;  3G4X A;  3EG9 B;  4XPX A;  2J46 A;  2NUT B;  5COM A;  3HJC A;  4JEB A;  2P61 A;  3WAQ A;  3QMK A;  1V74 B;  2L6F A;  3C8Z A;  4I1O B;  4U5D E;  1YYJ A;  1E2X A;  1QKR A;  2LFD A;  3A11 A;  2EIK C;  3I5Q A;  1D0X A;  3ZQY A;  2R7O A;  1HE9 A;  1WAS A;  2EIL C;  2XS1 A;  1OCC C;  2YL3 A;  4C7O A;  2CGE A;  5CIV A;  1A41 A;  2R7W A;  2VC9 A;  2L81 A;  4DRH B;  2NG1 A;  2PX0 A;  2R7Q A;  3JTL O;  3FDQ A;  3C8G D;  1T9K A;  2MWQ A;  4OIP F;  4RBN A;  4OD5 A;  5JT4 A;  2HFI A;  2YLI A;  2CYD A;  2A0B A;  2HSB A;  1H6G A;  3GM2 A;  1Z6A A;  1ZW2 A;  1RJ9 B;  1YZA A;  3OWT A;  3UMK A;  3ATP A;  3L34 A;  3X2Q C;  2IXO A;  4CJG A;  2HMZ A;  3KYI A;  5TJ5 E;  3I4U A;  4JTA B;  2W45 A;  2R7S A;  2OKU A;  3X1O A;  3AG3 C;  3HLZ A;  4MW8 A;  3RIP A;  4E18 A;  2Q9A A;  3C7J A;  5E3C A;  3G4Z A;  2P1A A;  4MVQ A;  5T3W A;  2TMV P;  2JD3 A;  1NFN A;  5JVE A;  3EHM A;  4JJG A;  3DJU B;  3LNM B;  3OEO A;  4OIN F;  1QZX A;  1M57 C;  4AE4 A;  4CS9 C;  4EIY A;  3S84 A;  1U0B B;  2PX3 A;  1OXK A;  4ULV A;  4Q7C A;  3L8J A;  5KYU A;  3IQC A;  3SXZ A;  2H8A A;  4N4W A;  4OIR F;  2XLW A;  4JIO A;  3ZWI A;  1FFT C;  4MVS A;  3UNG C;  4HFK B;  4U5G A;  2LFF A;  3HNL A;  1M2V B;  1T6U A;  1YVI A;  3SZR A;  4DOZ A;  4W8K A;  5A69 A;  4MQ9 F;  5BQG A;  1OKK D;  2XL4 A;  4HE8 D;  4IJJ A;  3KH2 A;  3LUT B;  3EG9 A;  4CIH A;  4PK4 A;  2WVO A;  3GEI A;  3RVY A;  5KYU B;  3LLK A;  3JYY A;  4CSA A;  2GDC A;  5IY5 C;  2H7B A;  1D0Y A;  3R7C A;  3MYI A;  2KNH A;  4D4N A;  1J8Y F;  2CNW A;  3AGT A;  1M2V A;  3JSZ A;  3PMR A;  2V26 A;  4G7O F;  2R7U A;  3N24 A;  2GAQ A;  3NYJ A;  1E83 A;  2NPU A;  3DAF A;  3HNI A;  1E86 A;  1YDI A;  4P6I C;  2IXP A;  2XLM A;  5DQT A;  1OCZ C;  5KYX B;  2AVK A;  5CI9 A;  2HV7 A;  1Q0K A;  1VYI A;  1YAU O;  1ZU5 A;  4K1O A;  3U0C A;  3M79 A;  4NTF A;  3NYM A;  2WB7 A;  3V5Y A;  3ITF A;  3Q7G A;  1M2O A;  1OCR C;  3AOU A;  4PFP A;  1YZC A;  1T6I A;  1SF8 A;  2VCC A;  4N6H A;  4DBR A;  5E2Q A;  2UUH A;  3JYH A;  2GWW A;  2ZD9 A;  2Y3H A;  5A6J A;  1LIH A;  3LES A;  2LSE A;  1UFB A;  4XWJ A;  5HV9 A;  2D5R B;  3FOP A;  4E7Z A;  1FMV A;  3N2Z B;  5JP7 A;  4DRJ B;  4E0H A;  1LS1 A;  2AU5 A;  3FAP B;  3K7D A;  5KYY A;  3C8G B;  3NKD A;  2R7X A;  1TR2 A;  3HNK A;  2KW3 C;  5T3T A;  4BJ5 A;  4WAB A;  3ZTM A;  1LVK A;  2AWC A;  3DKA A;  1XZP A;  3MLG A;  2PP4 A;  2MHR A;  4PJN A;  2GA0 A;  3VRC A;  1M6T A;  5BQI A;  1O87 A;  3US6 A;  3J06 A;  3EGX B;  3W4Y A;  5L0C A;  4RDA A;  4HEA J;  2HMQ A;  2OEV A;  1MQV A;  3EZH A;  2R9R B;  1LKX A;  1FR0 A;  5EK0 A;  3SXK A;  2PNO A;  1KNY A;  3B29 A;  3SEO A;  4IAO A;  2CDQ A;  1CGN A;  3C63 A;  1NU9 C;  2KQ9 A;  3O6X A;  4P9F A;  3EGD A;  2Q00 A;  2ZXO A;  4BG0 A;  4YL0 A;  2G3K A;  1QPU A;  3BRJ A;  1Z3I X;  1JOG A;  3NRH A;  3R2P A;  1TQG A;  4D4X A;  2KJG A;  4A4A A;  3EGX A;  256B A;  2QUP A;  3RQE A;  3PHF 2;  1NFO A;  4ZLC A;  2J7P A;  3EH2 A;  1GM5 A;  1ORS C;  4MVZ A;  1K40 A;  3NMK A;  1I4Y A;  4U5E E;  4W8P A;  3W2V A;  4NCQ A;  1RKC A;  3BEH A;  3U8V A;  2XRH A;  1MMA A;  1ZU4 A;  2L6H A;  1Y4C A;  2EPM X;  3OA1 A;  4IAQ A;  5KYX A;  1VLT A;  2H7O A;  3S29 A;  1DOW A;  2J9U A;  2W9Y A;  3DZA A;  3QTH A;  4ANJ A;  3POV A;  3VM6 A;  3M4B A;  4R32 A;  1G4W R;  2DGJ A;  3UR3 C;  1Q0D A;  3CQZ A;  2ETS A;  2R25 A;  5AC4 A;  4WJ0 A;  1HW2 A;  2B0J A;  3TQO A;  3QW0 A;  3Q6N A;  3K1H A;  2HJ3 A;  2Q9B A;  1SZI A;  1A0B A;  4RD9 A;  1O5H A;  2W4B A;  3IPM O;  1VK5 A;  3AGU A;  3EJN A;  2JPU A;  3IEE A;  3T6B A;  5DQZ A;  1FAP B;  4O6N A;  3ABK C;  5KYY B;  1WOL A;  4JRZ A;  4LLC A;  3C8G A;  2O9X A;  3TOL A;  4FAP B;  2XM4 A;  1YA9 A;  1IW7 F;  1LS4 A;  1QSP A;  4JCH A;  2IYL D;  2HZ8 A;  2X51 A;  2XLH A;  2OJQ A;  3WHN A;  1BZ4 A;  4JVS A;  3LS1 A;  2KYH A;  3IHU A;  1VLS A;  1HY5 A;  2KSF A;  3U5S A;  3VAY A;  4CIP A;  3B0U X;  1Q0M A;  1H7I A;  2E87 A;  3GAN A;  1DOV A;  4FX5 A;  2XSE A;  2YRF A;  5DS4 A;  3KL4 A;  1T01 A;  1WTY A;  3EGD B;  2Y39 A;  3KKB A;  1L7C A;  2A6H F;  4NQF A;  5B3S C;  1OR3 A;  2RD9 A;  2I15 A;  2W4M A;  2LCH A;  4GYT A;  4BJ1 A;  3S90 A;  1B68 A;  4PJJ A;  1OW6 A;  3H2U A;  2LQG A;  4J7T A;  2XLV A;  1CGM E;  3DAG A;  4J30 B;  3FXH A;  3HTK C;  5A6B A;  5A6K A;  3MX3 A;  3TD7 A;  4A2N B;  5L0G A;  3SXM A;  3TUL A;  3JSE O;  1SMY F;  4OIQ F;  3B0P A;  4DVY P;  1OQC A;  4MVR A;  3K1I A;  5CI8 A;  5EHH A;  2P6V A;  3ZQV A;  3KMI A;  3RFY A;  2HUJ A;  2XM0 A;  4JE9 A;  4KC9 A;  3S28 A;  5L0F A;  1EI7 A;  1D1C A;  1ORJ A;  2OJE D;  3EZI A;  3GWN A;  4KNW A;  2A0U A;  5HSW A;  3UGP A;  2NUP B;  2H7V C;  2J9V A;  2R03 A;  3HNJ A;  1EA8 A;  4I1M A;  4QI0 A;  4NTB A;  2DYR C;  3LEV A;  1VMA A;  4PAC A;  1UG7 A;  4YJW A;  4YT4 A;  4Z9H A;  3B0V C;  2BL2 A;  1GGQ A;  4CDY A;  4P9T A;  4OIO F;  3QW1 A;  4MND A;  4XQ1 A;  5D92 A;  5BUO A;  3PCV A;  2Y69 C;  1FTS A;  2BC5 A;  1MMD A;  2HV6 A;  1Z63 A;  2R7V A;  1BBH A;  2J0X A;  3EHN A;  2WZL A;  1S05 A;  3DI5 A;  4BPM A;  1A7E A;  4MVU A;  4UDV A;  4Q4Z F;  3NKE A;  4XPW A;  2WZF A;  4EUK B;  1BDJ B;  4YT8 A;  2P0N A;  4IRU A;  1RCP A;  4HFF B;  2NSF A;  4ULW A;  2VAS A;  2AWY A;  4AL0 A;  2EPN A;  5GPG B;  4BJ6 C;  4F4B A;  4YT2 A;  1ORY A;  1RKE B;  5FCL A;  4LER A;  3WG7 C;  1T6Q A;  5COG A;  3RF3 A;  3FMS A;  4G0H A;  4LDQ A;  1WWP A;  3NG1 A;  1NSG B;  1A7V A;  2LD6 A;  3GEE A;  1M56 C;  2Q4F A;  1SYQ A;  3JCU Q;  1HE1 A;  2C04 A;  4JZA A;  1G8X A;  3LJB A;  3EH1 A;  3AQC A;  3GWL A;  3MYF A;  2EPK X;  3CSK A;  3EFO B;  3M1C B;  3DJN B;  2FFH A;  4DVZ A;  5L3V A;  1D1B A;  2L9J A;  2OEX A;  1VB5 A;  3LS0 A;  1BR2 A;  4U5C E;  3S9O A;  4WGY A;  3ZC4 A;  3W2W A;  1RMV A;  2J0W A;  1G5Z A;  2YLD A;  3WOD F;  4E17 A;  1Q0F A;  1U89 A;  3EFO A;  2NUP A;  1R4T A;  4YL1 A;  1VTM P;  1MND A;  3A9C A;  1ZZP A;  5A6A A;  5F5F A;  4Z9I A;  2ZXW C;  3I5P A;  1HMD A;  3FAJ A;  3H2V A;  4IWB A;  4YN0 B;  2X0C A;  4B6I A;  5KYN A;  2I8B A;  1TWG A;  2OU6 A;  3FOO A;  2UUI A;  1BR4 A;  2VCA A;  3DMD A;  4J7Y A;  1JRA A;  5AC5 A;  1C17 M;  4U9E A;  2PF4 E;  4J32 B;  4YT5 A;  1V4A A;  4I44 A;  4JW1 A;  5F28 E;  2CNW D;  2F22 A;  4MTF A;  2XL6 A;  4LLE A;  4EBK A;  4XLP F;  3EPV A;  2YL1 A;  3V5X A;  2R7R A;  3G50 A;  2Y3B A;  4DXW A;  4EHP A;  1EQ1 A;  2VH3 A;  5KYW B;  1CGO A;  4MVM A;  4OD4 A;  1APC A;  4O6Y A;  1MMG A;  2QLA A;  4O7G A;  3RKO F;  1R5I D;  1RKE A;  1Z23 A;  2YEV A;  4H54 A;  4XTK A;  1OCO C;  3B71 A;  2M64 A;  4H4K C;  2KK1 A;  2AP3 A;  3U9M A;  2LK4 A;  3LAY A;  1I4Z A;  1ZYR F;  2P7V A;  4K0D A;  4N06 A;  2YLG A;  2FGY A;  3SP1 A;  4BEM J;  3PDM P;  4ZLD A;  4GQH A;  1J8M F;  1BR1 A;  4JKV A;  1GQA A;  3RQF A;  4MS2 A;  3VF0 A;  1TWH A;  3GOD A;  1YAR O;  2WZG A;  4LAC B;  1NG1 A;  4LDR A;  2ICW G;  4C3B A;  4C3D A;  4CS9 A;  5JUA A;  3ZSU A;  3L1M A;  5JLI A;  1L3P A;  4CBE A;  1ZW3 A;  1AVO B;  4BJ5 C;  2GFH A;  2MYS A;  5F5H A;  1ZHZ A;  2NSG A;  1TKN A;  5L0H A;  3GEH A;  4E0I A;  1GS9 A;  2ASR A;  2HSQ A;  3U3F A;  1YA7 O;  1YYX A;  1LE2 A;  3S27 A;  4EKW A;  3O55 A;  1C03 A;  1Y6D A;  1NZE A;  2EIN C;  1XZQ A;  5JSL A;  1C02 A;  1OR2 A;  3AG1 C;  2XLE A;  3T9O A;  1N1C A;  2J45 A;  4WGZ A;  1U6H A;  2B0H A;  2OG2 A;  4CSA C;  3C62 A;  1YLM A;  2XLO A;  3KPH A;  4K7B A;  4AK9 A;  3F46 A;  5T1D B;  2DB4 A;  1WAT A;  3IQ6 A;  3M15 A;  3ZVR A;  4KI2 A;  1PD1 A;  2DI3 A;  4IGG A;  3RVZ A;  2LP4 A;  2ZXR A;  4MTO A;  4AX2 A;  4G78 A;  4IAR A;  3VYW A;  1AEP A;  2Y3G A;  3ABL C;  3W8H A;  4U9D A;  1ZHX A;  3F47 A;  3AJM A;  3IQ5 A;  2EIM C;  2XS8 A;  1D1A A;  4LDK A;  1QLE C;  2WL8 A;  5DS5 A;  1ZHW A;  3MBG A;  3DE9 A;  5E33 A;  4JTD B;  5A6B D;  3RYL A;  4G7Z F;  4Q5S F;  5KYW A;  4PJL A;  1XWJ A;  2QY9 A;  3O10 A;  5E3A A;  4XPY A;  3RW0 A;  1TWA A;  3SXY A;  3U2M A;  3JT1 A;  2HS5 A;  5BQH A;  1CPR A;  2R02 A;  2WVQ A;  2G62 A;  3Q6M A;  4EBJ A;  3S0X A;  5K0I A;  2YHS A;  3ZG1 A;  3L8I A;  1JPJ A;  2YL0 A;  2FAP B;  5DLJ A;  3M4C A;  5JRA A;  3Q7L A;  1JMW A;  4XEV A;  4BEJ A;  2QE9 A;  1JR8 A;  2CCY A;  3DWW A;  3AG4 C;  4JEA A;  4NC3 A;  4O6M A;  5L3Q A;  1ZHY A;  3SYN A;  5B1B C;  1E84 A;  2XL8 A;  3QVY A;  4CS7 A;  2A1D D;  3C18 A;  1QVX A;  3LLI A;  4U5F E;  4DBQ A;  1AUE A;  1ZVZ A;  2QTV A;  2L6G A;  4YK5 A;  3NMI A;  2A69 F;  1EKY A;  3CZ6 A;  1VYK A;  3TJ5 A;  4DJ9 A;  4MW3 A;  1KTM A;  5L0D A;  3W8I A;  2OOC A;  2D4U A;  2Q9C A;  3JRM O;  2Q3T A;  1PV3 A;  4CDA A;  5FZT A;  2KC3 A;  3ABM C;  5COF A;  3FVY A;  4GEH A;  3AQB A;  1LI5 A;  1MMN A;  2OQM A;  2EIJ C;  2DYS C;  3ZIB A;  3UMH A;  1SR2 A;  2G3V A;  3DM5 A;  4CX9 A;  1JAF A;  4QI2 A;  3IQT A;  4XLN F;  1S7Z A;  4AL1 A;  2RSE B;  3AG2 C;  3LEO A;  1VOM A;  2KGO A;  2WVN A;  4G7H F;  1LPE A;  4JJF A;  5B1A C;  1I5N A;  5L0J A;  3ECS A;  2VB6 A;  1D0Z A;  3ASN C;  2YWA A;  3QVZ A;  3H65 A;  1TFK B;  3RH3 A;  1NLX A;  3K33 A;  2C03 A;  3KYJ A;  4PR9 A;  1Q0G A;  1NBB A;  1WGW A;  4M63 A;  4MTG A;  4YWQ A;  1G4U S;  3L0I A;  5JS5 A;  3TOM A;  3V7O A;  1ZHT A;  2R7T A;  1V55 C; 
#chains in the Genus database with same CATH homology
 4EUK B;  2A0B A;  1YVI A;  1BDJ B;  3US6 A;  1C03 A;  1Y6D A;  3KYI A;  1C02 A;  1FR0 A;  2R25 A;  4PAC A;  1SR2 A;  1OXB A;  3IQT A;  2LD6 A;  1A0B A;  2Q4F A;  1TQG A;  2LCH A;  2LP4 A;  1I5N A;  4G78 A;  1WN0 A;  3MYF A;  1OXK A;  3KYJ A;  1QSP A;  3U3B A;  2OOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...