1C02A

Crystal structure of yeast ypd1p
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
b'STIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMQHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOTRANSFERASE YPD1P
publication title Insights into eukaryotic multistep phosphorelay signal transduction revealed by the crystal structure of Ypd1p from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 61
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1c02A00
1I5NA 2OOCA 1SR2A 1OXKA 4G78A 4EUKB 1OXBA 2Q4FA 3US6A 4PACA 1WN0A 1QSPA 1FR0A 2LP4A 2A0BA 1Y6DA 1C03A 1TQGA 3IQTA 3U3BA 1C02A 2LD6A 2LCHA 2R25A 1BDJB 3KYIA 3MYFA 1YVIA 1A0BA 3KYJA
chains in the Genus database with same CATH superfamily
4LACB 5L0JA 3NDBB 3E70C 3L1MA 2KGOA 256BA 2YWAA 2P7VA 1ZW2A 3IPMO 2R7XA 3J06A 3EZIA 3U0CA 4MTOA 3RKOF 3IHUA 3U9JA 2VCCA 3LUTB 4HEAJ 2P1AA 3EQLF 3SXKA 1JPJA 1XWJA 4H54A 5CI8A 1G4US 5A6KA 2DI3A 3DD7A 3GWNA 1RKEB 1Y6DA 3L8JA 1OKKA 3RQFA 4F4BA 1HMDA 1C17M 1TWHA 1E85A 2XLOA 2HFIA 4AL0A 4D4NA 1XZPA 5A69A 2BL2A 1LI5A 1TFOB 4MVOA 2XXAB 2IXPA 1M6TA 3C8GB 3M79A 1CGME 3UGPA 4MVSA 4JC7A 4D4XA 2OCCC 2EIMC 3ABMC 2LK4A 2NUPB 3AJMA 3NG1A 2R9RB 4YL3A 2KSFA 3K1HA 2JPUA 2F22A 1Z5ZA 4Z9HA 2DYSC 3FAPB 4WGYA 4IRUA 4U5FE 3IEEA 1NFNA 2BC5A 3C8GD 1ZZPA 2JX0A 2DYRC 3HNIA 4OIRF 5F5HA 5E2QA 3ZTMA 4ULWA 1IW7F 1LI7A 4XWJA 4MVUA 3JYHA 1EA8A 3DMDA 3M15A 3RVZA 3LJBA 2R7TA 1OCZC 3FOPA 1QVXA 2VH3A 1ORSC 3H65A 3TQOA 2OU6A 4QI0A 5KYUB 1T6UA 3BEHA 2J0WA 2W9YA 1VYKA 1BBHA 5T1DB 5DLJA 4E7SA 4YWQA 2GDCA 2KNHA 1CGNA 4OIQF 4OIPF 3IQ5A 4G7ZF 1ZYRF 1MMGA 4CJOA 4YJWA 3PDMP 2OKUA 5A6BD 3DJUB 1FMWA 2V3CC 2KK1A 2WVOA 4EUKB 4I44A 2IXOA 3JCUQ 1DOVA 1ZHXA 3V5XA 4NTBA 4PACA 2YLGA 1WOLA 2EPMX 3QVYA 4CJGA 2P61A 3AQBA 2W4BA 3DE8A 2UUHA 2QE9A 2J9BA 3SXZA 5CIVA 4HFKB 4IB4A 3Q6NA 4JTCB 2M64A 4CX9A 4IGGA 1E83A 4U9EA 1FFTC 1APCA 1OW7A 1ZU4A 5KYYA 4RDAA 2NUTB 2XL4A 1HE9A 3AG4C 3GM3A 3KYIA 5AC4A 4MVMA 3T6BA 3JRMO 2VCBA 1YA7O 2ZPAA 3DE9A 3KH2A 3KYJA 3NRHA 4JW1A 4BEJA 2B0HA 2Q9CA 5E3CA 3G50A 4C3DA 4EIYA 3VAYA 1BZ4A 4AL1A 4EHPA 3TULA 1TFKB 2CNWD 3M4BA 4NTFA 1NG1A 4CDVA 2J46A 3GEIA 2R05A 3OWTA 2C03A 2OQMA 3N2ZB 3OA1A 2J0XA 3NKEA 4CS9C 5BUOA 2XLVA 3U9MA 2KW3C 2HSBA 1RJ9A 3W2WA 3ZVRA 2LQGA 3JTLO 3GEHA 3LEOA 3QZCA 3TD7A 3EH1A 3NKDA 4ONSA 3ASNC 3H2UA 2H7BA 5FCLA 2HZ8A 4JVSA 3UGOA 3WHNA 1YJGA 1LE4A 2OJED 5JSLA 3NMIA 1A41A 2WVQA 5BQIA 3KPHA 1H7IA 5HSWA 1A0BA 1YAUO 1Q0DA 4WGZA 2ICWG 5COMA 4XEVA 1J8YF 1LM3B 2XL8A 5B1AC 3U8VA 4CS9A 1MNDA 2C04A 4JZAA 4R32A 3ZQVA 1VLTA 2J9UA 2JD3A 3KKBA 1EQ1A 4MTGA 2YQYA 4PJNA 2A69F 3L34A 4ULVA 4MW8A 4IAQA 3QW0A 2R02A 4W8PA 4A2NB 4RBNA 4ZLCA 2XM4A 2LP4A 4IARA 2XSEA 3EGDA 5AGFA 2A0UA 1C03A 1QLEC 1HMOA 4UDVA 3S28A 4B6IA 2KQ9A 4JCZA 5E33A 1K04A 4CBEA 3WODF 2KYHA 4O7GA 3R7CA 2UUIA 4O6NA 1A7EA 4YK5A 3FXHA 2G3KA 5GPGB 3TJ6A 3TOMA 4DOZA 4XPXA 3RW0A 3C7JA 3SYNA 1M2OA 1SZIA 3O55A 2VASA 2Y3DA 5COGA 5EK0A 3JYYA 1HW2A 1MMNA 5JS5A 1D1CA 5DS6A 4JRZA 3KL4A 4DBQA 1PV3A 3MX3A 2Q4FA 3C18A 4DVZA 4MVRA 2EILC 3US6A 3BRJA 1MMAA 3QW1A 1YYJA 1H6GA 2EIJC 3IQ6A 1VK5A 3S90A 2L81A 1H9GA 4XTKA 2Q9AA 4ER9A 3I5QA 1LE2A 2IBFA 5L3VA 2HJ3A 1ZHZA 4J7TA 5A6AA 2XLHA 2FFHA 2PP4A 3OEOA 1KNYA 1D0ZA 2PF4E 3KMIA 5KYYB 4OINF 1NFOA 2R7QA 1G5ZA 2H7VC 2WVNA 1BDJB 3HJCA 3ZG1A 4AE4A 4BJ5C 3LAYA 5DQTA 3FAJA 3LEVA 1LVKA 4EBBA 3B0VC 3SEOA 2M4EA 3RVYA 2G3VA 2HV7A 3LLIA 5TJ5E 1YDIA 2TMVP 4U5DE 3SXMA 2EPOA 3U2LA 2P0NA 1M2VA 4QDLA 2Y3BA 3LESA 1D0XA 4J30B 4O6MA 3U8PA 4E7ZA 4G78A 4IJJA 2HS5A 1NU9C 3DM9B 3EPVA 3K6BA 4KC9A 2H8AA 3HKKA 2HSQA 4MNDA 2YLIA 3SNHA 2IM8A 3NMKA 1RJ9B 3C63A 3DWWA 3QMKA 1ORJA 2XS8A 3NYJA 4JEAA 3S84A 4C7OA 1L7CA 4A4AA 1OW6A 2OEVA 3EG9A 1FMVA 1Z6AA 1HY5A 1B68A 1V54C 1YZAA 2IOQA 2YL1A 1JPNA 2R7WA 4G0HA 2GA0A 2J45A 2J8WA 4EKWA 1OR3A 2O9XA 4WJ0A 4QI2A 1DOWA 2ZXPA 5D91A 3UMHA 4BG0A 3K33A 3AG2C 1KTMA 4PFOA 1ZHYA 3UR3C 4NQFA 3RF3A 3ABKC 2XL6A 1VTMP 1EKYA 5KYXA 1SMYF 1O87A 2HMQA 2YRFA 1Z23A 4Z9IA 2KC3A 2ZXOA 3CZ6A 4BEMJ 3G4ZA 2DB4A 1M57C 4NY3A 1RCPA 4H4KC 2W4MA 3JSEO 2YL7A 3LS1A 1NLXA 4ANJA 4XPYA 1WWPA 3ATPA 1NBBA 3EFOA 3ECSA 1YYXA 3M1CB 1C02A 4GQHA 3DAFA 4NTAA 2PBEA 2NSFA 2LCHA 4YT2A 1A7DA 3FVYA 3ZIBA 5BQHA 3S0XA 2WZGA 1HW1A 1LKXA 3V5ZA 4O6YA 2QNLA 3W2VA 3T9OA 4I3MA 4C3EA 4IAOA 3FDQA 3TOLA 2NG1A 5DS5A 1BR1A 3FMSA 4LDKA 4PFPA 1SR2A 4CIHA 2X0CA 3CEXA 4MQ9F 5L0FA 1YA9A 2W45A 4M63A 3X2QC 1H9TA 1VLSA 5B3SC 2Q3TA 3B71A 5K0IA 2L6FA 1CPQA 1MNEA 1NZEA 1FTSA 2XRHA 2YHSA 3H2VA 3QVZA 1I4YA 2D5RB 4JTDB 4DVYP 5JRAA 2WL8A 4AK9A 1RKEA 4CS8C 4I1MA 2VC9A 5JVEA 3LNMB 4YN0B 3EZHA 1T6IA 4E18A 1Z63A 2YL0A 3L8IA 4OD4A 4JIOA 1V4AA 1KU2A 2R25A 4U5BE 3W8HA 3EJNA 1NSGB 3EHMA 3HNKA 3UNGC 3GM2A 2OG2A 2Y69C 2L7AA 1OCOC 1R5ID 3AG1C 3C8GA 1Q0KA 2LFFA 3DJNB 1TWCA 2DGJA 1M2VB 3A11A 3CSKA 3EH2A 1OKKD 1S7ZA 4LLEA 4U5EE 4XLNF 3RIPA 2EPKX 3LNRA 3AGUA 2XLDA 4U5CE 4N06A 3TK0A 1WATA 1OXBA 2J7PA 2XLMA 2Y3GA 3G4XA 4OIOF 4LDQA 4KNVA 4HE8D 2J9WA 4CS8A 3NYLA 2WZLA 1QSPA 3MYIA 5HV9A 1R4TA 3B29A 4JJFA 4JJGA 1VOMA 4FWVA 4JEBA 4AX2A 5EGYA 2XLEA 1YARO 2A0BA 4N6HA 5L3QA 4C7OB 3RFYA 5A6BA 4O79A 5KYWB 3EG9B 3IQTA 5KYNA 4EBKA 4XLPF 2CW0F 1V74B 4Q4ZF 5EHHA 5AC5A 1FAPB 4BJTA 3GODA 2Q00A 1J8MF 1K05A 1D0YA 3R2PA 4RD9A 4N4WA 1O5HA 2QLAA 4K1OA 2YL3A 3DM5A 5DS4A 1ZU5A 3VF0A 4PJJA 5T3WA 4DBRA 4L6RA 5F5FA 3NMJA 4P6IC 1JOGA 1SF8A 4U5GA 3AOUA 2YEVA 1TWGA 3UMIA 3GANA 4CDAA 1PCXA 3SZRA 1TWAA 5KYXB 3ASOC 2MWQA 1G8XA 3VRCA 4HFFB 2XS1A 2R7OA 4DRJB 3O39A 3LS0A 3RQEA 1VB5A 3Q7LA 5L0HA 2VCAA 2P6VA 3EGXA 4Q7CA 1FR0A 3CAXA 4FX5A 4XEKA 4MW3A 2XLWA 3EFOB 1WASA 3T6GB 2I15A 1TQGA 1EI7A 3RH3A 4CIPA 5JLIA 2LD6A 1I4ZA 2CNWA 3W8IA 2CDQA 4KBLA 4P9FA 1U89A 2NSGA 1E2XA 1ZHTA 2ZXWC 4NC3A 2QUPA 4N6CA 1OR2A 1YLMA 1VMAA 3HNJA 4BJ6C 3F47A 1QPUA 2HV6A 3PMRA 2MYSA 2AWYA 3T6JA 1I5NA 2WB7A 2EIKC 2R03A 3PHF2 1WTYA 1TR2A 1U6HA 1UFBA 3B0UX 4J32B 1Q0FA 3CQZA 2FAPB 3M4CA 1V55C 3QTHA 5BQGA 2B0JA 2H7OA 2ZD9A 5D92A 1ZHWA 5B1BC 5JT4A 2V26A 3AGTA 4Q5SF 1XZQA 1FFHA 4KNWA 2L6GA 1Y4CA 4BJ5A 4K7BA 4PJLA 1NU7D 1F1MA 3S27A 4XQ1A 3ZTZA 4BJ6A 1BR4A 4MVQA 1MMDA 3ZWIA 4YL1A 4E17A 5B3IA 1E86A 4YL0A 3N24A 4MVZA 4EBJA 1CPRA 2WZFA 3FHDA 3I5PA 3RQGA 4FAPB 5L0DA 1JAFA 4BJ1A 5E3AA 3C62A 4FESA 1VYIA 1YVIA 1L3PA 1U0BB 1RKCA 3GEEA 1BR2A 2EPNA 4XPWA 1OXKA 2HJMA 2D4UA 1O3UA 2R7UA 2HMZA 5KYWA 2PNOA 1T01A 4GYTA 3B0PA 5DVWA 2ETSA 3JT1A 5FZTA 1Z7Qc 2AVKA 3MLGA 1T5OA 3U2MA 4X0RA 1LIHA 3ITFA 4LDRA 4DRHB 4ZLDA 3EGDB 3ZQYA 3WG7C 3Q7GA 1OQCA 3K1IC 1LS4A 2J7PD 1UG7A 2IYLD 5A6JA 3DXJF 3DZAA 3LLKA 2PFDA 2Y39A 4WABA 3VYWA 3O6XA 1OCCC 1GM5A 3WAQA 4YT8A 3ZSUA 1N1CA 5DQZA 2R7VA 4DRIB 2OEXA 3AG3C 2IXMA 1ZVZA 4JE9A 2IXNA 5L0CA 2EPLX 3W4YA 3F46A 4LERA 3PCVA 1JR8A 1QQ3A 2Z15A 3C8ZA 5IY5C 2OOCA 4G7HF 2X51A 4MS2A 4E0HA 1GGQA 3GM1A 2L6HA 3ZC4A 1Q0GA 5T3TA 1AEPA 4J7YA 3B9QA 1GQAA 2VB6A 1D1AA 3K1IA 3DAGA 2PX0A 2A68F 3EGXB 4PJMA 4PK4A 1YZCA 2YLDA 2A6HF 1M56C 4IWBA 3K66A 3UMKA 2E87A 4KI2A 1LPEA 3U5SA 2RSEB 4U9DA 5JUAA 3K7DA 3U3BA 5F28E 1RXQA 2LFDA 1T6QA 1ZW3A 1ORYA 2BE5F 5L0GA 4YT4A 2GFHA 2ZXRA 4XEFA 4AE4B 1G4WR 1E84A 1W2WA 3JSZA 2AP3A 2R7RA 4MTFA 1WGWA 2XXAA 1ST6A 4DXWA 4U5HA 1FNTc 3ZDLA 1AUEA 1AVOB 2NUPA 3VM6A 3RYLA 2I8BA 2XM0A 1A7VA 2A6EF 2FGYA 2Y3HA 3HLZA 1GS9A 3MBGA 4W8KA 4CS7A 1MQVA 4JURI 4CDYA 1WN0A 1D1BA 1QKRA 4I1OB 2QY9A 3I4UA 3DKAA 3DI5A 2MHRA 5COFA 2KJGA 4BPMA 3T4RA 1Z3IX 2NPUA 4Z9JA 3HNLA 2A1DD 1JRAA 3MFNA 4OD5A 2LIGA 1S05A 2J9VA 3POVA 3NYMA 1LS1A 3O10A 2R7SA 2RD9A 4CSAC 5KYUA 3JRTA 4P9TA 2GWWA 3MYFA 4E0IA 2AWCA 3SXYA 2HUJA 4JTAB 2AU5A 3TJ5A 2ASRA 4JKVA 2EINC 3X1OA 1JMWA 1OW8A 1TKNA 2GAQA 2PX3A 3A9CA 3HTKC 1Q0MA 3L0IA 3Q6MA 3GWLA 4C3BA 4GEHA 2YZSA 2Q7RA 1SYQA 4JCHA 3U3FA 1PD0A 3E9VA 4DJ9A 2CYDA 1RMVA 4YT5A 3JZ0A 3V7OA 1HE1A 2CCYA 2L9JA 3EHNA 3IQCA 1CGOA 1QZXA 2Q9BA 2YVKA 1IZMA 3N0TA 4NCQA 4CSAA 2G62A 3S9OA 3V5YA 5CI9A 4K0DA 4PR9A 1T9KA 2OJQA 4EWCA 2YKZA 1OCRC 3ABLC 1K40A 2CGEA 2LSEA 5JP7A 3SP1A 4G7OF 2HKVA 4LLCA 5L0IA 2NUTA 3GORA 1PD1A 3FOOA 3AQCA 3S29A 2QTVA
chains in the Genus database with same CATH topology
1I5NA 2OOCA 1SR2A 1OXKA 4G78A 4EUKB 1OXBA 2Q4FA 3US6A 4PACA 1WN0A 1QSPA 1FR0A 2LP4A 2A0BA 1Y6DA 1C03A 1TQGA 3IQTA 3U3BA 1C02A 2LD6A 2LCHA 2R25A 1BDJB 3KYIA 3MYFA 1YVIA 1A0BA 3KYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5N A;  2OOC A;  1SR2 A;  1OXK A;  4G78 A;  4EUK B;  1OXB A;  2Q4F A;  3US6 A;  4PAC A;  1WN0 A;  1QSP A;  1FR0 A;  2LP4 A;  2A0B A;  1Y6D A;  1C03 A;  1TQG A;  3IQT A;  3U3B A;  1C02 A;  2LD6 A;  2LCH A;  2R25 A;  1BDJ B;  3KYI A;  3MYF A;  1YVI A;  1A0B A;  3KYJ A; 
#chains in the Genus database with same CATH topology
 4LAC B;  5L0J A;  3NDB B;  3E70 C;  3L1M A;  2KGO A;  256B A;  2YWA A;  2P7V A;  1ZW2 A;  3IPM O;  2R7X A;  3J06 A;  3EZI A;  3U0C A;  4MTO A;  3RKO F;  3IHU A;  3U9J A;  2VCC A;  3LUT B;  4HEA J;  2P1A A;  3EQL F;  3SXK A;  1JPJ A;  1XWJ A;  4H54 A;  5CI8 A;  1G4U S;  5A6K A;  2DI3 A;  3DD7 A;  3GWN A;  1RKE B;  1Y6D A;  3L8J A;  1OKK A;  3RQF A;  4F4B A;  1HMD A;  1C17 M;  1TWH A;  1E85 A;  2XLO A;  2HFI A;  4AL0 A;  4D4N A;  1XZP A;  5A69 A;  2BL2 A;  1LI5 A;  1TFO B;  4MVO A;  2XXA B;  2IXP A;  1M6T A;  3C8G B;  3M79 A;  1CGM E;  3UGP A;  4MVS A;  4JC7 A;  4D4X A;  2OCC C;  2EIM C;  3ABM C;  2LK4 A;  2NUP B;  3AJM A;  3NG1 A;  2R9R B;  4YL3 A;  2KSF A;  3K1H A;  2JPU A;  2F22 A;  1Z5Z A;  4Z9H A;  2DYS C;  3FAP B;  4WGY A;  4IRU A;  4U5F E;  3IEE A;  1NFN A;  2BC5 A;  3C8G D;  1ZZP A;  2JX0 A;  2DYR C;  3HNI A;  4OIR F;  5F5H A;  5E2Q A;  3ZTM A;  4ULW A;  1IW7 F;  1LI7 A;  4XWJ A;  4MVU A;  3JYH A;  1EA8 A;  3DMD A;  3M15 A;  3RVZ A;  3LJB A;  2R7T A;  1OCZ C;  3FOP A;  1QVX A;  2VH3 A;  1ORS C;  3H65 A;  3TQO A;  2OU6 A;  4QI0 A;  5KYU B;  1T6U A;  3BEH A;  2J0W A;  2W9Y A;  1VYK A;  1BBH A;  5T1D B;  5DLJ A;  4E7S A;  4YWQ A;  2GDC A;  2KNH A;  1CGN A;  4OIQ F;  4OIP F;  3IQ5 A;  4G7Z F;  1ZYR F;  1MMG A;  4CJO A;  4YJW A;  3PDM P;  2OKU A;  5A6B D;  3DJU B;  1FMW A;  2V3C C;  2KK1 A;  2WVO A;  4EUK B;  4I44 A;  2IXO A;  3JCU Q;  1DOV A;  1ZHX A;  3V5X A;  4NTB A;  4PAC A;  2YLG A;  1WOL A;  2EPM X;  3QVY A;  4CJG A;  2P61 A;  3AQB A;  2W4B A;  3DE8 A;  2UUH A;  2QE9 A;  2J9B A;  3SXZ A;  5CIV A;  4HFK B;  4IB4 A;  3Q6N A;  4JTC B;  2M64 A;  4CX9 A;  4IGG A;  1E83 A;  4U9E A;  1FFT C;  1APC A;  1OW7 A;  1ZU4 A;  5KYY A;  4RDA A;  2NUT B;  2XL4 A;  1HE9 A;  3AG4 C;  3GM3 A;  3KYI A;  5AC4 A;  4MVM A;  3T6B A;  3JRM O;  2VCB A;  1YA7 O;  2ZPA A;  3DE9 A;  3KH2 A;  3KYJ A;  3NRH A;  4JW1 A;  4BEJ A;  2B0H A;  2Q9C A;  5E3C A;  3G50 A;  4C3D A;  4EIY A;  3VAY A;  1BZ4 A;  4AL1 A;  4EHP A;  3TUL A;  1TFK B;  2CNW D;  3M4B A;  4NTF A;  1NG1 A;  4CDV A;  2J46 A;  3GEI A;  2R05 A;  3OWT A;  2C03 A;  2OQM A;  3N2Z B;  3OA1 A;  2J0X A;  3NKE A;  4CS9 C;  5BUO A;  2XLV A;  3U9M A;  2KW3 C;  2HSB A;  1RJ9 A;  3W2W A;  3ZVR A;  2LQG A;  3JTL O;  3GEH A;  3LEO A;  3QZC A;  3TD7 A;  3EH1 A;  3NKD A;  4ONS A;  3ASN C;  3H2U A;  2H7B A;  5FCL A;  2HZ8 A;  4JVS A;  3UGO A;  3WHN A;  1YJG A;  1LE4 A;  2OJE D;  5JSL A;  3NMI A;  1A41 A;  2WVQ A;  5BQI A;  3KPH A;  1H7I A;  5HSW A;  1A0B A;  1YAU O;  1Q0D A;  4WGZ A;  2ICW G;  5COM A;  4XEV A;  1J8Y F;  1LM3 B;  2XL8 A;  5B1A C;  3U8V A;  4CS9 A;  1MND A;  2C04 A;  4JZA A;  4R32 A;  3ZQV A;  1VLT A;  2J9U A;  2JD3 A;  3KKB A;  1EQ1 A;  4MTG A;  2YQY A;  4PJN A;  2A69 F;  3L34 A;  4ULV A;  4MW8 A;  4IAQ A;  3QW0 A;  2R02 A;  4W8P A;  4A2N B;  4RBN A;  4ZLC A;  2XM4 A;  2LP4 A;  4IAR A;  2XSE A;  3EGD A;  5AGF A;  2A0U A;  1C03 A;  1QLE C;  1HMO A;  4UDV A;  3S28 A;  4B6I A;  2KQ9 A;  4JCZ A;  5E33 A;  1K04 A;  4CBE A;  3WOD F;  2KYH A;  4O7G A;  3R7C A;  2UUI A;  4O6N A;  1A7E A;  4YK5 A;  3FXH A;  2G3K A;  5GPG B;  3TJ6 A;  3TOM A;  4DOZ A;  4XPX A;  3RW0 A;  3C7J A;  3SYN A;  1M2O A;  1SZI A;  3O55 A;  2VAS A;  2Y3D A;  5COG A;  5EK0 A;  3JYY A;  1HW2 A;  1MMN A;  5JS5 A;  1D1C A;  5DS6 A;  4JRZ A;  3KL4 A;  4DBQ A;  1PV3 A;  3MX3 A;  2Q4F A;  3C18 A;  4DVZ A;  4MVR A;  2EIL C;  3US6 A;  3BRJ A;  1MMA A;  3QW1 A;  1YYJ A;  1H6G A;  2EIJ C;  3IQ6 A;  1VK5 A;  3S90 A;  2L81 A;  1H9G A;  4XTK A;  2Q9A A;  4ER9 A;  3I5Q A;  1LE2 A;  2IBF A;  5L3V A;  2HJ3 A;  1ZHZ A;  4J7T A;  5A6A A;  2XLH A;  2FFH A;  2PP4 A;  3OEO A;  1KNY A;  1D0Z A;  2PF4 E;  3KMI A;  5KYY B;  4OIN F;  1NFO A;  2R7Q A;  1G5Z A;  2H7V C;  2WVN A;  1BDJ B;  3HJC A;  3ZG1 A;  4AE4 A;  4BJ5 C;  3LAY A;  5DQT A;  3FAJ A;  3LEV A;  1LVK A;  4EBB A;  3B0V C;  3SEO A;  2M4E A;  3RVY A;  2G3V A;  2HV7 A;  3LLI A;  5TJ5 E;  1YDI A;  2TMV P;  4U5D E;  3SXM A;  2EPO A;  3U2L A;  2P0N A;  1M2V A;  4QDL A;  2Y3B A;  3LES A;  1D0X A;  4J30 B;  4O6M A;  3U8P A;  4E7Z A;  4G78 A;  4IJJ A;  2HS5 A;  1NU9 C;  3DM9 B;  3EPV A;  3K6B A;  4KC9 A;  2H8A A;  3HKK A;  2HSQ A;  4MND A;  2YLI A;  3SNH A;  2IM8 A;  3NMK A;  1RJ9 B;  3C63 A;  3DWW A;  3QMK A;  1ORJ A;  2XS8 A;  3NYJ A;  4JEA A;  3S84 A;  4C7O A;  1L7C A;  4A4A A;  1OW6 A;  2OEV A;  3EG9 A;  1FMV A;  1Z6A A;  1HY5 A;  1B68 A;  1V54 C;  1YZA A;  2IOQ A;  2YL1 A;  1JPN A;  2R7W A;  4G0H A;  2GA0 A;  2J45 A;  2J8W A;  4EKW A;  1OR3 A;  2O9X A;  4WJ0 A;  4QI2 A;  1DOW A;  2ZXP A;  5D91 A;  3UMH A;  4BG0 A;  3K33 A;  3AG2 C;  1KTM A;  4PFO A;  1ZHY A;  3UR3 C;  4NQF A;  3RF3 A;  3ABK C;  2XL6 A;  1VTM P;  1EKY A;  5KYX A;  1SMY F;  1O87 A;  2HMQ A;  2YRF A;  1Z23 A;  4Z9I A;  2KC3 A;  2ZXO A;  3CZ6 A;  4BEM J;  3G4Z A;  2DB4 A;  1M57 C;  4NY3 A;  1RCP A;  4H4K C;  2W4M A;  3JSE O;  2YL7 A;  3LS1 A;  1NLX A;  4ANJ A;  4XPY A;  1WWP A;  3ATP A;  1NBB A;  3EFO A;  3ECS A;  1YYX A;  3M1C B;  1C02 A;  4GQH A;  3DAF A;  4NTA A;  2PBE A;  2NSF A;  2LCH A;  4YT2 A;  1A7D A;  3FVY A;  3ZIB A;  5BQH A;  3S0X A;  2WZG A;  1HW1 A;  1LKX A;  3V5Z A;  4O6Y A;  2QNL A;  3W2V A;  3T9O A;  4I3M A;  4C3E A;  4IAO A;  3FDQ A;  3TOL A;  2NG1 A;  5DS5 A;  1BR1 A;  3FMS A;  4LDK A;  4PFP A;  1SR2 A;  4CIH A;  2X0C A;  3CEX A;  4MQ9 F;  5L0F A;  1YA9 A;  2W45 A;  4M63 A;  3X2Q C;  1H9T A;  1VLS A;  5B3S C;  2Q3T A;  3B71 A;  5K0I A;  2L6F A;  1CPQ A;  1MNE A;  1NZE A;  1FTS A;  2XRH A;  2YHS A;  3H2V A;  3QVZ A;  1I4Y A;  2D5R B;  4JTD B;  4DVY P;  5JRA A;  2WL8 A;  4AK9 A;  1RKE A;  4CS8 C;  4I1M A;  2VC9 A;  5JVE A;  3LNM B;  4YN0 B;  3EZH A;  1T6I A;  4E18 A;  1Z63 A;  2YL0 A;  3L8I A;  4OD4 A;  4JIO A;  1V4A A;  1KU2 A;  2R25 A;  4U5B E;  3W8H A;  3EJN A;  1NSG B;  3EHM A;  3HNK A;  3UNG C;  3GM2 A;  2OG2 A;  2Y69 C;  2L7A A;  1OCO C;  1R5I D;  3AG1 C;  3C8G A;  1Q0K A;  2LFF A;  3DJN B;  1TWC A;  2DGJ A;  1M2V B;  3A11 A;  3CSK A;  3EH2 A;  1OKK D;  1S7Z A;  4LLE A;  4U5E E;  4XLN F;  3RIP A;  2EPK X;  3LNR A;  3AGU A;  2XLD A;  4U5C E;  4N06 A;  3TK0 A;  1WAT A;  1OXB A;  2J7P A;  2XLM A;  2Y3G A;  3G4X A;  4OIO F;  4LDQ A;  4KNV A;  4HE8 D;  2J9W A;  4CS8 A;  3NYL A;  2WZL A;  1QSP A;  3MYI A;  5HV9 A;  1R4T A;  3B29 A;  4JJF A;  4JJG A;  1VOM A;  4FWV A;  4JEB A;  4AX2 A;  5EGY A;  2XLE A;  1YAR O;  2A0B A;  4N6H A;  5L3Q A;  4C7O B;  3RFY A;  5A6B A;  4O79 A;  5KYW B;  3EG9 B;  3IQT A;  5KYN A;  4EBK A;  4XLP F;  2CW0 F;  1V74 B;  4Q4Z F;  5EHH A;  5AC5 A;  1FAP B;  4BJT A;  3GOD A;  2Q00 A;  1J8M F;  1K05 A;  1D0Y A;  3R2P A;  4RD9 A;  4N4W A;  1O5H A;  2QLA A;  4K1O A;  2YL3 A;  3DM5 A;  5DS4 A;  1ZU5 A;  3VF0 A;  4PJJ A;  5T3W A;  4DBR A;  4L6R A;  5F5F A;  3NMJ A;  4P6I C;  1JOG A;  1SF8 A;  4U5G A;  3AOU A;  2YEV A;  1TWG A;  3UMI A;  3GAN A;  4CDA A;  1PCX A;  3SZR A;  1TWA A;  5KYX B;  3ASO C;  2MWQ A;  1G8X A;  3VRC A;  4HFF B;  2XS1 A;  2R7O A;  4DRJ B;  3O39 A;  3LS0 A;  3RQE A;  1VB5 A;  3Q7L A;  5L0H A;  2VCA A;  2P6V A;  3EGX A;  4Q7C A;  1FR0 A;  3CAX A;  4FX5 A;  4XEK A;  4MW3 A;  2XLW A;  3EFO B;  1WAS A;  3T6G B;  2I15 A;  1TQG A;  1EI7 A;  3RH3 A;  4CIP A;  5JLI A;  2LD6 A;  1I4Z A;  2CNW A;  3W8I A;  2CDQ A;  4KBL A;  4P9F A;  1U89 A;  2NSG A;  1E2X A;  1ZHT A;  2ZXW C;  4NC3 A;  2QUP A;  4N6C A;  1OR2 A;  1YLM A;  1VMA A;  3HNJ A;  4BJ6 C;  3F47 A;  1QPU A;  2HV6 A;  3PMR A;  2MYS A;  2AWY A;  3T6J A;  1I5N A;  2WB7 A;  2EIK C;  2R03 A;  3PHF 2;  1WTY A;  1TR2 A;  1U6H A;  1UFB A;  3B0U X;  4J32 B;  1Q0F A;  3CQZ A;  2FAP B;  3M4C A;  1V55 C;  3QTH A;  5BQG A;  2B0J A;  2H7O A;  2ZD9 A;  5D92 A;  1ZHW A;  5B1B C;  5JT4 A;  2V26 A;  3AGT A;  4Q5S F;  1XZQ A;  1FFH A;  4KNW A;  2L6G A;  1Y4C A;  4BJ5 A;  4K7B A;  4PJL A;  1NU7 D;  1F1M A;  3S27 A;  4XQ1 A;  3ZTZ A;  4BJ6 A;  1BR4 A;  4MVQ A;  1MMD A;  3ZWI A;  4YL1 A;  4E17 A;  5B3I A;  1E86 A;  4YL0 A;  3N24 A;  4MVZ A;  4EBJ A;  1CPR A;  2WZF A;  3FHD A;  3I5P A;  3RQG A;  4FAP B;  5L0D A;  1JAF A;  4BJ1 A;  5E3A A;  3C62 A;  4FES A;  1VYI A;  1YVI A;  1L3P A;  1U0B B;  1RKC A;  3GEE A;  1BR2 A;  2EPN A;  4XPW A;  1OXK A;  2HJM A;  2D4U A;  1O3U A;  2R7U A;  2HMZ A;  5KYW A;  2PNO A;  1T01 A;  4GYT A;  3B0P A;  5DVW A;  2ETS A;  3JT1 A;  5FZT A;  1Z7Q c;  2AVK A;  3MLG A;  1T5O A;  3U2M A;  4X0R A;  1LIH A;  3ITF A;  4LDR A;  4DRH B;  4ZLD A;  3EGD B;  3ZQY A;  3WG7 C;  3Q7G A;  1OQC A;  3K1I C;  1LS4 A;  2J7P D;  1UG7 A;  2IYL D;  5A6J A;  3DXJ F;  3DZA A;  3LLK A;  2PFD A;  2Y39 A;  4WAB A;  3VYW A;  3O6X A;  1OCC C;  1GM5 A;  3WAQ A;  4YT8 A;  3ZSU A;  1N1C A;  5DQZ A;  2R7V A;  4DRI B;  2OEX A;  3AG3 C;  2IXM A;  1ZVZ A;  4JE9 A;  2IXN A;  5L0C A;  2EPL X;  3W4Y A;  3F46 A;  4LER A;  3PCV A;  1JR8 A;  1QQ3 A;  2Z15 A;  3C8Z A;  5IY5 C;  2OOC A;  4G7H F;  2X51 A;  4MS2 A;  4E0H A;  1GGQ A;  3GM1 A;  2L6H A;  3ZC4 A;  1Q0G A;  5T3T A;  1AEP A;  4J7Y A;  3B9Q A;  1GQA A;  2VB6 A;  1D1A A;  3K1I A;  3DAG A;  2PX0 A;  2A68 F;  3EGX B;  4PJM A;  4PK4 A;  1YZC A;  2YLD A;  2A6H F;  1M56 C;  4IWB A;  3K66 A;  3UMK A;  2E87 A;  4KI2 A;  1LPE A;  3U5S A;  2RSE B;  4U9D A;  5JUA A;  3K7D A;  3U3B A;  5F28 E;  1RXQ A;  2LFD A;  1T6Q A;  1ZW3 A;  1ORY A;  2BE5 F;  5L0G A;  4YT4 A;  2GFH A;  2ZXR A;  4XEF A;  4AE4 B;  1G4W R;  1E84 A;  1W2W A;  3JSZ A;  2AP3 A;  2R7R A;  4MTF A;  1WGW A;  2XXA A;  1ST6 A;  4DXW A;  4U5H A;  1FNT c;  3ZDL A;  1AUE A;  1AVO B;  2NUP A;  3VM6 A;  3RYL A;  2I8B A;  2XM0 A;  1A7V A;  2A6E F;  2FGY A;  2Y3H A;  3HLZ A;  1GS9 A;  3MBG A;  4W8K A;  4CS7 A;  1MQV A;  4JUR I;  4CDY A;  1WN0 A;  1D1B A;  1QKR A;  4I1O B;  2QY9 A;  3I4U A;  3DKA A;  3DI5 A;  2MHR A;  5COF A;  2KJG A;  4BPM A;  3T4R A;  1Z3I X;  2NPU A;  4Z9J A;  3HNL A;  2A1D D;  1JRA A;  3MFN A;  4OD5 A;  2LIG A;  1S05 A;  2J9V A;  3POV A;  3NYM A;  1LS1 A;  3O10 A;  2R7S A;  2RD9 A;  4CSA C;  5KYU A;  3JRT A;  4P9T A;  2GWW A;  3MYF A;  4E0I A;  2AWC A;  3SXY A;  2HUJ A;  4JTA B;  2AU5 A;  3TJ5 A;  2ASR A;  4JKV A;  2EIN C;  3X1O A;  1JMW A;  1OW8 A;  1TKN A;  2GAQ A;  2PX3 A;  3A9C A;  3HTK C;  1Q0M A;  3L0I A;  3Q6M A;  3GWL A;  4C3B A;  4GEH A;  2YZS A;  2Q7R A;  1SYQ A;  4JCH A;  3U3F A;  1PD0 A;  3E9V A;  4DJ9 A;  2CYD A;  1RMV A;  4YT5 A;  3JZ0 A;  3V7O A;  1HE1 A;  2CCY A;  2L9J A;  3EHN A;  3IQC A;  1CGO A;  1QZX A;  2Q9B A;  2YVK A;  1IZM A;  3N0T A;  4NCQ A;  4CSA A;  2G62 A;  3S9O A;  3V5Y A;  5CI9 A;  4K0D A;  4PR9 A;  1T9K A;  2OJQ A;  4EWC A;  2YKZ A;  1OCR C;  3ABL C;  1K40 A;  2CGE A;  2LSE A;  5JP7 A;  3SP1 A;  4G7O F;  2HKV A;  4LLC A;  5L0I A;  2NUT A;  3GOR A;  1PD1 A;  3FOO A;  3AQC A;  3S29 A;  2QTV A; 
#chains in the Genus database with same CATH homology
 1I5N A;  2OOC A;  1SR2 A;  1OXK A;  4G78 A;  4EUK B;  1OXB A;  2Q4F A;  3US6 A;  4PAC A;  1WN0 A;  1QSP A;  1FR0 A;  2LP4 A;  2A0B A;  1Y6D A;  1C03 A;  1TQG A;  3IQT A;  3U3B A;  1C02 A;  2LD6 A;  2LCH A;  2R25 A;  1BDJ B;  3KYI A;  3MYF A;  1YVI A;  1A0B A;  3KYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...