1C0GA

Crystal structure of 1:1 complex between gelsolin segment 1 and a dictyostelium/tetrahymena chimera actin (mutant 228: q228k/t229a/a230y/e360h)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
375
structure length
367
Chain Sequence
DGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGKDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMKAYASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKHEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords PROTEIN (GELSOLIN SEGMENT 1)
total genus 120
structure length 367
sequence length 375
ec nomenclature
pdb deposition date 1999-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1c0gA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1c0gA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1c0gA03
2V7YA 5LY3A 1GLBG 1KAYA 1NGAA 3HZ6A 4BC3A 1Z6RA 1JCEA 4L3QA 4BR9A 3VERA 2V52B 1GLEG 4H0OA 4MO5A 3M6GA 1C0FA 3A5LC 3D7EO 2D0OA 4BGBA 3MN5A 2QWOA 4ISGA 4BG8A 1NBWA 3B8AX 1NM1A 3HTVA 4IO8A 4YDUA 4FPBA 3S41A 3CETA 3CQYA 4CZMA 1RGIA 1QQOA 1XQSC 4BRLA 2ASPA 4BC4A 1T6DA 3CJ7A 3HSCA 4H5WA 3SMPA 2YJEA 1BO5O 3CJBA 4QS8A 1T6CA 5BRFA 3H1QA 4B1WB 4NB4A 4M7YA 5AZIA 3WXIA 1X3MA 2Q0RA 2VYPA 5BN9A 3VETA 5EY4A 2P9NB 3P4IA 4K42A 4FO0A 4PKGA 5EX5A 4BRGA 4IWVA 1S22A 3R9PA 3EL2A 5F2RA 2VCPA 4O8KA 3FZHA 2FXUA 1ZXOA 5BREA 2GELA 1U2VB 4GY2B 4CZKA 3TU5A 1NGCA 3DXMA 3VEVA 1K8KA 2ZGYA 4BRAA 4H0XB 3O80A 4BREA 1MDUB 4BRFA 3UKRA 4H03B 3D2EA 1LCUA 4FWOA 2QWLA 2FSJA 3SK3A 5JLHA 2AA4A 4WQ5C 5AQNA 3LM9A 3BEXA 1ATRA 1ZC6A 4WQ4A 3VEWA 5AQLA 2P9LA 3O1WA 3QBWA 1ATSA 4FSVA 5AQQA 4CZIA 2QWPA 3CQXA 5FPMA 3WEEA 5AQPA 2HOEA 1NGBA 1TYQA 5ELZA 3FLCO 4B1ZA 3VENA 3U9ZA 4MLHA 4BRIA 3ZEUA 3SMSA 3ZX0A 4I6MB 5I9EB 2CGKA 3LDOA 3FZKA 3M1FA 3MN7A 2GWJA 4WQ4C 2P9PB 5EOYA 4EAHD 4CZEA 3H3NO 3D2FB 3I8BA 1QQMA 2F9TA 1CZAN 3U9DA 3R6MA 3MDQA 3LDPA 3CI5A 2FF6A 1MA9B 1C0GA 1XC3A 1NLVA 2E2NA 3QB0A 3ZETA 1NGDA 3UKUA 1WUAA 2W41A 4MO4A 4PKIA 5AQTA 4BVPA 3DJCA 5AQSA 1HLUA 2BTFA 2QWNA 3ULEA 2E2OA 2PBDA 5AZJB 2J4RA 1WOQA 3LDQA 1DGKN 5KPTA 1X3NA 1E4GT 2V7ZA 1GLCG 4A62A 2QWMA 2P9SA 5BPMA 1BU6O 5KPRA 3MN6A 4J8FA 5EVZA 3ZX3A 1SQKA 2UYTA 3FZLA 3FZMA 2QXLA 3DXMB 5JICA 4CZHA 4QS9A 2OANA 5AFUH 2FSKA 2IVPA 4XEIA 3W0LA 3ATVA 4WQ5A 1HUXA 3I33A 3BP8A 4CZLA 5E26A 3VGMA 2A40A 1BUPA 1TUYA 3IUCA 3QBXA 4PKHA 3WQUA 3FR0A 4FWNA 4FWSA 3UB5A 5LJWA 4B9QA 2PAVA 4CBWA 4ISFA 1X9JA 5JMVA 3AARA 3A5NC 4CD1A 3QDKA 2FSNA 3L0QA 2P9UB 1JCFA 4CBXA 1G99A 3BF3A 4PL8A 5BRHA 1BWFO 4A2BA 1NGFA 3H3OB 4FWMA 4BRMA 3QICA 3G25A 3VEZA 3JXUA 1KXPA 3GDQA 3QMLA 3LDLA 4CZJA 5KQDA 1NMDA 3IDHA 1GLLO 3MMVA 2YCHA 5CE3A 4E1JA 5KPZA 1ESVA 2E2QA 2P9IB 1NGEA 2E88A 4BR2A 3AAPA 1K8KB 1QQNA 4BR7A 3O1BA 2Q31A 5AQOA 4FWPA 2GWKA 2H3GX 3VGKA 2P9PA 4HWIA 1IJJA 3ULEB 5AQGA 2I7NA 3VF4A 4A61A 3CJAA 5LJVA 4RWTA 2Q0UA 5JLFA 4IZ9A 5AQWA 1DEJA 3O08A 5TKYA 4H5NA 4KBOA 2YHXA 5FPEA 4H5TA 3EKUA 4FL9A 4BR4A 4BC2A 3J8AA 4BRHA 1KAZA 5AZJA 2W40A 4BGAA 4FOEA 4H0VB 4HTLA 2FLOA 4DQ8A 2E1YA 3VF6A 3KVGA 1D4XA 5AQJA 2AP1A 4JD2B 3WQTA 3BUZB 3CJ9A 3MCPA 3H1VX 2I7PA 4C23A 1Q18A 1YAGA 3AY9A 2YI1A 2ZGZA 5BR9A 4FWQA 2ASMA 2ASOA 3IMXA 3W3DA 4MLEA 4BQLA 2QW9A 3FZFA 3CHWA 3OHRA 5AR0A 3CJCA 3WXLA 3DXKA 1MWKA 1BDGA 3HM8A 3IFRA 4ISEA 4CZGA 1YVNA 3QFPA 3UE5A 2F9WA 4GNIA 3DAWA 1NGGA 2NLXA 2KHOA 4BRKA 3UKUB 4JAXA 5F0XA 1P8ZA 3ENOA 4XH1A 1YUWA 3M3ZA 1OKJA 3A5MC 4BR0A 1NWKA 4K41A 2IVNA 2GTDA 4K43A 4BRPA 1DKGD 2P9SB 4B1YB 4JN4A 3FFKB 5BRDA 1JCGA 4BRQA 2CGLA 5F1XA 2HF3A 2VWBA 3RSEB 3VEXA 5ADXH 3VPZA 1E4FT 2Q97A 4B1XB 1BA0A 4B1VA 1HJOA 3H46O 5AQYA 4AM7A 3GBTA 2P9KA 2CH5A 3WXJA 4H5VA 5AQVA 4CZFA 4M63C 3A8YA 2IVOA 3EO3A 5EXWA 3U8XA 5KQ8A 4JHDA 5AQMA 3R8EA 2CH6A 2IIRA 2WUSA 4EIAA 4JNEA 4CJ7A 4YDUC 2HF4A 3DWLA 3WUHA 3KHYA 4BRDA 3EZWA 5FPNA 1RFQA 3EN9A 1NGIA 3CERA 1NGHA 5BPNA 2P9UA 3L6QA 4EHTA 1SZ2A 3O6WA 4WYBA 2QM1A 3TPQA 1EQYA 3VOVA 4BRCA 3C7NA 3A0IX 3AAQA 1QZ5A 1U6ZA 4XH4A 2YHYA 3C0BA 2E2PA 3ATUA 3HBTA 4IJAA 3WXKA 3FGUA 4RCHA 3H45C 2Q2RA 1YXQA 1Y64A 2P9IA 3GG4A 3GL1A 5AQFA 3BF1A 4XH5A 4FWRA 1HX1A 2ZF5O 2ZWHA 2ITMA 4QS7A 5AZIB 4BQZA 2FF3B 3LM2A 2QWQA 2P9NA 3VF2A 4F9OA 1H1VA 2EWSA 3JS6A 2D4WA 2A3ZA 1TUUA 4FPAA 5BN8A 2V51B 3L4IA 4BR5A 3MK6A 1BG3A 3O8MA 2CGJA 4IXCA 4JD2A 2Q36A 4RTFD 2DPNA 2GUPA 4CBUA 3WT0A 4DB3A 4FWKA 3FE1A 4BC5A 2BUPA 1S3XA 4H0TB 1XUPO 3D2EB 3ZX2A 4NO7A 3MN9A 2A42A 4K25A 1MWMA 1HKGA 5B8HA 2GEMA 4BROA 2E20A 2NRHA 1ZBSA 4IJNA 1V4SA 1SAZA 3A5OC 2P9LB 4B1UB 3LDNA 1RDWX 3DXKB 2YJFA 3HI0A 3GE1A 2HMPA 4O5FA 4A2AA 5FPDA 2NZTA 1T44A 5ADXA 4DHYA 2D0PA 3F9MA 3LL3A 4Y0WA 1GLAG 3ZEUB 4BVOA 4EFHA 1HKCA 5AQKA 2D1KA 2P9KB 3H6EA 1HKBA 4PL7A 3VEYA 4M7XA 4CD3A 3C7NB 1IG8A 5AQRA 3VESA 5AQXA 1NGJA 4FOIA 3EKSA 1R59O 4JHDB 4BRNA 1QHAA 1HPMA 3CJ1A 4H0PA 1GLFO 3SLCA 2YHWA 1QZ6A 1TYQB 1GLJO 1KAXA 3CIPA 3O5BA 4BG9A 3VEOA 2E1ZA 2A6AA 2A41A 1BA1A 2QWRA 5BPLA 1V4TA 1GLDG 1J6ZA 5AFUA 4I6MA 5AQIA 4FWLA 1LOTB 3KZBA 4LC9B 3SJHA 3ENHA 3O4WA 5AQZA 3D2FA 1Z05A 2E8AA 1BOTO 1U2VA 5AQUA 4EHUA 1ATNA 5E84A 3RSEA 4H0YB 3WEEB 3U4LA 3ZETB 4Z94A 2A5XA 3VGLA 3UKRB 3GOIA 4AM6A 4H5RA 4DCHA 3ID8A 5AQHA 4CI6A 3QFUA 2Q1NA
chains in the Genus database with same CATH superfamily
4E7HA 3KLFA 2YV0X 2KLAA 2IDOA 1KAYA 4IFYA 4BC3A 1D9FA 4BR9A 1C1AA 1C6VA 3VERA 4DTUA 1SKWA 4X62K 1GLEG 1OVYA 1NNEA 1OH6A 2Z1HA 1JL2A 1C0FA 2D0OA 4JK7A 4YOYA 4KRFA 4E7JA 5J2PA 4ISGA 3CMAN 4FW1A 3C6UA 5H1SQ 1NM1A 1DLOA 2GX9A 4DR5K 4CZMA 4U7BA 2OPSA 3PIOL 4CIFA 3OW2M 2RF2A 4CJRA 4AF1A 3VQQA 4J2EA 1RTIA 4QS8A 2UUAK 1NG9A 4NB4A 5AZIA 3WNHA 4CJKA 3KWIA 4LD0A 5BN9A 2OYQA 3V9XA 2YHAA 3U3GA 3VETA 4XJXA 3T1AA 2GV9A 4K42A 4FJ8A 4KFBA 4CW7B 4CJ3A 2FXUA 1XMOK 1J5OA 2GELA 3P38A 4FK0A 1NGCA 5CZ1A 3O80A 1MDUB 4Q5VA 3D2EA 1LCUA 4FWOA 5CYMA 3SK3A 3VQEA 3V9WA 1ATRA 4FYDA 3AVHA 2P9LA 4F8RA 1ATSA 5JENA 3O4NA 3VQBA 4CZIA 2QWPA 3CQXA 2BDPA 3FLCO 3U9ZA 3QNOA 3SMSA 4I6MB 1C0MA 2CGKA 3CFPA 3LDOA 1C0TA 4FXDA 3MN7A 4WQ4C 4LH4A 3CQ8A 1RDCA 4CZEA 4OX9K 3H3NO 1EETA 2UU9K 2F9TA 4E7KA 4C8KA 4WE1A 4KKOA 3KLHA 1XC3A 3CCJN 1NGDA 4J2AA 2QKBA 4FLXA 4ID5A 3SNNA 4B9LA 1WUAA 1IBMK 2F8TA 4KB1A 4WCEL 1W7AA 3ZYYX 4GW6A 3HXMA 1HLUA 2BTFA 5HBMA 4CJTA 5FROA 2E2OA 2PBDA 3HVTA 1XMQK 2J4RA 1GOCA 3LDQA 3J7YP 4DKWA 1DGKN 1RBRA 2V7ZA 5K14A 1GLCG 4M3ZA 1VSHA 5BPMA 4DFJA 3ZCMA 3MN6A 3CCLN 4DV1K 3RWUA 4K8ZA 3PLAA 4Y1CA 3BGRA 3HOSA 1N32K 1RCHA 2FSKA 2NRZA 1VQLN 2HNZA 3MXJA 2JWKA 4W5NA 3BP8A 3VGMA 3THXB 1CXUA 2YKNA 3S3OA 2HHHK 4I9QA 3IUCA 2EX3A 1VRTA 2FBVA 3OBWA 3T69A 3WQUA 4M42A 3SYZA 1NOZA 4YHHK 3AA4A 4CD1A 1EXQA 2WOMA 1JCFA 5D3GA 4FLTA 3PO5A 1JKHA 1ASWA 1RBTA 1NMNA 3BF3A 4Z4GA 4PL8A 4DR2K 3EY1A 3AVFA 3ZSVA 1NGFA 3H3OB 5DM7L 3R3LA 3G25A 3QETA 4JI2K 4FK4A 3JXUA 1EP4A 4FLWA 4M3TA 3LDLA 4JYAK 3K5OA 4OPHA 4DTRA 3ULDA 4NLCA 1EO1A 2E88A 4LF4K 4HHTA 4EP4A 1KFSA 3HPOA 5J2MA 2H3GX 1S1TA 4IFVA 1NJXA 2E5LK 3VA3A 4OKJA 4RW9A 4CF2A 4LFBK 1VQ5N 4DR7K 3QNNA 4DTMA 5TKYA 5FRNA 1Y97A 5GIOA 4KBOA 1D5AA 2YHXA 5FPEA 4BR4A 2GBZA 4FJXA 2YNIA 2HBKA 3J8AA 2XHBA 1OH8A 4KREA 3ZSOA 3PIPL 4BY9C 4BGAA 3QEXA 1VHXA 3VF6A 3L2RA 2VG7A 4FM0A 3L2WA 5AQJA 3O3HA 2AP1A 3SAFA 1IG9A 4H8KA 3CJ9A 4M45A 2OCEA 4Z0UA 1Q18A 3N4QA 4IOXA 1TKTA 1J54A 3ALYA 4CJVA 4DLGA 2YI1A 1VSLA 4LY7A 2O4IA 3NF8A 4CHQA 4X66K 3THYB 3VTHA 4C8LA 3K57A 4PY5A 1G15A 3CHWA 5AR0A 3T1HK 3IRXA 1MWKA 1RBUA 4CZGA 4JKBA 2O8EA 3F9KA 2RPIA 4JI6K 5HROA 2G8KA 2NLXA 4JLHA 4KHQA 4DUYK 1JLAA 4JAXA 4Z4IA 4DSFA 2G8UA 1OH5A 2KZMA 1U48A 3M3ZA 3A5MC 1CZBA 1O1WA 4K41A 1BGXT 3ENBA 3NDKA 2P9SB 4B9SA 4B1YB 4R5PA 4FZYA 4BRQA 2KW4A 3ASMA 3VEXA 5ADXH 1U45A 3PX4A 1HJOA 3H46O 4DV3K 4JKAA 3P39A 1IKXA 5AQYA 1KC8O 1KD1O 2WBNA 3WXJA 1UA1A 3J7AP 3PY8A 4JS4A 1NU0A 4M63C 5DMRA 4BECA 2IVOA 5EXWA 3VTIA 5KQ8A 4JHDA 4O8UA 1WB9A 4DV6K 3QEIA 3QEPA 2KZZA 1W0HA 1RFQA 3EN9A 4KHWA 4CJLA 2XY7A 4JK8A 4DF8A 4WYBA 1TKXA 3SJJA 1ZBIA 1N36K 2HMIA 5DK5A 1QZ5A 4XH4A 3WNFA 2YHYA 1CLQA 2QKKA 4KI4A 3HBTA 1RTDA 3F5TA 3FGUA 4DTSA 1YXQA 1Y64A 4OPAA 3BF1A 4XH5A 4DR4K 1HX1A 2I5JA 4BQZA 3VQDA 3LM2A 3NF6A 2QWQA 3QERA 2C1GA 2P9NA 2YNGA 3AVNA 4FJ7A 4FK2A 5IWAK 2O8BB 2NUBA 3LP3A 4DSJA 1EWRA 3MK6A 4B3TK 4RTFD 4LSNA 1SV5A 2OPRA 2GUPA 3TTFA 4CEDA 1LW0A 3FE1A 4CGHA 5C12A 2BGGA 5C2DA 2YNFA 4FJLA 3NF7A 4NO7A 4AHSA 3MN9A 5EU7A 1K8AO 4K25A 5B8HA 2GEMA 4YY3K 3JSMA 2E20A 2NRHA 1WAJA 2OZMA 3A5OC 1LWEA 3KKRA 3A2FA 4CK3A 1RDWX 3HSTB 2VGNA 1UAXA 2HNYA 3GE1A 5FPDA 1ZBFA 2NZTA 3NFAA 3F9MA 4BVOA 2FC0A 5AQKA 3TI0A 4V19S 2UXBK 4FJ5A 1IG8A 4AH9A 4BDPA 4FM1A 1NK5A 1QHAA 3DMJA 1GLFO 2KQ2A 3SLCA 4FJIA 1TYQB 1GLJO 1KAXA 2E6LA 4BG9A 4CF9A 1HYSA 2A41A 1BA1A 3BZCA 2IGIA 1SL1A 3DLRA 4DSIA 4OGEA 4KV8A 5A2QO 1BCMA 3CCMN 4FWLA 4I7FA 3L3VA 1U4BA 1ZBLA 1Z25A 3ENHA 1U04A 3EE9A 3D2FA 4CJUA 1Z05A 1RT3A 5KTQA 2E8AA 1U2VA 2IC3A 1ATNA 3RTVA 4H0YB 3U4LA 3ZETB 3TSPA 4DTNA 3E9LA 2W42A 3OYLA 4B9UA 4O44A 4O5BA 1JCEA 1XC9A 1WSGA 4WFAL 3M6GA 1E3MA 3D7EO 3MN5A 1QTMA 1NK9A 4DU4A 1BQNA 4YDUA 1VQ7N 4GV9A 5CY4A 3S41A 2KFNA 3AVMA 1IKYA 1P90A 3OYCA 5J2QA 1T6DA 3HSCA 4H5WA 1T8EA 2YJEA 3D0PA 2RHKA 4FW2A 4B1WB 4DUZK 4M7YA 3OYIA 4OLAA 3WXIA 1X3MA 2Q0RA 4NXMK 4CF8A 4ZHRA 3M8RA 4DTJA 4C8OA 5EY4A 5M1FA 3O9RA 5TKWA 3S9HA 5EX5A 3O3GA 1S1VA 3EL2A 5F2RA 2VCPA 1FXXA 1ZXOA 1XHZA 1KLMA 5BREA 1U2VB 3SI6A 3K9JA 1QE1A 3RVCA 4YFUA 3TU5A 3VEVA 3ZSZA 4BRAA 2QEXN 3HJFA 3ZSXA 1RT1A 3OYNA 3TAMA 2FSJA 4FLZA 4WQ5C 3M5RA 3O9QA 3VEWA 2O8DB 3O1WA 1TK0A 1VAZA 5KRSA 5AQQA 4C1NK 2HOEA 3E1YA 1NGBA 1U47A 5ELZA 1RTJA 3O9UA 4B1ZA 2QI2A 3CXCM 1VQKN 1TVRA 3NVMA 4BRIA 3ZEUA 2BH1A 4KH5A 3THVA 2X6SA 3FZKA 2GWJA 3L2VA 4KH4A 2W6LA 3C95A 4E7IA 4M41A 2Z1GA 1QQMA 3AVLA 3I8BA 2F4VK 1CZAN 4JEPA 3R6MA 1BI4A 4JI0K 4B9NA 2HBLA 2YHBA 2FF6A 1MA9B 4FLVA 1XHXA 1NLVA 2E2NA 3QB0A 1I39A 2KFZA 3UKUA 3SQ0A 4MO4A 4PKIA 4ILJA 4BVPA 3MX2A 1N34K 2QWNA 3G6EN 1WLJA 3NHGA 3ULEA 4LF9K 2YKMA 1CZ9A 1E4GT 1X3NA 3P31A 1DTTA 1VQ9N 5I3UA 4J8FA 3ZX3A 3THWB 1SQKA 2B4JA 3LALA 2UYTA 3FZLA 3FZMA 3AVBA 3O3FA 3IS9A 4E72A 2EHGA 1S6QA 3SUQA 4B8AB 4WQ5A 3CCSN 1HUXA 2QXFA 3M8QA 2HSTA 3I33A 3THYA 4CZLA 4ICLA 5E26A 3M8SA 3HM9A 4DR3K 4OVLA 4PKHA 4CVNE 4W5RA 4IG0A 5I42A 4CBWA 4NXNK 5HLFA 4JKGB 3MWPA 3AARA 4JI1K 4KH6A 3QDKA 2P9UB 4CBXA 1ZYQA 1S6PA 4KHNA 1BWFO 5FLXO 4W5OA 4BRMA 3VEZA 5HL7L 1KXPA 4DSLA 5JS1A 3AGKA 1TAUA 3I55N 5CE3A 4ELTA 1L5UA 2UUBK 3K59A 4M3XA 1NGEA 1OH7A 4BR2A 1K8KB 3NBPA 1MU2A 3HP9A 3O1BA 2Q31A 4A5AA 3T1YK 5M1NA 2GWKA 1M1KO 4AILC 2P9PA 4HWIA 1C1BA 1UWBA 3ULEB 3KLEA 3QESA 3OS2A 4B08A 2P5GA 4A61A 3CJAA 1YT3A 5LJVA 3OS1A 4JKFA 4IZ9A 5AQWA 1DEJA 3O08A 1WSIA 5J1EA 4YORA 2C1IA 4I2PA 1JL1A 4H5TA 4FL9A 4FJ9A 1C1CA 4JKCA 4FLYA 5HRSA 3AO3A 4FZZA 1KAZA 3OJUA 4O0IA 3KKSA 3ISNC 4M3UA 4Z4EA 5AZJA 3CFRA 4W5TA 3MAQA 4CGGA 3SBTA 4H0VB 5LMUK 3B6OA 4YOTA 2E1YA 4X65K 4B3SK 2Q3SA 3DLLL 3EZ5A 3AO5A 3WQTA 4BDZA 1TK8A 3OYEA 1NK0A 2I7PA 3VQ6A 2ATQA 1CXQA 2X78A 1QS4A 3LAMA 2A1RA 4FWQA 1JLEA 1WSEA 3SZ2A 4JKEA 3V4IA 1Q82O 3K5NA 4DQIA 5FRMA 3DXKA 4CGIA 4DTPA 1BDGA 3HM8A 3RR7A 1O13A 4AQYK 2HW3A 4DSKA 2F9WA 3TAFA 2W00A 2KHOA 1HYZA 3CCRN 3KK3A 5F0XA 2E4LA 5GAGP 1S5JA 2HBMA 5M1PA 1N8RO 1SL2A 4IBNA 4CJ4A 1BCOA 2IVNA 2GTDA 4E89A 3SUNA 2HHVA 1YVUA 1HQEA 2RKIA 3FFKB 3KLIA 5KGXA 1VQON 1HNVA 2CGLA 1HJRA 5F1XA 2HF3A 1YTAA 3V9UA 1S1WA 4CGJA 1BA0A 3RMBA 5CZ2A 3VQCA 3D6RA 3V9ZA 3CM6A 1D9DA 2X74A 3GBTA 1NKEA 2OTJN 1XWLA 5AQVA 4CZFA 5KRTA 3A8YA 5C2FA 1BHLA 5CHIA 1QSSA 5AQMA 3R8EA 4CCHA 2CH6A 4IFEA 2WUSA 5C24A 4JNEA 1TL1A 4YDUC 2HF4A 2ETJA 4KTWA 3KHYA 4BRDA 5FPNA 3I56N 3CERA 1ASVA 3Q7BA 3VQ5A 1T7PA 3RR8A 1HMVA 4DQPA 3NH1A 1EQYA 3VOVA 2VG6A 2HHSA 3C7NA 3K5LA 2ZJQL 3A0IX 3AV9A 2G8FA 3KLGA 4FJGA 4N56A 2BANA 3KIOA 2WFBA 2OZSA 4ZTJA 2E2PA 2B6AA 3H45C 4OKKA 2Q2RA 2P9IA 3GL1A 4FJMA 4FWRA 4BE1A 2ZWHA 3OBYA 2ITMA 3IG1A 5AZIB 3BZKA 3S3NA 3SQ2A 1H1VA 2EWSA 3AA3A 1T03A 4KTZA 1TUUA 5SWMA 4UY8O 4CEEA 4IXCA 4JD2A 2Q36A 3LP1A 2HHIA 1VQMN 2DFHA 1XUPO 3C6TA 3D2EB 3ZT4A 3L2UA 2UXDK 2A42A 3KJVA 1FKOA 4BROA 1ZBSA 4IJNA 2NRTA 3SAGA 1V4SA 2P9LB 4DV4K 4DV5K 4OJRA 2HHXA 4A2AA 2A1SA 4FVUA 3OYJA 1ILYA 4YNQA 4DHYA 3CPWM 4Y0WA 1WSFA 1HKCA 3ZLJA 2D1KA 2P9KB 3H6EA 1HKBA 1JLGA 3CMEN 4CD3A 4M7XA 3C7NB 4LFCK 1NGJA 4FOIA 3EKSA 5GINA 4BRNA 5CYQA 3CJ1A 5CR4A 3CCUN 4FJNA 1YI2N 3CPEA 1BL3A 4CFBA 3NGZA 4DMNA 3G0ZA 4Z4CA 2ZQBA 4I6MA 3LPTA 2D5RA 3MXMA 5AQIA 3O9SA 4Z4HA 2KKZA 3QIPA 1LOTB 3KZBA 3SJHA 3PSFA 5HP1A 1K73O 3E66A 1X9WA 4CEAA 1TGOA 5E84A 3RSEA 3TAQA 4IDKA 2NRVA 3NH2A 3UKRB 3KD5E 4E0DA 3ID8A 4AHRA 4CI6A 2P1JA 4YOXA 3DI6A 2V7YA 5LY3A 1GLBG 2G8IA 3CFOA 1Z6RA 3TARA 3THXA 2V52B 4H0OA 3OYBA 1W2BM 3A5LC 4RW4A 4DS4A 1X9SA 2QWOA 3MECA 3C65A 4BG8A 1VQNN 3CETA 4BACA 3R1XA 4LF7K 3SPYA 2ITGA 1HNIA 1RDDA 4BRLA 5J2NA 1DTQA 4BC4A 5JVHL 1VQPN 2NRRA 3U3YA 1YJ9N 3CCEN 4CJEA 3AVKA 3THWA 3NH0A 1BO5O 3CJBA 1VK0A 3NVKA 5BRFA 1VSIA 3DRRA 3H1QA 4WFNL 1UA0A 4DQRA 4KPYA 2UXCK 2VYPA 1XNRK 4CERA 4CGFA 2VWKA 3J81O 3P4IA 3M8PA 1F21A 4O0JA 4PKGA 3DLHA 1S1UA 1HR0K 4JKDA 4BRGA 4IWVA 3R9PA 2VG5A 4O8KA 1KTQA 4GY2B 4CZKA 4PQUA 2OPQA 2XRIA 4ID1A 4H0XB 3L2QA 4BRFA 1REVA 3UKRA 4H03B 2GUIA 2QWLA 5JLHA 2AA4A 1HYVA 3JAMO 4HCCA 2HNDA 3BEXA 4DG1A 1ZC6A 2ZJRL 3QBWA 5M1QA 2IAJA 4FSVA 2RN2A 1HRHA 4CESA 1L3TA 3LANA 4J2BA 1B9FA 2FBYA 2O4GA 3LZJA 3VENA 4MLHA 1S1XA 3HL8A 4AHVA 3ZX0A 2HHQA 1J5EK 3K9KA 4DR1K 1N33K 1BISA 1IV0A 2P9PB 3PUFA 2R7YA 3VQPA 3RMAA 1UOCA 3U9DA 4A5BA 3LDPA 3MXIA 3AVAA 3DOKA 4X64K 3G71N 3TWHA 4DTOA 3TAPA 3EE8A 3G4SN 3DJCA 3FFIA 2PYLA 5AZJB 2AJQA 4M3RA 5KPTA 1HNWK 4YOWA 4A62A 2P9SA 2O8EB 1BU6O 5DM6L 5KPRA 2E6MA 1BQMA 4B9VA 3WXMB 4CJQA 3DOLA 2QXLA 4CEQA 4LF8K 4QS9A 3LZIA 1JLBA 1W97L 4N41A 4CHNA 3SV3A 3HRGA 4KHSA 3PV8A 2A40A 4FJJA 1TUYA 2ZE2A 3VQ7A 3QBXA 4JRPA 3FR0A 4FWNA 3I0RA 4B9QA 4FLUA 2PAVA 4DFMA 1X9JA 5JMVA 3A5NC 4GVMA 3L0QA 4CHZA 4DU1A 1YIJN 1JLQA 5BRHA 1QHTA 4FWMA 4RW6A 3LWLA 2Z1IA 5M1OA 2HHTA 3QMLA 4CZJA 5KQDA 1RTHA 3KTQA 1SS6A 1NMDA 3PX6A 3MMVA 2YCHA 1KVBA 3VQAA 4E1JA 3BDPA 4Q0BA 2E2QA 3MWTA 3AVIA 3HPGA 3AAPA 1D8YA 4E1MA 3SUOA 5AQOA 4IOAL 4HUGA 4CFAA 3VGKA 4DV7K 1IJJA 4N5SA 4E1NA 4CHOA 4RWTA 4KB0A 3WNEA 1T3VA 3LDSA 1QSLA 3DYAA 1RDUA 3EKUA 3SV4A 2FBXA 5C42A 1I94K 3LWMA 3SQ1A 4JI7K 1B92A 3S3MA 4LFAK 2O8BA 4WFBL 4HTLA 4DQSA 3QIOA 2FLOA 4DQ8A 4F2RA 3KVGA 3ZT0A 4HUFA 4H4MA 3KK1A 3BUZB 1RDAA 1JJ2M 4C23A 4FZXC 3K5MA 4CFDA 3AY9A 5BR9A 3HK2A 4A59A 1NKBA 4GKKK 3DM2A 3FZFA 3WXLA 3OHRA 4CJPA 4ISEA 4RG8A 5JS2A 3QFPA 4KAZA 3UE5A 2IOCA 4GNIA 1BIUA 3DAWA 1L3SA 3OYGA 5C10A 1RT4A 3MX5A 1P8ZA 3ENOA 4XH1A 4Z4FA 2JGUA 4CIEA 1OKJA 1IBLK 2O8CA 2UUCK 2ZD1A 4K43A 4BRPA 4CJFA 3OJSA 3TTDA 4AHCA 5JVGL 3AGRA 4MFBA 2VWBA 2P5OA 1E4FT 2Q97A 4B1VA 2X6NA 3CCQN 4NYNA 1J9AA 1TAQA 3VQ8A 1Q7YO 3MEEA 3TSUA 3NGYA 4NLBA 2P9KA 3QINA 4H5VA 3LAKA 4N47A 3ZT3A 4IEIA 3EO3A 3U8XA 1HPZA 4KTQA 2IIRA 4NCGA 2YNHA 4EIAA 4CJ7A 1LW2A 4FVMA 1VSMA 4CF0A 1LAVA 3DWLA 3WUHA 1NK7A 1NGHA 3VA0A 5HRRA 1SZ2A 2P51A 3HOTA 3N4PA 3O6WA 3P83D 2VQFK 3CD6N 3DLEA 4I9LA 4CK1A 3AAQA 1YHQN 4KHPK 5M1KA 3C0BA 4E19A 1WSJA 4RCHA 4FJHA 1KVCA 1TKDA 2B5JA 2NRXA 1L3VA 4JI8K 3SUPA 3LP0A 3WNGA 1EKEA 1FKPA 1QVFM 2ZM6K 4Y1DA 4EP5A 4IDHA 3VF2A 4F9OA 1NK8A 3CC7N 3I0SA 1GOBA 3JS6A 2O8CB 2D4WA 2A3ZA 4FPAA 3NE6A 5BN8A 1LWCA 4DU3A 4DWIA 4DFKA 2OPPA 4WF9L 1X9MA 2DPNA 3OYDA 3K2PA 3WT0A 4FWKA 3AO2A 1S3XA 4H0TB 5FDLA 2NNWA 3ZX2A 5LL6Z 4B9TA 5E41A 1MWMA 3VMFB 3DRSA 4W5QA 1NJWA 2PFUA 3P5JA 2O8DA 4B1UB 3H08A 4GKJK 3DRPA 4HUEA 2YJFA 4KHUA 2HMPA 4FJKA 1T44A 1S9EA 2D0PA 4H4OA 4QOZB 4IOCL 3NMUA 3LL3A 2PZSA 2D0AA 3AO4A 1GLAG 3ZEUB 3O9TA 5GADP 3OVNA 1KVAA 3MCAB 1ZBHA 3VEYA 5AQRA 3VESA 5AQXA 4B3OA 1Q9XA 3QEWA 4OKEA 1HNZK 4CEZA 3DLKA 4E3SA 1QZ6A 3O5BA 3CIPA 1TL3A 4JKHA 3VEOA 2E1ZA 2A6AA 5BPLA 2QWRA 2PY5A 1V4TA 1SKRA 2Y1IA 5AFUA 3DLBA 1W9HA 2HB5A 4LC9B 5GAHP 4DV0K 3HO1A 4O4GA 3AA2A 1SKSA 3UIQA 5KGWA 3J80O 3RRHA 1BI4B 4XIUA 1BOTO 3PX0A 1DT9A 1VSDA 2A5XA 4A57A 1VRUA 4H5RA 5AQHA 3EEQA 3V1RA 1XNQK 2Q1NA 3QEVA 4NCAA 1RNHA 4LF5K 4CJSA 1NGAA 3HZ6A 3PSIA 1LWFA 2W6KA 2HVHA 4L3QA 5IT9O 2QTDA 4CJWA 3OYAA 1WBBA 1VSFA 1IKVA 2DFFA 1LV5A 4MO5A 4ELVA 4M3WA 4JKGA 4DFPA 2O8FB 4BGBA 1TV6A 4NYFA 2WC9A 5KI6A 1NBWA 3B8AX 3HTVA 3DLGA 4IO8A 4LSLA 4DV2K 4FPBA 4B8CA 4BDYA 3CQYA 5C0YA 1RGIA 1QQOA 1XQSC 4TSXA 2ASPA 4B3MK 5HRPA 2XY5A 3CJ7A 3OYHA 3SMPA 3AVGA 1VSKA 4IEEA 3SQ4A 4HVJA 4F3OA 3HPHA 1J53A 3Q7CA 1T6CA 1N6QA 3NGIA 1L3UA 5GIPA 3TAEA 2OTLN 2P9NB 3CC2N 3P1GA 1XI1A 4FO0A 4J2DA 1S22A 3AA5X 3FZHA 4PUOA 4OLBA 3T3FA 3I8DA 4NCBA 3OYMA 3DXMA 1RDBA 2JWLA 1K8KA 2ZGYA 4EZ9A 3G10A 3J7ZO 4BREA 4CE9A 3MEDA 3U6FA 3K58A 4PHTX 1YJNN 2F8SA 2F96A 2D0CA 1IO2A 5AQNA 3LM9A 4GV3A 4N76A 3TANA 4WQ4A 5AQLA 3V6DA 3C6AA 1S72N 2HVIA 1NJZA 4CEBA 4QAGA 5FPMA 3WEEA 2NRWA 5AQPA 1TYQA 3IAYA 2QK9A 2O8FA 3NAEA 4YOUA 5I9EB 3M1FA 3V81A 4KI6A 3KWGA 4DLEA 1YJWN 4AHUA 5EOYA 4EAHD 4OPKA 1NJIO 2JLEA 4JI4K 1FW6A 3D2FB 3MDQA 3CI5A 1WSHA 1C0GA 4MDAA 3ZETA 4IKFA 1RILA 4QCLA 4FCYA 1RBSA 2W41A 3PO4A 4DR6K 1QSYA 4KO0A 3C94A 5AQTA 1S9GA 3L3UA 3NF9A 5AQSA 4CF1A 2VWJA 1QVGM 1WOQA 4JI3K 4CFCA 4C8MA 2QWMA 4CK2A 5EVZA 3F73A 3DXMB 5JICA 4CZHA 1A5XA 2OANA 3OA9A 5AFUH 2IVPA 4XEIA 1Z26A 3W0LA 2OA8A 4K0KK 3ATVA 2QA4N 1NOYA 1IBKK 4IO9L 1TKZA 3T19A 1NK6A 1BUPA 4BE2A 2HHWA 1WAFA 5GAEP 4M3YA 3VQ4A 4FWSA 3UB5A 4CEOA 5LJWA 1A5VA 4ISFA 3T7ZA 1VSJA 2ZJPL 5C25A 1VSEA 4HTUA 2FSNA 2Y1JA 1G99A 1T05A 4MDBA 1EX4A 3SBGA 4A2BA 3ZT1A 1KRPA 4K8XA 4BWMA 3QICA 3S5TA 3GDQA 4CIGA 1VQ4N 3IDHA 1GLLO 1QQCA 3ZSRA 5KPZA 4JV5K 1ESVA 2P9IB 3V9SA 4I2QA 3KD1E 1A5WA 1QQNA 4BR7A 5T7BA 4JRQA 3ITHA 1ITGA 4FWPA 1HNXK 3ZSWA 3TTCA 3KK2A 5AQGA 1RT6A 2I7NA 3VF4A 3OS0A 1ASUA 2Q0UA 5JLFA 4OGCA 1JXEA 1I3AA 3CC4N 3CM5A 4H5NA 4G9ZA 2F7TA 4BC2A 3CF5L 3AVJA 4AHTA 4BRHA 4LF6K 1RT2A 4OO1J 2IS3A 1YITN 3VN5A 4F2SA 2W40A 4FOEA 4BE7B 3LPUA 4ELUA 1D4XA 4R79A 4EZ6A 4JD2B 1YF5L 1SUQA 3MCPA 3H1VX 3ID6A 1YAGA 3NCIA 2ZGZA 2VGMA 2HBJA 3ZT2A 2ASMA 4KHYA 2ASOA 3TR8A 3IMXA 3W3DA 4MLEA 4YOVA 4FM2A 1NK4A 1KQSM 2G8WA 4BQLA 2QW9A 4IG3A 3CJCA 4CJ5A 2XY8A 3IFRA 2XY6A 1YVNA 1WNSA 3AVCA 4JI5K 4LH5A 3TSQA 4ILHA 4DQQA 1NGGA 2G8VA 4BWJA 1FJGK 4BRKA 1X1PA 3UKUB 4ILGB 3OYFA 1YUWA 3HYFA 5C15A 2DY4A 1JXBA 4O55A 4BR0A 1NWKA 2Z1JA 1KLNA 2DTUA 1NJYA 1DKGD 3JYTA 3B6PA 4JN4A 3OYKA 4CECA 3TABA 5BRDA 1JCGA 1WBDA 3L8BA 1KCFA 4MQ3A 3RSEB 1TK5A 4PWDA 3VPZA 4B1XB 1IH7A 3CYGA 5MLCQ 4RW8A 3LP2A 4JS5A 4AM7A 1C0UA 1GOAA 2VQEK 1WN7A 5HRNA 2CH5A 5AJ3K 4BE0A 3ZSQA 3V1OA 4BEBA 1JLCA 3D45A 3KK7A 3EZWA 3V1QA 1NGIA 5BPNA 2P9UA 3L6QA 4EHTA 2QM1A 3TPQA 4BRCA 5BR8K 2HHUA 4PA1A 1NKCA 1EWQA 1U6ZA 1OVQA 1VQ8N 4U67L 5LMNK 5HOOA 3ATUA 4RW7A 1Q8IA 3WXKA 3HT3A 3TAGA 4C1NI 2RE2A 3SCXA 3GG4A 4B9MA 2WTUA 1Q81O 4GMJB 3BY5A 5AQFA 3OY9A 1VQ6N 2ZF5O 1Q86O 1HQUA 4QS7A 2FF3B 1K9MO 1SL0A 3F2KA 1RT5A 3E9OA 3E9PA 4CEFA 2V51B 3L4IA 4G1QA 4BR5A 1BG3A 3O8MA 2CGJA 4CHYA 5SZTA 2G8HA 3RRGA 4CBUA 4DB3A 4JK9A 4BC5A 3QO9A 2BUPA 3MEGA 4DSEA 4L8RB 2KTQA 1JLFA 2BE2A 3SAHA 1HKGA 4ZTFA 1R0AA 3O4QA 4DS5A 1SAZA 2XO7A 3LDNA 2D0BA 3DXKB 4OPJA 3HI0A 4DF4A 1Q9YA 4O5FA 3SPZA 2LSNA 5ADXA 1M90O 4CHPA 3OTOK 1LAWA 1RBVA 4EFHA 1BIZA 3HVRA 2FBTA 4PL7A 3E01A 4DTXA 4HCBA 1YTUA 3ZSYA 1R59O 4JHDB 1HPMA 1ZBUA 3CYMA 4H0PA 4CGDA 1RT7A 2YHWA 1U49A 1FK9A 2WONA 4F4KA 3RMCA 4C8NA 4F3TA 3AO1A 1GLDG 1J6ZA 1IKWA 2YX6A 4B3RK 3CG7A 1KSPA 4E7LA 1N5YA 3QLHA 3HP6A 3EYZA 3O4WA 1B9DA 5AQZA 1K6YA 3CCVN 4GVEA 1KFDA 3VQ9A 4UQGA 2DFEA 5AQUA 3K0SA 4EHUA 3WEEB 2PYJA 3RMDA 4Z94A 3VGLA 3GOIA 3C6HA 4AM6A 4DCHA 4GV6A 3IKMA 3L4QA 3QFUA 4IJAA
chains in the Genus database with same CATH topology
4YOXA 2V7YA 2KLAA 5LY3A 1GLBG 1KAYA 1NGAA 3HZ6A 4BC3A 1Z6RA 1JCEA 4L3QA 2QTDA 4BR9A 3VERA 2V52B 4WFAL 1GLEG 1OVYA 4H0OA 4MO5A 3M6GA 1W2BM 1C0FA 3A5LC 3D7EO 2D0OA 4JKGA 4JK7A 4BGBA 3MN5A 4YOYA 2WC9A 2QWOA 4ISGA 3CMAN 3C65A 4BG8A 1NBWA 3B8AX 1NM1A 3HTVA 4IO8A 4YDUA 5H1SQ 1VQ7N 4FPBA 4GV9A 1VQNN 3S41A 3CETA 2GX9A 3CQYA 3R1XA 4CZMA 5C0YA 1RGIA 4U7BA 1QQOA 1XQSC 3PIOL 4BRLA 3OW2M 1P90A 2ASPA 4BC4A 1T6DA 3CJ7A 5JVHL 3HSCA 4H5WA 4AF1A 3SMPA 1VQPN 2NRRA 4IEEA 3CCEN 1YJ9N 2YJEA 1BO5O 3Q7CA 3CJBA 4QS8A 3NVKA 1T6CA 5BRFA 2RHKA 3H1QA 4WFNL 5GIPA 4B1WB 4NB4A 4M7YA 5AZIA 3WXIA 1X3MA 2Q0RA 2VYPA 3KWIA 5BN9A 2OTLN 4XJXA 3VETA 5EY4A 5M1FA 2P9NB 3CC2N 3P4IA 3O9RA 4K42A 4FO0A 4PKGA 5TKWA 4JKDA 5EX5A 4BRGA 4IWVA 1S22A 3R9PA 3EL2A 5F2RA 2VCPA 4O8KA 3FZHA 2FXUA 1ZXOA 5BREA 2GELA 1U2VB 4GY2B 3K9JA 3P38A 3RVCA 4CZKA 3TU5A 1NGCA 3DXMA 3VEVA 2JWLA 1K8KA 2ZGYA 4BRAA 4H0XB 2QEXN 3O80A 3J7ZO 4BREA 1MDUB 4BRFA 3UKRA 4H03B 3D2EA 1LCUA 4FWOA 2QWLA 2FSJA 3SK3A 4PHTX 5JLHA 1YJNN 2AA4A 4WQ5C 3M5RA 5AQNA 3LM9A 4GV3A 3O9QA 3BEXA 1ATRA 1ZC6A 4WQ4A 3VEWA 2ZJRL 5AQLA 2P9LA 3C6AA 3O1WA 3QBWA 1VAZA 5M1QA 1S72N 1ATSA 4FSVA 5AQQA 4CZIA 2QWPA 3CQXA 4C1NK 5FPMA 3WEEA 2NRWA 5AQPA 2HOEA 3E1YA 1NGBA 1TYQA 5ELZA 3O9UA 3FLCO 4B1ZA 3VENA 2QI2A 3U9ZA 4MLHA 3CXCM 3NVMA 4BRIA 1VQKN 3ZEUA 2BH1A 3SMSA 4YOUA 3ZX0A 4KH5A 4I6MB 5I9EB 2CGKA 3LDOA 3K9KA 3FZKA 3M1FA 3MN7A 2GWJA 3KWGA 4KH4A 4WQ4C 2P9PB 1YJWN 5EOYA 4EAHD 4CZEA 1NJIO 3H3NO 3D2FB 1QQMA 3I8BA 2F9TA 1CZAN 3U9DA 4JEPA 3R6MA 4A5BA 3MDQA 3LDPA 2HBLA 3CI5A 2FF6A 1MA9B 1C0GA 1XC3A 1NLVA 2E2NA 3QB0A 4MDAA 3CCJN 3ZETA 3G71N 1NGDA 3UKUA 1WUAA 2W41A 4MO4A 3EE8A 4PKIA 4WCEL 5AQTA 3G4SN 4ILJA 4BVPA 3DJCA 5AQSA 3ZYYX 3MX2A 1HLUA 2BTFA 2QWNA 3G6EN 3ULEA 2E2OA 2PBDA 5AZJB 2J4RA 1QVGM 1WOQA 3LDQA 4DKWA 1DGKN 5KPTA 1X3NA 1E4GT 4YOWA 2V7ZA 1GLCG 4A62A 2QWMA 2P9SA 5BPMA 3P31A 1BU6O 5DM6L 5KPRA 1VQ9N 3MN6A 3CCLN 4J8FA 5EVZA 3ZX3A 3WXMB 1SQKA 2UYTA 3FZLA 3FZMA 2QXLA 3PLAA 3DXMB 5JICA 4CZHA 4QS9A 2OANA 3OA9A 5AFUH 3HOSA 2FSKA 2NRZA 2IVPA 4XEIA 3W0LA 1VQLN 3ATVA 1W97L 2QA4N 4WQ5A 3CCSN 1HUXA 3HRGA 2HSTA 2JWKA 3I33A 4IO9L 3BP8A 4CZLA 5E26A 3VGMA 2A40A 1BUPA 1TUYA 3IUCA 3QBXA 3OBWA 5GAEP 3T69A 4PKHA 3WQUA 3FR0A 4FWNA 4FWSA 3UB5A 5LJWA 4B9QA 2PAVA 4CBWA 4ISFA 1X9JA 5JMVA 4JKGB 3MWPA 3AARA 3T7ZA 3A5NC 2ZJPL 4KH6A 3QDKA 4CD1A 2FSNA 3L0QA 2P9UB 1JCFA 4CBXA 1G99A 3BF3A 4PL8A 1YIJN 5BRHA 4MDBA 1BWFO 3SBGA 4A2BA 1NGFA 3H3OB 4FWMA 5DM7L 3R3LA 3QICA 4BRMA 3G25A 3VEZA 5HL7L 5M1OA 3JXUA 1KXPA 3GDQA 3QMLA 3LDLA 4CZJA 3AGKA 5KQDA 1SS6A 1VQ4N 1NMDA 3IDHA 1GLLO 3MMVA 4OPHA 2YCHA 3I55N 5CE3A 4E1JA 5KPZA 1ESVA 2E2QA 2P9IB 3MWTA 1NGEA 4NLCA 1EO1A 2E88A 4BR2A 3AAPA 1K8KB 1QQNA 4BR7A 3O1BA 2Q31A 4A5AA 5AQOA 4FWPA 5M1NA 4IOAL 2GWKA 1M1KO 2H3GX 3VGKA 2P9PA 4HWIA 3TTCA 1IJJA 3ULEB 5AQGA 2I7NA 3VF4A 4A61A 3CJAA 5LJVA 4RWTA 1VQ5N 2Q0UA 4JKFA 5JLFA 4IZ9A 5AQWA 1DEJA 3O08A 5TKYA 3CC4N 4H5NA 4YORA 4G9ZA 1T3VA 2F7TA 4KBOA 5GIOA 2YHXA 2C1IA 5FPEA 4H5TA 1RDUA 3EKUA 4FL9A 4JKCA 4BR4A 4BC2A 3CF5L 2HBKA 3J8AA 4BRHA 1KAZA 3PIPL 5AZJA 4OO1J 1YITN 4BY9C 2W40A 4BGAA 4FOEA 4BE7B 3SBTA 4H0VB 4WFBL 4HTLA 2FLOA 4DQ8A 4YOTA 2E1YA 3VF6A 3KVGA 3DLLL 1D4XA 5AQJA 4R79A 2AP1A 1YF5L 4JD2B 3SAFA 3WQTA 3BUZB 3CJ9A 3MCPA 3H1VX 3ID6A 2I7PA 1JJ2M 4C23A 1Q18A 1YAGA 3N4QA 4IOXA 3AY9A 2YI1A 2ZGZA 5BR9A 2VGMA 2HBJA 4FWQA 2ASMA 2ASOA 4A59A 3IMXA 3W3DA 4MLEA 4YOVA 1KQSM 4JKEA 1Q82O 4BQLA 3VTHA 2QW9A 3FZFA 3CHWA 3OHRA 5AR0A 3CJCA 3WXLA 3DXKA 1MWKA 1BDGA 3HM8A 3IFRA 1O13A 4ISEA 4JKBA 1YVNA 3QFPA 4CZGA 3UE5A 2F9WA 3TSQA 4ILHA 4GNIA 3DAWA 1NGGA 2NLXA 5C10A 2W00A 2KHOA 4BRKA 3CCRN 3UKUB 3MX5A 4ILGB 4JAXA 5F0XA 1P8ZA 3ENOA 4XH1A 5GAGP 1YUWA 2HBMA 5M1PA 1N8RO 3M3ZA 5C15A 1OKJA 3A5MC 4BR0A 1NWKA 4K41A 2IVNA 2GTDA 4K43A 4BRPA 3ENBA 1DKGD 2P9SB 4B1YB 4JN4A 3FFKB 5BRDA 3TTDA 1VQON 1JCGA 4BRQA 2CGLA 5F1XA 2HF3A 5JVGL 3AGRA 2VWBA 3RSEB 3VEXA 5ADXH 3VPZA 1E4FT 2Q97A 4B1XB 1BA0A 4B1VA 1HJOA 3H46O 3D6RA 5MLCQ 4JKAA 3P39A 5AQYA 3CCQN 1KC8O 1Q7YO 1KD1O 3TSUA 4AM7A 3GBTA 2WBNA 4NLBA 2P9KA 2CH5A 3WXJA 2OTJN 4H5VA 5AQVA 4CZFA 4M63C 3A8YA 4BECA 4IEIA 2IVOA 5C2FA 3EO3A 5EXWA 3U8XA 3VTIA 5KQ8A 5CHIA 4JHDA 5AQMA 3R8EA 4O8UA 4BEBA 2CH6A 2IIRA 4IFEA 2WUSA 4EIAA 4JNEA 4CJ7A 3KK7A 4YDUC 2HF4A 3DWLA 3WUHA 3KHYA 4BRDA 3EZWA 5FPNA 1RFQA 3EN9A 3I56N 1NGIA 3CERA 3Q7BA 1NGHA 5BPNA 2P9UA 4JK8A 3L6QA 4EHTA 1SZ2A 3HOTA 3N4PA 3O6WA 4WYBA 2QM1A 3TPQA 3CD6N 1EQYA 3VOVA 4BRCA 3C7NA 2ZJQL 3A0IX 3AAQA 1YHQN 1QZ5A 1U6ZA 4XH4A 1VQ8N 2YHYA 4U67L 5M1KA 5HOOA 2WFBA 3C0BA 2E2PA 3ATUA 3HBTA 4IJAA 3F5TA 3WXKA 3FGUA 4RCHA 3H45C 4C1NI 2Q2RA 2NRXA 1YXQA 1Y64A 2RE2A 2P9IA 3GG4A 4OPAA 3GL1A 1Q81O 5AQFA 3BF1A 4XH5A 4FWRA 1VQ6N 1HX1A 2ZF5O 1Q86O 2ZWHA 3OBYA 2ITMA 4QS7A 5AZIB 1QVFM 4BQZA 2FF3B 1K9MO 3LM2A 2QWQA 2C1GA 2P9NA 4IDHA 3VF2A 3F2KA 4F9OA 1H1VA 3CC7N 2EWSA 3JS6A 2D4WA 3E9OA 2A3ZA 1TUUA 3E9PA 4FPAA 5BN8A 2V51B 3L4IA 4UY8O 4BR5A 3MK6A 1BG3A 3O8MA 2CGJA 4IXCA 4JD2A 4WF9L 2Q36A 4RTFD 2DPNA 2GUPA 4CBUA 3WT0A 3TTFA 4DB3A 4FWKA 3FE1A 5C12A 4JK9A 1VQMN 4BC5A 2BUPA 1S3XA 4H0TB 1XUPO 5C2DA 3D2EB 2NNWA 3ZX2A 3SAHA 4NO7A 1K8AO 3MN9A 2A42A 4K25A 1MWMA 1HKGA 3VMFB 5B8HA 2GEMA 4BROA 2E20A 2NRHA 1ZBSA 4IJNA 2NRTA 3SAGA 1V4SA 1SAZA 3A5OC 2PFUA 2P9LB 4B1UB 3LDNA 1RDWX 3DXKB 2VGNA 2YJFA 3HI0A 3GE1A 2HMPA 4O5FA 4A2AA 5FPDA 4FVUA 2NZTA 1T44A 1ILYA 5ADXA 4DHYA 2D0PA 1M90O 3F9MA 4IOCL 3NMUA 3LL3A 3CPWM 4Y0WA 1GLAG 3ZEUB 4BVOA 4EFHA 1HKCA 3O9TA 5AQKA 5GADP 3MCAB 2D1KA 2P9KB 3H6EA 1HKBA 3CMEN 4PL7A 3VEYA 4M7XA 4CD3A 3C7NB 1IG8A 5AQRA 3VESA 5AQXA 1NGJA 4FOIA 3EKSA 1R59O 5GINA 4JHDB 4BRNA 1QHAA 1HPMA 3CJ1A 4H0PA 1GLFO 5CR4A 3SLCA 3CCUN 1YI2N 3CPEA 2YHWA 1QZ6A 1TYQB 1GLJO 1KAXA 3CIPA 3O5BA 4JKHA 4BG9A 3VEOA 2E1ZA 2A6AA 2A41A 1BA1A 2QWRA 5BPLA 1V4TA 1GLDG 1J6ZA 5AFUA 4I6MA 2YX6A 3CCMN 5AQIA 3O9SA 2KKZA 4FWLA 1LOTB 3KZBA 4LC9B 3SJHA 5GAHP 3ENHA 3EE9A 3O4WA 5AQZA 1K73O 3CCVN 3D2FA 1Z05A 3E66A 4GVEA 2E8AA 1BOTO 1U2VA 5AQUA 4EHUA 1ATNA 5E84A 3RSEA 1DT9A 4H0YB 3WEEB 3U4LA 3ZETB 2NRVA 3TSPA 4Z94A 2A5XA 4A57A 3VGLA 3UKRB 3GOIA 3C6HA 4H5RA 4AM6A 4DCHA 4GV6A 3IKMA 3L4QA 3ID8A 5AQHA 4CI6A 3E9LA 3QFUA 2Q1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7Y A;  5LY3 A;  1GLB G;  1KAY A;  1NGA A;  3HZ6 A;  4BC3 A;  1Z6R A;  1JCE A;  4L3Q A;  4BR9 A;  3VER A;  2V52 B;  1GLE G;  4H0O A;  4MO5 A;  3M6G A;  1C0F A;  3A5L C;  3D7E O;  2D0O A;  4BGB A;  3MN5 A;  2QWO A;  4ISG A;  4BG8 A;  1NBW A;  3B8A X;  1NM1 A;  3HTV A;  4IO8 A;  4YDU A;  4FPB A;  3S41 A;  3CET A;  3CQY A;  4CZM A;  1RGI A;  1QQO A;  1XQS C;  4BRL A;  2ASP A;  4BC4 A;  1T6D A;  3CJ7 A;  3HSC A;  4H5W A;  3SMP A;  2YJE A;  1BO5 O;  3CJB A;  4QS8 A;  1T6C A;  5BRF A;  3H1Q A;  4B1W B;  4NB4 A;  4M7Y A;  5AZI A;  3WXI A;  1X3M A;  2Q0R A;  2VYP A;  5BN9 A;  3VET A;  5EY4 A;  2P9N B;  3P4I A;  4K42 A;  4FO0 A;  4PKG A;  5EX5 A;  4BRG A;  4IWV A;  1S22 A;  3R9P A;  3EL2 A;  5F2R A;  2VCP A;  4O8K A;  3FZH A;  2FXU A;  1ZXO A;  5BRE A;  2GEL A;  1U2V B;  4GY2 B;  4CZK A;  3TU5 A;  1NGC A;  3DXM A;  3VEV A;  1K8K A;  2ZGY A;  4BRA A;  4H0X B;  3O80 A;  4BRE A;  1MDU B;  4BRF A;  3UKR A;  4H03 B;  3D2E A;  1LCU A;  4FWO A;  2QWL A;  2FSJ A;  3SK3 A;  5JLH A;  2AA4 A;  4WQ5 C;  5AQN A;  3LM9 A;  3BEX A;  1ATR A;  1ZC6 A;  4WQ4 A;  3VEW A;  5AQL A;  2P9L A;  3O1W A;  3QBW A;  1ATS A;  4FSV A;  5AQQ A;  4CZI A;  2QWP A;  3CQX A;  5FPM A;  3WEE A;  5AQP A;  2HOE A;  1NGB A;  1TYQ A;  5ELZ A;  3FLC O;  4B1Z A;  3VEN A;  3U9Z A;  4MLH A;  4BRI A;  3ZEU A;  3SMS A;  3ZX0 A;  4I6M B;  5I9E B;  2CGK A;  3LDO A;  3FZK A;  3M1F A;  3MN7 A;  2GWJ A;  4WQ4 C;  2P9P B;  5EOY A;  4EAH D;  4CZE A;  3H3N O;  3D2F B;  3I8B A;  1QQM A;  2F9T A;  1CZA N;  3U9D A;  3R6M A;  3MDQ A;  3LDP A;  3CI5 A;  2FF6 A;  1MA9 B;  1C0G A;  1XC3 A;  1NLV A;  2E2N A;  3QB0 A;  3ZET A;  1NGD A;  3UKU A;  1WUA A;  2W41 A;  4MO4 A;  4PKI A;  5AQT A;  4BVP A;  3DJC A;  5AQS A;  1HLU A;  2BTF A;  2QWN A;  3ULE A;  2E2O A;  2PBD A;  5AZJ B;  2J4R A;  1WOQ A;  3LDQ A;  1DGK N;  5KPT A;  1X3N A;  1E4G T;  2V7Z A;  1GLC G;  4A62 A;  2QWM A;  2P9S A;  5BPM A;  1BU6 O;  5KPR A;  3MN6 A;  4J8F A;  5EVZ A;  3ZX3 A;  1SQK A;  2UYT A;  3FZL A;  3FZM A;  2QXL A;  3DXM B;  5JIC A;  4CZH A;  4QS9 A;  2OAN A;  5AFU H;  2FSK A;  2IVP A;  4XEI A;  3W0L A;  3ATV A;  4WQ5 A;  1HUX A;  3I33 A;  3BP8 A;  4CZL A;  5E26 A;  3VGM A;  2A40 A;  1BUP A;  1TUY A;  3IUC A;  3QBX A;  4PKH A;  3WQU A;  3FR0 A;  4FWN A;  4FWS A;  3UB5 A;  5LJW A;  4B9Q A;  2PAV A;  4CBW A;  4ISF A;  1X9J A;  5JMV A;  3AAR A;  3A5N C;  4CD1 A;  3QDK A;  2FSN A;  3L0Q A;  2P9U B;  1JCF A;  4CBX A;  1G99 A;  3BF3 A;  4PL8 A;  5BRH A;  1BWF O;  4A2B A;  1NGF A;  3H3O B;  4FWM A;  4BRM A;  3QIC A;  3G25 A;  3VEZ A;  3JXU A;  1KXP A;  3GDQ A;  3QML A;  3LDL A;  4CZJ A;  5KQD A;  1NMD A;  3IDH A;  1GLL O;  3MMV A;  2YCH A;  5CE3 A;  4E1J A;  5KPZ A;  1ESV A;  2E2Q A;  2P9I B;  1NGE A;  2E88 A;  4BR2 A;  3AAP A;  1K8K B;  1QQN A;  4BR7 A;  3O1B A;  2Q31 A;  5AQO A;  4FWP A;  2GWK A;  2H3G X;  3VGK A;  2P9P A;  4HWI A;  1IJJ A;  3ULE B;  5AQG A;  2I7N A;  3VF4 A;  4A61 A;  3CJA A;  5LJV A;  4RWT A;  2Q0U A;  5JLF A;  4IZ9 A;  5AQW A;  1DEJ A;  3O08 A;  5TKY A;  4H5N A;  4KBO A;  2YHX A;  5FPE A;  4H5T A;  3EKU A;  4FL9 A;  4BR4 A;  4BC2 A;  3J8A A;  4BRH A;  1KAZ A;  5AZJ A;  2W40 A;  4BGA A;  4FOE A;  4H0V B;  4HTL A;  2FLO A;  4DQ8 A;  2E1Y A;  3VF6 A;  3KVG A;  1D4X A;  5AQJ A;  2AP1 A;  4JD2 B;  3WQT A;  3BUZ B;  3CJ9 A;  3MCP A;  3H1V X;  2I7P A;  4C23 A;  1Q18 A;  1YAG A;  3AY9 A;  2YI1 A;  2ZGZ A;  5BR9 A;  4FWQ A;  2ASM A;  2ASO A;  3IMX A;  3W3D A;  4MLE A;  4BQL A;  2QW9 A;  3FZF A;  3CHW A;  3OHR A;  5AR0 A;  3CJC A;  3WXL A;  3DXK A;  1MWK A;  1BDG A;  3HM8 A;  3IFR A;  4ISE A;  4CZG A;  1YVN A;  3QFP A;  3UE5 A;  2F9W A;  4GNI A;  3DAW A;  1NGG A;  2NLX A;  2KHO A;  4BRK A;  3UKU B;  4JAX A;  5F0X A;  1P8Z A;  3ENO A;  4XH1 A;  1YUW A;  3M3Z A;  1OKJ A;  3A5M C;  4BR0 A;  1NWK A;  4K41 A;  2IVN A;  2GTD A;  4K43 A;  4BRP A;  1DKG D;  2P9S B;  4B1Y B;  4JN4 A;  3FFK B;  5BRD A;  1JCG A;  4BRQ A;  2CGL A;  5F1X A;  2HF3 A;  2VWB A;  3RSE B;  3VEX A;  5ADX H;  3VPZ A;  1E4F T;  2Q97 A;  4B1X B;  1BA0 A;  4B1V A;  1HJO A;  3H46 O;  5AQY A;  4AM7 A;  3GBT A;  2P9K A;  2CH5 A;  3WXJ A;  4H5V A;  5AQV A;  4CZF A;  4M63 C;  3A8Y A;  2IVO A;  3EO3 A;  5EXW A;  3U8X A;  5KQ8 A;  4JHD A;  5AQM A;  3R8E A;  2CH6 A;  2IIR A;  2WUS A;  4EIA A;  4JNE A;  4CJ7 A;  4YDU C;  2HF4 A;  3DWL A;  3WUH A;  3KHY A;  4BRD A;  3EZW A;  5FPN A;  1RFQ A;  3EN9 A;  1NGI A;  3CER A;  1NGH A;  5BPN A;  2P9U A;  3L6Q A;  4EHT A;  1SZ2 A;  3O6W A;  4WYB A;  2QM1 A;  3TPQ A;  1EQY A;  3VOV A;  4BRC A;  3C7N A;  3A0I X;  3AAQ A;  1QZ5 A;  1U6Z A;  4XH4 A;  2YHY A;  3C0B A;  2E2P A;  3ATU A;  3HBT A;  4IJA A;  3WXK A;  3FGU A;  4RCH A;  3H45 C;  2Q2R A;  1YXQ A;  1Y64 A;  2P9I A;  3GG4 A;  3GL1 A;  5AQF A;  3BF1 A;  4XH5 A;  4FWR A;  1HX1 A;  2ZF5 O;  2ZWH A;  2ITM A;  4QS7 A;  5AZI B;  4BQZ A;  2FF3 B;  3LM2 A;  2QWQ A;  2P9N A;  3VF2 A;  4F9O A;  1H1V A;  2EWS A;  3JS6 A;  2D4W A;  2A3Z A;  1TUU A;  4FPA A;  5BN8 A;  2V51 B;  3L4I A;  4BR5 A;  3MK6 A;  1BG3 A;  3O8M A;  2CGJ A;  4IXC A;  4JD2 A;  2Q36 A;  4RTF D;  2DPN A;  2GUP A;  4CBU A;  3WT0 A;  4DB3 A;  4FWK A;  3FE1 A;  4BC5 A;  2BUP A;  1S3X A;  4H0T B;  1XUP O;  3D2E B;  3ZX2 A;  4NO7 A;  3MN9 A;  2A42 A;  4K25 A;  1MWM A;  1HKG A;  5B8H A;  2GEM A;  4BRO A;  2E20 A;  2NRH A;  1ZBS A;  4IJN A;  1V4S A;  1SAZ A;  3A5O C;  2P9L B;  4B1U B;  3LDN A;  1RDW X;  3DXK B;  2YJF A;  3HI0 A;  3GE1 A;  2HMP A;  4O5F A;  4A2A A;  5FPD A;  2NZT A;  1T44 A;  5ADX A;  4DHY A;  2D0P A;  3F9M A;  3LL3 A;  4Y0W A;  1GLA G;  3ZEU B;  4BVO A;  4EFH A;  1HKC A;  5AQK A;  2D1K A;  2P9K B;  3H6E A;  1HKB A;  4PL7 A;  3VEY A;  4M7X A;  4CD3 A;  3C7N B;  1IG8 A;  5AQR A;  3VES A;  5AQX A;  1NGJ A;  4FOI A;  3EKS A;  1R59 O;  4JHD B;  4BRN A;  1QHA A;  1HPM A;  3CJ1 A;  4H0P A;  1GLF O;  3SLC A;  2YHW A;  1QZ6 A;  1TYQ B;  1GLJ O;  1KAX A;  3CIP A;  3O5B A;  4BG9 A;  3VEO A;  2E1Z A;  2A6A A;  2A41 A;  1BA1 A;  2QWR A;  5BPL A;  1V4T A;  1GLD G;  1J6Z A;  5AFU A;  4I6M A;  5AQI A;  4FWL A;  1LOT B;  3KZB A;  4LC9 B;  3SJH A;  3ENH A;  3O4W A;  5AQZ A;  3D2F A;  1Z05 A;  2E8A A;  1BOT O;  1U2V A;  5AQU A;  4EHU A;  1ATN A;  5E84 A;  3RSE A;  4H0Y B;  3WEE B;  3U4L A;  3ZET B;  4Z94 A;  2A5X A;  3VGL A;  3UKR B;  3GOI A;  4AM6 A;  4H5R A;  4DCH A;  3ID8 A;  5AQH A;  4CI6 A;  3QFU A;  2Q1N A; 
#chains in the Genus database with same CATH topology
 4E7H A;  3KLF A;  2YV0 X;  2KLA A;  2IDO A;  1KAY A;  4IFY A;  4BC3 A;  1D9F A;  4BR9 A;  1C1A A;  1C6V A;  3VER A;  4DTU A;  1SKW A;  4X62 K;  1GLE G;  1OVY A;  1NNE A;  1OH6 A;  2Z1H A;  1JL2 A;  1C0F A;  2D0O A;  4JK7 A;  4YOY A;  4KRF A;  4E7J A;  5J2P A;  4ISG A;  3CMA N;  4FW1 A;  3C6U A;  5H1S Q;  1NM1 A;  1DLO A;  2GX9 A;  4DR5 K;  4CZM A;  4U7B A;  2OPS A;  3PIO L;  4CIF A;  3OW2 M;  2RF2 A;  4CJR A;  4AF1 A;  3VQQ A;  4J2E A;  1RTI A;  4QS8 A;  2UUA K;  1NG9 A;  4NB4 A;  5AZI A;  3WNH A;  4CJK A;  3KWI A;  4LD0 A;  5BN9 A;  2OYQ A;  3V9X A;  2YHA A;  3U3G A;  3VET A;  4XJX A;  3T1A A;  2GV9 A;  4K42 A;  4FJ8 A;  4KFB A;  4CW7 B;  4CJ3 A;  2FXU A;  1XMO K;  1J5O A;  2GEL A;  3P38 A;  4FK0 A;  1NGC A;  5CZ1 A;  3O80 A;  1MDU B;  4Q5V A;  3D2E A;  1LCU A;  4FWO A;  5CYM A;  3SK3 A;  3VQE A;  3V9W A;  1ATR A;  4FYD A;  3AVH A;  2P9L A;  4F8R A;  1ATS A;  5JEN A;  3O4N A;  3VQB A;  4CZI A;  2QWP A;  3CQX A;  2BDP A;  3FLC O;  3U9Z A;  3QNO A;  3SMS A;  4I6M B;  1C0M A;  2CGK A;  3CFP A;  3LDO A;  1C0T A;  4FXD A;  3MN7 A;  4WQ4 C;  4LH4 A;  3CQ8 A;  1RDC A;  4CZE A;  4OX9 K;  3H3N O;  1EET A;  2UU9 K;  2F9T A;  4E7K A;  4C8K A;  4WE1 A;  4KKO A;  3KLH A;  1XC3 A;  3CCJ N;  1NGD A;  4J2A A;  2QKB A;  4FLX A;  4ID5 A;  3SNN A;  4B9L A;  1WUA A;  1IBM K;  2F8T A;  4KB1 A;  4WCE L;  1W7A A;  3ZYY X;  4GW6 A;  3HXM A;  1HLU A;  2BTF A;  5HBM A;  4CJT A;  5FRO A;  2E2O A;  2PBD A;  3HVT A;  1XMQ K;  2J4R A;  1GOC A;  3LDQ A;  3J7Y P;  4DKW A;  1DGK N;  1RBR A;  2V7Z A;  5K14 A;  1GLC G;  4M3Z A;  1VSH A;  5BPM A;  4DFJ A;  3ZCM A;  3MN6 A;  3CCL N;  4DV1 K;  3RWU A;  4K8Z A;  3PLA A;  4Y1C A;  3BGR A;  3HOS A;  1N32 K;  1RCH A;  2FSK A;  2NRZ A;  1VQL N;  2HNZ A;  3MXJ A;  2JWK A;  4W5N A;  3BP8 A;  3VGM A;  3THX B;  1CXU A;  2YKN A;  3S3O A;  2HHH K;  4I9Q A;  3IUC A;  2EX3 A;  1VRT A;  2FBV A;  3OBW A;  3T69 A;  3WQU A;  4M42 A;  3SYZ A;  1NOZ A;  4YHH K;  3AA4 A;  4CD1 A;  1EXQ A;  2WOM A;  1JCF A;  5D3G A;  4FLT A;  3PO5 A;  1JKH A;  1ASW A;  1RBT A;  1NMN A;  3BF3 A;  4Z4G A;  4PL8 A;  4DR2 K;  3EY1 A;  3AVF A;  3ZSV A;  1NGF A;  3H3O B;  5DM7 L;  3R3L A;  3G25 A;  3QET A;  4JI2 K;  4FK4 A;  3JXU A;  1EP4 A;  4FLW A;  4M3T A;  3LDL A;  4JYA K;  3K5O A;  4OPH A;  4DTR A;  3ULD A;  4NLC A;  1EO1 A;  2E88 A;  4LF4 K;  4HHT A;  4EP4 A;  1KFS A;  3HPO A;  5J2M A;  2H3G X;  1S1T A;  4IFV A;  1NJX A;  2E5L K;  3VA3 A;  4OKJ A;  4RW9 A;  4CF2 A;  4LFB K;  1VQ5 N;  4DR7 K;  3QNN A;  4DTM A;  5TKY A;  5FRN A;  1Y97 A;  5GIO A;  4KBO A;  1D5A A;  2YHX A;  5FPE A;  4BR4 A;  2GBZ A;  4FJX A;  2YNI A;  2HBK A;  3J8A A;  2XHB A;  1OH8 A;  4KRE A;  3ZSO A;  3PIP L;  4BY9 C;  4BGA A;  3QEX A;  1VHX A;  3VF6 A;  3L2R A;  2VG7 A;  4FM0 A;  3L2W A;  5AQJ A;  3O3H A;  2AP1 A;  3SAF A;  1IG9 A;  4H8K A;  3CJ9 A;  4M45 A;  2OCE A;  4Z0U A;  1Q18 A;  3N4Q A;  4IOX A;  1TKT A;  1J54 A;  3ALY A;  4CJV A;  4DLG A;  2YI1 A;  1VSL A;  4LY7 A;  2O4I A;  3NF8 A;  4CHQ A;  4X66 K;  3THY B;  3VTH A;  4C8L A;  3K57 A;  4PY5 A;  1G15 A;  3CHW A;  5AR0 A;  3T1H K;  3IRX A;  1MWK A;  1RBU A;  4CZG A;  4JKB A;  2O8E A;  3F9K A;  2RPI A;  4JI6 K;  5HRO A;  2G8K A;  2NLX A;  4JLH A;  4KHQ A;  4DUY K;  1JLA A;  4JAX A;  4Z4I A;  4DSF A;  2G8U A;  1OH5 A;  2KZM A;  1U48 A;  3M3Z A;  3A5M C;  1CZB A;  1O1W A;  4K41 A;  1BGX T;  3ENB A;  3NDK A;  2P9S B;  4B9S A;  4B1Y B;  4R5P A;  4FZY A;  4BRQ A;  2KW4 A;  3ASM A;  3VEX A;  5ADX H;  1U45 A;  3PX4 A;  1HJO A;  3H46 O;  4DV3 K;  4JKA A;  3P39 A;  1IKX A;  5AQY A;  1KC8 O;  1KD1 O;  2WBN A;  3WXJ A;  1UA1 A;  3J7A P;  3PY8 A;  4JS4 A;  1NU0 A;  4M63 C;  5DMR A;  4BEC A;  2IVO A;  5EXW A;  3VTI A;  5KQ8 A;  4JHD A;  4O8U A;  1WB9 A;  4DV6 K;  3QEI A;  3QEP A;  2KZZ A;  1W0H A;  1RFQ A;  3EN9 A;  4KHW A;  4CJL A;  2XY7 A;  4JK8 A;  4DF8 A;  4WYB A;  1TKX A;  3SJJ A;  1ZBI A;  1N36 K;  2HMI A;  5DK5 A;  1QZ5 A;  4XH4 A;  3WNF A;  2YHY A;  1CLQ A;  2QKK A;  4KI4 A;  3HBT A;  1RTD A;  3F5T A;  3FGU A;  4DTS A;  1YXQ A;  1Y64 A;  4OPA A;  3BF1 A;  4XH5 A;  4DR4 K;  1HX1 A;  2I5J A;  4BQZ A;  3VQD A;  3LM2 A;  3NF6 A;  2QWQ A;  3QER A;  2C1G A;  2P9N A;  2YNG A;  3AVN A;  4FJ7 A;  4FK2 A;  5IWA K;  2O8B B;  2NUB A;  3LP3 A;  4DSJ A;  1EWR A;  3MK6 A;  4B3T K;  4RTF D;  4LSN A;  1SV5 A;  2OPR A;  2GUP A;  3TTF A;  4CED A;  1LW0 A;  3FE1 A;  4CGH A;  5C12 A;  2BGG A;  5C2D A;  2YNF A;  4FJL A;  3NF7 A;  4NO7 A;  4AHS A;  3MN9 A;  5EU7 A;  1K8A O;  4K25 A;  5B8H A;  2GEM A;  4YY3 K;  3JSM A;  2E20 A;  2NRH A;  1WAJ A;  2OZM A;  3A5O C;  1LWE A;  3KKR A;  3A2F A;  4CK3 A;  1RDW X;  3HST B;  2VGN A;  1UAX A;  2HNY A;  3GE1 A;  5FPD A;  1ZBF A;  2NZT A;  3NFA A;  3F9M A;  4BVO A;  2FC0 A;  5AQK A;  3TI0 A;  4V19 S;  2UXB K;  4FJ5 A;  1IG8 A;  4AH9 A;  4BDP A;  4FM1 A;  1NK5 A;  1QHA A;  3DMJ A;  1GLF O;  2KQ2 A;  3SLC A;  4FJI A;  1TYQ B;  1GLJ O;  1KAX A;  2E6L A;  4BG9 A;  4CF9 A;  1HYS A;  2A41 A;  1BA1 A;  3BZC A;  2IGI A;  1SL1 A;  3DLR A;  4DSI A;  4OGE A;  4KV8 A;  5A2Q O;  1BCM A;  3CCM N;  4FWL A;  4I7F A;  3L3V A;  1U4B A;  1ZBL A;  1Z25 A;  3ENH A;  1U04 A;  3EE9 A;  3D2F A;  4CJU A;  1Z05 A;  1RT3 A;  5KTQ A;  2E8A A;  1U2V A;  2IC3 A;  1ATN A;  3RTV A;  4H0Y B;  3U4L A;  3ZET B;  3TSP A;  4DTN A;  3E9L A;  2W42 A;  3OYL A;  4B9U A;  4O44 A;  4O5B A;  1JCE A;  1XC9 A;  1WSG A;  4WFA L;  3M6G A;  1E3M A;  3D7E O;  3MN5 A;  1QTM A;  1NK9 A;  4DU4 A;  1BQN A;  4YDU A;  1VQ7 N;  4GV9 A;  5CY4 A;  3S41 A;  2KFN A;  3AVM A;  1IKY A;  1P90 A;  3OYC A;  5J2Q A;  1T6D A;  3HSC A;  4H5W A;  1T8E A;  2YJE A;  3D0P A;  2RHK A;  4FW2 A;  4B1W B;  4DUZ K;  4M7Y A;  3OYI A;  4OLA A;  3WXI A;  1X3M A;  2Q0R A;  4NXM K;  4CF8 A;  4ZHR A;  3M8R A;  4DTJ A;  4C8O A;  5EY4 A;  5M1F A;  3O9R A;  5TKW A;  3S9H A;  5EX5 A;  3O3G A;  1S1V A;  3EL2 A;  5F2R A;  2VCP A;  1FXX A;  1ZXO A;  1XHZ A;  1KLM A;  5BRE A;  1U2V B;  3SI6 A;  3K9J A;  1QE1 A;  3RVC A;  4YFU A;  3TU5 A;  3VEV A;  3ZSZ A;  4BRA A;  2QEX N;  3HJF A;  3ZSX A;  1RT1 A;  3OYN A;  3TAM A;  2FSJ A;  4FLZ A;  4WQ5 C;  3M5R A;  3O9Q A;  3VEW A;  2O8D B;  3O1W A;  1TK0 A;  1VAZ A;  5KRS A;  5AQQ A;  4C1N K;  2HOE A;  3E1Y A;  1NGB A;  1U47 A;  5ELZ A;  1RTJ A;  3O9U A;  4B1Z A;  2QI2 A;  3CXC M;  1VQK N;  1TVR A;  3NVM A;  4BRI A;  3ZEU A;  2BH1 A;  4KH5 A;  3THV A;  2X6S A;  3FZK A;  2GWJ A;  3L2V A;  4KH4 A;  2W6L A;  3C95 A;  4E7I A;  4M41 A;  2Z1G A;  1QQM A;  3AVL A;  3I8B A;  2F4V K;  1CZA N;  4JEP A;  3R6M A;  1BI4 A;  4JI0 K;  4B9N A;  2HBL A;  2YHB A;  2FF6 A;  1MA9 B;  4FLV A;  1XHX A;  1NLV A;  2E2N A;  3QB0 A;  1I39 A;  2KFZ A;  3UKU A;  3SQ0 A;  4MO4 A;  4PKI A;  4ILJ A;  4BVP A;  3MX2 A;  1N34 K;  2QWN A;  3G6E N;  1WLJ A;  3NHG A;  3ULE A;  4LF9 K;  2YKM A;  1CZ9 A;  1E4G T;  1X3N A;  3P31 A;  1DTT A;  1VQ9 N;  5I3U A;  4J8F A;  3ZX3 A;  3THW B;  1SQK A;  2B4J A;  3LAL A;  2UYT A;  3FZL A;  3FZM A;  3AVB A;  3O3F A;  3IS9 A;  4E72 A;  2EHG A;  1S6Q A;  3SUQ A;  4B8A B;  4WQ5 A;  3CCS N;  1HUX A;  2QXF A;  3M8Q A;  2HST A;  3I33 A;  3THY A;  4CZL A;  4ICL A;  5E26 A;  3M8S A;  3HM9 A;  4DR3 K;  4OVL A;  4PKH A;  4CVN E;  4W5R A;  4IG0 A;  5I42 A;  4CBW A;  4NXN K;  5HLF A;  4JKG B;  3MWP A;  3AAR A;  4JI1 K;  4KH6 A;  3QDK A;  2P9U B;  4CBX A;  1ZYQ A;  1S6P A;  4KHN A;  1BWF O;  5FLX O;  4W5O A;  4BRM A;  3VEZ A;  5HL7 L;  1KXP A;  4DSL A;  5JS1 A;  3AGK A;  1TAU A;  3I55 N;  5CE3 A;  4ELT A;  1L5U A;  2UUB K;  3K59 A;  4M3X A;  1NGE A;  1OH7 A;  4BR2 A;  1K8K B;  3NBP A;  1MU2 A;  3HP9 A;  3O1B A;  2Q31 A;  4A5A A;  3T1Y K;  5M1N A;  2GWK A;  1M1K O;  4AIL C;  2P9P A;  4HWI A;  1C1B A;  1UWB A;  3ULE B;  3KLE A;  3QES A;  3OS2 A;  4B08 A;  2P5G A;  4A61 A;  3CJA A;  1YT3 A;  5LJV A;  3OS1 A;  4JKF A;  4IZ9 A;  5AQW A;  1DEJ A;  3O08 A;  1WSI A;  5J1E A;  4YOR A;  2C1I A;  4I2P A;  1JL1 A;  4H5T A;  4FL9 A;  4FJ9 A;  1C1C A;  4JKC A;  4FLY A;  5HRS A;  3AO3 A;  4FZZ A;  1KAZ A;  3OJU A;  4O0I A;  3KKS A;  3ISN C;  4M3U A;  4Z4E A;  5AZJ A;  3CFR A;  4W5T A;  3MAQ A;  4CGG A;  3SBT A;  4H0V B;  5LMU K;  3B6O A;  4YOT A;  2E1Y A;  4X65 K;  4B3S K;  2Q3S A;  3DLL L;  3EZ5 A;  3AO5 A;  3WQT A;  4BDZ A;  1TK8 A;  3OYE A;  1NK0 A;  2I7P A;  3VQ6 A;  2ATQ A;  1CXQ A;  2X78 A;  1QS4 A;  3LAM A;  2A1R A;  4FWQ A;  1JLE A;  1WSE A;  3SZ2 A;  4JKE A;  3V4I A;  1Q82 O;  3K5N A;  4DQI A;  5FRM A;  3DXK A;  4CGI A;  4DTP A;  1BDG A;  3HM8 A;  3RR7 A;  1O13 A;  4AQY K;  2HW3 A;  4DSK A;  2F9W A;  3TAF A;  2W00 A;  2KHO A;  1HYZ A;  3CCR N;  3KK3 A;  5F0X A;  2E4L A;  5GAG P;  1S5J A;  2HBM A;  5M1P A;  1N8R O;  1SL2 A;  4IBN A;  4CJ4 A;  1BCO A;  2IVN A;  2GTD A;  4E89 A;  3SUN A;  2HHV A;  1YVU A;  1HQE A;  2RKI A;  3FFK B;  3KLI A;  5KGX A;  1VQO N;  1HNV A;  2CGL A;  1HJR A;  5F1X A;  2HF3 A;  1YTA A;  3V9U A;  1S1W A;  4CGJ A;  1BA0 A;  3RMB A;  5CZ2 A;  3VQC A;  3D6R A;  3V9Z A;  3CM6 A;  1D9D A;  2X74 A;  3GBT A;  1NKE A;  2OTJ N;  1XWL A;  5AQV A;  4CZF A;  5KRT A;  3A8Y A;  5C2F A;  1BHL A;  5CHI A;  1QSS A;  5AQM A;  3R8E A;  4CCH A;  2CH6 A;  4IFE A;  2WUS A;  5C24 A;  4JNE A;  1TL1 A;  4YDU C;  2HF4 A;  2ETJ A;  4KTW A;  3KHY A;  4BRD A;  5FPN A;  3I56 N;  3CER A;  1ASV A;  3Q7B A;  3VQ5 A;  1T7P A;  3RR8 A;  1HMV A;  4DQP A;  3NH1 A;  1EQY A;  3VOV A;  2VG6 A;  2HHS A;  3C7N A;  3K5L A;  2ZJQ L;  3A0I X;  3AV9 A;  2G8F A;  3KLG A;  4FJG A;  4N56 A;  2BAN A;  3KIO A;  2WFB A;  2OZS A;  4ZTJ A;  2E2P A;  2B6A A;  3H45 C;  4OKK A;  2Q2R A;  2P9I A;  3GL1 A;  4FJM A;  4FWR A;  4BE1 A;  2ZWH A;  3OBY A;  2ITM A;  3IG1 A;  5AZI B;  3BZK A;  3S3N A;  3SQ2 A;  1H1V A;  2EWS A;  3AA3 A;  1T03 A;  4KTZ A;  1TUU A;  5SWM A;  4UY8 O;  4CEE A;  4IXC A;  4JD2 A;  2Q36 A;  3LP1 A;  2HHI A;  1VQM N;  2DFH A;  1XUP O;  3C6T A;  3D2E B;  3ZT4 A;  3L2U A;  2UXD K;  2A42 A;  3KJV A;  1FKO A;  4BRO A;  1ZBS A;  4IJN A;  2NRT A;  3SAG A;  1V4S A;  2P9L B;  4DV4 K;  4DV5 K;  4OJR A;  2HHX A;  4A2A A;  2A1S A;  4FVU A;  3OYJ A;  1ILY A;  4YNQ A;  4DHY A;  3CPW M;  4Y0W A;  1WSF A;  1HKC A;  3ZLJ A;  2D1K A;  2P9K B;  3H6E A;  1HKB A;  1JLG A;  3CME N;  4CD3 A;  4M7X A;  3C7N B;  4LFC K;  1NGJ A;  4FOI A;  3EKS A;  5GIN A;  4BRN A;  5CYQ A;  3CJ1 A;  5CR4 A;  3CCU N;  4FJN A;  1YI2 N;  3CPE A;  1BL3 A;  4CFB A;  3NGZ A;  4DMN A;  3G0Z A;  4Z4C A;  2ZQB A;  4I6M A;  3LPT A;  2D5R A;  3MXM A;  5AQI A;  3O9S A;  4Z4H A;  2KKZ A;  3QIP A;  1LOT B;  3KZB A;  3SJH A;  3PSF A;  5HP1 A;  1K73 O;  3E66 A;  1X9W A;  4CEA A;  1TGO A;  5E84 A;  3RSE A;  3TAQ A;  4IDK A;  2NRV A;  3NH2 A;  3UKR B;  3KD5 E;  4E0D A;  3ID8 A;  4AHR A;  4CI6 A;  2P1J A;  4YOX A;  3DI6 A;  2V7Y A;  5LY3 A;  1GLB G;  2G8I A;  3CFO A;  1Z6R A;  3TAR A;  3THX A;  2V52 B;  4H0O A;  3OYB A;  1W2B M;  3A5L C;  4RW4 A;  4DS4 A;  1X9S A;  2QWO A;  3MEC A;  3C65 A;  4BG8 A;  1VQN N;  3CET A;  4BAC A;  3R1X A;  4LF7 K;  3SPY A;  2ITG A;  1HNI A;  1RDD A;  4BRL A;  5J2N A;  1DTQ A;  4BC4 A;  5JVH L;  1VQP N;  2NRR A;  3U3Y A;  1YJ9 N;  3CCE N;  4CJE A;  3AVK A;  3THW A;  3NH0 A;  1BO5 O;  3CJB A;  1VK0 A;  3NVK A;  5BRF A;  1VSI A;  3DRR A;  3H1Q A;  4WFN L;  1UA0 A;  4DQR A;  4KPY A;  2UXC K;  2VYP A;  1XNR K;  4CER A;  4CGF A;  2VWK A;  3J81 O;  3P4I A;  3M8P A;  1F21 A;  4O0J A;  4PKG A;  3DLH A;  1S1U A;  1HR0 K;  4JKD A;  4BRG A;  4IWV A;  3R9P A;  2VG5 A;  4O8K A;  1KTQ A;  4GY2 B;  4CZK A;  4PQU A;  2OPQ A;  2XRI A;  4ID1 A;  4H0X B;  3L2Q A;  4BRF A;  1REV A;  3UKR A;  4H03 B;  2GUI A;  2QWL A;  5JLH A;  2AA4 A;  1HYV A;  3JAM O;  4HCC A;  2HND A;  3BEX A;  4DG1 A;  1ZC6 A;  2ZJR L;  3QBW A;  5M1Q A;  2IAJ A;  4FSV A;  2RN2 A;  1HRH A;  4CES A;  1L3T A;  3LAN A;  4J2B A;  1B9F A;  2FBY A;  2O4G A;  3LZJ A;  3VEN A;  4MLH A;  1S1X A;  3HL8 A;  4AHV A;  3ZX0 A;  2HHQ A;  1J5E K;  3K9K A;  4DR1 K;  1N33 K;  1BIS A;  1IV0 A;  2P9P B;  3PUF A;  2R7Y A;  3VQP A;  3RMA A;  1UOC A;  3U9D A;  4A5B A;  3LDP A;  3MXI A;  3AVA A;  3DOK A;  4X64 K;  3G71 N;  3TWH A;  4DTO A;  3TAP A;  3EE8 A;  3G4S N;  3DJC A;  3FFI A;  2PYL A;  5AZJ B;  2AJQ A;  4M3R A;  5KPT A;  1HNW K;  4YOW A;  4A62 A;  2P9S A;  2O8E B;  1BU6 O;  5DM6 L;  5KPR A;  2E6M A;  1BQM A;  4B9V A;  3WXM B;  4CJQ A;  3DOL A;  2QXL A;  4CEQ A;  4LF8 K;  4QS9 A;  3LZI A;  1JLB A;  1W97 L;  4N41 A;  4CHN A;  3SV3 A;  3HRG A;  4KHS A;  3PV8 A;  2A40 A;  4FJJ A;  1TUY A;  2ZE2 A;  3VQ7 A;  3QBX A;  4JRP A;  3FR0 A;  4FWN A;  3I0R A;  4B9Q A;  4FLU A;  2PAV A;  4DFM A;  1X9J A;  5JMV A;  3A5N C;  4GVM A;  3L0Q A;  4CHZ A;  4DU1 A;  1YIJ N;  1JLQ A;  5BRH A;  1QHT A;  4FWM A;  4RW6 A;  3LWL A;  2Z1I A;  5M1O A;  2HHT A;  3QML A;  4CZJ A;  5KQD A;  1RTH A;  3KTQ A;  1SS6 A;  1NMD A;  3PX6 A;  3MMV A;  2YCH A;  1KVB A;  3VQA A;  4E1J A;  3BDP A;  4Q0B A;  2E2Q A;  3MWT A;  3AVI A;  3HPG A;  3AAP A;  1D8Y A;  4E1M A;  3SUO A;  5AQO A;  4IOA L;  4HUG A;  4CFA A;  3VGK A;  4DV7 K;  1IJJ A;  4N5S A;  4E1N A;  4CHO A;  4RWT A;  4KB0 A;  3WNE A;  1T3V A;  3LDS A;  1QSL A;  3DYA A;  1RDU A;  3EKU A;  3SV4 A;  2FBX A;  5C42 A;  1I94 K;  3LWM A;  3SQ1 A;  4JI7 K;  1B92 A;  3S3M A;  4LFA K;  2O8B A;  4WFB L;  4HTL A;  4DQS A;  3QIO A;  2FLO A;  4DQ8 A;  4F2R A;  3KVG A;  3ZT0 A;  4HUF A;  4H4M A;  3KK1 A;  3BUZ B;  1RDA A;  1JJ2 M;  4C23 A;  4FZX C;  3K5M A;  4CFD A;  3AY9 A;  5BR9 A;  3HK2 A;  4A59 A;  1NKB A;  4GKK K;  3DM2 A;  3FZF A;  3WXL A;  3OHR A;  4CJP A;  4ISE A;  4RG8 A;  5JS2 A;  3QFP A;  4KAZ A;  3UE5 A;  2IOC A;  4GNI A;  1BIU A;  3DAW A;  1L3S A;  3OYG A;  5C10 A;  1RT4 A;  3MX5 A;  1P8Z A;  3ENO A;  4XH1 A;  4Z4F A;  2JGU A;  4CIE A;  1OKJ A;  1IBL K;  2O8C A;  2UUC K;  2ZD1 A;  4K43 A;  4BRP A;  4CJF A;  3OJS A;  3TTD A;  4AHC A;  5JVG L;  3AGR A;  4MFB A;  2VWB A;  2P5O A;  1E4F T;  2Q97 A;  4B1V A;  2X6N A;  3CCQ N;  4NYN A;  1J9A A;  1TAQ A;  3VQ8 A;  1Q7Y O;  3MEE A;  3TSU A;  3NGY A;  4NLB A;  2P9K A;  3QIN A;  4H5V A;  3LAK A;  4N47 A;  3ZT3 A;  4IEI A;  3EO3 A;  3U8X A;  1HPZ A;  4KTQ A;  2IIR A;  4NCG A;  2YNH A;  4EIA A;  4CJ7 A;  1LW2 A;  4FVM A;  1VSM A;  4CF0 A;  1LAV A;  3DWL A;  3WUH A;  1NK7 A;  1NGH A;  3VA0 A;  5HRR A;  1SZ2 A;  2P51 A;  3HOT A;  3N4P A;  3O6W A;  3P83 D;  2VQF K;  3CD6 N;  3DLE A;  4I9L A;  4CK1 A;  3AAQ A;  1YHQ N;  4KHP K;  5M1K A;  3C0B A;  4E19 A;  1WSJ A;  4RCH A;  4FJH A;  1KVC A;  1TKD A;  2B5J A;  2NRX A;  1L3V A;  4JI8 K;  3SUP A;  3LP0 A;  3WNG A;  1EKE A;  1FKP A;  1QVF M;  2ZM6 K;  4Y1D A;  4EP5 A;  4IDH A;  3VF2 A;  4F9O A;  1NK8 A;  3CC7 N;  3I0S A;  1GOB A;  3JS6 A;  2O8C B;  2D4W A;  2A3Z A;  4FPA A;  3NE6 A;  5BN8 A;  1LWC A;  4DU3 A;  4DWI A;  4DFK A;  2OPP A;  4WF9 L;  1X9M A;  2DPN A;  3OYD A;  3K2P A;  3WT0 A;  4FWK A;  3AO2 A;  1S3X A;  4H0T B;  5FDL A;  2NNW A;  3ZX2 A;  5LL6 Z;  4B9T A;  5E41 A;  1MWM A;  3VMF B;  3DRS A;  4W5Q A;  1NJW A;  2PFU A;  3P5J A;  2O8D A;  4B1U B;  3H08 A;  4GKJ K;  3DRP A;  4HUE A;  2YJF A;  4KHU A;  2HMP A;  4FJK A;  1T44 A;  1S9E A;  2D0P A;  4H4O A;  4QOZ B;  4IOC L;  3NMU A;  3LL3 A;  2PZS A;  2D0A A;  3AO4 A;  1GLA G;  3ZEU B;  3O9T A;  5GAD P;  3OVN A;  1KVA A;  3MCA B;  1ZBH A;  3VEY A;  5AQR A;  3VES A;  5AQX A;  4B3O A;  1Q9X A;  3QEW A;  4OKE A;  1HNZ K;  4CEZ A;  3DLK A;  4E3S A;  1QZ6 A;  3O5B A;  3CIP A;  1TL3 A;  4JKH A;  3VEO A;  2E1Z A;  2A6A A;  5BPL A;  2QWR A;  2PY5 A;  1V4T A;  1SKR A;  2Y1I A;  5AFU A;  3DLB A;  1W9H A;  2HB5 A;  4LC9 B;  5GAH P;  4DV0 K;  3HO1 A;  4O4G A;  3AA2 A;  1SKS A;  3UIQ A;  5KGW A;  3J80 O;  3RRH A;  1BI4 B;  4XIU A;  1BOT O;  3PX0 A;  1DT9 A;  1VSD A;  2A5X A;  4A57 A;  1VRU A;  4H5R A;  5AQH A;  3EEQ A;  3V1R A;  1XNQ K;  2Q1N A;  3QEV A;  4NCA A;  1RNH A;  4LF5 K;  4CJS A;  1NGA A;  3HZ6 A;  3PSI A;  1LWF A;  2W6K A;  2HVH A;  4L3Q A;  5IT9 O;  2QTD A;  4CJW A;  3OYA A;  1WBB A;  1VSF A;  1IKV A;  2DFF A;  1LV5 A;  4MO5 A;  4ELV A;  4M3W A;  4JKG A;  4DFP A;  2O8F B;  4BGB A;  1TV6 A;  4NYF A;  2WC9 A;  5KI6 A;  1NBW A;  3B8A X;  3HTV A;  3DLG A;  4IO8 A;  4LSL A;  4DV2 K;  4FPB A;  4B8C A;  4BDY A;  3CQY A;  5C0Y A;  1RGI A;  1QQO A;  1XQS C;  4TSX A;  2ASP A;  4B3M K;  5HRP A;  2XY5 A;  3CJ7 A;  3OYH A;  3SMP A;  3AVG A;  1VSK A;  4IEE A;  3SQ4 A;  4HVJ A;  4F3O A;  3HPH A;  1J53 A;  3Q7C A;  1T6C A;  1N6Q A;  3NGI A;  1L3U A;  5GIP A;  3TAE A;  2OTL N;  2P9N B;  3CC2 N;  3P1G A;  1XI1 A;  4FO0 A;  4J2D A;  1S22 A;  3AA5 X;  3FZH A;  4PUO A;  4OLB A;  3T3F A;  3I8D A;  4NCB A;  3OYM A;  3DXM A;  1RDB A;  2JWL A;  1K8K A;  2ZGY A;  4EZ9 A;  3G10 A;  3J7Z O;  4BRE A;  4CE9 A;  3MED A;  3U6F A;  3K58 A;  4PHT X;  1YJN N;  2F8S A;  2F96 A;  2D0C A;  1IO2 A;  5AQN A;  3LM9 A;  4GV3 A;  4N76 A;  3TAN A;  4WQ4 A;  5AQL A;  3V6D A;  3C6A A;  1S72 N;  2HVI A;  1NJZ A;  4CEB A;  4QAG A;  5FPM A;  3WEE A;  2NRW A;  5AQP A;  1TYQ A;  3IAY A;  2QK9 A;  2O8F A;  3NAE A;  4YOU A;  5I9E B;  3M1F A;  3V81 A;  4KI6 A;  3KWG A;  4DLE A;  1YJW N;  4AHU A;  5EOY A;  4EAH D;  4OPK A;  1NJI O;  2JLE A;  4JI4 K;  1FW6 A;  3D2F B;  3MDQ A;  3CI5 A;  1WSH A;  1C0G A;  4MDA A;  3ZET A;  4IKF A;  1RIL A;  4QCL A;  4FCY A;  1RBS A;  2W41 A;  3PO4 A;  4DR6 K;  1QSY A;  4KO0 A;  3C94 A;  5AQT A;  1S9G A;  3L3U A;  3NF9 A;  5AQS A;  4CF1 A;  2VWJ A;  1QVG M;  1WOQ A;  4JI3 K;  4CFC A;  4C8M A;  2QWM A;  4CK2 A;  5EVZ A;  3F73 A;  3DXM B;  5JIC A;  4CZH A;  1A5X A;  2OAN A;  3OA9 A;  5AFU H;  2IVP A;  4XEI A;  1Z26 A;  3W0L A;  2OA8 A;  4K0K K;  3ATV A;  2QA4 N;  1NOY A;  1IBK K;  4IO9 L;  1TKZ A;  3T19 A;  1NK6 A;  1BUP A;  4BE2 A;  2HHW A;  1WAF A;  5GAE P;  4M3Y A;  3VQ4 A;  4FWS A;  3UB5 A;  4CEO A;  5LJW A;  1A5V A;  4ISF A;  3T7Z A;  1VSJ A;  2ZJP L;  5C25 A;  1VSE A;  4HTU A;  2FSN A;  2Y1J A;  1G99 A;  1T05 A;  4MDB A;  1EX4 A;  3SBG A;  4A2B A;  3ZT1 A;  1KRP A;  4K8X A;  4BWM A;  3QIC A;  3S5T A;  3GDQ A;  4CIG A;  1VQ4 N;  3IDH A;  1GLL O;  1QQC A;  3ZSR A;  5KPZ A;  4JV5 K;  1ESV A;  2P9I B;  3V9S A;  4I2Q A;  3KD1 E;  1A5W A;  1QQN A;  4BR7 A;  5T7B A;  4JRQ A;  3ITH A;  1ITG A;  4FWP A;  1HNX K;  3ZSW A;  3TTC A;  3KK2 A;  5AQG A;  1RT6 A;  2I7N A;  3VF4 A;  3OS0 A;  1ASU A;  2Q0U A;  5JLF A;  4OGC A;  1JXE A;  1I3A A;  3CC4 N;  3CM5 A;  4H5N A;  4G9Z A;  2F7T A;  4BC2 A;  3CF5 L;  3AVJ A;  4AHT A;  4BRH A;  4LF6 K;  1RT2 A;  4OO1 J;  2IS3 A;  1YIT N;  3VN5 A;  4F2S A;  2W40 A;  4FOE A;  4BE7 B;  3LPU A;  4ELU A;  1D4X A;  4R79 A;  4EZ6 A;  4JD2 B;  1YF5 L;  1SUQ A;  3MCP A;  3H1V X;  3ID6 A;  1YAG A;  3NCI A;  2ZGZ A;  2VGM A;  2HBJ A;  3ZT2 A;  2ASM A;  4KHY A;  2ASO A;  3TR8 A;  3IMX A;  3W3D A;  4MLE A;  4YOV A;  4FM2 A;  1NK4 A;  1KQS M;  2G8W A;  4BQL A;  2QW9 A;  4IG3 A;  3CJC A;  4CJ5 A;  2XY8 A;  3IFR A;  2XY6 A;  1YVN A;  1WNS A;  3AVC A;  4JI5 K;  4LH5 A;  3TSQ A;  4ILH A;  4DQQ A;  1NGG A;  2G8V A;  4BWJ A;  1FJG K;  4BRK A;  1X1P A;  3UKU B;  4ILG B;  3OYF A;  1YUW A;  3HYF A;  5C15 A;  2DY4 A;  1JXB A;  4O55 A;  4BR0 A;  1NWK A;  2Z1J A;  1KLN A;  2DTU A;  1NJY A;  1DKG D;  3JYT A;  3B6P A;  4JN4 A;  3OYK A;  4CEC A;  3TAB A;  5BRD A;  1JCG A;  1WBD A;  3L8B A;  1KCF A;  4MQ3 A;  3RSE B;  1TK5 A;  4PWD A;  3VPZ A;  4B1X B;  1IH7 A;  3CYG A;  5MLC Q;  4RW8 A;  3LP2 A;  4JS5 A;  4AM7 A;  1C0U A;  1GOA A;  2VQE K;  1WN7 A;  5HRN A;  2CH5 A;  5AJ3 K;  4BE0 A;  3ZSQ A;  3V1O A;  4BEB A;  1JLC A;  3D45 A;  3KK7 A;  3EZW A;  3V1Q A;  1NGI A;  5BPN A;  2P9U A;  3L6Q A;  4EHT A;  2QM1 A;  3TPQ A;  4BRC A;  5BR8 K;  2HHU A;  4PA1 A;  1NKC A;  1EWQ A;  1U6Z A;  1OVQ A;  1VQ8 N;  4U67 L;  5LMN K;  5HOO A;  3ATU A;  4RW7 A;  1Q8I A;  3WXK A;  3HT3 A;  3TAG A;  4C1N I;  2RE2 A;  3SCX A;  3GG4 A;  4B9M A;  2WTU A;  1Q81 O;  4GMJ B;  3BY5 A;  5AQF A;  3OY9 A;  1VQ6 N;  2ZF5 O;  1Q86 O;  1HQU A;  4QS7 A;  2FF3 B;  1K9M O;  1SL0 A;  3F2K A;  1RT5 A;  3E9O A;  3E9P A;  4CEF A;  2V51 B;  3L4I A;  4G1Q A;  4BR5 A;  1BG3 A;  3O8M A;  2CGJ A;  4CHY A;  5SZT A;  2G8H A;  3RRG A;  4CBU A;  4DB3 A;  4JK9 A;  4BC5 A;  3QO9 A;  2BUP A;  3MEG A;  4DSE A;  4L8R B;  2KTQ A;  1JLF A;  2BE2 A;  3SAH A;  1HKG A;  4ZTF A;  1R0A A;  3O4Q A;  4DS5 A;  1SAZ A;  2XO7 A;  3LDN A;  2D0B A;  3DXK B;  4OPJ A;  3HI0 A;  4DF4 A;  1Q9Y A;  4O5F A;  3SPZ A;  2LSN A;  5ADX A;  1M90 O;  4CHP A;  3OTO K;  1LAW A;  1RBV A;  4EFH A;  1BIZ A;  3HVR A;  2FBT A;  4PL7 A;  3E01 A;  4DTX A;  4HCB A;  1YTU A;  3ZSY A;  1R59 O;  4JHD B;  1HPM A;  1ZBU A;  3CYM A;  4H0P A;  4CGD A;  1RT7 A;  2YHW A;  1U49 A;  1FK9 A;  2WON A;  4F4K A;  3RMC A;  4C8N A;  4F3T A;  3AO1 A;  1GLD G;  1J6Z A;  1IKW A;  2YX6 A;  4B3R K;  3CG7 A;  1KSP A;  4E7L A;  1N5Y A;  3QLH A;  3HP6 A;  3EYZ A;  3O4W A;  1B9D A;  5AQZ A;  1K6Y A;  3CCV N;  4GVE A;  1KFD A;  3VQ9 A;  4UQG A;  2DFE A;  5AQU A;  3K0S A;  4EHU A;  3WEE B;  2PYJ A;  3RMD A;  4Z94 A;  3VGL A;  3GOI A;  3C6H A;  4AM6 A;  4DCH A;  4GV6 A;  3IKM A;  3L4Q A;  3QFU A;  4IJA A; 
#chains in the Genus database with same CATH homology
 4YOX A;  2V7Y A;  2KLA A;  5LY3 A;  1GLB G;  1KAY A;  1NGA A;  3HZ6 A;  4BC3 A;  1Z6R A;  1JCE A;  4L3Q A;  2QTD A;  4BR9 A;  3VER A;  2V52 B;  4WFA L;  1GLE G;  1OVY A;  4H0O A;  4MO5 A;  3M6G A;  1W2B M;  1C0F A;  3A5L C;  3D7E O;  2D0O A;  4JKG A;  4JK7 A;  4BGB A;  3MN5 A;  4YOY A;  2WC9 A;  2QWO A;  4ISG A;  3CMA N;  3C65 A;  4BG8 A;  1NBW A;  3B8A X;  1NM1 A;  3HTV A;  4IO8 A;  4YDU A;  5H1S Q;  1VQ7 N;  4FPB A;  4GV9 A;  1VQN N;  3S41 A;  3CET A;  2GX9 A;  3CQY A;  3R1X A;  4CZM A;  5C0Y A;  1RGI A;  4U7B A;  1QQO A;  1XQS C;  3PIO L;  4BRL A;  3OW2 M;  1P90 A;  2ASP A;  4BC4 A;  1T6D A;  3CJ7 A;  5JVH L;  3HSC A;  4H5W A;  4AF1 A;  3SMP A;  1VQP N;  2NRR A;  4IEE A;  3CCE N;  1YJ9 N;  2YJE A;  1BO5 O;  3Q7C A;  3CJB A;  4QS8 A;  3NVK A;  1T6C A;  5BRF A;  2RHK A;  3H1Q A;  4WFN L;  5GIP A;  4B1W B;  4NB4 A;  4M7Y A;  5AZI A;  3WXI A;  1X3M A;  2Q0R A;  2VYP A;  3KWI A;  5BN9 A;  2OTL N;  4XJX A;  3VET A;  5EY4 A;  5M1F A;  2P9N B;  3CC2 N;  3P4I A;  3O9R A;  4K42 A;  4FO0 A;  4PKG A;  5TKW A;  4JKD A;  5EX5 A;  4BRG A;  4IWV A;  1S22 A;  3R9P A;  3EL2 A;  5F2R A;  2VCP A;  4O8K A;  3FZH A;  2FXU A;  1ZXO A;  5BRE A;  2GEL A;  1U2V B;  4GY2 B;  3K9J A;  3P38 A;  3RVC A;  4CZK A;  3TU5 A;  1NGC A;  3DXM A;  3VEV A;  2JWL A;  1K8K A;  2ZGY A;  4BRA A;  4H0X B;  2QEX N;  3O80 A;  3J7Z O;  4BRE A;  1MDU B;  4BRF A;  3UKR A;  4H03 B;  3D2E A;  1LCU A;  4FWO A;  2QWL A;  2FSJ A;  3SK3 A;  4PHT X;  5JLH A;  1YJN N;  2AA4 A;  4WQ5 C;  3M5R A;  5AQN A;  3LM9 A;  4GV3 A;  3O9Q A;  3BEX A;  1ATR A;  1ZC6 A;  4WQ4 A;  3VEW A;  2ZJR L;  5AQL A;  2P9L A;  3C6A A;  3O1W A;  3QBW A;  1VAZ A;  5M1Q A;  1S72 N;  1ATS A;  4FSV A;  5AQQ A;  4CZI A;  2QWP A;  3CQX A;  4C1N K;  5FPM A;  3WEE A;  2NRW A;  5AQP A;  2HOE A;  3E1Y A;  1NGB A;  1TYQ A;  5ELZ A;  3O9U A;  3FLC O;  4B1Z A;  3VEN A;  2QI2 A;  3U9Z A;  4MLH A;  3CXC M;  3NVM A;  4BRI A;  1VQK N;  3ZEU A;  2BH1 A;  3SMS A;  4YOU A;  3ZX0 A;  4KH5 A;  4I6M B;  5I9E B;  2CGK A;  3LDO A;  3K9K A;  3FZK A;  3M1F A;  3MN7 A;  2GWJ A;  3KWG A;  4KH4 A;  4WQ4 C;  2P9P B;  1YJW N;  5EOY A;  4EAH D;  4CZE A;  1NJI O;  3H3N O;  3D2F B;  1QQM A;  3I8B A;  2F9T A;  1CZA N;  3U9D A;  4JEP A;  3R6M A;  4A5B A;  3MDQ A;  3LDP A;  2HBL A;  3CI5 A;  2FF6 A;  1MA9 B;  1C0G A;  1XC3 A;  1NLV A;  2E2N A;  3QB0 A;  4MDA A;  3CCJ N;  3ZET A;  3G71 N;  1NGD A;  3UKU A;  1WUA A;  2W41 A;  4MO4 A;  3EE8 A;  4PKI A;  4WCE L;  5AQT A;  3G4S N;  4ILJ A;  4BVP A;  3DJC A;  5AQS A;  3ZYY X;  3MX2 A;  1HLU A;  2BTF A;  2QWN A;  3G6E N;  3ULE A;  2E2O A;  2PBD A;  5AZJ B;  2J4R A;  1QVG M;  1WOQ A;  3LDQ A;  4DKW A;  1DGK N;  5KPT A;  1X3N A;  1E4G T;  4YOW A;  2V7Z A;  1GLC G;  4A62 A;  2QWM A;  2P9S A;  5BPM A;  3P31 A;  1BU6 O;  5DM6 L;  5KPR A;  1VQ9 N;  3MN6 A;  3CCL N;  4J8F A;  5EVZ A;  3ZX3 A;  3WXM B;  1SQK A;  2UYT A;  3FZL A;  3FZM A;  2QXL A;  3PLA A;  3DXM B;  5JIC A;  4CZH A;  4QS9 A;  2OAN A;  3OA9 A;  5AFU H;  3HOS A;  2FSK A;  2NRZ A;  2IVP A;  4XEI A;  3W0L A;  1VQL N;  3ATV A;  1W97 L;  2QA4 N;  4WQ5 A;  3CCS N;  1HUX A;  3HRG A;  2HST A;  2JWK A;  3I33 A;  4IO9 L;  3BP8 A;  4CZL A;  5E26 A;  3VGM A;  2A40 A;  1BUP A;  1TUY A;  3IUC A;  3QBX A;  3OBW A;  5GAE P;  3T69 A;  4PKH A;  3WQU A;  3FR0 A;  4FWN A;  4FWS A;  3UB5 A;  5LJW A;  4B9Q A;  2PAV A;  4CBW A;  4ISF A;  1X9J A;  5JMV A;  4JKG B;  3MWP A;  3AAR A;  3T7Z A;  3A5N C;  2ZJP L;  4KH6 A;  3QDK A;  4CD1 A;  2FSN A;  3L0Q A;  2P9U B;  1JCF A;  4CBX A;  1G99 A;  3BF3 A;  4PL8 A;  1YIJ N;  5BRH A;  4MDB A;  1BWF O;  3SBG A;  4A2B A;  1NGF A;  3H3O B;  4FWM A;  5DM7 L;  3R3L A;  3QIC A;  4BRM A;  3G25 A;  3VEZ A;  5HL7 L;  5M1O A;  3JXU A;  1KXP A;  3GDQ A;  3QML A;  3LDL A;  4CZJ A;  3AGK A;  5KQD A;  1SS6 A;  1VQ4 N;  1NMD A;  3IDH A;  1GLL O;  3MMV A;  4OPH A;  2YCH A;  3I55 N;  5CE3 A;  4E1J A;  5KPZ A;  1ESV A;  2E2Q A;  2P9I B;  3MWT A;  1NGE A;  4NLC A;  1EO1 A;  2E88 A;  4BR2 A;  3AAP A;  1K8K B;  1QQN A;  4BR7 A;  3O1B A;  2Q31 A;  4A5A A;  5AQO A;  4FWP A;  5M1N A;  4IOA L;  2GWK A;  1M1K O;  2H3G X;  3VGK A;  2P9P A;  4HWI A;  3TTC A;  1IJJ A;  3ULE B;  5AQG A;  2I7N A;  3VF4 A;  4A61 A;  3CJA A;  5LJV A;  4RWT A;  1VQ5 N;  2Q0U A;  4JKF A;  5JLF A;  4IZ9 A;  5AQW A;  1DEJ A;  3O08 A;  5TKY A;  3CC4 N;  4H5N A;  4YOR A;  4G9Z A;  1T3V A;  2F7T A;  4KBO A;  5GIO A;  2YHX A;  2C1I A;  5FPE A;  4H5T A;  1RDU A;  3EKU A;  4FL9 A;  4JKC A;  4BR4 A;  4BC2 A;  3CF5 L;  2HBK A;  3J8A A;  4BRH A;  1KAZ A;  3PIP L;  5AZJ A;  4OO1 J;  1YIT N;  4BY9 C;  2W40 A;  4BGA A;  4FOE A;  4BE7 B;  3SBT A;  4H0V B;  4WFB L;  4HTL A;  2FLO A;  4DQ8 A;  4YOT A;  2E1Y A;  3VF6 A;  3KVG A;  3DLL L;  1D4X A;  5AQJ A;  4R79 A;  2AP1 A;  1YF5 L;  4JD2 B;  3SAF A;  3WQT A;  3BUZ B;  3CJ9 A;  3MCP A;  3H1V X;  3ID6 A;  2I7P A;  1JJ2 M;  4C23 A;  1Q18 A;  1YAG A;  3N4Q A;  4IOX A;  3AY9 A;  2YI1 A;  2ZGZ A;  5BR9 A;  2VGM A;  2HBJ A;  4FWQ A;  2ASM A;  2ASO A;  4A59 A;  3IMX A;  3W3D A;  4MLE A;  4YOV A;  1KQS M;  4JKE A;  1Q82 O;  4BQL A;  3VTH A;  2QW9 A;  3FZF A;  3CHW A;  3OHR A;  5AR0 A;  3CJC A;  3WXL A;  3DXK A;  1MWK A;  1BDG A;  3HM8 A;  3IFR A;  1O13 A;  4ISE A;  4JKB A;  1YVN A;  3QFP A;  4CZG A;  3UE5 A;  2F9W A;  3TSQ A;  4ILH A;  4GNI A;  3DAW A;  1NGG A;  2NLX A;  5C10 A;  2W00 A;  2KHO A;  4BRK A;  3CCR N;  3UKU B;  3MX5 A;  4ILG B;  4JAX A;  5F0X A;  1P8Z A;  3ENO A;  4XH1 A;  5GAG P;  1YUW A;  2HBM A;  5M1P A;  1N8R O;  3M3Z A;  5C15 A;  1OKJ A;  3A5M C;  4BR0 A;  1NWK A;  4K41 A;  2IVN A;  2GTD A;  4K43 A;  4BRP A;  3ENB A;  1DKG D;  2P9S B;  4B1Y B;  4JN4 A;  3FFK B;  5BRD A;  3TTD A;  1VQO N;  1JCG A;  4BRQ A;  2CGL A;  5F1X A;  2HF3 A;  5JVG L;  3AGR A;  2VWB A;  3RSE B;  3VEX A;  5ADX H;  3VPZ A;  1E4F T;  2Q97 A;  4B1X B;  1BA0 A;  4B1V A;  1HJO A;  3H46 O;  3D6R A;  5MLC Q;  4JKA A;  3P39 A;  5AQY A;  3CCQ N;  1KC8 O;  1Q7Y O;  1KD1 O;  3TSU A;  4AM7 A;  3GBT A;  2WBN A;  4NLB A;  2P9K A;  2CH5 A;  3WXJ A;  2OTJ N;  4H5V A;  5AQV A;  4CZF A;  4M63 C;  3A8Y A;  4BEC A;  4IEI A;  2IVO A;  5C2F A;  3EO3 A;  5EXW A;  3U8X A;  3VTI A;  5KQ8 A;  5CHI A;  4JHD A;  5AQM A;  3R8E A;  4O8U A;  4BEB A;  2CH6 A;  2IIR A;  4IFE A;  2WUS A;  4EIA A;  4JNE A;  4CJ7 A;  3KK7 A;  4YDU C;  2HF4 A;  3DWL A;  3WUH A;  3KHY A;  4BRD A;  3EZW A;  5FPN A;  1RFQ A;  3EN9 A;  3I56 N;  1NGI A;  3CER A;  3Q7B A;  1NGH A;  5BPN A;  2P9U A;  4JK8 A;  3L6Q A;  4EHT A;  1SZ2 A;  3HOT A;  3N4P A;  3O6W A;  4WYB A;  2QM1 A;  3TPQ A;  3CD6 N;  1EQY A;  3VOV A;  4BRC A;  3C7N A;  2ZJQ L;  3A0I X;  3AAQ A;  1YHQ N;  1QZ5 A;  1U6Z A;  4XH4 A;  1VQ8 N;  2YHY A;  4U67 L;  5M1K A;  5HOO A;  2WFB A;  3C0B A;  2E2P A;  3ATU A;  3HBT A;  4IJA A;  3F5T A;  3WXK A;  3FGU A;  4RCH A;  3H45 C;  4C1N I;  2Q2R A;  2NRX A;  1YXQ A;  1Y64 A;  2RE2 A;  2P9I A;  3GG4 A;  4OPA A;  3GL1 A;  1Q81 O;  5AQF A;  3BF1 A;  4XH5 A;  4FWR A;  1VQ6 N;  1HX1 A;  2ZF5 O;  1Q86 O;  2ZWH A;  3OBY A;  2ITM A;  4QS7 A;  5AZI B;  1QVF M;  4BQZ A;  2FF3 B;  1K9M O;  3LM2 A;  2QWQ A;  2C1G A;  2P9N A;  4IDH A;  3VF2 A;  3F2K A;  4F9O A;  1H1V A;  3CC7 N;  2EWS A;  3JS6 A;  2D4W A;  3E9O A;  2A3Z A;  1TUU A;  3E9P A;  4FPA A;  5BN8 A;  2V51 B;  3L4I A;  4UY8 O;  4BR5 A;  3MK6 A;  1BG3 A;  3O8M A;  2CGJ A;  4IXC A;  4JD2 A;  4WF9 L;  2Q36 A;  4RTF D;  2DPN A;  2GUP A;  4CBU A;  3WT0 A;  3TTF A;  4DB3 A;  4FWK A;  3FE1 A;  5C12 A;  4JK9 A;  1VQM N;  4BC5 A;  2BUP A;  1S3X A;  4H0T B;  1XUP O;  5C2D A;  3D2E B;  2NNW A;  3ZX2 A;  3SAH A;  4NO7 A;  1K8A O;  3MN9 A;  2A42 A;  4K25 A;  1MWM A;  1HKG A;  3VMF B;  5B8H A;  2GEM A;  4BRO A;  2E20 A;  2NRH A;  1ZBS A;  4IJN A;  2NRT A;  3SAG A;  1V4S A;  1SAZ A;  3A5O C;  2PFU A;  2P9L B;  4B1U B;  3LDN A;  1RDW X;  3DXK B;  2VGN A;  2YJF A;  3HI0 A;  3GE1 A;  2HMP A;  4O5F A;  4A2A A;  5FPD A;  4FVU A;  2NZT A;  1T44 A;  1ILY A;  5ADX A;  4DHY A;  2D0P A;  1M90 O;  3F9M A;  4IOC L;  3NMU A;  3LL3 A;  3CPW M;  4Y0W A;  1GLA G;  3ZEU B;  4BVO A;  4EFH A;  1HKC A;  3O9T A;  5AQK A;  5GAD P;  3MCA B;  2D1K A;  2P9K B;  3H6E A;  1HKB A;  3CME N;  4PL7 A;  3VEY A;  4M7X A;  4CD3 A;  3C7N B;  1IG8 A;  5AQR A;  3VES A;  5AQX A;  1NGJ A;  4FOI A;  3EKS A;  1R59 O;  5GIN A;  4JHD B;  4BRN A;  1QHA A;  1HPM A;  3CJ1 A;  4H0P A;  1GLF O;  5CR4 A;  3SLC A;  3CCU N;  1YI2 N;  3CPE A;  2YHW A;  1QZ6 A;  1TYQ B;  1GLJ O;  1KAX A;  3CIP A;  3O5B A;  4JKH A;  4BG9 A;  3VEO A;  2E1Z A;  2A6A A;  2A41 A;  1BA1 A;  2QWR A;  5BPL A;  1V4T A;  1GLD G;  1J6Z A;  5AFU A;  4I6M A;  2YX6 A;  3CCM N;  5AQI A;  3O9S A;  2KKZ A;  4FWL A;  1LOT B;  3KZB A;  4LC9 B;  3SJH A;  5GAH P;  3ENH A;  3EE9 A;  3O4W A;  5AQZ A;  1K73 O;  3CCV N;  3D2F A;  1Z05 A;  3E66 A;  4GVE A;  2E8A A;  1BOT O;  1U2V A;  5AQU A;  4EHU A;  1ATN A;  5E84 A;  3RSE A;  1DT9 A;  4H0Y B;  3WEE B;  3U4L A;  3ZET B;  2NRV A;  3TSP A;  4Z94 A;  2A5X A;  4A57 A;  3VGL A;  3UKR B;  3GOI A;  3C6H A;  4H5R A;  4AM6 A;  4DCH A;  4GV6 A;  3IKM A;  3L4Q A;  3ID8 A;  5AQH A;  4CI6 A;  3E9L A;  3QFU A;  2Q1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...