1C0TB

Crystal structure of hiv-1 reverse transcriptase in complex with bm+21.1326
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
423
structure length
373
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 98
structure length 373
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0tB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tB02
1S6PB 1C1CB 2OPSA 1JXLA 2WB4A 3DLEA 3H5SA 2F8EX 2RDIA 4JUZA 5DG8A 4H4MB 3I0RA 3HVTA 3C6TB 1OS5A 1LWFB 4ZP6A 2UVWA 3IRXB 3PJXA 4DL2A 1IKVB 3IG1B 5HLFB 3PHEA 4YR3A 3KHHA 3NL0A 3D28A 3G6VA 1HNIB 1J5OA 5KFSA 4M94A 1EETA 3DI6B 1JLAB 1LWEB 3OL6A 5DLGA 3DLEB 2BQ3A 3QIDA 3MR5A 3C6UA 4RUCA 3BQ1A 1JLBB 3H98A 1C0TA 2IA6A 2VG5B 1FK9B 4I2PB 1J5OB 2IM3A 5I42A 2DPJA 3GIKA 2R8JA 4TN2A 4KHMA 3IGVA 2XC9A 4ZHRA 1RTJA 4NLWA 5HROA 5DLFA 2YNFB 1RT4B 3NKYA 3QZ8A 1S6QA 3DMJA 3NAIA 2VG5A 5K14B 3D5MA 4WFXA 1TP7A 2RF2A 1DTTA 3MEDB 4IH5A 4MKBA 1ZETA 5KFCA 4RUAA 2V4QA 4O3PA 3V6DB 1XR7A 2V4RA 3OLAA 1GX6A 3NGDA 4TLRA 4J9NA 4JV1A 4WYWA 5DG9A 3MFIA 3MR6A 1HQEA 3LP0A 2ALZA 2R2RA 1RTHA 5KFZA 1Z4UA 1FKPA 4IG0B 2C2DA 2JLEA 4K4ZA 2YKNB 3E51A 4TXSA 5KG0A 4K4WA 4ZVHA 2QV6A 5J1EB 3QZ7A 4RW9A 4KAIA 1RTDB 2UUWA 1HQEB 1XR5A 5KFEA 1JLCA 5CYMA 4ID5B 3MEEA 4RW8A 3DRSA 1ZTWA 1RA6A 1KLMB 4RW4A 1EP4A 5KG1A 2ASJA 1S97A 4EO6A 1N5YB 3NMAA 2OPQA 5F8IA 3H2LA 3CJ4A 1JLCB 1JX4A 2UVUA 2WCXA 3GYNA 4H4OB 3KLEA 1TKZB 4IFYB 3TVKA 3KHRA 1S1VA 4DL5A 3SFGA 4K4XA 3TAMB 1R0AA 4WYLA 4NRTA 3V6KA 1N5YA 4JV0A 1TKXA 2UVVA 5CYQA 1S0NA 3PW4A 2JEIA 3RB0A 2R2TA 3LALA 1JLQA 1RT6B 5KFTA 5DG7A 1QAJA 3HVAA 3TAMA 3BQ0A 4ED6A 3Q8SB 5F8GA 4Y34A 4NLPA 4IFVB 4ZPDA 5C5JA 1JKHA 4I7FB 1LWFA 5KFFA 2BE2B 3IRXA 3N6MA 2BQRA 2VG6B 4RZRA 2J6UA 4K50A 3DRPB 4ICLA 3KK1A 3UPFA 4LSNA 2WOMB 1RYRA 2HNDB 3E01A 3G86A 3DYAB 1YVFA 1RA7A 3MTKA 3CDUA 4Q8EA 1LW0A 5DGAA 1TL3A 4ZPCA 2C28A 1C0TB 2VG6A 4O4RA 1HMVB 4TY8A 2ZD1A 3QO9A 4O3NA 3DOLA 1MU2A 3I0SB 1RT5A 4WXOA 4Y2CA 5I42B 5F9LA 2W9BB 2C22A 2IJFA 2ASDA 4K4UA 5C24B 1U09A 1N48A 4ZHRB 1RT3A 5L1JA 2VG7A 3LP2A 4Q0BA 4IG3B 4RW6B 3KLGA 1HMVA 4J9OA 1TKTB 3QO9B 3KK3B 4B3OB 5KT3A 5L1LA 3QLHA 5HBMA 3I5AA 1I6JA 3Q8PB 2HNZA 1QE1A 5KT6A 2ZE2A 3NAHA 1S9GA 2FVPA 4MIAA 2OPPA 5KG3A 4U7CA 4FS1A 1HYSA 1N6QB 4EEYA 1IKXA 5KFOA 1C1BA 3ISND 1BQNB 3IS9B 5HP1B 3LP0B 1TKTA 4URQU 3KK3A 2YKNA 1HNVA 1HQUB 4ZVGA 1SH2A 1S1UA 4KV8A 2IM1A 5FDLA 1TQLA 3CO9A 1SV5A 2J6TA 2E9ZA 1N6QA 5KG7A 3PJWA 1RTDA 3GQCA 1C1BB 4QWDA 2QE5A 1UWBB 4DG1A 2R8KA 4F50A 3M8QB 5D3GA 5EWFA 4ID5A 2FVQA 4IDKB 1JLEB 5C42A 1RT7B 3SI8A 4RW4B 1EP4B 1T94A 1S1XA 1VRTB 3KLIB 4KBIA 2RKIB 4KO0B 3KHLA 4WE1B 5L1KA 3OHBA 1REVA 4ED3A 5KFNA 1LW2B 4RW7A 4ED0A 2ATLA 4FBUA 3OL9A 3MEGB 3KJVA 4ZPAA 4NZ0A 3C6TA 3PW2A 4EBDA 4IDKA 5C42B 4H4OA 2B6AA 3KLEB 1HPZA 3OSNA 4KKOB 5F8MA 4QPXA 3PR5B 1DTQB 1VRTA 3KLIA 2BRLA 5KG5A 4YR2A 3IN5A 2FLPA 1RAJA 2FVRA 2AX1A 2VA2A 1TKXB 3PVXA 3KK2B 3MECA 4ZMMA 1BQMB 3M8PB 5J2NA 3EZUA 3QYYA 4IH6A 2IJNA 3QGIA 1JLQB 1TL1A 5J2QA 4XPEA 3KLFB 2HMIA 3CJ5A 4RNOA 4HYKA 2HNYA 4FBTA 4I2PA 2GIRA 1DTQA 2B5JB 1NNDA 1T03B 3FQLA 3PR4A 3KHGA 1SH0A 1WNEA 4IFVA 2WK4A 4J9PA 3MECB 3BGRB 4I7FA 4KFBB 2HAIA 1RTJB 4Q44A 2JEGA 5HROB 4WZQA 2YNFA 3DM2B 4O4GA 4DL4A 4MK8A 1TL1B 2HMIB 4R5PA 2DPIA 3N6LA 4QWCA 2B5JA 3V81A 3KLHB 1T03A 3BR9A 2W8LA 1N4LA 2R8HA 3RB4A 4H4MA 5KG4A 3T5KA 3DLGA 4QWBA 4ED2A 3SFUA 4ECVA 1IKVA 3IG1A 1XR6A 2C2EA 4R5PB 4LSLB 4WXWA 3DI6A 1JLAA 3KLHA 1LWEA 2YNGB 3OHAA 2E9TA 4NCGA 1RT3B 2XCAA 2VG7B 3LP2B 2HWHA 4NRUA 2YNHA 2IAJB 1ZTTA 4KHRA 4R0EA 4F4WA 3LANA 4QWAA 2O5DA 4MK9A 1FK9A 1MMLA 4TQRA 1FKOB 2OPRA 2V0NA 5CYMB 3H5UA 4RW8B 1QE1B 4MKAA 1RT2A 2J6SA 3NBPA 1NHVA 1C2PA 4O3QA 5KT4A 4K4TA 4J9LA 3V6JA 3PW7A 4IOBA 1IKXB 5KFAA 3RAXA 4PQUA 1VRUB 1S1TA 4XPCA 5K14A 2GIQA 4LQ9A 3OL8A 5DQGA 1K1QA 3G6XA 4NLSA 1KHVA 3MFHA 2E9RX 5I3UA 2I5JA 2XWYA 3VQSA 3DRRB 4G3IA 4NLQA 1S1UB 4KV8B 4PWDA 5FDLB 3PW0A 4NLVA 1QUVA 4ED7A 2AGPA 3CDEA 4J9SA 4J9QA 4F4XA 1VRUA 5F8JA 1DLOB 2V9WA 5CYQB 1RTHB 1FKPB 4O3RA 1RT7A 2WHOA 2IM0A 1S1XB 1RT6A 4PWDB 3H59A 2XCPA 4EBCA 4ECXA 4I2QB 3V4IA 3QGHA 2BQUA 5J2MA 1KHWA 1LW2A 4RW7B 4KSEB 3I5BA 1DLOA 4KE5A 3ICLA 3KMSA 1JKHB 3CIZA 4TY9A 3GIMA 3DRSB 4IQXA 1C0UA 4ECRA 4Q45A 5F8LA 3DRPA 4O3OA 2W9AA 4ECUA 3GILA 4PUOB 4I2QA 1GX5A 2D3ZA 4DL6A 2YNIA 2IC3A 5KT5A 3H5YA 1RT1A 4LQ3A 2OPQB 3GIJA 2D3UA 3KK2A 1JLGA 1BQMA 2JC0A 2CKWA 5KG6A 3MR2A 3GV7B 2R2SA 5KFUA 4YP3A 4IRKA 4IKAA 1TL3B 1C0UB 5J2QB 3LP1A 2GC8A 5HLFA 3QIPB 2W8KA 4RNFA 1HNIA 4PUOA 2IC3B 2W7OA 3DLKB 2JEFA 3UDLA 3BGRA 4KFBA 3CJ0A 3C6UB 4NLOA 4Q0BB 2C2RA 3QGGA 4QWEA 3BQ2A 4MIBA 2AGOA 4HKQA 4YMEA 2IMWP 3QIPA 5KT7A 3JSMB 4B3OA 4ZPBA 5L1IA 1JIHA 2VA3A 5F9NA 3DLKA 2ZE2B 1QAIA 3BSNA 1JLFB 2OPPB 1TVRA 3DLGB 5DQIA 4U6PA 5KFLA 4ECSA 3RBDA 3HVWA 1S6QB 3DMJB 5EWEA 4ZP8A 5EWGA 2FVSA 4RU9A 2WOMA 3IGNA 2BRKA 5KFYA 4R8UA 3JSMA 4RNMA 5C25B 1T05A 1NHUA 3M9NB 3KMQA 2RF2B 2W7PA 2HNDA 2YNGA 3E01B 3BSOA 2R2UA 5KG2A 3GV5B 3I0RB 3HVTB 5F8NA 3RBEA 2YNHB 1S49A 5KFGA 4DEZA 3V6HA 2BANA 4TY8B 5EDWA 3RB3A 2ZD1B 2D41A 3DOLB 1RT5B 3BSAA 4R8UB 4Q8FA 5C25A 1SUQA 3Q8RB 4IG0A 1JLEA 3MF5A 1RT2B 4IRCA 4DL7A 2WONA 4WZMA 3N6NA 5J1EA 5JUMA 1S1TB 3FQKA 4EO8A 2FVCA 5KFBA 5KFHA 3TQ1A 5HBMB 4DL3A 2R8GA 4NLDA 2B6AB 5KFRA 1HPZB 3H4BA 1S0OA 4KKOA 4NLTA 3KNAA 3CJ3A 4ECZA 1W25A 3DOKA 3GIIA 2XI2A 2ILYA 4RNNA 1RT4A 3GV8B 2BR0A 2IBKA 1BQNA 3IS9A 5HP1A 1IKWA 4QW9A 3M8PA 5J2NB 4NLYA 4ECYA 4IRDA 4Y2AA 1TKZA 4YQWA 3KLFA 4GC7A 3T5HA 2FJWA 2HNYB 3V4IB 2I1RA 3FDSA 1R0AB 4EYHB 4URSA 2UVRA 2ILZA 4JV2A 4NYZA 4FS2A 3KOAA 3Q8QB 4ED8A 1IKWB 4TYAA 2W9CA 3DM2A 4O4GB 4RNHA 2R8IA 2AQ4A 3RAQA 2FLNA 4NLUA 4ZP7A 1TV6B 3JYTA 1K1SA 5KFJA 4YR0A 4O3SA 3FFIB 3T19A 2HWIA 1JLGB 2JC1A 3MEGA 3CWJA 5T14A 3BJYA 3MEEB 4IR9A 5JXSA 4H54A 3LP1B 2AGQA 4X2BA 4NLXA 1RYSA 4ICLB 3KK1B 4LSNB 1SH3A 3MR3A 5EUHA 1TV6A 3JYTB 3FFIA 1S6PA 5KFVA 4J9MA 4GC6A 3ISNC 3HKWA 4MH8A 3DYAA 2B43A 3FRZA 4KB7A 3G6YA 4EBEA 4ZVEA 4NCGB 4Y3CA 4MFBA 3M9MB 1LW0B 4IFYA 3HHKA 4ZP9A 3I0SA 1LWCB 1RTIA 2FJVA 2OPRB 5KFWA 3UR0A 3OLBA 2UUTA 3PZPA 1S0MA 3NBPB 2AU0A 3KLVA 4J9RA 2FJXA 4MFBB 4IG3A 2EC0A 1JLBA 5KFPA 1S9FA 2AX0A 4RW6A 3KLGB 2XGQA 4TYBA 3DDKA 3T1AA 1LWCA 1HARA 1RTIB 3QLHB 2IM2A 5I3UB 2WTFA 2HNZB 2I5JB 3DRRA 4IR1A 4ZVFA 2ZKUA 3CVKA 1S4FA 4XO0A 1S48A 5KFKA 4J9KA 2BE2A 3LAMA 2BANB 1S1WB 2YKMB 4LSLA 1D0EA 4ED1A 4K4SA 3BREA 1SUQB 1DTTB 3MEDA 1T3NA 4WFYA 3V6DA 2WONB 1RDRA 4NLRA 4K4YA 1SV5B 2IAJA 5L9XA 4F4ZA 1S1WA 4OL8A 1UWBA 2YKMA 2CJQA 5J2PA 1MU2B 3M8QA 2W9BA 1FKOA 5D3GB 4WFZA 3EPGA 4ECWA 3CDWA 1S10A 5C24A 3BSCA 3M9OB 3DOKB 2D7SA 4RW9B 2RKIA 4KO0A 4PQUB 4WE1A 4ECQA 1REVB 5KFMA 3ITHA 5F8HA 4G1QB 5J2PB 4K4VA 2XGPA 3KJVB 4M95A 5KFQA 3OSPA 1KLMA 1S9GB 2AWZA 3OL7A 1HYSB 4MK7A 1N56A 4IH7A 1D1UA 4O44B 2XI3A 3CJ2A 2ASLA 3EPIA 3I5CA 4TQSA 5KFDA 3ITHB 4G1QA 2W9CB 2JEJA 3FSIA 3H40A 1HNVB 1HQUA 4F4YA 5DQHA 4QW8A 2FLLA 2RDJA 1S1VB 3H5XA 1S9EB 5KFXA 5KT2A 5J2MB 1IKYA 1C1CA 2OPSB 4O44A 2WRMA 5DGBA 4DG1B 3PW5A 3UQSA 2OH2A 1JLFA 3T5LA 1TVRB 4URGA 3H4DA 4ECTA 3RB6A 5KFIA 4Q43A 4NLGA 3T5JA 4EYIB 3LAKA 1S9EA 1IM4A 1CSJA 1EETB 2YNIB 1T05B 3V81B 1IKYB 1RT1B
chains in the Genus database with same CATH superfamily
1S6PB 3CTRA 2WB4A 2OJ3A 4JUZA 3KG0A 3A8EA 2DKOB 2WVCA 4DR2J 4H4MB 1RSCA 3MUTP 4ZP6A 1T0TV 2VDIA 3ZZOA 3D3BJ 4F4AA 3G6VA 2HG4A 2MLZA 5KFSA 3NEKA 4CWBA 1VQPS 2VOPA 4CLLA 1J27A 2HPUA 4FF1A 4PWWA 4F02A 3F44A 3C6UA 5AE2A 4YB1P 3BQ1A 1U24A 1JLBB 2CUYA 2VG5B 1OJ4A 4DDFA 2BX6A 4I2PB 3AXKA 2K7KA 3CIMA 1NMEB 1CC8A 1VLYA 2DNQA 5LSOA 3EZOA 1YIJS 3GIKA 2R8JA 3I9V9 3IGVA 4DX7A 3KG1A 3W2WB 3HM9A 2XC9A 4DXLA 1UVNA 1RTJA 4LFAJ 1NK8A 3NXZA 2QLXA 1FA0A 3C66A 4TLQA 5K14B 1UEVA 1RAFB 3VGUA 1ZYQA 5B0GA 2H5EA 1XN9A 5H9EK 4IH5A 3IRWP 5AXMA 2OEJA 1ZETA 1UVKA 3K5NA 4RUAA 2QEXS 4O3PA 3V6DB 1XR7A 3QQCD 4C3MA 5KOXA 4UY85 1A9NB 1KEKA 1NZ8A 2OTJS 3M2VB 3GJTB 4JV1A 3QT7A 5B09A 2ZDOA 1RLCL 4UTGA 4A47A 3LP0A 2CRLA 2KKHA 4DX8H 3QBCA 2UV8A 1Z4UA 2JLEA 2QC3A 1RWMB 3E51A 3PFOA 5KG0A 5J1PA 5B0FA 2XY5A 3GP9A 4UUXA 2D3OR 4G1IA 4NI2B 3G4SS 1BUXA 4RW9A 4Y65A 2VC1A 1RTDB 4LF1A 4CYUA 1ZM9A 5GMKa 3PEJA 1XR5A 4LR7A 4OHZA 1T95A 1ZTWA 1N5TA 2QYGA 1RA6A 1RBLA 2C3UA 4DR7J 2R7VA 2IPOB 1JJ4A 2FHOB 2YBVA 3HHEA 1N5YB 1WC4A 4PG6A 5HL7Q 2OPQA 2E1AA 5F8IA 3THVA 3MWBA 1EQ0A 2UVUA 3ENWA 2WCXA 4LF7J 2HFOA 5B0DA 3H20A 3KHRA 3TVKA 2MQ8A 4DL5A 3S1TA 3SFGA 1RWOB 2FD2A 3TAMB 1NU4A 2MZQA 4OX7A 1LXNA 3F56A 2V4JA 3W3SA 4QU7A 2VUGA 2AP6A 1FXDA 3AOCA 1TL5A 1S0NA 1YITS 4TU7A 2JEIA 4XAKA 3HJVA 3RB0A 3B4MA 4LF9J 4Q5VA 4LR9A 1BWEA 2ACMA 2NSCA 2ZNZA 3HVAA 5DDRC 5K20B 2DR9A 3N9UC 2MTLA 5F8GA 2VFTA 2FDNA 2CNNB 4NLPA 1PC5A 3ET6B 1F0XA 2L9NA 3OVAA 4NCAA 3EGVA 2DR5A 4ZITA 5C2GA 3CE8A 7AT1B 4A8FA 4IO1A 3KK1A 3UNYA 4RLEA 4LMZA 1VISA 2QJ3A 3V4MA 3K17A 1RYRA 1EHWA 1W2BR 2XZDB 1OYDA 2LP4A 3G86A 1ZM2A 2CYYA 2F9DA 3DYAB 1UFKA 1FEEA 2CZ4A 2DGOA 2WVBA 4GMKA 2FPHX 4J5OA 3CCRS 3T3FA 3AQPA 1NHKL 2WW8A 4B3SJ 2E7VA 2XYHB 3P96A 3WX8A 2LEPA 4DV5F 2XY7A 1SJQA 1WEYA 2VPXB 3IBFB 4O4RA 4O3NA 3R8YA 3DOLA 2KG0A 2OH2A 5I42B 3SSRA 3W9IA 3CCUS 5I4MA 1CJKB 1GMWD 1KFDA 2Z56B 3BS9A 4OZNA 3CJKA 1HHQA 4ZLPA 2ASDA 1RT3A 5L1JA 3ONQA 2CQ3A 2DCLA 3WC0A 4IG3B 1RAGB 3C8YA 4LR8A 4C8LA 1M5KC 4RW6B 2ZBRA 4J9OA 1HW8A 3QO9B 2GVZA 5L1LA 3QLHA 5HBMA 4I64A 1I6JA 2HNZA 4GVBA 3MURP 1UZDA 2VPYB 2PDAA 3NAHA 4B17A 1X4GA 1YRXA 1YTYA 1WTFA 2LMIA 2QFJA 1S72S 2A1BA 2HAFA 2VQEJ 1JK9B 4UW2A 1BQNB 1B70B 2DK2A 2F8MA 3BPDA 3JQJA 3LP0B 1VIXA 3EVWA 4C48A 3U27A 2GMJA 2RUGA 2M4MA 2R7UA 2WZ1A 2XHWA 1W7WA 1S1UA 4KV8A 3CO9A 2J6TA 1SV5A 5DM6Q 3DU6A 1PC4A 2E9ZA 5KG7A 3UD3P 4OYZA 3DXBA 1C1BB 3FEZA 2EFPA 1H7WA 2HFZA 4M1KA 1UWBB 4QWDA 4DG1A 2PMHA 1LWXA 3CJQA 2R8KA 3RR8A 3UD4P 4DR3F 5EWFA 4ID5A 3QRRA 2FVQA 3BH7B 4E8UA 5K8MA 4LSZB 5GAGI 3CC2S 3FZBA 1L3SA 1HI0P 5SZTA 1B0VA 3TEGA 1CJUB 1IWAA 3OFGA 2RRNA 2RKIB 3HHLA 4ED3A 4WE1B 5A8RA 3LWMA 5L1KA 2DNLA 1TKDA 3CF5Q 1T9TA 4G6VB 4ZPAA 2UUCF 3C6TA 5C42B 1RWVB 1GFWB 2B6AA 2MHNA 1WI8A 3OSNA 1G6BA 4M5HA 3Q89A 3C14B 1N33J 2BM1A 2BRLA 1D9AA 3BPSP 1WOSA 4X64F 4YR2A 2M3DA 1NLKL 1RAJA 2AX1A 3M05A 3TJAA 4F3QA 4TU8A 3HD2A 4DV7F 1Q8LA 2NSBA 4N7TA 3PVXA 1BQMB 4YB6A 5J2NA 3EZUA 2PE8A 4GVLA 4F04B 4B9MA 2HBYB 4XPEA 1Q53A 1M0SA 3CJ5A 1EJ7L 1B64A 4P72A 1P9QC 4GO7X 5G0RB 3W2VB 3WHIA 2MZSA 3KHGA 2Q6CA 2HFSA 4KFBB 2QSFA 4N41A 2BZ2A 5HROB 3O8WA 2DY9A 4O4GA 4QR2A 2H5JB 3HZEA 2AMCB 3R5JB 1TL1B 3PRDA 3J7A1 1VJQA 1YJNS 3R97A 3NS7B 3R5CA 3LA0A 3NG8A 3V81A 3KLHB 2BJ3A 2BMBA 4FKXA 4CNZA 2MQOA 3D66A 2O66A 2ZOMA 3OFHA 2WB1D 3SV3A 4ECVA 2DIVA 4RKUC 2PFFB 2K8GA 2IBOA 1YBAA 2E5IA 2OUGA 3BYPA 2MKCA 4Y28C 4JI0F 4LSLB 1RE1B 2DNNA 5AE3A 5B08A 3DI6A 5HQLA 2MY8A 1JLAA 1O6XA 1ZZFA 1N0VC 2YNGB 1XQIA 1GH8A 3EGWB 1Q78A 5HJYA 5LXRA 1QDUB 4L72B 3WBZA 2YNHA 2IHR1 2MMYA 2HBRB 4R0EA 1FK9A 4CTAB 1MMLA 1CQNA 3LGHA 2CG8A 3M8RA 1TK5A 1G3OA 3S7RA 4W90B 2YH0A 3LPEA 2DR7A 4B3MF 2AT1B 3PW7A 2GZOA 3R9LA 4IOBA 4PQUA 4CNYA 3CD0A 4XPCA 1VJWA 2R7QA 3CJSA 4P2SA 4DHVA 3IAS9 3UVJB 1X5PA 3OL8A 1OQ6A 2C2ZB 3HP6A 1GXLA 1KHVA 2B9YA 4N5SA 1Q0NA 3MFHA 1JB0C 1FE0A 3CNQP 2QLWA 3DRRB 4FVMA 4J7CA 3UD5A 4C97A 2XO6A 3D0GE 4ZLLA 3THPA 1DHMA 1WJ9A 2AGPA 3NS5A 2L9DA 1FWKA 2OFHX 2QYCA 3U7JA 4ZCIA 5GADU 1VRUA 4F4XA 3G9CA 1LNQA 5EHHA 4KPYA 3AA9A 1K47A 4YDXA 5F8JA 1RTHB 2YQ0A 2BDPA 1Q8KA 4QBUA 3CDBA 3ETMA 1RWKB 2MQNA 2XSJA 2XULA 4ERDA 2WHOA 1S1XB 3PO5A 4PWDB 4Z2XA 1N8RT 4RBUA 2QMXA 3AHPA 1YJ7A 2HGNA 4JI7J 1ROFA 2ZUGA 3POTA 2IVYA 1TL7B 1QTNB 3OR1B 4KSEB 3I5BA 3WIVA 1DLOA 4DPOA 1FXRA 3JTNA 1U6ZA 2G13A 4PXEA 1JKHB 4C11B 1UTAA 1M90T 3DRSB 2E5LF 2QMWA 1HNWJ 1GAOA 2RRBA 1U6FA 3GIRA 3UCGA 2VQFF 4Q45A 2X1AA 3DRPA 4O3OA 2W4PA 4N77A 3GILA 3K59A 1Y3KA 3P5TL 2YNIA 5KT5A 1M5PC 1WEZA 1NB2A 2H4WB 2NUUG 5E3CA 4JI8F 1H74A 3IM8A 3MPYA 5L39A 3H5YA 3K5LA 1JLGA 2MKHA 3MR2A 3GCXP 4A8YA 4AL7A 1TL3B 1C0UB 2J0XA 2OFGX 3UDCA 2HURA 5LM7E 1J5EF 3SCIE 2SXLA 2W8KA 2FUG9 1XNRJ 2DO4A 1AFJA 2IC3B 2FC9A 3TZXA 3SYZA 3W64A 1HIYA 1Y5IB 2HLTA 4KFBA 1HQ2A 4KYZA 5E3PA 1VQMS 1NK6A 3FCVA 3C6UB 4Q0BB 4DR5J 1DFDA 2K1RB 1D09B 1WC6A 2AGOA 1N52B 4HKQA 2AZ1A 2VBZA 2VPWB 3QIPA 8ATCB 3UCZP 1U1QA 1N34J 1XJWB 1APSA 5L1IA 1JJCB 3N28A 1JIHA 4A48A 3PO4A 2VU5A 4JI3J 3ZTQA 1JJ2R 2MZJA 2XTJP 1QAIA 2X51A 4M5KA 1NRKA 2OPPB 1TVRA 5DQIA 1F1BB 4HDHA 1O51A 1RHQB 1FDDA 3CC4S 3HVWA 5ITHA 5EWEA 4ZP8A 4MT1A 3MMCB 2WOMA 1J2VA 2VL1A 3FSYA 1JMTA 1NHUA 2HBQB 2NXUA 4Y2MA 1J5EJ 3E01B 3KMQA 2HW3A 3BSOA 2DYAA 1FFWB 3LOUA 3K5MA 1NK9A 1B7FA 3M32A 3HVTB 2AYEA 2BUNA 1RACB 2YNHB 3CB4A 3OV7A 4AQYF 4DEZA 3THTA 3RB3A 2XYGB 2ZD1B 2D41A 3CMES 2WAQD 1RT5B 3BSAA 3HI9A 4R8UB 4CLWA 3F0NA 1NZAA 1UPPA 2KI2A 4USTA 5HO4A 3Q8RB 1VGYA 3G8SA 3FBBA 1RT2B 2YQ1A 3PYEA 1KS2A 4JV5F 1O0PA 1UL3A 2CZ9A 2W2MP 3E3XA 3FZ2A 2XMJA 4DL7A 4WZMA 5J1EA 1W26A 2RB7A 4Y6IA 1S1TB 2RAQA 3ELHA 4CYUB 2XQCA 1T9WA 1Y7PA 3GG0A 4B3SF 1NM2A 2ZJPQ 3H4BA 3UN5A 1AUDA 3E2EA 1UW9A 3D1OA 3DOKA 3EXYA 3GWCA 2H1YA 2D9PA 9RUBA 1HNZJ 2BXJA 2BEFA 2PMWA 1IKWA 2BKPA 2ZWPA 3W9JA 5GVQA 4FNHA 1B99A 2RH3A 1F60B 3MAHA 5L38A 2XSJB 4IRDA 4CO2A 2FJWA 2HNYB 3V4IB 3DHWC 2CVEA 1DRZA 3CULA 1R0AB 4M5GA 2ZC4A 4URSA 5L46A 2UVRA 3QJPA 3SXLA 4DFJA 3AH6A 4F0MA 4ED8A 5F41A 1R8AA 1DURA 1OIAA 5E7OB 3IXQA 4NA3A 5E0OA 4FYVB 3DM2A 1DQAA 1Y9OA 4BCAA 4DSFA 2DH8A 4RNHA 2AQ4A 1M5OC 3K8VA 1FT8A 1VOMA 1S57A 2NS1B 2ADBA 3JYTA 5KFJA 1TELA 4EK2A 2KRRA 4NXNJ 4LF7F 1JLGB 1HBNA 3MEGA 3D68A 4CH7A 4RUHA 4NA2A 4WIIA 5JXSA 4H54A 1N5SA 4DR1F 1ZAVA 3BO4A 3KK1B 2BV3A 2FB0A 2J9DE 1SVDA 3MR3A 4C4WA 1M1HA 3FFIA 2YTCA 4GC6A 2OEKA 1HD0A 4EBEA 4KB7A 4DSKA 2PSZA 2CJXB 2J7UA 2C2NA 4Y3CA 4MFBA 3J80U 2DNYA 1DY3A 2AYGA 1LW0B 1CVJA 1NK4A 3R2CJ 4X84A 5HQ8A 2JZ5A 1RTIA 2FJVA 3AJDA 4XK8C 1RAAB 2Q3PA 4RL1A 1IR0A 1R8BA 1QJHA 1WSVA 3NBPB 2RUSA 1HHTP 1YLXA 4MYTA 4ZOSA 3DDIA 3KLGB 4DN9A 1UA0A 1XMBA 1X4EA 2KFNA 1YK9A 3TJ9A 2HNZB 2I5JB 1RHKB 4GVBB 4LREA 4PG5A 3D0IE 2GJFA 1XC9A 4ILMA 2M88A 3CMAS 2ADCA 3LAMA 3J81U 4FVCA 2B9WA 5D4LA 2XO7A 1VBYA 2OMOA 3ZZPA 3TUZC 2UUAF 4K4SA 4Y2KA 3TOQA 3PYGA 1MROB 2C42A 4WPAA 3CCQS 4F8RA 2QMUB 4WFYA 3AB2B 2WONB 4NLRA 1HWLA 3HFKA 4A8WA 2AIRB 1SV5B 3K0JA 2IAJA 2DITA 3OVBA 3R7NB 1S1WA 2LDYA 4OL8A 1PYOB 1UWBA 3BO2A 3HT0A 5J2PA 3M8QA 2Y0BB 1FKOA 2Z2ZA 1FF2A 1U0HA 3OXFA 3TX8A 3TR5A 3CDWA 4PG7A 3TVYA 5C7PA 1UWAA 1S10A 4RBVA 3R5BA 1ITPA 1UEUA 1F2GA 4NPOA 1F2HA 2HLUA 3NWGA 4KO0A 3Q23A 4WE1A 3GONA 1X4CA 2HFUA 2LXIA 2ATCB 5KFMA 4C8ZA 4DFKA 3KJVB 4M95A 2VASA 3GJRB 3UN2A 3OSPA 3IC1A 1KLMA 2KT3A 4PCQA 3ZZUA 3OL7A 1N56A 1WTBA 3CJRA 2C3OA 4RWWA 3DLHA 1VIOA 3I5CA 3ITHB 2ZVSA 5IS2A 1RAEB 2VQEF 1VK8A 5CCMA 5A2QU 2D69A 2R7SA 2OEMA 1V5VA 5DQHA 3RBZA 2RDJA 5G4DA 4AUKA 4L6V3 4TNOA 4CLPA 4C8YA 5J2MB 1HKAA 1Z2ZA 1X5SA 1MWQA 4DPYA 8RUCA 1UETA 1UFWA 5IXUA 5DGBA 1S0VA 4B02A 5AXKA 3PX4A 4OYPA 4DR5F 2OGUA 2VFVA 4AL5A 3MMBA 4ZLJA 2KZMA 2F4FA 3CJTA 3LAKA 1S9EA 1IM4A 2UXDJ 1T05B 2IIHA 2CJQA 3V81B 3H5SA 1P27B 2C3YA 4QIGA 2KXFA 2G0IA 3H42A 4NXNF 4DV4F 1SPBP 1CJVA 2AJ2A 2DBBA 3AY0A 2MXYA 3D1HA 2UVWA 3IRXB 3R6GB 3JTOA 4F36A 3DC2A 3QAUA 5M2UA 4YR3A 3KHHA 4H4KA 2W2PP 3HVRA 4P2MA 2U1AA 4OI6A 1KQSR 1HNZF 5IZHA 1KSPA 1EETA 3W5ZA 2EG1A 1JLAB 3OL6A 5DLGA 4ZN1A 3DLEB 4RJVA 4BWMA 3MM7A 3QIDA 3M8SA 3MR5A 1SL1A 3TARA 3FEYB 2FZKB 4H4KC 4OYBA 1ULRA 2DHAA 4KRWA 1C0TA 2P9EA 1K9MT 1FK9B 2VB6A 2ZUAA 2ROPA 4JI1J 2YX1A 1J5OB 2FHKA 3PYDA 4CLTA 2V8VA 2HHQA 2QRRA 3GFXA 3PJ9A 1XERA 1XWLA 2HFVA 4NEZA 1FVSA 2IFXA 2L3MA 3IA0A 2QLJB 4QIFA 4ZHRA 2LYVA 4WKYA 4M5DA 5IFMA 2HFNA 3HLUA 3N5BA 3TQEA 3D6TB 2VG5A 3NAIA 3D5MA 2DEIA 2PT0A 2A6OA 1TP7A 2MLYA 1S5ZA 4KH1B 2LQ9A 5SUHA 3CCJS 1DTTA 3MEDB 2OAUA 1YJTA 4PRFA 3TEHB 1CJTB 2XMMA 1HI1A 2JH3A 1L3KA 5D4PA 3CUNA 2WW4A 1GX6A 1MWZA 1D9FA 3HMJG 2HHPA 2F4VF 1AW0A 1HL6A 1GT8A 3MFIA 2XYPB 3DXSX 2YWEA 1SB6A 3R27A 1EQMA 3TZYA 2OMLA 2ALZA 2E1CA 2HQGA 5KFZA 2DR8A 2M5YA 2P2CB 2Z30B 3FKBA 3IMQJ 2KFYA 4K4ZA 3OXGA 3R1HA 4K4WA 1QAXA 1R0BG 1IVZA 3HSGA 2KHCA 4ZA1A 4OX9F 3QZ7A 3R5DA 3BBCA 3KNAA 3AAWB 1TL7A 2ABYA 3OR1A 3RU0A 2BR0A 1U1OA 4K0KJ 4FZVA 2N3LA 5KFEA 4QIWD 3RRKA 4CRJA 2ZJRQ 2HVIA 3DRSA 4ES1A 3QFHA 3IR5B 4M5IA 1X5TA 1S97A 5DDOC 2NZCA 4EO6A 4ANEA 1U1PA 1WOOA 4M5NA 4O0NA 4B08A 1GXUA 5D0HA 1JNRB 3RTVA 4AXIA 4IUFA 3NMAA 1VQSA 3H2LA 1RI7A 4OQJA 2C3PA 3JSBA 1VLOA 4H4OB 4C0BA 1N36F 3IWNC 3ULHA 1BY9A 2WSFC 2HVHA 1V6HA 2G9OA 4LVNP 4K4XA 2YKAA 4X66J 1AB8A 1FDBA 5IC4B 4DR4J 1T11A 1TKXA 1MMNA 5CYQA 2EG2A 2E5GA 2K3KA 3A12A 4QR1A 5A8KB 2AEJA 3GPAA 3RZAA 5IT4A 3PW4A 2QSWA 4ID8A 1YJWS 2R2TA 1S4EA 2IY5B 1M1KT 2HQDA 1RT6B 5KFTA 3HHDA 1F9FA 1VDHA 2GJ2A 2WSEC 2I38A 5CZXA 3JS9A 1AROP 2VC0A 3NOGA 4ATNA 4BDPA 2UUCJ 2HZAA 1WACA 1IBKJ 2AJ1A 4Y34A 3TYTA 4IFVB 3L4BC 1JKHA 2ROEA 2MSTA 5KFFA 2CPIA 2AHOB 3O5TB 4UOHA 5A0YB 3HPOA 2VG6B 4RZRA 1X7VA 2J6UA 1RAIB 3MM9A 3VCDA 4ICLA 2FC8A 3PIOQ 4LSNA 2OI2A 4DV7J 4LFCJ 4K50A 2NXEA 4MKVA 4MJKA 3W60A 3E01A 4AD6A 5IQQA 2M52A 3ZZZA 1FXLA 3D6FB 3M6VA 4X66F 3DLBA 4DV3J 1H73A 3WIUA 5DGAA 1TL3A 2A18A 1C0TB 1QD1A 3K5PA 4TY8A 5I3PA 3ADAC 2ZD1A 2WSCC 3CCWA 3AJ2A 1MU2A 3I0SB 4I6WA 4WXOA 4QQBA 5F9LA 2W9BB 1NKBA 2UP1A 2C22A 5JMNA 1RU1A 2IJFA 3PCOB 1N48A 4ZHRB 2F65A 1KONA 3R3TA 3LP2A 2KO1A 2K1RA 3PTWA 4MMOA 3CCVS 4FPRA 3R7BB 1CG2A 2VH7A 4X4OA 2VOOA 4U7UD 5ETOA 3HT3A 3Q8PB 2VFUA 4X4RA 2RS2A 1N34F 5KT6A 2ZE2A 1UKUA 1S9GA 1NJWA 2CJKA 2O67A 2OPPA 2O3DA 2HQCA 3P4UB 1FRIA 1M5SA 5KG3A 4FS1A 1LOUA 3DFEA 3ZZYA 2BOPA 5DETA 1U49A 2PC6A 2DTJA 4NEYA 2W2QP 4JI6J 1VQNS 1GNKA 2YWFA 1TKTA 4FDFA 2R4FA 3KK3A 1GEHA 2LA4A 3M6UA 2CJAA 2B3TB 2Y9HA 4ZCKA 2QT7A 1HNVA 1U25A 2KYZA 1SH2A 1UVJA 3PIPQ 4YS2A 1VQLS 3C15A 5K5MA 5LJ3Y 3DHXA 2E66A 3W65A 2KB2A 3Q22A 2QE5A 1NDKA 2NUHA 3CD6S 2P6TA 1T9UA 1VHIA 2DGVA 2V8HA 3A4TA 1L3VA 4MTPA 5C42A 1RT7B 3AD8C 4RW4B 1YKWA 1A6LA 2KU7A 1WC1A 3OJSA 3I82A 2BVZA 1VRTB 3KLIB 1R3NA 5AT1B 4U7UK 3KHLA 2E5LJ 2JRSA 4N56A 1REVA 3CC7S 2DNKA 5KFNA 4FBUA 5F3TA 5IWAF 2CQGA 3DGPB 1SJ1A 3NNHA 2DT9A 2YWWA 2UXCJ 3PKYA 3PW2A 4EBDA 3KLEB 1FRHA 1OPIA 2ZITA 1RTZA 3MM6B 4QPXA 4LF9F 1IWGA 3GU0A 5KG5A 3W61A 5B0AA 2FLPA 1PYTA 3J7ZT 3TUIC 2IDLA 3I4PA 4QPTA 1GQEA 3QGPA 3MECA 3TVZA 4FPIA 2M8HA 5ETRA 5EX0A 5FD1A 7FD1A 1B3TA 2IJNA 1Q81T 4K2JA 1URRA 2QGFB 1WHVA 1FJGJ 2HMIA 5J2QA 4OV6A 3CCES 2P9CA 2FZGB 4FYDA 4Z37A 2I6WA 2PO4A 2GIRA 3SSQA 1M5VC 2B5JB 2MQLA 1REGX 1T9YA 3FQLA 3VZHA 3PR4A 1N88A 1TK8A 1TK0A 2WK4A 1WNEA 1YGYA 4J9PA 1IN0A 5CXTA 3R5GA 4J9VA 4I7FA 1TAUA 1RTJB 1S59A 2UUAJ 3IBCB 3UI3A 1DBDA 3DM2B 4MK8A 2MPUA 1VS3A 2GMLA 5GADI 3RRGA 1N33F 3PV8A 2EFOA 2DPIA 3BBFA 4QWCA 2XZWA 1T03A 3KUHA 4WP9A 3OW2R 3ETOA 2W8LA 2QO3A 1N4LA 3H90A 1HBNB 2NXCA 3BGOP 1FE4A 2G1DA 3L7PA 4LF2A 5ETVA 5KG4A 4ILLA 4C6AA 4AFFA 2KZZA 2B8QA 3D7SB 3SFUA 4ALZA 1IKVA 3IG1A 1VI7A 4XDDA 4UQGA 4AXJA 1XMOJ 2C2EA 3I56S 4R5PB 3AFGA 4F2RA 3IR7B 4QCLA 1RAHB 3OHAA 3DRYA 1LK7A 4LF8F 4FXVA 9ATCB 4OV1A 2E9TA 3WQPA 4CDIA 2XCAA 1MLAA 2VG7B 4NRUA 4QU6A 2IAJB 1ZTTA 1EB0A 2IYIA 4P9SA 1WHWA 2O5DA 3IBWA 4G65A 4LRBA 3HF5A 3UVJA 2D9OA 1FKOB 2BKOA 3H5UA 2V0NA 3HD1A 2Z4PA 4RW8B 2GA7A 5LL6d 2KM8C 4MKAA 3PNIA 3AXMA 1FDNA 3J7AN 1Y4ZB 4OZLA 3NBPA 1NHVA 5GAHU 4K4TA 3V6JA 4GKJF 2BJ1A 3H0PA 1NDCA 1X4DA 5KFAA 1QSLA 1VRUB 4F3OA 2EWHA 2ZBQA 1WD6A 5DQGA 1K1QA 4CTAA 3MAAA 5A76A 3DLLQ 4JI5F 1XIQA 5HMYA 3MR7A 2XMKA 2ZOFA 2GHWA 3M2RB 2E9RX 1MSWD 3IWLA 3EUNA 4JI8J 2KTQA 2F7VA 3W5YA 4C7QA 2JVRA 3SCJE 4P73A 1K8AT 4OYMA 4ZCLA 1RWNB 1UCNA 1NJYA 4LFAF 3DOMB 2CVIA 2CPFA 2EEYA 4PQAA 5D6GA 1HNWF 4HACB 1KKHA 5E3RA 4WTYA 3QGHA 1KFSA 2MJNA 4WU3A 2MY7A 2BQUA 1KHWA 1Q82T 1JJHA 4RX6A 2ZBIA 3CSKA 2B7BB 3C16A 2HRTA 3HCXA 4KE5A 3ET6A 4NASA 3CCMS 5FJ4A 1PKUA 1U0HB 1AT1B 4IQXA 4CH0S 1AXQA 1UMJA 5D15A 1C0UA 1KC8T 3T9NA 1UFLA 3JAMY 2W9AA 2I0XA 5LMUJ 4DR6J 1YX2A 4C2MA 1RT1A 2OPQB 1QAYA 2D3UA 3KK2A 2H48B 3T1YJ 5AE1A 2CKWA 3ZTRA 4P71A 3FJ2A 4DV0F 2R2SA 2QA2A 3LPYA 1HWJA 2W2NP 3OUYA 4DV1F 2KVQE 5HLFA 3QIPB 4X62J 1VQ8S 1FHTA 4HH1A 2MKJA 2ACYA 3H7HB 2QA4S 1H6KX 5HVGA 1TTHB 2W7OA 1I94F 1UJ6A 2BW2A 3UDLA 3CJKB 3BGRA 3HFZB 3SMZA 3ZZ0A 1RGVA 1Z2LA 4PPZA 2ZHAA 1SL2A 4KJIA 3D54A 3QGGA 1KBRA 2FZCB 1R8CA 1UEKA 2DJWA 1F9EB 2LA6A 2BE9B 2PEHA 3MMCA 4MIBA 3TJ8A 3J7YI 2IMWP 2IVFB 3GLJA 4P6QA 1UVIA 1I51B 4IOAQ 1NDLA 3K2YA 3GB0A 4NXMF 2MHEA 2QLBB 3RBDA 1S6QB 3AD7C 2W1BA 3M8WA 2FVSA 4M5MA 5LMNJ 2EFGA 1T9VA 3IGNA 5KFYA 3JSMA 2BJDA 3W8PA 5FLXU 4RNMA 1UA1A 4X62F 2RF2B 3QWUA 2PD1A 3VAHA 5KG2A 4UF4A 2DHGA 4C3KA 4DV1J 3NGTA 5F8NA 4BC9A 1BC6A 1GXTA 3IM9A 2HK2A 4USMA 2NCKL 3K7RA 1H0HB 2VKRA 3DOLB 4OYAA 5EDWA 2XS5A 3RR7A 5C25A 1SUQA 1VQYA 2MZTA 4IG0A 4CLFA 4DQSA 2GQQA 3M30B 3MF5A 4CO1A 2FJDB 1VK3A 3KUEA 2CZVC 4L74A 4N8NA 1UZHA 3CDAA 3G2XA 3VVTA 3QRPA 5BYQA 5DJBA 2DRAA 4FYXB 4EO8A 1BWVA 3VALA 1EAYC 3NRBA 4NMXA 4NA1A 1I1GA 3PYFA 4P52A 1D8YA 2ZDPA 4USWA 3M2RA 1A7GE 2KJWA 3P49B 2V6AA 1HPZB 1WDTA 4OLOA 4CZCA 4I56A 5CYJA 4DUYJ 4V1Ak 3MOZA 1S0OA 1BMQB 1W25A 3I87A 2LXFA 4I1TA 1KQFB 2MZRA 3QAEA 1RT4A 4RNNA 4CLKA 4Y2IA 3BYRA 3GV8B 1U48A 1BQNA 2PMZD 2OP5A 1Q95G 2XS2A 5D77A 1IBLF 1S12A 3T1HJ 5J2NB 1XNQJ 4PKDB 4Y2AA 3MDFA 1VYAA 5M2PA 1SBRA 2WBRA 1RWXB 4JI5J 3DU5A 3B82A 3TWZA 2ZZTA 1JQGA 4NYZA 4P2FA 4F2SA 1IQZA 1EKRA 3BEGB 4CO0A 4CM2A 5D0GA 3Q8QB 2HS0A 2V8PA 4TYAA 2W9CA 2BOAA 4ZIVA 3MCMA 4NOHA 4O4GB 4QYZJ 2RU9A 2OIHA 2R8IA 3N0VA 1XBWA 1SIWB 2NPFA 4BHQA 1RADB 4O3SA 4XTTA 3T19A 2JC1A 2UXBJ 1N32F 3BJYA 4HTIA 2DISA 2GHPA 2V94A 5K8OA 1RYSA 4B3RF 5E33A 4JBCA 2OD4A 1R43A 3JYTB 1FERA 3S6EA 4B3MJ 4PABA 1S6PA 4UZCA 1V5IB 1FESA 2JDJA 2Z0GA 3D67A 2IRXA 5CHCB 3FRZA 3G6YA 3EVMA 4J9MA 2BE7D 4JI4J 4A46A 4NCGB 3GFYA 4DZ6A 2CADA 4F26A 7FDRA 4IFYA 3MPDA 4ZP9A 1ZA2B 2AF6A 2DNGA 2M7SA 3AT1B 5G0RA 3EX7B 3Q0AA 1RWWB 1TMMA 2DXDA 3I0SA 2NREA 3N01A 3UR0A 2UUTA 1X9MA 3PZPA 1MWYA 5E2QA 4GRSA 1I94J 3X3UA 2AU0A 1RHMB 2FJXA 4J9RA 4I0WA 4DUTA 2VBXA 4ES3A 1JLBA 3VAGA 2EC0A 1S9FA 2AX0A 1F3FA 2RQMA 3UDEA 3T1AA 4IQMA 1LWCA 1HARA 1PIEA 2LFVA 2R7XA 2YVSA 2Y1JA 2B4OA 4ZVFA 3CVKA 1S4FA 2JX2A 1S48A 4J9KA 4U96A 3FVYA 2BE2A 3IR6B 3KDOA 3OFEA 4Z7CA 2EKYA 3H8YA 3QPIA 2XZTB 4CQ1A 3NP5A 4LSLA 2VKZG 4LRAA 4ED1A 2QA1A 5CAAA 3BREA 3NY0A 1UPMB 2ZH9A 1T3NA 4DU7A 4QYRA 5GAEI 3R5AA 3ZZTA 1U4BA 1EZZB 1GMVA 3V6DA 1RDRA 4X4PA 3K89A 4OJ1A 5L9XA 1U0SA 1SQGA 1ELOA 4F4ZA 3EE3A 4LBPA 2GO9A 5D3GB 3BGFA 4PG4A 2H4YB 3QT6A 4PG8A 2AZ3A 2J9CA 2FIUA 3VAKA 1CBKA 1OMSA 2C3MA 3M9OB 2Y8YA 4A8QA 2D7SA 4RW9B 4PQUB 1DAXA 1MMDA 2GS8A 2YPYA 2KXHA 3ITHA 5F8HA 3NMRA 1XK8A 5J2PB 1KRPA 2ZH2A 3DGVA 1YBUA 2KT2A 4WWSA 1EARA 1HLWA 1HBOB 4L3KA 1HYSB 2F5GA 1NPPA 1AUSL 2QN6B 2XI3A 3CJ2A 4IYQA 3SBMA 3HSZA 2ZFHA 4ZVSB 5THWA 1AFIA 1WUUA 2W9CB 1LXJA 1YWXA 1ZM4A 4AT1B 4DSJA 2XEXA 4KTQA 2G0JA 5DZ7A 1S9EB 1X5OA 4FYYB 1NB7A 1PAUB 4FN5A 3FGVA 2Y0SD 2VF3A 4O44A 3J7YU 2ZHBA 4KH0B 4TU9A 3PW5A 3UQSA 1HR0J 1N5QA 2LLZA 4RUBA 4DX6A 2XS7A 3RB6A 3TA2A 4ER8A 5KFIA 4NCBA 3T5JA 4LUBA 3G96A 4JYAF 4FF2A 4HTJA 1K73T 1CSJA 5K9FA 2YNIB 2RQ4A 3VGSA 1FTRA 3R2DJ 1C1CB 2OPSA 1JXLA 1R31A 3FBEA 3DLEA 1RABB 2GV1A 3ZZRA 5DG8A 3GR1A 3UW1A 3SZ2A 3HVTA 1OS5A 4K5RA 3RG6A 3UCUP 1HNXJ 3HZGA 1F6TA 2LQBA 4DLEA 4ZPVR 3PJXA 5ETLA 4HHHA 1IKVB 3IG1B 1AA1B 4DL2A 3MM6A 1IBLJ 2JJ4D 3NL0A 4DI6A 1FJCA 1HFEL 1HNIB 1J5OA 4M94A 1SCJB 1YDLA 2CXEA 2EFVA 2PI5A 2J0SD 1RZMA 4ZK7M 2DGTA 3RW6A 4CLZA 2CQPA 1U45A 2UUBF 2COLA 2NZ4A 1IBKF 2W25A 4RR5A 2IM3A 1FJGF 5I42A 2VV5A 2EXUA 4ZVRB 3QATA 3T1HF 4TN2A 4KHMA 4EUVA 1R0CB 4I68A 4DSIA 1VRQC 4NLWA 1Q86T 3FEXB 2YNFB 5DLFA 2X1BA 2CQBA 3NKYA 3QZ8A 1U1RA 3DMJA 4KC5A 3G8TA 5CZVA 4DBQA 2BW7A 4WFXA 2ZBCA 2DNPA 4J37A 1HD1A 1UP1A 3OD2A 4HHJA 4NWBA 4PWUA 2GCFA 3IFEA 5KFCA 2ZBPA 3I32A 2V4QA 4J91A 1HNXF 1O5JA 2OD6A 2IMOA 3NGDA 4J9NA 2ZH4A 2Z8QA 3U1LA 1VBZA 5DG9A 1NCLA 1KWMA 1V9OA 1NH8A 1VFJA 2FJBB 3MM8B 5M2RA 4LRDA 2EW9A 2N4CA 4N47A 2R2RA 5EGYA 2RQKA 3M1VB 5A6PA 3LQVA 2BJ7A 4DSEA 2X3DA 2IYGA 2Q43A 1WHXA 2QV6A 2EVZA 4ZN3A 2KM8B 2X1FA 2UV8G 5J1EB 1QTMA 2CPZA 3FNNA 3LH2S 3PX0A 4B9SA 4Q2MA 4K0KF 2ZEJA 3P6YC 2CIMA 3KXDA 2GO8A 2UUWA 4HI1A 1HQEB 2ZHOA 5MLCV 1JLCA 4ID5B 4E0DA 4RW8A 4USUA 4PYDA 4WK3A 3ZTOA 3SSSA 1EP4A 1HBOA 3HHLC 5KG1A 2ASJA 4MIWA 4OHXA 2ZH6A 3SDEB 2AYBA 1SL0A 5A8KA 2KXNB 4B9NA 2F63A 3CJ4A 4Q7AA 3EMTA 4DX5A 2R9LA 2UU9F 1JX4A 2DEJA 4KPCA 1S7IA 5FLXY 1SXLA 5T7LA 4DV5J 2YWKA 1HWKA 1NPKA 1S1VA 1G4CA 1M5HA 2FGCA 2PN6A 3C14A 4U67Q 2CQIA 2AKWB 1R0AA 2MKYA 4YN3B 4NRTA 1NUEA 4DR6F 1S77D 2UVVA 4G1PA 2F1FA 4WCEQ 3EYZA 5JVGQ 1LKZA 3BBBA 3DOMA 3QJJA 2Y3YA 5DG7A 4A8MP 1NEEA 1Y11A 1QAJA 1V3RA 3BQ0A 1WC3A 1C4AA 3Q8SB 3D6HB 4S0MA 2UXCF 2BABA 2P5VA 4ZPDA 4ZDNA 4ZCMA 5LSLA 5C5JA 1TFWA 1NO8A 1V3SA 5DDQC 3FMWA 4WFAQ 1WC0A 1FNXH 2NPIA 2K06A 1WI6A 2BKNA 2VBYA 3HKZD 4WK1A 3UPFA 2K2PA 4ED4A 1R6VA 5A8WA 3IWXA 3PDNA 5BYRA 3PKMA 2G1HA 3NGUA 5E41A 1WELA 2A6MA 1RA7A 1RK8A 4OYWA 4L76A 2GMHA 1KOHA 3MTKA 3NOCA 3OUYB 1LW0A 4X4QA 2VDHA 4DF8A 2C28A 2IRYA 2VG6A 2QG9B 2AEFA 3FRYA 4C8KA 1HMVB 2E7XA 4OHVA 3O3LA 4F0HA 2EBEA 4HDGA 4K4UA 5C24B 1SC1B 2HS3A 1MW7A 3NGKA 4OZ0A 2ZH7A 2Y1IA 4OI1A 1RP5A 1KNZA 2XB2D 3KLGA 3K8WA 1TKTB 4GKKJ 3KK3B 1Q79A 2VZ9A 2V67A 2LEAA 3I5AA 3FMBA 2ERRA 4CT9A 3UNGC 4MIAA 4QJVA 2MGZA 4U7CA 3CMQA 3LTOA 2YX7A 1IKXA 4LIRA 4W4MA 2J8AA 1LV5A 4WFNQ 3ISND 5CABA 4BLGA 3IS9B 2I8EA 2G2YA 1XMOF 4CH1A 3MOJB 2XG8A 2HHHJ 1Z1ZA 4A8XA 2Q66A 2Z58B 1HQUB 1FJEB 5L8RC 3C2PA 2JSXA 3DLJA 4JI3F 2V69A 2OKQA 2UXBF 1BQXA 2DR6A 1N6QA 4U8VA 3PJWA 1RTDA 3KNGA 3S01A 3GQCA 4DV3F 1KLNA 4DQPA 3BKFA 3GSDA 1VMBA 3MPWA 4F50A 1PGZA 3M8QB 2LCWA 2BJEA 4IDKB 1L3UA 4OZ1A 3D4JA 3M30A 3SI8A 2CJBA 1EP4B 3QNWB 1T94A 4PR6A 3P5BP 1S1XA 4YDDB 4AE5A 4Y00A 4YY3J 2OO4A 2CPHA 2R3VA 5H9EJ 1CLFA 1CPZA 2CPJA 4KO0B 4KBIA 2MKKA 2XNRA 3OTEA 1RCOB 3D6MB 4UY8T 2B4UA 3HFVA 3O6QA 4WU2A 3BM7A 3KJVA 4OIXA 1SC4B 2FLOA 2KT5A 1CJVB 1LK5A 2HVZA 4CLUA 4NXMJ 1HPZA 3SCLE 1OY8A 5AXLA 4B9TA 2P6SA 1VHFA 3G87A 4ZIWA 1DTQB 1VRTA 3KLIA 1UVMA 1D3WA 1V3ZA 5IM0B 5BR8F 4PAAA 2FVRA 2V4JB 1YBTA 4UOCA 4DLGA 3PFEA 2LEBA 2HIQA 2VA2A 4ZMMA 2E5JA 3M8PB 4IH6A 1SKUB 3QGIA 4DUYF 2N4DA 2V2KA 3KLFB 4RNOA 4HYKA 3BZQA 4FBTA 5ETKA 3BN4A 3AJ1A 2QL7B 1RU2A 1T03B 2VD3A 3I31A 3MMAB 3BGLA 3W62A 3A13A 1SH0A 4DS4A 3T9ZA 3PHTA 4B9LA 2H65B 3MECB 2JEGA 2HAIA 1VQOS 4Q44A 2VFSA 2G4BA 4WZQA 1TR0A 2HMIB 3D2WA 4LBHA 4ZVPB 1B0PA 2RRAA 4R5PA 2LXUA 2Y1RI 2V2ZA 4LVOP 1RQ0A 4OHWA 4WP3A 2RQCA 2B5JA 3CEDA 3VAMA 3BR9A 2HQIA 2R8HA 3L3CA 4OX8A 1IM6A 1GTEA 3FBFA 4CO4A 3AQOA 3Q2TC 1KVJA 1WSRA 3NS6A 4M5LA 2FY1A 2MLXA 2APOA 2HRYA 3AOAA 4OZ5A 3JSYA 3FUYA 1B0TA 2HQFA 3BF4A 4M63A 4F67A 3R1LA 4WXWA 1I5OB 2PEBA 1LWEA 1CJKA 1WG1A 2W01A 4MAKA 4HH0A 4O0IA 3CCLS 3W8GA 4NCGA 1RT3B 1XMQJ 4OZ3A 2HWHA 3SCKE 3G8QA 4KHRA 6AT1B 2VHGA 4F4WA 3LANA 4MK9A 3J81Y 6FD1A 4TQRA 3TAQA 3QT5A 3TAPA 2PI4A 2KJVA 4NX9A 5CYMB 2ZH3A 2E29A 3OJUA 1RT2A 4L75A 2EBGA 1PG5B 3PY8A 2FTRA 4KIAA 1U1KA 1VQKS 4O3QA 1N5VA 3U02A 3KTQA 3RW7A 3RAXA 1IKXB 2VQFJ 3VVUA 2NQPA 1S1TA 3OVSA 1FCAA 2GIQA 4KY3A 4PEOA 3G6XA 5ETNA 1R8PA 4WBFA 1X4FA 1R7IA 4NLSA 4D3HA 5HJXA 3C19A 5I3UA 1GMUA 1U02A 4F25A 4G3IA 2JLGA 1S1UB 4KV8B 5CCLA 3PW0A 1CQMA 1IJFB 3ISZA 1LQ9A 4YFUA 2C2MB 3T1YF 4J9SA 1YJ9S 2EK1A 4LFCF 2YKPA 5D8HB 2KDOA 5AJ3F 5CYQB 3GJSB 2VJUA 4Q8FA 1FKPB 4O3RA 2YPZA 1SQEA 4OFZA 2J76E 4DV6J 3JB9k 3Q8UA 1RHRB 1NK7A 1NKCA 3TX0A 2IM0A 3W7BA 1RT6A 3H59A 1CJUA 4X4SA 2XCPA 2QLFB 4EBCA 3V4IA 4ZVUB 2GJIA 3K57A 4R0JA 2RIJA 1DZ5A 1LFWA 2GW8A 1F3VA 1I3OB 2CPEA 3KMSA 2YH1A 4QIEA 1XTZA 4TY9A 1SQFA 2YQ3A 1L5UA 4LF6F 1OY6A 5GMDA 1X31C 3Q86A 2RHQB 3O1LA 4JOUA 3BB5A 4HACA 4U9RA 4I2QA 2D3ZA 1VC5A 2GIFA 1OQ3A 5B0BA 2JOQA 1U8WA 2IDEA 5HI7A 4CO3A 4LQ3A 1MN9A 3AA8A 3CCZA 4DL0C 2JC0A 1BQMA 5KG6A 4DN0A 4YP3A 5KFUA 3WDOA 2LVWA 1KD1T 2AYMA 2RSQA 3LP1A 3DKDA 4FKYA 1MN7A 4RNFA 1U2RA 1T7PA 1HNIA 4PUOA 3EJMA 4RPFA 2HK3A 2KN4A 2QFIA 3HSDA 4JYAJ 3MPUB 4DV2J 1Y10A 4LIWA 3RBXA 3OPKA 3CXCR 5BXIA 4ED5A 2RS8A 3AB4B 4QR0A 2HHXA 3CJ0A 3MZIA 4C8NA 3ZC4A 2GGPB 4JI0J 4KT0C 1KQKA 2GNKA 3VR1A 3ZNUA 2N3OA 4QWEA 2C2RA 2GQCA 1IR2A 5KT7A 2KHDA 3JSMB 3P45B 4B3OA 3BH6B 4OYIA 4P2XA 4ZPBA 1U7LA 1GTHA 3DLKA 3JQKA 5J1NA 2ZE2B 5IC6B 3BSNA 2XNQA 3HSJA 1H2TZ 3MAQA 3S8SA 2LQ5A 3L95X 1WC5A 5KFLA 4L73A 4NZ6A 5HQMA 3DMJB 4ECSA 3MM9B 5EWGA 4WJBA 3BDPA 2F3JA 2J0WA 3ENAA 2BRKA 4C0OC 4DV2F 5C25B 1X4HA 3OT9A 4Y0FA 2EFNA 2HNDA 2YNGA 1FKAF 3VZIA 3GV5B 3BR8A 4FXDA 3SEOA 1S49A 1WDDA 2HQ3A 1ZAWA 5A2QY 3MD3A 4DCPB 1CS4A 4I6AA 4TY8B 4DUZF 3V6HA 3JQMA 2HHTA 1D9DA 3H25A 4ANCA 4YOEA 1QM9A 1JLEA 2GFFA 3TO8A 1SKSA 4LFBF 4X4UA 2WONA 2Z2LA 3N6NA 5HMXA 1E6VA 5KTQA 4C8OA 2F4VJ 3ENQA 4JI7F 3DGPA 5KFBA 5KFHA 5HK4A 1FD2A 1FD8A 1WEXA 3PRBA 4NL5A 4P7VA 1FTCA 4NLDA 2R8GA 2VJVA 1CEZA 3NCRA 5KFRA 3A8KA 2V9KA 4KKOA 1NSKL 2CG4A 3PACA 4ILRA 3W2WA 4DV6F 3TUPA 3GIIA 2IBKA 2FHMA 1KQGB 3QT8A 3UWTA 2MQQA 4D3GA 5HP1A 4L3NA 2V8DA 1U1MA 3I55S 1KN6A 4QW9A 4DR4F 5HAOA 2GAHC 1H72C 3Q24A 3VF0B 4HT5A 2HWTA 3GTYX 3GYXB 4DWIA 2KL8A 4ZPTR 5DS7A 8AT1B 4YQWA 4O23A 4JI1F 2PGCA 4X4VA 2C1EB 2E7WA 2AJ0A 1FNMA 2HVEA 2L08A 2I1RA 3TP2A 3EZ5A 2JLFA 4FNIA 4NYOA 4EYHB 4JV2A 1SJRA 2DY1A 2EPIA 1YQHA 3HK2A 4BBYA 1NAQA 4KGXB 4JV5J 1G2EA 2V68A 2DGSA 1P9YA 2DNHA 2NR0A 1JXEA 1SI9A 2WVFA 1TFYA 3RUBL 1YHQS 2VPZB 2BJ8A 1AYEA 4LRCA 4ECXA 1U6BA 4ZP7A 1JXVA 1TV6B 1K1SA 1TMJA 2R7RA 5L9NA 3CCSS 1HR0F 3NNAA 4KGZB 5D78A 5LT5A 3JSRA 2E44A 3CWJA 5T14A 3OTBA 2JVOA 3DCAA 4YB7A 3PEHA 4IR9A 5E3QA 2DGXA 3LP1B 2AGQA 3UE2A 3N79A 4NLXA 4OI3A 4X2BA 1UW4A 2CPXA 1SH3A 3UFCX 5EUHA 3SDEA 3B4DA 4B9VA 1FO1A 1BGXT 3OTOJ 4LF5F 2L48A 2QZ8A 5KFVA 4MH8A 3DYAA 1TZ0A 4ZVEA 1W2IA 2I9SA 5T7LB 3HHKA 2CNLB 4WFBQ 3MCSA 1WG4A 4UOFA 5IT0A 1SJ3P 1VQ5S 1LWCB 2XY6A 2IJRA 2OPRB 5KFWA 2N82B 4ELVA 1U26A 2RU3A 3OLBA 4LF8J 2E1RA 2HEKA 2CQHA 2ROGA 3VAIA 2DGUA 3MM7B 2KVIA 2W2OP 3KLVA 2B9XA 2CQ2A 2BA9A 2RNEA 1F5AA 1UVLA 2KYXA 3QSYB 4IG3A 5KFPA 4RW6A 2DB1A 4ZVTB 2XGQA 3DDKA 3NNCA 4YEAA 3QLHB 2WTFA 2IM2A 4NZ7A 4PYAA 4USHA 3PXGa 1NJZA 4W92B 3HHNB 2V8GA 2AJQA 1QUPA 2ZKUA 3M32B 1Q8IA 4XO0A 4CO5A 5KFKA 2MGZB 1Q8BA 5HMZA 4DF4A 1FX4A 2DHXA 3KWMA 1X60A 2OSQA 3PG9A 5ETSA 2XSFA 2YKMB 2B9EA 1FEHA 1TUWA 1D0EA 2HZCA 2MSSA 2R7TA 2POKA 2RMLA 4QOTA 1DTTB 3MEDA 1O8BA 4HI2A 4DCJB 4DQIA 3BGUA 3VTIA 2GQ2A 4E98A 4TKTA 1R89A 2FGOA 3X1LB 2V34A 2ZZMA 1S76D 1YSJA 2E1PA 2PIIA 3O44A 3EPGA 4ECWA 1KP6A 1X0PA 1ZPWX 2R42A 3L9ZA 4ES2A 5C24A 2J5AA 2Q1LA 3BV8A 4EI2A 1YI2S 1RB0A 3MI7X 5IQ6A 2XM3A 3DOKB 4I67A 4LFBJ 2YY3A 2G2OA 1HBMA 2RKIA 1BLUA 1CC7A 6FDRA 3GZ7A 1GK8A 1OSDA 4G1QB 5D4NA 2ZM6F 2VBWA 2N7YA 5KFQA 4DR2F 2ZC3A 4ZS6A 4P75A 2DNRA 5A6WA 4OJGA 2AWZA 1Q5YA 4MK7A 4IH7A 1D1UA 3OTOF 4DFMA 3PX6A 1RKJA 4LF5J 3MXHP 4O44B 4TQSA 5KFDA 2CNOB 4LJMA 2H54B 2JEJA 4LF4F 3H40A 1HQUA 3R6LB 4P7TA 4QW8A 2XMUA 4N8OA 2FLLA 1ZAXA 2W4DA 3WC2A 3G82A 3MM5B 3H5XA 5KT2A 2MQMA 2HGMA 1IKYA 1G7CB 1C1CA 2OPSB 2XWXA 2ZOGA 3A8JA 3ILJA 3M2UA 4DG1B 4ZKAA 4KQZA 2ZM6J 1Q7YT 1JLFA 2JFDA 4URGA 3H4DA 2DRBA 3CPWR 4JI6F 4Q43A 1KVIA 2R7WA 1X8DA 1YJVA 3KJNB 4R25A 5ETQA 5EX3A 3ZTPA 4CLSA 3J80Y 1RT1B 4WIQA 4ECZA 1XNRF 1FFSB 2F8EX 2RDIA 3MPVA 4CI0B 3I0RA 2DRDA 3C6TB 3AODA 1LWFB 3GJQB 1X4BA 5A0YA 4DMZA 3NLCA 3PHEA 5F3ZA 5HLFB 3FCWA 4OMFG 3TZZA 2ZJQQ 3LF0A 3D28A 2DXFA 3LW5C 4PXCA 2RT3A 3LGNA 2ZH5A 3DI6B 2JHEA 3GSIA 5LMUF 3QJLA 1LWEB 3D1QA 1K0TA 2HS4A 5FIIA 5I3QA 2MQPA 2BQ3A 3M8YA 1NK5A 4CCHA 2HHUA 3CO0P 3U1MA 5LJ5Y 1RWPB 3H98A 2CQ1A 4KGKA 4RUCA 4UUWA 5HANA 1NK0A 2IA6A 3Q8VA 3BKTA 4WF9Q 2L9WA 2RHSB 4C98A 4ENOA 2J7KA 1BD6A 1OY9A 5ETPA 2DPJA 1GMWA 2M0GB 1U8SA 4M8LA 4OI0A 4USVA 2H3EB 3LGMA 1DQ8A 5HROA 1RT4B 4X64J 1FRKA 5LMNF 1S6QA 1Y00A 2J8SA 4P10A 5GMEA 3UO0A 3VAFA 4OHYA 3D3CJ 3KJQB 3GYGA 3NWRA 2RF2A 2XMAA 4MKBA 4I4BA 3EDRB 4DV4J 4RBTA 1IR1A 1YG0A 2V4RA 2G0CA 4V19X 1TU0B 2M70A 3OLAA 1MNEA 3LWLA 4TLRA 3QSIA 4WYWA 4JP8A 1NJXA 1YZ7A 3L09A 4YHHF 1HQEA 3KDNA 3I6PA 3HHLD 2CQ4A 5E3AA 1RTHA 3ILOA 1LFPA 1FKPA 1RBOB 4IG0B 1WF0A 1RXOB 5DM7Q 2C2DA 4NMLA 2YKNB 4B3TF 2GAGC 2V50A 4HEA9 4ZVHA 4DPUA 2B51A 3Q2SC 2CQ0A 5C2CA 1DARA 1HBMB 3H2VE 3M2VA 3GE9A 4HL9A 1CULB 2B0GA 4HVZA 2V2VA 1S6UA 1PCAA 1SC3B 4KAIA 1RKIA 2LQ8A 3MM8A 2YX4A 4CT8A 4FF4A 2CJYB 5CYMA 3MEEA 2V63A 4EU0A 1KLMB 4ZLNA 4LF4J 3VGTA 4RW4A 1BXNA 1UAWA 4USJC 2LU1A 3KJFB 4DSLA 1Q5VA 2XMTA 3KKFA 1NPRA 2YWGA 3M4XA 4KHPJ 3OTDA 4DU8A 5F0WA 2LECA 4U8YA 4DPXA 1JLCB 2KRBA 2ZH1A 3GYNA 3KLEA 1TKZB 4IFYB 1HWIA 1WF2A 2GVDB 1OSCA 2NLWA 1FI4A 4EWTA 1QVFR 2Z2YB 3ILIA 4WYLA 2ZKTA 3V6KA 1N5YA 3EDQB 4JV0A 4F0KA 3PRVA 1KVKA 2CAJA 2VIHA 2FJAB 4LF6J 4J90A 1TUVA 2DO0A 3LALA 4OI2A 1JLQA 3VAJA 2K7JA 3ZFVA 2O1PA 1NSAA 2C2OB 2JL9A 2Z2MA 3TAMA 1FRJA 2KFZA 3W63A 3EICA 1X0FA 1SKWA 2M2BA 2UUBJ 3OTCA 2NXJA 4I7FB 1ZBTA 3VGVA 1LWFA 3ILLA 3B8HA 1VQ6S 2BE2B 4ETXA 3IRXA 3N6MA 3GG1A 3QMQA 4PPDA 3RAMA 3F73A 2BQRA 5EN1A 3DRPB 3BN7A 2EI5A 3CGIA 4FXWA 2WOMB 4OLPA 1ZZNA 1VQ7S 2HNDB 1IBCB 5HVFA 1FRLA 3A8IA 1YVFA 3KUGA 4DZDA 2QL9B 4C3LA 3CDUA 4Q8EA 4K2XA 4ZPCA 2FY8A 1N36J 2VFRA 2W4CA 2FJEB 3EVOA 3QO9A 4ED6A 4Y2CA 1FRMA 2ZVIA 1RT5A 4A8KA 2MB0B 3I96A 5A8WB 5K8PA 1U09A 3UN3A 3SV4A 2RJZA 4K59A 4OI4A 4ZVOB 4M5DB 4DCOB 5IV4A 1HHSA 3M6WA 2VG7A 4Q0BA 3TUJC 4K8RA 2Q79A 4WP8A 4C9DA 1S6OA 2DCUB 1HMVA 2ZH8A 1U1NA 4B3OB 1BHNA 2ALYB 2D74B 5KT3A 3DNCA 3ENVA 4C0HA 5RUBA 1QE1A 1CJTA 1S7HA 2BACA 2QX0A 1HW9A 5LXYA 2NXNA 2FVPA 2L41A 3SQGA 5ETTA 2FHJD 1HYSA 3PM9A 5CH7B 1N6QB 4EEYA 5KFOA 1FJ7A 1C1BA 3MUVP 2RE1A 5HP1B 2X3GA 1XEZA 2DH7A 2H51B 3QFWA 4URQU 1OYEA 1H2UX 3MAAB 4WTOB 2H9ZA 5U47A 3N5FA 1WG5A 2YKNA 2M9KA 3A3OB 2QL5B 4ZVGA 4YUDA 2AEMA 4ELTA 2IM1A 3BDEA 5FDLA 1TQLA 2EK6A 2WBMA 2DNZA 1FWLA 3JTPA 1CULA 3VWSA 3QRQA 2HBZB 2A10A 4ANDA 3G6ES 3ZO7A 3Q8YA 2GX8A 5D3GA 1Y5NB 1VBKA 4EMDA 1JLEB 2LDIA 1YRUA 1RCXB 1ZM3A 3HDSA 4LBIA 1OO0B 4EFAC 2HHWA 2E1MC 4A8SA 1SJ4P 2X7IA 3J7Z5 2XLIA 2DVIA 4CM0A 1ZS6A 1N0UA 1T9XA 3Q83A 1E6VB 2CWKA 3OBIA 4ED0A 2D3O1 3OHBA 2ATLA 3IP0A 1LW2B 4RW7A 5CD4H 3CD5A 3WZ0A 3OL9A 3MEGB 3RRHA 4NZ0A 2Q6BA 3TA1A 4IDKA 1FWPA 1WKKA 4H4OA 3D9BA 2EKNA 4KKOB 5F8MA 4DPTA 2F8HA 2OLWA 4AYBD 3MMAA 1F5CA 1S99A 3V5RA 4ETZA 5BR8J 5CD4A 3PR5B 3IN5A 1IBMJ 1QSSA 5A8RB 1TKXB 1IBMF 1AZSB 4HT7A 3KK2B 1NDPA 5MAOA 4EZ6A 1NXIA 4YB5A 3QYYA 3B6BA 1SJFA 1Q1KA 1T3OA 1JLQB 1TL1A 1B4SA 2HNYA 4I2PA 2B4VA 1DTQA 1WWHA 1NNDA 3KG4A 3B78A 1FNOA 2OTLS 1RHUB 4Q2LA 4IFVA 4XDCA 2VICA 2J0QD 3BGRB 2RILA 2HRUA 5H1SV 2B56A 1U47A 2YNFA 2JFKA 3NGSA 4DL4A 2UXDF 1NJIT 3QWPA 4OJ3A 3N6LA 4DQQA 3C46A 1URNA 1P6TA 3W2VA 4DUZJ 2NYHA 5IOLA 4ZJOA 5AXNA 5HVHA 4OX6A 4OYXA 2J7WA 4AQYJ 4AL6A 4H4MA 1WHYA 2E5HA 2MKSA 3RB4A 4EGLA 3DLGA 4QWBA 1Q4RA 4A8OA 4ED2A 3T5KA 1X9SA 3FK4A 5H9FK 3HO1A 3US5A 2MKIA 3VQTA 2P9GA 1XR6A 3DRXA 4KHPF 5ETMA 1FDAA 1H3DA 2C2KB 1G1XA 2W24A 5CQGA 3KLHA 3NGRA 1YJRA 3SQOP 2HZVA 2VODA 4B3RJ 1WKLA 2CWXA 2IA0A 5D4OA 4I6YA 4DFPA 4DR7F 2CQDA 4NI2A 3LP2B 1U1LA 1KTQA 3AOBA 4FP9A 1VR6A 4QWAA 1N32J 4LRFA 4KGMA 3W66A 4MKYA 4PZVA 5DDPC 2OPRA 5BJRA 2Y8WA 1QE1B 2HHHF 4CP5A 4LT6A 3D0HE 2J6SA 1PSDA 1C2PA 3VV2B 1YZ6A 5KT4A 2DNOA 4J9LA 2DD8S 3F41A 2HKEA 5K14A 4LQ9A 3CT9A 3EGNA 2XBPA 1RBAA 2V5HG 4M5JA 2I5JA 2XWYA 4I69A 4ZVQB 3RJMB 3VQSA 5LOQA 4NLQA 2CA9A 4PWDA 2G2ZA 5FDLB 2QTWA 4NLVA 1QUVA 4ED7A 2MZ1A 4DQRA 1XNQF 3CDEA 2AV5A 3GCWP 4F3MA 5JJBA 4J9QA 2AJ4A 1DLOB 4NE9C 5GAEU 2V9WA 2F9JA 2AW0A 1RUSA 3BKUA 3M1VA 2EC2A 1T8EA 1A0OB 2WVDA 1H38A 1RT7A 1R6YA 4B9UA 1F5BA 4OZ2A 1DQ9A 1TUGB 1TL4A 1UJ4A 3O2IA 4I2QB 1FFGB 2XMWA 4DJBA 5ADZA 5J2MA 4OZJA 1RJJA 1LW2A 4RW7B 3OR2A 1FVQA 1WF1A 3ICLA 4X65J 3CIZA 3U1NA 3GIMA 1QY7A 5HSPA 2N7CA 3JAMU 4ECRA 2M8DB 4KR0B 2XLJA 4ECUA 5F8LA 3P3DA 3I9ZA 1IQTA 3MMJA 3H2UB 4PUOB 1GX5A 1U2FA 4HLBA 4X4TA 2MEWA 2IC3A 4DL6A 1SKRA 4DR3J 2A2DA 3M7VA 2KH9A 4QZVB 3NCPA 1AZSA 3T41A 3GIJA 1JWWA 5IV3A 2DIUA 3A3PB 1H2VZ 3GFHA 3VHQA 3ZTSA 3GV7B 1VQ4S 5B0CA 4IOCQ 4IRKA 2VONA 2HHVA 1IXKA 4IKAA 4P74A 4F4KA 2HHSA 5J2QB 2GC8A 4UZBA 1IJEB 1P1TA 2AJFE 2LKZA 5HMWA 2B7CB 1HWUA 1VC6A 2JEFA 3DLKB 1FX2A 4RU2A 3W1YC 2HIYA 1Y0HA 3EM1A 4USIA 1NSPA 2JNJA 2DGWA 4NLOA 4DR1J 3BQ2A 4ZJLA 4YMEA 3L7OA 4CIOA 2B8PA 5KAKA 1IUJA 2DHSA 2VA3A 2PA8D 5F9NA 2UU9J 3HULA 1Y5LB 1PBAA 1XMQF 2UZAA 3MCOA 3J81j 2XMVA 3NCQA 1JLFB 3TI0A 4DPWA 3DLGB 4U6PA 2I2YA 2CNKB 3M6XA 3MMBB 2ZWOA 4UOGA 1RWUA 5LSRA 4RU9A 4F7VA 3EGZA 3M9NB 4R8UA 3E8OA 3N4WA 3OFFA 1T05A 1R27B 4YHHJ 3MD1A 2W7PA 1ZA1B 3LO3A 2R2UA 5D0RA 3I0RB 1U2CA 3FC9A 3I4HX 3RBEA 2QA4G 1UJ5A 5KFGA 3MUMP 4FF3A 4WKRA 2BANA 2DGQA 3CJ8A 3OXLA 2CPDA 3T6BA 3K58A 2RVJA 4N76A 3B54A 3CCTA 4KGVB 1RHJB 1WOPA 2BBEA 4IRCA 1LEOA 2R7OA 2DNMA 1B7YB 2ZZNA 2OELA 2OHDA 3GFZA 2PFDA 1WKJA 2MDAA 5JUMA 2IVMA 3FQKA 4X65F 1S79A 2FVCA 1CS4B 3BO3A 2XLKA 2DXEA 3TQ1A 2GVZB 5HBMB 2RDDA 3GR0A 4DL3A 1KOOA 3SIPB 2NYIA 5K8NA 1QVGR 3MTJA 2B6AB 3TW0A 1PAEX 4NLTA 3CJ3A 1TAQA 1E6YA 2XI2A 2ILYA 2YXLA 1Y3JA 5DO2A 3UDVA 2V2QA 2YKOA 3ZXWA 3IS9A 1ZPVA 4EZ9A 2K3IA 3M8PA 3FCHA 4NLYA 4TVAB 4ECYA 1JNZB 3IO1A 1TKZA 1YJUA 2FHJA 3KLFA 2GVDA 3MGJA 4GC7A 3T5HA 2CFXA 2X1GA 3FDSA 3V2UC 2ILZA 3MEKA 4BC7A 4FS2A 3KOAA 1ACMB 3OR2B 5HN0A 3C16B 1IKWB 1DJ0A 3RGIA 3RYLA 1EIYB 2HYIB 5AJ3J 2LQJA 2P8IA 1FRXA 2Y1LB 5BYSA 1HBUB 3MHYA 3RAQA 2O01C 4E2FB 2FLNA 4NLUA 4YR0A 3HHLB 1RAOA 2J9EA 3FFIB 1D8ZA 3OQ2A 2MYFA 2HWIA 1C4CA 1KDNA 1BE4A 4FYWB 4RO0A 3MEEB 2DHHA 2BYCA 2BM0A 3L7UA 1P8GA 5DRKA 4Z7YA 1PJ6A 4JI4F 3FBCA 1HA1A 4ICLB 3G71S 4LSNB 1N54B 5B7WA 4DOZA 5IM0A 1TV6A 5IT9U 2GHVC 3CW2C 1SIZA 2QIFA 3ISNC 3HKWA 3MCNA 2J9DA 2B43A 1ZOTA 2LU2A 1K44A 4UQTA 3T6JA 3M9MB 4W98A 2HGLA 4GKKF 4ELUA 5GAHI 1Q7LB 2A0FB 2WVEA 5HATA 3WX4A 3TANA 2B4PA 2IRUA 3A1YG 4HR2A 4USKA 3AD9C 1PJ7A 4ZPWR 2HSEB 3W9HA 4JI2J 5IT9Y 1VC0A 1NSQA 4QYZK 2MJUA 1S0MA 5B0EA 1H7XA 4MFBB 4GKJJ 3GMGA 2XHCA 1KTVA 1PYSB 4HHUA 1P1LA 2KG1A 1VQ9S 4A4JA 2AD9A 2ZNYA 4TYBA 3DDNA 5DZ6A 1MROA 1RTIB 4X4NA 4K5SA 2A2CA 5I3UB 2CJ9A 3HX9A 4OJHA 3HJFA 3DRRA 3W5XA 4IR1A 1M1GA 4UT4A 2W7AA 3IAM9 4MYUA 4J9UE 3TRGA 3CD7A 2BANB 1S1WB 3P8BB 3EXCX 3HXMA 1PBUA 1ICEB 1RLDA 1X4AA 1SUQB 2CPYA 1PILA 1SC6A 3R7SB 1RISA 4K4YA 3C15B 2F40A 2HVDA 2CDQA 1NKEA 5IWAJ 4V19J 3K5OA 2D1CA 2YKMA 4GO5X 1MU2B 3KFWX 4QIVA 5D0EA 4BWJA 4WFZA 2W9BA 1PO6A 1EKSA 4U95A 1NBEB 2BJ9A 3BSCA 4IO9Q 3TA0A 5GAGU 3KYLA 1H98A 1E6YB 4JI2F 3A3NB 4NYPA 4DS5A 3JXOA 3DN9A 5KOWA 1X9WA 4ECQA 3ZNJ1 1REVB 1QLNA 1YRTA 2FYXA 3MR6A 4K4VA 2XGPA 3LUYA 4XIUA 4ITSA 5H9FJ 1OPZA 1OWXA 1QSYA 1T02A 2Z57B 4CLYA 1S9GB 4OX9J 3SQGB 1MG7A 1VCTA 2FQQB 2YKQA 2CDRB 3FSXA 4PXDA 1VBXA 5CA5A 2CQCA 4YY3F 1K0VA 1Q16B 2ASLA 2YWHA 3M2UB 3EPIA 1L3TA 3UR3C 4B3TJ 1ZH5A 5F0UA 4C8MA 4G1QA 2PA3A 2JWNA 2GGPA 3FSIA 1KR4A 1F9HA 1HNVB 1PJ5A 2U2FA 4OYOA 4F4YA 5T41A 1HBUA 5JVHQ 1S1VB 2H5IB 5KFXA 1HI8A 3EWGA 3TNVA 3C3LA 3POTB 4BS2A 2WRMA 2DH9A 1NH7A 1WORA 4DV0J 3TZWA 4ZJQA 4PXBA 2ASYA 2RD5C 3T5LA 4C11A 1TVRB 4ECTA 2A3JA 1R8HA 4NLGA 4EYIB 4JB8B 2OSRA 4K7QA 4RWXA 3G82B 3M8ZA 1EX8A 2EFQA 3MM5A 1EETB 4TXSA 1IKYB 5E5NA
chains in the Genus database with same CATH topology
1S6PB 3CTRA 2WB4A 2OJ3A 4JUZA 3KG0A 3A8EA 4H4MB 3MUTP 4ZP6A 3ZZOA 3G6VA 2HG4A 5KFSA 1VQPS 2VOPA 2HPUA 4FF1A 4F02A 3F44A 3C6UA 5AE2A 4YB1P 3BQ1A 1U24A 1JLBB 4DDFA 2VG5B 4I2PB 2K7KA 3CIMA 1CC8A 1VLYA 2DNQA 5LSOA 1YIJS 3GIKA 2R8JA 3I9V9 3IGVA 3HM9A 3KG1A 3W2WB 1UVNA 2XC9A 2UXDF 1RTJA 1NK8A 2QLXA 1FA0A 3C66A 4TLQA 5K14B 1UEVA 1ZYQA 5B0GA 2H5EA 1XN9A 4IH5A 3IRWP 5AXMA 1ZETA 1UVKA 3K5NA 4RUAA 2QEXS 4O3PA 3V6DB 1XR7A 5KOXA 4C3MA 4UY85 2OTJS 1A9NB 1KEKA 3M2VB 4JV1A 5B09A 2ZDOA 4A47A 4DX8H 3LP0A 2CRLA 2KKHA 2UV8A 1Z4UA 2JLEA 3PFOA 5J1PA 3E51A 5KG0A 5B0FA 2XY5A 4UUXA 2D3OR 4G1IA 3G4SS 4RW9A 4Y65A 2VC1A 1RTDB 1ZM9A 5GMKa 3PEJA 1XR5A 4OHZA 1T95A 1ZTWA 1N5TA 1RA6A 2C3UA 2R7VA 1JJ4A 2FHOB 3HHEA 1N5YB 4PG6A 5HL7Q 2OPQA 2E1AA 5F8IA 3THVA 3MWBA 2UVUA 3ENWA 2WCXA 2HFOA 5B0DA 3H20A 3KHRA 3TVKA 4DL5A 3S1TA 3SFGA 2FD2A 3TAMB 1NU4A 2MZQA 4OX7A 1LXNA 3F56A 2V4JA 3W3SA 4QU7A 2VUGA 2AP6A 1FXDA 1S0NA 1TL5A 1YITS 4TU7A 2JEIA 4XAKA 3RB0A 3B4MA 4Q5VA 1BWEA 2NSCA 2ZNZA 3HVAA 5DDRC 2DR9A 3N9UC 5F8GA 2VFTA 2FDNA 4NLPA 1PC5A 1F0XA 2L9NA 3OVAA 4NCAA 2DR5A 3CE8A 4A8FA 4IO1A 3KK1A 4RLEA 4LMZA 3V4MA 1RYRA 1W2BR 3G86A 1ZM2A 2CYYA 2F9DA 3DYAB 2CZ4A 1FEEA 4GMKA 2DGOA 4J5OA 3CCRS 2FPHX 3T3FA 2HHTA 3AQPA 2WW8A 3P96A 2LEPA 4DV5F 1SJQA 1WEYA 2VPXB 4O4RA 2OH2A 4O3NA 2KG0A 3DOLA 5I42B 3SSRA 3CCUS 5I4MA 3BS9A 1KFDA 4OZNA 2ASDA 3CJKA 4ZLPA 1RT3A 5L1JA 3ONQA 2CQ3A 2DCLA 3WC0A 4IG3B 3C8YA 4C8LA 1M5KC 4RW6B 4J9OA 1HW8A 3QO9B 5L1LA 3QLHA 5HBMA 4I64A 1I6JA 2HNZA 3MURP 2VPYB 2PDAA 3NAHA 4B17A 1X4GA 1YRXA 1YTYA 1WTFA 2LMIA 2QFJA 1S72S 2A1BA 1JK9B 4UW2A 1BQNB 2DK2A 2F8MA 3LP0B 1VIXA 3U27A 2GMJA 2RUGA 2M4MA 2R7UA 2XHWA 1S1UA 4KV8A 3CO9A 2J6TA 1SV5A 5DM6Q 3DU6A 1PC4A 2E9ZA 5KG7A 3UD3P 3DXBA 1C1BB 3FEZA 2EFPA 1H7WA 2HFZA 4M1KA 1UWBB 4QWDA 4DG1A 2PMHA 2R8KA 3RR8A 3UD4P 4DR3F 5EWFA 4ID5A 2FVQA 4E8UA 5GAGI