1C0UB

Crystal structure of hiv-1 reverse transcriptase in complex with bm+50.0934
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
435
structure length
414
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 119
structure length 414
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0uB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uB03
1RYSA 3QO9A 1HMVB 3KLEB 3JYTB 5KFNA 1RT2B 4EYHB 3V81B 3Q8QB 1DTTB 4PWDB 1RT6B 3RBDA 2I5JA 1Z4UA 4O4RA 1SV5B 3C6UA 2BANA 4NLQA 4ECTA 3KLFA 1S49A 2YKNA 2I1RA 2BQRA 3QIPA 2R2UA 1UWBA 2RF2B 1S0MA 2YNHA 3GIMA 2XGQA 4KB7A 4K4VA 3ISNC 3BSNA 3KK2A 4RNFA 5F8IA 4I7FA 4O4GA 2RKIA 2WOMA 2R8GA 1EETA 4H4MA 3T5KA 3ICLA 4JV0A 1S4FA 4GC7A 4KBIA 3DLKA 4X2BA 3V6KA 2FLPA 5F8MA 3PR4A 3PW4A 3IRXB 3G6XA 3MECA 2R2SA 3V4IA 5KFPA 1RTIB 2V4QA 5KG2A 4F4XA 1IM4A 4Q43A 4ZPAA 3MEDB 4IFYA 4GC6A 1EP4A 4RW4B 2BE2A 4XPCA 3H5SA 2C2RA 2JC1A 3LAKA 3OSNA 5KFFA 2IM3A 2DPJA 1N6QB 5DQGA 4RZRA 2W9AA 4TY9A 4O3OA 4O44A 1HQEB 1JLFB 2W8KA 3QLHB 4MFBB 3LP1A 1QAIA 4ICLA 4DG1B 2WOMB 2O5DA 5EUHA 3OHAA 1SUQB 5HROB 5DLGA 3G6YA 5L1JA 4G3IA 4EBCA 1S9EA 1LWCB 1TL1A 3IGNA 5KFCA 2JEGA 2HNYA 1T05A 1C2PA 3V6HA 3BREA 4NYZA 3KHLA 2E9TA 3V4IB 1S1TB 2ATLA 1RTHB 4MH8A 2B6AA 1SV5A 3C6UB 3KK3B 4KO0A 3T5JA 4ZHRB 1KLMA 3RB6A 2HMIA 3H4DA 3FQKA 3JSMB 4ZVHA 1NNDA 4IFVB 4MIAA 2VG7A 2AX1A 1DTQB 3E01B 3I0RB 4NLRA 1JLCB 3NBPB 1ZETA 4PQUA 4KV8A 2OPQA 3DMJB 3LP2A 4NLXA 1C1CB 4IDKA 4ECVA 3QZ7A 4RW7A 3FFIA 1HPZB 5KG3A 1C0TB 3M8QB 3HVTB 2XGPA 4TQRA 1IKWA 1IKXA 2UUWA 4Q44A 2WB4A 1RTDB 5FDLB 4WFXA 3IS9A 4ED8A 4OL8A 1KLMB 1RT2A 1FK9A 1RT3A 5KT2A 1HMVA 3KLEA 5KFIA 1S0NA 1W25A 1DTQA 4RUCA 1FKPB 3M9NB 4YP3A 4RUAA 4IFVA 2HNYB 1T05B 4R5PB 1S1WB 1GX5A 4H54A 5KFLA 5F9NA 3MR5A 1TVRB 2BQ3A 4J9LA 2HMIB 4J9MA 3MEGA 4ECQA 4KO0B 3OL6A 3EPIA 5J2MA 1J5OB 3I5CA 3M9MB 1S6QB 1S48A 2FJXA 3N6NA 2AGQA 3H5YA 4IG3A 1IKXB 5D3GB 4QWBA 3TQ1A 3D28A 5KFXA 3I5AA 1RT4B 1VRUB 5C24A 4DL4A 1BQNB 1MU2B 4RNOA 3KLVA 3HHKA 5L1LA 4KFBB 1MMLA 4ECRA 4IG0A 3BSOA 3OLBA 3T1AA 4XPEA 4F4YA 1RTIA 4O44B 4LSLA 4MK7A 1LWFA 1QAJA 1JLQB 3DI6B 5CYMA 3KNAA 4I2PA 2IJFA 3H59A 3MEGB 3CDWA 4KAIA 4H4MB 1D0EA 2YKMA 2UVWA 2AQ4A 4U6PA 1IKYA 1S1XB 2OPRA 5KG1A 3PVXA 1FKPA 1REVB 2CKWA 2RDIA 4M95A 1T03A 5HLFB 2IBKA 4URGA 5EWEA 3Q8PB 1ZTWA 4XO0A 1J5OA 3CWJA 3H40A 3OHBA 2HNZA 3DLGB 4I2QA 4EBEA 4NZ0A 1HQEA 4M94A 3PW0A 3KJVA 4ZP9A 1T3NA 4JV1A 1S6PA 2YNIA 1C1CA 1RAJA 2RF2A 2HWHA 3QO9B 3DRSB 4WFZA 2V9WA 4Y34A 4O3QA 2VG7B 1FKOA 3BQ1A 1XR5A 4EO6A 4NLWA 4ED0A 2FVPA 2ZKUA 2BQUA 3GIJA 2FVQA 4ECWA 2FJWA 2FVSA 3V6JA 4K4SA 4K4ZA 2B6AB 2XC9A 4K4UA 3CIZA 4IOBA 4RW6A 3FFIB 2GC8A 2XWYA 2XCAA 4Y3CA 3DOLA 3ITHA 2YNGB 3H5UA 4RNMA 2RKIB 1S6PB 2YNIB 4RNNA 1JLGB 3H2LA 4NRTA 2R8HA 1JLCA 2IM2A 1QE1A 4NLOA 4RNHA 5DLFA 3RAQA 4Q0BB 3OSPA 2EC0A 5KT3A 3I0SA 1HNVA 1T94A 1S10A 2GIQA 2FLNA 4IH6A 3RB0A 1RA7A 5CYQA 3GYNA 2W8LA 3PHEA 4QWEA 3I5BA 3IG1B 2E9RX 5I3UB 5KFEA 1TVRA 4EEYA 1EP4B 4RW4A 4F4WA 2E9ZA 1JLEA 1LW2A 1KHWA 5HBMB 1LW0A 1N4LA 3MTKA 3N6MA 2ILYA 3GILA 5J2NA 3IRXA 5KFSA 4H4OB 3LP1B 3T5HA 3QLHA 3KJVB 3FQLA 4WE1B 5KG6A 5KT6A 4ED3A 4QWAA 1EETB 4IG0B 1N6QA 4ZPBA 2ZE2B 1HYSB 1HQUB 3DOKA 3UQSA 2AGPA 3KMQA 2BRKA 3PJWA 3KLHB 3DMJA 4IG3B 5D3GA 2JEIA 1S1UA 1R0AA 4HYKA 4J9PA 2R2RA 4YQWA 4ZVEA 1JLBB 2I5JB 1DTTA 4PWDA 3KLGA 4MKBA 3QGIA 5J1EA 3NAIA 5L1IA 1TKXA 5EDWA 4I2PB 1U09A 3KK3A 1JLQA 3DI6A 2R8IA 5KFWA 1RT1B 3TVKA 4EO8A 3N6LA 3KK1B 1ZTTA 2FVRA 3LP0B 4J9OA 1JLEB 1LW2B 5F9LA 5C42B 2W9BB 2ASJA 1S9EB 1TL1B 5KG7A 1HQUA 5EWGA 5FDLA 5KFOA 4R8UA 3HVAA 2W7PA 4NLDA 5KFZA 1TKZB 2OPSB 3MR2A 4TY8A 2F8EX 4IQXA 4K4YA 4ECZA 3SFGA 1XR6A 4Q8FA 3UDLA 4RW7B 2W7OA 5T14A 3KHHA 4QW8A 4KKOA 4R0EA 1RTJA 2VG5A 2W9CA 4ED2A 5DQHA 3T19A 3BGRB 4B3OB 1S1WA 3NAHA 4J9QA 1N56A 3MEDA 1TV6A 1I6JA 3MEEA 4NLTA 5KFQA 3Q8RB 5JUMA 1JLBA 2YNFA 2J6TA 5CYMB 5C25B 4J9SA 2WHOA 3RB3A 4RW8B 5KFVA 4QPXA 1IKVA 3MEEB 4FS1A 2ALZA 4WYLA 1HNVB 5C5JA 1LWCA 2XI3A 5KG4A 5KFDA 2JC0A 5L1KA 2D3UA 5DG9A 3DRSA 3CJ4A 2IJNA 1RTJB 2QE5A 3DRRA 3ITHB 4PQUB 1JLFA 2UVUA 3T5LA 5KFUA 1N5YB 1RA6A 4TY8B 4LSNB 2VG6A 5J2PB 3CJ3A 3BJYA 3KHGA 5DGBA 3V6DA 4O3SA 5JXSA 5L9XA 5J2NB 2IM1A 3Q8SB 2ILZA 2BRLA 3KLIB 3C6TB 5K14A 5C42A 4PUOB 2WCXA 5HLFA 3CJ0A 3QGGA 5KFRA 3M8PA 5KFYA 5KFHA 1RTHA 4DEZA 2XCPA 1S1TA 3OL9A 4WZQA 4IH5A 4IR9A 3LANA 5I3UA 2V0NA 3QZ8A 1TL3B 3RB4A 2OPPA 5KT7A 2YKMB 4YR2A 3KLIA 3DOKB 1LWEB 5F8HA 5DG7A 2ZE2A 3KHRA 2IA6A 2HNZB 3DLGA 1JLAA 4TN2A 2BR0A 4O4GB 1LWFB 2R8KA 4WE1A 1R0AB 4ZP7A 2J6SA 4WZMA 2HNDB 4IDKB 3G6VA 4FBUA 3LP2B 1JKHA 4IR1A 4EBDA 4NLUA 4IRCA 1REVA 3QGHA 3M8PB 4IFYB 1SH2A 2RDJA 2AGOA 1JIHA 4KHMA 1JX4A 2JEJA 3V6DB 5J2PA 3DLKB 1FKOB 4ZP6A 4TQSA 2CJQA 1TP7A 5KFJA 3BR9A 1D1UA 1C0UA 4NLSA 4DL7A 3I0SB 3H4BA 4NRUA 1C1BB 4ID5B 2FJVA 3OLAA 4ED7A 3D5MA 3ISND 5HP1B 5KFMA 3KMSA 2W9CB 2C2DA 2B5JB 4KKOB 2YNGA 3DOLB 3FSIA 4RW8A 1S0OA 2JEFA 3UR0A 1HARA 1BQMB 1DLOA 1TKZA 2OPSA 2WONA 4YR0A 4DL6A 3FRZA 4Q0BA 3MF5A 4KHRA 4WXOA 4IH7A 1QE1B 4R8UB 3EPGA 3GIIA 4NLVA 3PZPA 3JYTA 1S1VA 1IKYB 1S1XA 3G86A 3GIKA 5KT5A 2VA2A 3DRPB 3BGRA 4B3OA 2UUTA 3SI8A 3E01A 3I0RA 3SFUA 3IN5A 4J9RA 1RT5A 3H98A 3BSAA 2JLEA 4QW9A 5F8JA 1FK9B 1RT3B 3PJXA 1VRTA 4JUZA 1S9GA 2HWIA 4KE5A 2IAJA 1RDRA 4I2QB 4YR3A 1IKWB 3HVTA 4TYBA 1C0TA 3MR6A 1S1UB 2B43A 4NCGA 2OH2A 3HKWA 2OPPB 2AX0A 4KSEB 1UWBB 3LP0A 5HP1A 3QIPB 4QWCA 4ZVGA 1S6QA 1HYSA 2XI2A 3DM2B 3IGVA 1JXLA 2OPRB 3C6TA 5K14B 4MFBA 1TKXB 4PUOA 3CVKA 5J1EB 2WK4A 3MR3A 1TKTA 3BSCA 2UVVA 1S9GB 1HNIB 2WTFA 4DL3A 1N48A 2VG6B 4ZMMA 1N5YA 3DM2A 4Q45A 1XR7A 4TYAA 1S97A 3DRPA 3GQCA 3NL0A 1S1VB 4TXSA 3GV7B 3NGDA 3QYYA 4ZP8A 5DQIA 1BQNA 1MU2A 1VRUA 5C24B 1JKHB 2WONB 3CDUA 4MK8A 5I42B 4LSNA 2HNDA 1RT7A 1KHVA 4NLYA 5CYQB 2IAJB 2W9BA 4HKQA 3CJ2A 4TLRA 3EZUA 1JLAB 5KFTA 5J2QB 1SH3A 2D41A 4EYIB 1CSJA 3NKYA 4K4WA 1K1SA 2YNHB 1LW0B 2FVCA 3DYAB 4F50A 4ECSA 5F8LA 3GV5B 4QWDA 4K4XA 1C0UB 1S9FA 3E51A 4Y2AA 4ECXA 5KFKA 2VG5B 5DGAA 4ZPCA 3LAMA 2D3ZA 4G1QB 1HNIA 1OS5A 5KFGA 4K4TA 4NLGA 4O3RA 2IC3A 4Y2CA 3PW7A 1YVFA 1RYRA 2B5JA 3M8QA 3PR5B 1NHUA 2VA3A 4I7FB 1HPZA 3KK2B 3CO9A 5DG8A 4DL5A 5KG5A 2C2EA 3DRRB 5J2QA 1NHVA 2OPQB 3QIDA 3KK1A 3OL8A 3IS9B 3NBPA 2YKNB 4RW9A 4RW6B 1QUVA 3KLFB 1RT7B 5F8NA 3NMAA 4DL2A 3BQ2A 3JSMA 2IMWP 3KLGB 2UVRA 4MKAA 4G1QA 4U7CA 2BE2B 1VRTB 3VQSA 1TL3A 1T03B 3CDEA 3LALA 4KV8B 1K1QA 4RU9A 1RT1A 3RAXA 2FLLA 3DLEB 2AWZA 2WRMA 5KFAA 5KG0A 4ECYA 5F8GA 2DPIA 3GV8B 2IM0A 4O3PA 4IRKA 5HROA 4ZHRA 2ASDA 5EWFA 1BQMA 2V4RA 2ZD1B 4FS2A 4RW9B 4URSA 4J9NA 1LWEA 4LQ9A 2R2TA 3FDSA 3CJ5A 4H4OA 2QV6A 3TAMA 4WYWA 4F4ZA 4ECUA 4K50A 4NCGB 4URQU 4WFYA 2C28A 4ID5A 1C1BA 1RT4A 4IRDA 1SUQA 5HBMA 2D7SA 3MFIA 2GIRA 4ICLB 4DG1A 3H5XA 3PW5A 2IC3B 5KFBA 4ED1A 1RT6A 3RBEA 2ASLA 4ZVFA 2HAIA 5C25A 5KT4A 3PW2A 5J2MB 2AU0A 3IG1A 2YNFB 1WNEA 4LSLB 1TKTB 4Q8EA 2C22A 4LQ3A 1TV6B 4IKAA 3DYAA 4MK9A 4ED6A 3DLEA 4WXWA 4ZPDA 3BQ0A 4KFBA 4MIBA 4FBTA 1TQLA 3MECB 3TAMB 3KLHA 3OL7A 4JV2A 1DLOB 2R8JA 1IKVB 2J6UA 1RTDA 2ZD1A 2BANB 5I42A 4J9KA 3MFHA 3DDKA 3UPFA 4O3NA 4YMEA 1GX6A 3V81A 1JLGA 3HVWA 4R5PA 3M9OB 1SH0A 4NLPA 3KOAA 1RT5B
chains in the Genus database with same CATH superfamily
1OMSA 3R5BA 5IWAJ 1NDKA 3PACA 4LFAF 2QYGA 3NLCA 3BO3A 4OZ2A 1RT2B 4EYHB 3V81B 3AXKA 4ZVUB 3AOBA 3DDNA 4QIWD 4K59A 5ETNA 5HJXA 3TJ9A 3P3DA 3GFYA 5GADU 2KU7A 2HIYA 4ILMA 7FDRA 2EFGA 3S01A 2UXDJ 2B4UA 3NCPA 4C0HA 3CMAS 2O66A 3S1TA 3TJ8A 2MLZA 3GJTB 2LEPA 3EX7B 2C3MA 2ZBCA 3A3NB 1VQSA 2XTJP 3GIMA 1YHQS 2XGQA 1I94F 1XEZA 1IR0A 2BBEA 3QSIA 4EU0A 3KK2A 2K3IA 4RNFA 2AJFE 1VBKA 1WJ9A 2J0QD 3VV2B 3FMWA 3HPOA 2WOMA 4PQAA 2R8GA 2PMZD 1TL7A 1BHNA 2MYFA 3CJKB 3TEGA 3PJ9A 1S4FA 3R5GA 4JB8B 3DLKA 3CF5Q 3V6KA 5F8MA 5IV4A 2V63A 7FD1A 4QIEA 3MM8B 2QL7B 1T95A 4A8KA 1IM4A 1KRPA 3PV8A 4RW4B 2HS0A 2V8VA 4XPCA 3D67A 3L7OA 3PDNA 1ICEB 2VPWB 2YX7A 4J37A 3OSNA 2IM3A 5JMNA 4OYIA 2DEJA 1VR6A 5B0FA 1HBUB 5M2PA 1VMBA 3VAJA 2PI5A 3K7RA 4OV1A 2W8KA 2HEKA 4QBUA 3R6LB 1WC0A 5EUHA 4WKRA 5HROB 3AQPA 1FHTA 1MMNA 3G6YA 4OJ3A 5KFCA 3IGNA 2JEGA 3N9UC 1T05A 1ACMB 3UN3A 3NS5A 3BREA 1Y4ZB 2R7RA 2GHWA 1KBRA 1RTHB 2B6AA 1NDPA 2QSWA 1SV5A 4KO0A 4PG8A 2BX6A 2HMIA 1WI8A 2POKA 1IJEB 1TL7B 1X5PA 5HK4A 3M6XA 2H1YA 3GG0A 4ANEA 3KUGA 4JI8J 1RADB 3CJQA 1KWMA 2AX1A 5A0YB 1ZBTA 1WHYA 2J9DE 5ETSA 5D0EA 4NMXA 4ZVPB 2QSFA 3DGPB 2D3OR 2Z2ZA 1FO1A 1QLNA 3J7A1 4DR6J 2NS1B 4ECVA 3SSQA 2N82B 2GO8A 1AUDA 2CRLA 1H7XA 3V2UC 3ZZUA 4CYUB 2FTRA 1WHXA 3CT9A 1C0TB 3CD7A 2KXFA 3HVTB 2OEMA 2H5EA 5ETLA 4LFBF 1IKWA 1IKXA 1V5IB 4A8YA 1YTYA 2UUWA 1Q4RA 4Q44A 3IBCB 4DV0F 3T6JA 3TEHB 1NDCA 1FNXH 3FKBA 4F3QA 1LXNA 4OZJA 4NEZA 3K5NA 2A2DA 5KFIA 4E98A 3ENQA 3ZZOA 4BCAA 4C8OA 2Q66A 3VGUA 4F67A 3M9NB 5HL7Q 4P71A 1KVKA 2G1HA 1T05B 1E6VB 2V8HA 2XWXA 4DN0A 1GX5A 2Z58B 4H54A 2CYYA 3MR5A 1VYAA 2BQ3A 1N8RT 3R1HA 4P75A 3TP2A 2R4FA 3ULHA 5C2CA 1Q81T 3MPDA 4KO0B 3OL6A 2E1CA 5J2MA 1J5OB 4JI7F 4HT7A 3ZFVA 2AGQA 2R7TA 3CEDA 3CD0A 5D3GB 2CPHA 2LEBA 4DUTA 1IBMF 5KFXA 2B9EA 4NYPA 1RHQB 4RNOA 4L74A 3HHKA 3TW0A 4UF4A 1MN9A 1P8GA 2KN4A 3ILIA 4IG0A 4DU8A 5J1PA 1DAXA 1HBOA 3OLBA 3OW2R 3PX6A 1UVIA 4DV7F 4MK7A 2QC3A 3IR6B 1JLQB 4DN9A 2VC0A 4CIOA 4N8NA 4I2PA 2EFPA 1L3TA 2GQQA 1HKAA 2K1RA 2PN6A 2QA2A 1S7HA 1FJGJ 1HR0J 2ABYA 4H4MB 1D0EA 2YKMA 3PRDA 5KOXA 4U6PA 4WTYA 2Y1IA 2I0XA 4F3MA 3MGJA 5GVQA 1YZ6A 8ATCB 4B3MF 1I3OB 4DSLA 2E1RA 4M95A 2CQ1A 2IBKA 2DGOA 3LWMA 2ZH3A 4LMZA 3Q8PB 1NK7A 1Z2LA 2XM3A 3QFHA 5J1NA 1WDTA 3CWJA 5CABA 5EGYA 3H40A 4KGZB 4NZ0A 1HQEA 1IJFB 3FVYA 3W9IA 1NZ8A 4DV3J 3AJ1A 4X4RA 5IOLA 2RF2A 4YB1P 1WTBA 3DRSB 4WFZA 4J9VA 5HAOA 4P2SA 4CO5A 4PYAA 4EZ6A 2QYCA 3NOCA 1GXLA 2VG7B 2FJAB 1FKOA 2VONA 1OQ6A 1XR5A 2VFVA 3LGMA 4NLWA 4V1Ak 5JVHQ 1KVIA 3HJFA 3GIJA 2HRUA 2W1BA 2FVSA 1CQNA 1X4BA 2E5LF 4K4ZA 2RU3A 1TK8A 1WWHA 5GAHU 2QL9B 4TKTA 2LXIA 1CS4A 2XWYA 4PXBA 3DLHA 2DRBA 3NY0A 1UVMA 1S6PB 2YNIB 4LRAA 4RNNA 3FK4A 3MAQA 3W9JA 1MG7A 3VGTA 1JLCA 1LK7A 1K8AT 2E7VA 3RAQA 1NJIT 4Q0BB 1FRIA 2MQPA 2MKKA 4FF1A 1T94A 3OXGA 4AL5A 1F9HA 5U47A 3RB0A 2UUBF 3RU0A 2PMHA 2W8LA 3MOJB 4AQYJ 5ETKA 3X1LB 2VOPA 2MGZB 4PXCA 1S4EA 3AY0A 5I3UB 5KFEA 3S6EA 2HHSA 1ZA1B 1EP4B 2CZ9A 1AB8A 1WUUA 1JLEA 2JRSA 1KHWA 2PMWA 2DR9A 1IQTA 1XNQF 1TUVA 1S77D 5J2NA 3RW7A 1NXIA 2OJ3A 2M2BA 1DHMA 2R7OA 3QNWB 4YHHF 1H3DA 2MQ8A 2F1FA 2HGNA 5B0BA 1VBYA 3KJVB 3OR2B 4KRWA 1VJQA 2A0FB 2G2ZA 2BJ9A 2HURA 1BXNA 2NYHA 3BN4A 3CW2C 4P52A 1N36J 1T9VA 2XMJA 2I2YA 4LIWA 1N6QA 1X5OA 2Z4PA 3GR1A 3T1HF 4GVLA 2RUSA 3ZNJ1 5E2QA 1X9MA 3PJWA 3H8YA 4QR2A 4Y00A 4MT1A 4DI6A 1UJ5A 1PJ7A 1APSA 3MWBA 4ZVSB 1RKIA 1YJ7A 2Y1LB 3ADAC 4ZN1A 2X7IA 5F8HA 2CPFA 3OFEA 3M2UB 4ZJOA 5B7WA 1VC5A 2MHEA 3DN9A 1CC8A 2BDPA 3QGIA 5J1EA 3VHQA 2N7CA 1TKXA 2CA9A 3FCWA 2LQ5A 2MPUA 3SSRA 1U09A 2CQ3A 3EE3A 5EDWA 3DI6A 2QO3A 3SIPB 2UXBJ 2CQIA 3TVKA 2B0GA 4EO8A 3KK1B 1N5TA 3U7JA 2FVRA 1N54B 5DDQC 1LW2B 3KYLA 3M30B 5BR8F 2G0JA 1S9EB 2JHEA 2VKRA 4CLUA 4G6VB 4R8UA 3HVAA 2OPSB 2I9SA 1HWJA 2DNLA 2DTJA 5H9EK 1WOSA 4ECZA 2AV5A 1A6LA 5EHHA 1Q79A 4IQXA 3G4SS 3UDLA 4NCAA 4V19X 2OTJS 5T14A 1WHVA 3GFHA 5GMEA 1KD1T 1T7PA 2C3OA 1RTJA 4DX7A 2IVYA 4C3MA 4X4PA 2ZM6J 3T19A 3HHDA 1RU2A 3NAHA 3A8JA 3JTOA 1H74A 4OHXA 1CJVA 3MEDA 1TV6A 1HI8A 1YDLA 2FC9A 3MEEA 2FZCB 2NUHA 3A13A 3LO3A 4DS5A 2M5YA 5KFQA 3OFFA 5LMUJ 2M3DA 3SEOA 5CYJA 4X62J 2J6TA 1YBTA 1YWXA 1IBLF 2CJ9A 4J9SA 5H9FK 1SJQA 3F41A 1BY9A 2IPOB 4RW8B 2ZH4A 3RB3A 3CCUS 1D9FA 3MEEB 4WP8A 4G1PA 5HVFA 2ALZA 1I51B 5L1KA 5DG9A 2WSCC 1HHQA 5F0UA 1HWKA 2CVEA 4C98A 1RTJB 5DETA 4C0BA 2A1BA 4DX6A 1WC1A 2ZDOA 2BOPA 5IV3A 4P7VA 3BM7A 3AA8A 2YPZA 2RILA 4Y6IA 3V6DA 1KQFB 1VQ9S 2KM8B 2ILZA 4ELTA 2BRLA 2FQQB 1RHMB 3KFWX 5IC6B 2WCXA 4DV5J 4UOFA 3MR2A 5HMWA 5HLFA 3CJ0A 1M1GA 2QRRA 3M8PA 3HT0A 1KLNA 4DEZA 1WC4A 2OEJA 4KH0B 3CXCR 3TR5A 3LANA 3MOZA 4Y2MA 4DUYF 2OPPA 5KT7A 3HHLA 3J7AN 1X9SA 2VFRA 1LWEB 1QUPA 1CPZA 5DG7A 3GIRA 3G2XA 3DLGA 1R8BA 2VFTA 1KQSR 3H20A 2VQFF 4WE1A 3I96A 1F3VA 4FPIA 4WZMA 3SQOP 3LP2B 5AXNA 4DFJA 2O01C 3M2VB 4AQYF 1ZETA 4EBDA 1PC5A 1RBLA 5AE3A 3I87A 5SZTA 3EZOA 3W62A 3QGHA 3ZZYA 4IFYB 1JNZB 3Q23A 1HR0F 2R7QA 2CNOB 3H7HB 4KHMA 4AD6A 3UVJA 1FJEB 4J9UE 1P9YA 5J2PA 1FKOB 2P8IA 1FEHA 2X1GA 1H2UX 1ROFA 4FKXA 5KFJA 4F25A 4NLSA 1D1UA 1C0UA 1FERA 2MKJA 3BKUA 4JI0J 2U2FA 3H42A 1RWMB 2XLKA 4NRUA 3NCRA 2R9LA 2ZH1A 2FJVA 4IO1A 4DR5F 3RZAA 1GXUA 4CP5A 2IJRA 4DCOB 4KKOB 4DX5A 4DV3F 3FSIA 7AT1B 1C4AA 2QEXS 1UTAA 1YLXA 4Z37A 4GVBB 2JEFA 6AT1B 5B0AA 1R31A 3PXGa 4DL6A 2WONA 4KHRA 3MF5A 1VS3A 4WXOA 1O5JA 3TWZA 5RUBA 4RU2A 5GAEU 3DNCA 5IM0B 5E3CA 3IRWP 3GIIA 1ZM3A 3QJLA 1UCNA 3JYTA 2BKOA 1S1VA 2DGWA 2OTLS 3DRPB 2Z0GA 2J7UA 3SI8A 2NZ4A 4J9RA 3FC9A 3H98A 2N7YA 4FKYA 2CADA 3GCXP 3GJQB 2W2PP 1VRTA 3PJXA 2CQDA 4JUZA 2PEBA 2QG9B 5ADZA 2HHHF 2A6MA 3TJAA 4DHVA 3AA9A 1DBDA 3BR8A 4YR3A 2J5AA 2KVQE 4ES2A 4LF7F 1C0TA 4DV6F 3SZ2A 5AE1A 4PPZA 3MR6A 3NS7B 4WK3A 2OH2A 4DX8H 2UUBJ 1BMQB 1G4CA 3OTDA 3AH6A 3GSDA 4KSEB 5B0EA 1UWBB 1CEZA 5HP1A 2GIFA 4B08A 4KGMA 2CNLB 1IWAA 5C7PA 4QWCA 4ZVGA 1L3KA 2XI2A 2RU9A 2H48B 1EX8A 3NS6A 1JXLA 3BGUA 2KFNA 2LMIA 2OLWA 1XWLA 3PRBA 4DDFA 5K14B 2NQPA 4IRCA 4RWWA 3J7ZT 1H98A 3A12A 2UVVA 1LFPA 1S9GB 2ZZNA 2C2ZB 4I1TA 2GMJA 2NPFA 3CD6S 2VPYB 4DL3A 4AL7A 1FXLA 2FY8A 4Y28C 2EG2A 4Q45A 2ALYB 2XSJB 2C1EB 2D9OA 1PJ5A 2RT3A 3BKTA 2J9DA 3SV4A 3ZNUA 4TXSA 3GV7B 3EICA 1GK8A 4ZP8A 5DQIA 1T02A 4YFUA 1BQNA 4X4TA 2VBXA 1JKHB 1UP1A 1DQ9A 2HVDA 2V68A 3MAHA 5CZVA 3RUBL 4CNYA 1FKAF 3TARA 1F5CA 3D6TB 3UO0A 2AP6A 3TX0A 2HHUA 4DQIA 1NKEA 5AE2A 4TLRA 3GP9A 2WBMA 2DNOA 1JLAB 4N8OA 1M5OC 4JI1J 5J2QB 2D41A 4ZJQA 1QAYA 2J8SA 3A3OB 2DGQA 4LUBA 2GW8A 4L76A 1N0UA 2YNHB 1LW0B 2H5IB 3IR7B 3MHYA 3Q86A 4DPOA 1NJZA 1NMEB 1F5BA 1S9FA 2RQ4A 3E51A 3HD2A 3TNVA 4DOZA 2F4VF 4ZPCA 3LAMA 3TA0A 2B8PA 1HNIA 3CJKA 4K4TA 1TUWA 1VQ4S 4O3RA 2CJBA 2JDJA 2KJVA 3A8EA 2RJZA 2HFSA 1YVFA 2A10A 2B5JA 1RYRA 3L3CA 2QN6B 4F4KA 2VA3A 4X84A 2GZOA 2OO4A 3CPWR 1FE0A 2RB7A 3KK2B 3W66A 3CO9A 3FCVA 1XC9A 3CMES 3UD5A 2C2EA 1K73T 4O23A 1S0VA 2B4OA 1U8WA 2W2NP 1N32J 4AXIA 3NBPA 2AEFA 4RW9A 4RW6B 1VLOA 2HFNA 3DGVA 3MCOA 3KG0A 5F8NA 2R42A 1B3TA 3ZTPA 4CO3A 4DL2A 3VVTA 2HW3A 2RNEA 3KLGB 1Q7LB 1QSYA 5E3RA 3FEZA 2Z30B 1OO0B 4L73A 5HQMA 1YG0A 1PAUB 3D0GE 4NPOA 5E7OB 3AOAA 3THTA 3B54A 3BH7B 1RT1A 5K8OA 2PE8A 4RU9A 3RAXA 2AWZA 2WRMA 4CM2A 3BB5A 3DHWC 5HSPA 2K8GA 4RUCA 3GV8B 2KT3A 2KT5A 3GYXB 1I94J 1WG1A 1P9QC 3DRYA 2HAFA 5HROA 3HZEA 2VASA 3ISZA 3MR7A 3GB0A 1B64A 1K47A 4RW9B 3IO1A 4URSA 5HMZA 4J9NA 1LWEA 2F63A 4N76A 4PWUA 4GRSA 4PXEA 3KJNB 5EX3A 4C8MA 1VC6A 1XMBA 2C2MB 4EUVA 3EVOA 4ID5A 4IRDA 1RT4A 1N5QA 3G71S 1SUQA 5HBMA 4GKJF 1RWNB 1J27A 2V34A 3NXZA 2Y3YA 4Q7AA 4Z2XA 1LQ9A 2RMLA 5KFBA 3G96A 1RT6A 4QU7A 1O0PA 3RBEA 4C3LA 2KFYA 5KT4A 3EWGA 5J2MB 2AU0A 4B9TA 3QMQA 3K5OA 4HHUA 5HATA 1Y7PA 4W90B 1WNEA 1TKTB 1FDAA 4KYZA 2HHHJ 3DYAA 1RHJB 2RHSB 4WXWA 4KFBA 3M8WA 3CJ8A 4RL1A 2L48A 4UOGA 3VZIA 4LF6J 2RUGA 1Q7YT 4LF7J 1FVQA 3NNCA 2Z8QA 4NASA 3EYZA 4B3SF 4UOHA 2ZC3A 3RW6A 1DZ5A 3PX4A 4CZCA 2ZD1A 1NHKL 1R27B 2HQIA 4J9KA 3CTRA 3D0IE 2YTCA 2E29A 3EUNA 4CYUA 2DGVA 1GX6A 2HHVA 2CXEA 1G7CB 2ROGA 3MUMP 4NLPA 2ZFHA 2VPXB 1RBAA 1RT5B 2IRXA 2DHHA 3D66A 1Z1ZA 5KFNA 3L7UA 2V6AA 4X66J 3J80U 2M4MA 2KKHA 1S59A 3NCQA 1NBEB 3G87A 3R9LA 4O4RA 3C6UA 4DF8A 1NU4A 1OPIA 2YWGA 3KLFA 2Y1RI 3ZTSA 4U95A 1JXVA 1S49A 4ECTA 2EBEA 2YY3A 1VQYA 1NRKA 3EGNA 3GWCA 4LF9F 5GMKa 3FMBA 3BSNA 3C66A 4C7QA 2UUCF 4I7FA 2H65B 4O4GA 4KGXB 2RKIA 1ZAWA 2MHNA 2XNRA 1EETA 2DHAA 3MAAB 1F9EB 2D3O1 4TVAB 1WC5A 5FJ4A 3MM7B 4X2BA 4CLSA 2DNQA 1CULB 3UW1A 1L5UA 3HSGA 1BQXA 4K5SA 3VAIA 5KFPA 1U4BA 1O8BA 5DM7Q 4KH1B 2YQ1A 2KB2A 4Q43A 4ZPAA 4UY85 1AROP 4QQBA 3F56A 2BE2A 3QBCA 2MDAA 4ATNA 2KM8C 2BYCA 2IYIA 1PYSB 4NA1A 1CULA 3CC4S 4CNZA 2DPJA 4RZRA 3OTEA 1B7YB 2W9AA 1T9UA 4DR3F 1N5SA 1Y10A 3HD1A 5HANA 4BWJA 4O44A 1HQEB 1JLFB 1J5EF 2J0SD 4MFBB 4CI0B 3CIMA 3MM5B 2MKSA 3A8IA 1SUQB 3UCGA 2W2QP 1U0HB 3LQVA 3VVUA 3ZZZA 1M5VC 1PJ6A 1B70B 2BUNA 5L1JA 4EBCA 4G3IA 1LWCB 4DPYA 1ZH5A 2RVJA 2GS8A 3HMJG 4FNIA 3V6HA 2BEFA 3KHLA 2KL8A 1A7GE 3BBCA 4ZIWA 1QSSA 5GAGI 2WVDA 2VOOA 3C6UB 3KK3B 1TUGB 1KLMA 4C9DA 3H4DA 3GPAA 3KXDA 3FQKA 4YB5A 5IS2A 5HVGA 4ID8A 4ZVHA 4YB6A 1WC6A 3G6XA 3CCES 1W2BR 1MW7A 1PILA 1FI4A 1NKBA 1IBKF 4A8XA 1DTQB 3I0RB 4NLRA 1JLCB 3NBPB 4KV8A 2WAQD 4OZ1A 4XAKA 2OPQA 4OJGA 4JI6F 2AKWB 3QWUA 3R5CA 3WZ0A 4W4MA 4FPRA 2HHPA 3NWGA 5B08A 4PKDB 5GADI 1F60B 2HZVA 5EX0A 2LKZA 4JI1F 5KG3A 1FEEA 1NJYA 2KHDA 2XGPA 1VCTA 2VPZB 4USHA 1BC6A 2WB4A 3SBMA 2QTWA 1J2VA 2DITA 2GAGC 4GKKJ 3GMGA 4OL8A 4USKA 4YN3B 1ZS6A 1N34J 1HMVA 4DSIA 1S0NA 2DIVA 4DS4A 1NKCA 2IA6A 1FKPB 3MZIA 4YUDA 4IFVA 2HNYB 1MWQA 1RAEB 3L09A 3TQEA 5L38A 4R5PB 1S1WB 2B7CB 3NGSA 4J5OA 4OYZA 5GMDA 2D74B 3IBWA 4C8LA 2ZH5A 1QTMA 2C2OB 4RX6A 4A48A 3M9MB 1S6QB 2FJXA 3N6NA 2CZ4A 3H5YA 5DDRC 4OYOA 2PT0A 1IKXB 2VKZG 4DV7J 3TQ1A 2LA6A 2DR5A 4PRFA 1RT4B 3QQCD 1BQNB 4HTIA 4M5IA 5BXIA 4DL4A 5L1LA 2MZTA 3J81j 1T3OA 4RR5A 3BSOA 1JJCB 2GO9A 2DVIA 3T1AA 3ZTOA 2ROEA 2IFXA 1RTIA 4W98A 4YS2A 3HHNB 1U1QA 2H51B 4C97A 1BD6A 1LWFA 1QAJA 2FYXA 3CGIA 3VAKA 1XNQJ 2IJFA 1R6VA 2CPIA 4NEYA 4KPYA 3N28A 5CZXA 3MMBB 2WW8A 3K8VA 1M5KC 2EFVA 2PI4A 2UVWA 2V5HG 2AQ4A 1VQLS 1N56A 2OPRA 3E8OA 3OD2A 1WOPA 1REVB 4FF3A 2AIRB 3EMTA 2DBBA 4B3SJ 1UW9A 2K06A 4HL9A 2K3KA 4HLBA 4URGA 5EWEA 1IQZA 1CG2A 4XO0A 2G0IA 1FA0A 1NUEA 2AT1B 3DLGB 4S0MA 4I2QA 3SDEA 1FRKA 3J81U 4M94A 2RQCA 2UUCJ 2KZMA 2MKYA 1T3NA 1C1CA 1FNMA 1RLCL 3KKFA 3QO9B 2M0GB 2WVCA 4Y34A 2ZH9A 1N33J 3HM9A 5L39A 4I64A 3W5XA 1PGZA 4F04B 2P9GA 2YWKA 5EN1A 1E6YB 2V8GA 3WX8A 3DOMB 4L3NA 2BQUA 1O6XA 3HHEA 2EFNA 1R8CA 3C3LA 2KI2A 1UEKA 5IWAF 3JSBA 4K4UA 2PSZA 1SKWA 2GC8A 1A9NB 4Y3CA 3MPUB 2EW9A 2DHXA 3VAFA 5LMUF 5M2UA 4DSKA 2BJ3A 1VQ8S 1JLGB 1X60A 3DGPA 4X62F 2R8HA 2LQJA 3PO4A 4FP9A 5A0YA 3OSPA 1JJ4A 2ACMA 2E1PA 2ZHAA 4A8WA 3ILJA 4IH6A 2ADBA 2VFUA 3GYNA 2D69A 1AFIA 4PPDA 3RYLA 2YPYA 2SXLA 3T9ZA 2F8MA 1TL4A 2KT2A 2AEJA 3DKDA 1U1RA 2E9RX 4PABA 3W63A 2PDAA 1TVRA 2KJWA 4HDGA 4LF5F 4MYTA 4F4WA 1P1LA 3F73A 2Y0BB 4YY3F 2HVZA 4M5JA 3MTKA 2HZCA 1PYOB 2CQPA 3IRXA 3IC1A 4B17A 1WSVA 4DV2J 1AZSA 3N0VA 1VIXA 3T5HA 2FD2A 3FQLA 4WE1B 3P5TL 3PY8A 2PC6A 3FZ2A 2RRAA 2CFXA 2DGSA 4LRDA 1FFGB 4IG0B 1YJRA 4KTQA 4OHZA 3ZZPA 2UUAJ 1HYSB 2V67A 5E3AA 1F0XA 4CDIA 2AGPA 3DLLQ 1UFWA 4L72B 3DMJA 5D3GA 2IYGA 2YQ0A 5ETQA 2JEIA 4OYBA 1S1UA 4HYKA 1RACB 1N34F 4GMKA 2FZKB 1I1GA 1SC4B 3PM9A 4KGVB 4KT0C 4ZVEA 2VQFJ 1JLBB 3CDBA 2EXUA 1HNXF 1DTTA 2RSQA 5L1IA 4B3RJ 5L9NA 5E41A 4HR2A 1VQ7S 3KK3A 5ETVA 2R8IA 4OZ5A 1CJUA 1U7LA 2XS5A 4LJMA 1J5EJ 2J0XA 2L08A 5CCMA 3J81Y 4DLEA 3Q22A 2ASJA 1YRUA 1VGYA 1FNOA 1CQMA 1HQUA 1HD0A 3B4MA 3BDEA 3SCKE 3OJUA 4L6V3 2H3EB 3A3PB 5KFZA 2CJXB 1T9YA 4ZK7M 3OVAA 3QFWA 4DR6F 2Q3PA 3P96A 4FVMA 2LQ8A 4A4JA 3PNIA 5CA5A 2W7OA 2GVDB 3WC0A 1OQ3A 4KKOA 4R0EA 4BBYA 3KHHA 3IBFB 4TNOA 3UCUP 2YBVA 2CQ2A 5DQHA 2CDQA 3BGRB 4B3OB 1S1WA 1I6JA 3D6MB 3ETMA 3CCVS 2BJ8A 2GJ2A 4D3HA 4ZN3A 4X4UA 4A8QA 3RBZA 1TL5A 4C2MA 3MM7A 2DH8A 5E3PA 2QLWA 2WHOA 2OHDA 4EK2A 5KFVA 4QPXA 1SKSA 4UZBA 2ZWPA 2DISA 3PYEA 1M1KT 4WYLA 1GMWA 2DNGA 5C5JA 2HLUA 1LWCA 2LXFA 4ZCKA 3K0JA 1WG4A 1NM2A 2NREA 2NZCA 3Q8YA 4CLYA 2IJNA 5LM7E 2DHSA 4QR1A 1Q5VA 1WD6A 2XS7A 2CG4A 3K2YA 1JLFA 3IP0A 2PO4A 2UVUA 1IVZA 3T5LA 3TA1A 5KFUA 3FSYA 4TY8B 3BJYA 4LSNB 3CJ3A 3VALA 4O3SA 1VBZA 2IVMA 2P9EA 4NI2B 4U96A 5JXSA 3LUYA 3KG1A 4CWBA 1K0TA 2M9KA 1TAQA 1PSDA 2BM1A 3AQOA 4PR6A 4OZ0A 3C6TB 4PUOB 5C42A 5GAEI 4EEYA 3QGGA 3UDVA 5KFHA 1XJWB 2RS8A 2XCPA 2FUG9 2V94A 2KVIA 4JI2F 3VZHA 3GJSB 1RE1B 1FVSA 4WZQA 2V0NA 5HMXA 3QZ8A 1TL3B 3Q8UA 3R3TA 1WC3A 4DCPB 4RUHA 2NR0A 4YR2A 1FJGF 3KLIA 4JI8F 3W8GA 2CJYB 1WEYA 2QJ3A 4OYMA 5G4DA 1QVGR 2ZE2A 1FWKA 2L3MA 5D78A 2LFVA 2GMLA 2OGUA 2BR0A 1X4AA 4O4GB 1LWFB 1JXEA 1TU0B 1YRXA 2N3OA 2CPZA 8RUCA 4ENOA 2HNDB 2GHVC 2JX2A 2XHCA 4F0HA 4FBUA 4CLFA 4WIIA 4USWA 4DMZA 4NLUA 1WF0A 1MLAA 3E3XA 4A47A 3FCHA 4AUKA 9ATCB 3CCSS 1NDLA 3CD5A 2ZBIA 3N5FA 5LMNJ 1RJJA 4R0JA 2Z2MA 3GTYX 3HO1A 1H72C 2BJ7A 3O2IA 5I3QA 4C8YA 1R8AA 1F6TA 2XYHB 4B9LA 1GFWB 1NH7A 2H5JB 1CJVB 4FN5A 3I0SB 4H4KA 5G0RB 5A8WB 3H4BA 3Q24A 4ID5B 2W25A 3HX9A 2L9NA 4KR0B 4ED7A 4OI0A 1U0HA 3ISND 3KMSA 2B5JB 3W9HA 1U49A 5A6WA 2AZ1A 2MQOA 1WACA 1C4CA 2YX1A 1HBUA 1HARA 1WF2A 2OPSA 4W92B 3J7Z5 4P2FA 4R8UB 4Q0BA 4IH7A 1U02A 3EPGA 2J0WA 2VH7A 3DXSX 2EK6A 2XY6A 4OI6A 2F9DA 3JTNA 1S1XA 3W2VA 2VA2A 3UD4P 1Q86T 2DKOB 2XMWA 3OTCA 4JI5J 3E01A 4XTTA 4HDHA 2JLEA 3GFZA 4QW9A 2BV3A 1KN6A 2HWIA 9RUBA 2IAJA 3I82A 3V5RA 3W5ZA 4DV4J 1V5VA 1SIZA 1IKWB 3D9BA 3HVTA 4TYBA 1AYEA 2K2PA 5LXYA 4GO5X 3I9ZA 3HKWA 3PO5A 3VAMA 5H9FJ 1ZM9A 2HK2A 3LP0A 2RE1A 4HI1A 5KTQA 1UA1A 3TUPA 1UZDA 3GYGA 1Q0NA 2XNQA 1KC8T 3OT9A 3MPVA 3IGVA 5IQ6A 2B51A 1CJKB 4B9SA 4BS2A 3C6TA 4PUOA 1JK9B 4X4SA 1ZM4A 3QRQA 4ELVA 3OR1A 1TKTA 2DHGA 2WTFA 4DR7J 1HBMB 2VG6B 2F3JA 3BGLA 1N5YA 5D0GA 5DZ7A 1U1OA 3US5A 4TYAA 4I67A 1L3UA 4ZS6A 3CCJS 3W2VB 2H9ZA 3QYYA 2G2OA 2RD5C 3UFCX 5C2GA 4A8MP 1VRUA 5KAKA 3A8KA 3MTJA 2E5JA 4ETXA 4P10A 2DR7A 4MK8A 1HNZF 1UEUA 1EQ0A 1LWXA 1KHVA 2P5VA 3HDSA 4ZVRB 2DT9A 1T9TA 5LSRA 5CYQB 3OVBA 2DXDA 3EZUA 3C15A 4LF6F 4ZIVA 2CPXA 2R7VA 1CSJA 4MIWA 1R8HA 2FY1A 1HNXJ 4E8UA 2OP5A 4CT8A 1K1SA 1VK3A 4QYRA 2FVCA 3DYAB 4ECSA 5F8LA 3EJMA 4HH0A 2OMOA 4I0WA 2ZBQA 1RAHB 4QWDA 2XO7A 3MURP 4DCJB 3W1YC 1TAUA 4RWXA 4TU7A 3FEYB 2VG5B 2UU9F 1M5HA 2QIFA 1X5SA 3V4MA 1VISA 1K44A 4G1QB 1OS5A 4P2MA 4USVA 1UL3A 2AYMA 3TI0A 1HHTP 4NLGA 1N32F 3W65A 2BOAA 1M0SA 2LYVA 5ITHA 3M8QA 5IT4A 1NHUA 3PR5B 2F4FA 1AFJA 3P45B 4YHHJ 4BLGA 1SBRA 4E2FB 4QYZK 1QY7A 3DRRB 5J2QA 2YWHA 2EBGA 1IBLJ 2CPDA 1NHVA 3G8TA 1N36F 3QIDA 3UNYA 1NSPA 2KXNB 2KZZA 2YKNB 1IM6A 1PBUA 1N5VA 3GLJA 2GFFA 2Y1JA 3O6QA 1D9DA 3NMAA 1WF1A 2JOQA 3JSMA 2IMWP 3ZO7A 2DIUA 4DPWA 2F65A 4G1QA 3FUYA 2ADCA 1SQGA 2NCKL 5A8RA 1VRTB 4CLPA 4EI2A 5CD4H 1TL3A 2EVZA 4N5SA 2VQEF 5AXKA 3RTVA 1CJUB 1NK9A 2VHGA 2FLLA 5KG0A 4ECYA 3ENVA 3J7YU 3P5BP 1SL0A 5DO2A 3G6ES 4DV5F 3Q0AA 1Y9OA 2UXBF 1HNWJ 2K7JA 2XB2D 4ZHRA 5D4LA 1FF2A 5EWFA 5CHCB 4DFKA 2ASDA 2IY5B 4ED4A 2AYGA 2PGCA 1DFDA 1JNRB 2HFOA 5A8KA 3S8SA 4DPTA 1IXKA 1HBOB 4H4OA 2HIQA 2LP4A 2QV6A 3NGRA 1U48A 1GMWD 2ZNYA 1ZM2A 4DSEA 1SL1A 4LR7A 3OQ2A 2Y8YA 2JNJA 1FXDA 2D7SA 3VF0B 3MFIA 2GIRA 4ICLB 3H5XA 3KWMA 2VD3A 5A8KB 3PW5A 4DQSA 3EVMA 2WBRA 4ZVFA 1PKUA 2HAIA 2ZM6F 3PW2A 2OSRA 4JI5F 3IG1A 1B7FA 1UPPA 2EC0A 4G1IA 2XG8A 4LSLB 3DU6A 1RXOB 2C22A 3MXHP 3H2VE 3F0NA 3UR3C 1S6UA 1YQHA 4NWBA 4CLZA 3M6UA 3BQ0A 1RWKB 4MIBA 3WHIA 4ED6A 3TAQA 1TQLA 4FBTA 3CCZA 3IM8A 1ZYQA 2XMAA 2FJEB 3TAMB 3KLHA 1RWUA 1VOMA 2Z56B 3ZZRA 2V9KA 3MD3A 2FGCA 2IRYA 4U8VA 1MMDA 2HHQA 2J9CA 4OZ3A 4RO0A 5AT1B 3MFHA 3DDKA 4B9VA 2NSCA 4O3NA 2HQCA 4JI4F 3RAMA 3D3BJ 4CTAA 1RCOB 3V81A 1H73A 1E6YA 4R5PA 3HVWA 4X66F 4FF2A 1SH0A 3T3FA 2VL1A 4OYWA 5HI7A 5LJ3Y 2GVZA 4MMOA 3MI7X 4DR7F 3HVRA 3QO9A 4DWIA 1BE4A 1A0OB 3G82B 3KLEB 4FNHA 3P6YC 3GE9A 4WTOB 3JAMU 1H7WA 1UVNA 3Q8QB 1BWEA 2JFKA 5IM0A 4UQTA 4PWDB 1LXJA 1ZPWX 2FZGB 3KUEA 2I5JA 1RZMA 1Z4UA 2G0CA 1SV5B 3M8SA 1NJXA 2KTQA 5ETRA 2DXFA 4C6AA 4EMDA 1OIAA 1G2EA 3NG8A 5AXMA 1UWBA 2X1BA 1X0FA 3M30A 3ZC4A 2YNHA 1XIQA 4NMLA 4KB7A 4K4VA 1LKZA 3ISNC 2ZKTA 2YX4A 4X64F 4OMFG 5H9EJ 2AJQA 2FJDB 5F8IA 1NK5A 5A8WA 2KH9A 1SC1B 2VF3A 2FIUA 2YH0A 2Z57B 3NNAA 4KHPF 4FYWB 3MMBA 3ICLA 3ETOA 3T5KA 4FF4A 4OZNA 4KBIA 3CJTA 3HFZB 2FLPA 3G9CA 3IRXB 4N7TA 3FBCA 3TO8A 2R2SA 2CPJA 4ZCIA 3DU5A 3V4IA 1Y3KA 1RTIB 2P6TA 1TFWA 5KG2A 1Q95G 3MEDB 1M5SA 1UPMB 4F0MA 4DV4F 3N5BA 2C2RA 2FB0A 4IQMA 5KFFA 2FJBB 3PYDA 5DDPC 1N6QB 1AA1B 5DQGA 2X3DA 1WEXA 1AW0A 1U2FA 2DY1A 2NSBA 4F36A 3QLHB 4FYYB 3AJ2A 1QAIA 4DG1B 3D2WA 2WOMB 4DR5J 1RWXB 2G2YA 3I55S 5DLGA 1WG5A 4CM0A 1YJVA 2GGPA 2Z2LA 4Y65A 1RWVB 3EGZA 2KFZA 3J80Y 1S9EA 2KO1A 4MTPA 5AXLA 3WX4A 1C2PA 1KS2A 3FZBA 1KOOA 1XMOF 3DFEA 4ZVTB 1NB7A 2E9TA 3RRKA 4X4VA 3V4IB 3EXYA 3PEHA 2ZJPQ 2VDHA 1OPZA 2FC8A 3HSJA 4I6YA 2HHTA 4LF4F 2HS3A 1FFWB 2A18A 3CCQS 2ASYA 2MQQA 2JL9A 1VQOS 2Q43A 4UQGA 4DSJA 4RUBA 1NO8A 3GFXA 4PWWA 3E01B 2QT7A 2V2ZA 3GR0A 5K9FA 3U27A 3ZTRA 3Q2TC 1GTEA 3CB4A 4JI7J 4NLXA 3DMJB 3LP2A 1Q78A 2CQBA 1C1CB 4K2JA 1X4HA 2F5GA 2W4PA 4WPAA 1NK8A 4L75A 3QZ7A 2M8DB 4GKKF 2O1PA 5D8HB 3FFIA 1IBMJ 3W64A 3D54A 4DUZJ 4H4KC 4YDDB 4WCEQ 1RBOB 3MM9A 4TQRA 3T1YJ 3CMQA 4PG4A 3T6BA 1RTDB 2C3YA 2KXHA 3BPSP 3IS9A 4ZA1A 2NYIA 3PRVA 2Q79A 1KLMB 1FK9A 2KDOA 2BXJA 3KLEA 1NSKL 3B6BA 2XMVA 2UU9J 1XBWA 2DGXA 2QLJB 3OXLA 1EQMA 1W25A 2BE9B 3FJ2A 4OI4A 4C3KA 1KONA 2ZEJA 4EWTA 1SC3B 4RUAA 3PKMA 3PFEA 5AJ3F 2RQMA 1TVRB 2FGOA 3OR1B 4J9MA 3MEGA 1TMMA 2XSFA 2ZOMA 4UY8T 3I5CA 3UVJB 2XY5A 1RCXB 3QJPA 1NZAA 1S48A 2V4JB 4IG3A 1DRZA 3ENAA 3MM9B 3D28A 3I5AA 3NMRA 5C24A 4RJVA 3TZZA 4KFBB 4HACA 4K5RA 2V8PA 4CH0S 1UW4A 1XTZA 1G6BA 1U2CA 4O44B 4LSLA 3QRRA 2ZHBA 4YY3J 5CYMA 3H59A 3CCTA 4LFCF 3MEGB 3CDWA 4GKJJ 4LF1A 4KAIA 3MAAA 2BABA 3M2UA 3PVXA 1IKYA 3D3CJ 1KOHA 1FKPA 2CKWA 2QMXA 2VUGA 2DK2A 1NH8A 4DPXA 1FXRA 2FHJA 2KYXA 5DJBA 4CRJA 4ZVQB 5HLFB 2YQ3A 2Q6CA 2YWEA 5BJRA 1YI2S 4UUXA 2HBRB 2L41A 3O5TB 4LF8F 4OLPA 1ZTWA 3FRYA 1Y00A 4NI2A 1J5OA 3C14B 5T41A 5LOQA 2HNZA 2QZ8A 4EBEA 1X8DA 2DGUA 3IWLA 3PW0A 1FT8A 5HMYA 3KJVA 3OR2A 4ZP9A 1XMQF 4JV1A 2XMUA 1S6PA 2YNIA 2UZAA 3DLBA 2XS2A 1RAJA 2OD6A 3HK2A 3TRGA 3G82A 1TTHB 3QATA 3CSKA 4HHHA 3OUYA 2V9WA 3P8BB 1CC7A 1SJRA 1W7WA 1RISA 1UETA 4OYAA 1VHIA 2ZC4A 1OYDA 3B82A 4CO4A 1XERA 1PBAA 1V3RA 2V2KA 4I56A 4USJC 2AJ1A 4DR2F 3OVSA 4DSFA 1VRQC 1GNKA 2ZKUA 4ED0A 2X1FA 1HD1A 2FVQA 2K1RB 2WW4A 2J76E 2XMKA 2VDIA 4ED5A 3CIZA 4F2SA 2CWKA 2XCAA 1SL2A 3DOLA 3ITHA 2YNGB 3H5UA 4LRCA 2ZUGA 3H2LA 1KP6A 2IM2A 1QE1A 2MZRA 3C16B 4NLOA 1SC6A 4NA3A 2XBPA 4RNHA 4CO0A 1F5AA 1HNVA 5ETTA 2AHOB 1OY6A 1RKJA 1CS4B 2FLNA 1RA7A 1R8PA 2EI5A 2HHXA 3PHEA 4QWEA 4J90A 3I5BA 3PTWA 3IG1B 1Q8BA 2G4BA 2ZBRA 1R7IA 1JJHA 1LEOA 1VHFA 1RAGB 2KRRA 3JTPA 5ETPA 1LW2A 2E9ZA 3QSYB 1LW0A 1N4LA 3S7RA 2B8QA 2UUAF 4U7UK 1WI6A 4H4OB 4DR4J 1YBUA 3R2DJ 2BKPA 1U6BA 1ZAXA 1PC4A 5KT6A 2B9XA 3UE2A 2ZVIA 2CUYA 3IAM9 4QWAA 4ED3A 1FRJA 1T9XA 2IHR1 3B4DA 4XK8C 4DBQA 3UQSA 3T1YF 5D77A 2BRKA 2O3DA 2CQ0A 1JMTA 2Q1LA 3WDOA 3KLHB 2MZQA 2R7WA 1T0TV 2E1AA 5B0CA 1R0AA 2G1DA 5LL6d 2R2RA 4J9PA 3LF0A 4YQWA 4LRFA 2HVHA 2I5JB 1Q8KA 4PWDA 4MKBA 3KLGA 4WBFA 1XNRF 3NAIA 2RAQA 4JYAF 1RK8A 3GU0A 1R89A 2L9DA 2IBOA 2XEXA 1EB0A 3POTA 1HIYA 2VV5A 5KFWA 1RT1B 4OHWA 4O0NA 3I4HX 4A8FA 3JSYA 1ZTTA 4DQPA 3R27A 3LP0B 2ZOFA 3OV7A 1HHSA 1JLEB 5F9LA 4J9OA 2W9BB 2WVBA 3AODA 1PCAA 3AHPA 3QT7A 3AFGA 5KG7A 4Y0FA 4CTAB 5EWGA 3W3SA 1UAWA 2KG0A 1IBKJ 4NLDA 1TKZB 4WFAQ 2EPIA 2F8EX 3K89A 4JI6J 1XMQJ 1S79A 1XR6A 3IMQJ 3SFGA 5CXTA 1Q16B 4BDPA 4RW7B 1FTRA 2DNMA 2FPHX 3NRBA 2VG5A 1VK8A 2PEHA 3MD1A 3QT5A 2W9CA 3UI3A 4ED2A 2ZNZA 4KC5A 3R5AA 5L8RC 2XQCA 3IM9A 2PA3A 3VTIA 3POTB 4WJBA 4ZOSA 3CCRS 4FXDA 3D6FB 1CLFA 4NLTA 4F2RA 4V19J 3LPEA 3SCJE 3TVZA 3Q8RB 2W7AA 1UVJA 1AT1B 3QGPA 1KKHA 3N01A 3G8QA 3GONA 4PG7A 2CPEA 2LECA 2OKQA 2PIIA 4P6QA 4FS1A 1RWWB 1WELA 2DO4A 1FDBA 2YWFA 5KG4A 2ZDPA 2JZ5A 3TUZC 3WIUA 2DNZA 3CJ4A 4U7UD 1N0VC 1X4GA 3BGOP 1VC0A 2MZJA 2HLTA 2QE5A 3DRRA 4BHQA 3HLUA 4M5KA 3NOGA 4ER8A 4OX9J 1N5YB 2DY9A 1RA6A 4K0KJ 4N56A 2VG6A 5J2PB 4JI3F 3IWNC 4WF9Q 3C8YA 5L9XA 3UWTA 2E5IA 2IDLA 2IM1A 2HPUA 1FDDA 3PHTA 5K14A 2W9BA 4ZCMA 3TZXA 5KFYA 2ZH2A 1Y3JA 5KFRA 4IUFA 4OIXA 2GA7A 4IH5A 2ZBPA 5IXUA 4IR9A 2UXDF 4MKVA 1MSWD 1GT8A 4N41A 4JI0F 4C48A 2C2KB 1BWVA 1UFKA 2YH1A 3DOKB 4RBTA 3K58A 2QMUB 2ROPA 3W2WA 3WQPA 2MLYA 3DDIA 3WIVA 1X4FA 2EKNA 5HQLA 3C15B 2QA4S 1CJKA 3L95X 3ZXWA 2BMBA 2J7KA 4J91A 2F9JA 3AOCA 5LMNF 2J6SA 1V3SA 3G6VA 1HQ2A 1EKRA 3EZ5A 2OSQA 1VI7A 1KEKA 4IR1A 2DCUB 2UV8G 1WORA 2DYAA 3EGWB 2G13A 1NK4A 1NPRA 3CJRA 1FCAA 1OY9A 2LU1A 4I6AA 5K20B 2RDJA 2N3LA 3EXCX 1JIHA 4USMA 4HTJA 4ZLJA 4F4AA 1JX4A 2ATCB 2W4DA 2JEJA 3V6DB 4B02A 1IR2A 1QDUB 2BE7D 2OFGX 4ZP6A 1TP7A 1KDNA 2OD4A 1M5PC 4WU3A 4ZKAA 3SCIE 2CNNB 2MJUA 2I38A 5D15A 5CAAA 5BYSA 4LF8J 2KRBA 2CQHA 1C1BB 2MQNA 3A1YG 3JQKA 3MMAB 2C2DA 2MB0B 2XULA 2YNGA 2DB1A 4OQJA 1ZA2B 3H25A 1S99A 4B3TF 1LOUA 3LH2S 4USTA 2ERRA 1QSLA 4YR0A 1BQMB 1DLOA 2UV8A 4PG5A 4ZITA 5LXRA 3FRZA 5DS7A 1Y5LB 3PZPA 1YK9A 2DEIA 4KIAA 1JQGA 1Y0HA 3ZZTA 4X4NA 1IKYB 2OELA 3G86A 3GIKA 1ULRA 5KT5A 4OHYA 1MWZA 1HA1A 3BGRA 4B3OA 2E66A 2UUTA 3I0RA 3SFUA 3ELHA 3TX8A 1RT5A 3IN5A 1D3WA 3BSAA 4O0IA 5F8JA 4JV5J 1RT3B 2HRTA 1S9GA 2XZWA 3QT6A 2VQEJ 1RDRA 5D4OA 4CLKA 3AB2B 1RWPB 3RG6A 3R1LA 4EGLA 4DV2F 4M5DA 4ZLLA 1H0HB 1MN7A 2AX0A 1YJTA 3HJVA 5HQ8A 1WKKA 2GQCA 3QIPB 4IO9Q 3MMAA 4DJBA 1S6QA 3FEXB 3DM2B 4NYOA 2OAUA 5FLXY 3MUVP 3C14A 3M8ZA 4MFBA 1TKXB 3MR3A 2WK4A 1GMUA 4U8YA 2DH7A 3BSCA 3RR7A 1HNIB 4AT1B 3GZ7A 3AAWB 2ZHOA 1N48A 1FX2A 3L9ZA 4ZMMA 5HN0A 3DM2A 2AJ4A 2DNHA 1XR7A 2ZOGA 1Z2ZA 4FXWA 4PZVA 1YBAA 1RSCA 1S97A 1S1VB 4B3RF 2COLA 3NGDA 4ZCLA 3JXOA 1MROA 3I32A 5F3ZA 3PKYA 1MU2A 3L7PA 1T9WA 5C24B 3HI9A 2GJIA 2HWTA 2WONB 3CDUA 3MCSA 4LSNA 1RT7A 4NLYA 4DR1F 1TK0A 2VODA 1Y5IB 3AJDA 3BV8A 3O1LA 5E5NA 2JVOA 1YIJS 2BJEA 3CJ2A 3PCOB 4OHVA 5KFTA 3HT3A 1SH3A 5JJBA 2YVSA 5K8MA 1N52B 4EYIB 1SKRA 1GTHA 4BC9A 4K4WA 1B0PA 4F50A 2JVRA 2DO0A 2MY8A 2WZ1A 3MMCA 3QWPA 4K4XA 1VFJA 2HFZA 2CDRB 2CJAA 3AD8C 1X4EA 1YITS 2M70A 4ECXA 4AFFA 3Q89A 4QCLA 1GXTA 5T7LA 4TU9A 2B4PA 2MGZA 2RS2A 5K5MA 2D3ZA 2IC3A 4LT6A 2U1AA 4Y2CA 3PW7A 1SB6A 2CQ4A 2MKIA 4ZJLA 1HPZA 2BJDA 4QR0A 3VAHA 2VC1A 4K7QA 5KG5A 1FFSB 1HLWA 1HW8A 2HHWA 4AL6A 4RBVA 3KK1A 3OL8A 1O51A 2M52A 2GQ2A 2CZVC 5DRKA 2BA9A 5FLXU 1RT7B 1YJWS 4J7CA 3BQ2A 4K4SA 4JYAJ 4MKAA 4XDDA 3CO0P 3DOMA 4U7CA 1FWLA 4DQQA 3VQSA 3WC2A 1T03B 4M63A 2JLFA 1H6KX 1K1QA 1Q1KA 2E5LJ 3LWLA 1PG5B 4Y2KA 2P2CB 3LOUA 2AMCB 3WBZA 5F8GA 2DPIA 1NLKL 2LA4A 2VBYA 2ZWOA 2AYEA 4NE9C 1KQKA 5GAGU 4WFBQ 2IM0A 3QJJA 2QA1A 2Z2YB 2DD8S 2GJFA 2YWWA 3RRHA 3THVA 1D8ZA 4DFPA 1SIWB 4FS2A 3PYFA 3VQTA 4DFMA 2HQDA 4P74A 4EFAC 2R2TA 3FDSA 1RI7A 4FDFA 1H2VZ 4C8NA 4B3TJ 1AZSB 1P6TA 2NLWA 4F4ZA 3TAMA 4ECUA 2E5GA 1SJFA 4NCGB 4URQU 4WFYA 2E1MC 3BPDA 4JI3J 2F8HA 4PAAA 1CJTA 4PXDA 2D1CA 3VWSA 1CVJA 4JBCA 2VICA 1T11A 4DG1A 1U0SA 3FNNA 4CQ1A 2B7BB 3CUNA 2IC3B 4ED1A 3HFVA 3O44A 1X4DA 2OIHA 2ASLA 1YJNS 3NWRA 2LVWA 3KHRA 4IOAQ 4B3MJ 1KVJA 4QYZJ 2CWXA 2DNRA 2JWNA 1FESA 4ZPWR 4Q2MA 1NK0A 1ZAVA 2NXCA 1TV6B 1TZ0A 2HQGA 2ZUAA 4MK9A 2WVFA 3DLEA 3ENWA 3KUHA 1S12A 2MSSA 3MECB 4UZCA 2BM0A 3M2VA 3BYPA 5IT0A 3T1HJ 3OL7A 2QFJA 4JV2A 1DLOB 1KQGB 3PG9A 1RQ0A 3R7BB 1W26A 1IKVB 4LR9A 4OFZA 2R8JA 3D7SB 1RTDA 5KOWA 4M5MA 2DRAA 2BANB 5I42A 3EM1A 3CE8A 4X65J 3UPFA 2HBZB 4P73A 2XYPB 1YRTA 5D0HA 4YMEA 2UP1A 3CULA 1JLGA 3M9OB 2IVFB 1E6VA 1RUSA 2JC1A 3UDEA 2YKOA 5A76A 1RYSA 2QMWA 3HULA 1SQFA 3N79A 3M6WA 1U26A 1HMVB 3I31A 1HL6A 3JYTB 2MTLA 2VFSA 4Z7YA 1VLYA 1DTTB 5DM6Q 1RT6B 1BGXT 1W2IA 3I6PA 3RBDA 1VQ5S 1UJ6A 1R3NA 1UZHA 3R7NB 2QLFB 1DARA 4KQZA 1HBNA 3OFGA 2BANA 2BZ2A 2VU5A 4GVBA 4NLQA 3TYTA 2XMTA 1U2RA 4LFAJ 2YKNA 2I1RA 5CQGA 3R6GB 3QIPA 2BQRA 2R2UA 3H2UB 2RF2B 2MKHA 4FVCA 4AE5A 1SJ4P 1S0MA 5K8NA 4KHPJ 2PFFB 3QRPA 1NPPA 3KDNA 3EGVA 2ZH8A 2APOA 2R7SA 5BYQA 3BO4A 1M1HA 3MM6B 1Q8IA 4CH7A 5F3TA 4H4MA 2WSFC 3TZYA 4NCBA 2VIHA 4UT4A 1K9MT 2XO6A 3TAPA 1Q82T 4ELUA 4JV0A 5AJ3J 4GC7A 1PYTA 2AJ2A 2QX0A 1L3SA 2DR8A 3E2EA 3R7SB 3PR4A 3PW4A 4F02A 2KG1A 3MECA 1WSRA 4QIGA 3VGSA 1FDNA 5B09A 3PIOQ 3LGHA 2V4QA 3VAGA 4F4XA 1RLDA 1YKWA 2ACYA 2KHCA 3I9V9 4IFYA 4GC6A 1EP4A 3H5SA 3TA2A 5A8RB 1LV5A 3LAKA 1EZZB 1S72S 2AD9A 1REGX 2CPYA 4F8RA 2NPIA 3U02A 4IOCQ 1JWWA 2K7KA 3CCMS 4TY9A 4NXMF 4ANDA 3M7VA 4O3OA 4K8RA 1XMOJ 1R43A 4LF9J 5HJYA 3OHAA 3LP1A 2GV1A 4ICLA 2Q6BA 2O5DA 3MM6A 4HT5A 5LT5A 3SSSA 1FE4A 2JH3A 3UN5A 2ZH7A 1Y5NB 4X4OA 2ZJRQ 2ZZMA 5D0RA 4UUWA 4LF4J 3M2RA 1VQNS 1TL1A 2CAJA 2EKYA 2HNYA 2XZDB 5IQQA 3UNGC 4NYZA 4R25A 5IT9Y 3ET6A 1S1TB 2ATLA 1HWIA 1UEVA 4MH8A 2V2VA 1B99A 4DU7A 1HBNB 2JLGA 4UTGA 5F0WA 3T5JA 4ZHRB 4G65A 1KNZA 3RB6A 1AUSL 2HGLA 2HVEA 3M1VA 4LBHA 3JSMB 4WK1A 5BR8J 4ERDA 6FD1A 4EZ9A 3AD9C 1NNDA 4IFVB 4MIAA 2VG7A 2ZITA 3EDQB 5LSOA 5KFDA 3CCWA 2BW7A 2ZZTA 4F26A 2X1AA 2AYBA 1ZOTA 3UCZP 5CCLA 4PQUA 3UDCA 4DF4A 2NXUA 1PIEA 2AEMA 4IDKA 1EHWA 2C3UA 1FRXA 4RW7A 1SXLA 3H0PA 3FGVA 3JQMA 4HACB 4QPTA 3KTQA 1HPZB 4LBIA 3O3LA 3M8QB 1RWOB 4DL0C 4WFNQ 2QA4G 2HYIB 5FDLB 4WFXA 3NNHA 4ED8A 3THPA 1LK5A 1RT2A 1FD2A 1RT3A 1WDDA 2B3TB 1NSQA 3BBFA 5KT2A 1EAYC 2IRUA 2ZVSA 3UD3P 2XSJA 1DTQA 3BH6B 5F41A 4YP3A 1G3OA 4OI2A 1KFSA 3OFHA 3KNGA 1QD1A 1QTNB 1U25A 4NX9A 5KFLA 3W8PA 5F9NA 3BYRA 4OX7A 4HH1A 4J9LA 2HMIB 3W5YA 3M8RA 3GCWP 3K59A 4ECQA 3EPIA 2QGFB 1YZ7A 5CD4A 1VBXA 4HHJA 2G9OA 4I6WA 1TELA 2VJUA 1HW9A 1OWXA 2V2QA 4QWBA 2OFHX 3PFOA 3OBIA 1V6HA 1WTFA 1TK5A 1VRUB 2WVEA 3ONQA 1MU2B 2BJ1A 3P4UB 1YSJA 1HWLA 1MROB 4X65F 3KLVA 4ECRA 1MMLA 3IWXA 3HHLC 1FTCA 4HVZA 2M88A 2NUUG 2DNYA 4XPEA 4F4YA 2CQGA 1RHKB 3KNAA 3DI6B 3PYGA 4A8OA 1IR1A 2YKQA 1X0PA 4OX8A 4DUYJ 3L4BC 2EK1A 4DQRA 1EJ7L 1HI1A 3HHLB 5L46A 3I4PA 1S1XB 5KG1A 1UJ4A 3NEKA 3MUTP 3MM8A 2RDIA 1T03A 1HBMA 3OTBA 2VBZA 4P72A 4ES1A 1TMJA 4ZPTR 3KG4A 1D09B 2GGPB 3BS9A 4NOHA 4WIQA 5D4NA 4OI1A 3HXMA 1U47A 3C2PA 1F2GA 3D1HA 4M5LA 1LFWA 5E3QA 4N77A 3OHBA 5DZ6A 3K57A 3R2CJ 2FHKA 4Q5VA 4K0KF 1U1KA 3D0HE 2FLOA 4NXNJ 2HWHA 4E0DA 1NAQA 1Q5YA 1IN0A 5B0DA 1XQIA 4FYVB 4O3QA 4Y2IA 2GHPA 4ZLNA 4EO6A 3BQ1A 4DV0J 3CC7S 3LA0A 2VBWA 2FVPA 5FD1A 1NJWA 1FRHA 4C8ZA 1D9AA 2HK3A 2CJKA 4ECWA 2OUGA 4FYDA 2FJWA 2J9EA 2MZSA 2XHWA 2VJVA 3V6JA 1Q53A 2B6AB 1OJ4A 1RAAB 4BC7A 2XC9A 4IOBA 2XY7A 4RW6A 2MLXA 3FFIB 2JSXA 3IR5B 2A2CA 3MPWA 2BW2A 4A8SA 4NXMJ 3HZGA 4RNMA 2RKIB 2LLZA 4JP8A 4U67Q 1HFEL 1U6FA 3IFEA 2MQMA 4NRTA 2ZH6A 1SI9A 4C8KA 3H90A 5DLFA 1S6OA 5KT3A 3I0SA 3LGNA 4ETZA 1S10A 2GIQA 5IC4B 4ANCA 2FHOB 2HFUA 4WU2A 5CYQA 1XK8A 2MMYA 3T9NA 2UXCJ 4XDCA 3U1LA 1KTQA 5LSLA 2HSEB 3BN7A 1IBCB 1N33F 4DV1J 3C19A 2E5HA 2WSEC 1NK6A 1UMJA 5BYRA 3RJMB 4RW4A 1CBKA 3DCAA 3W7BA 3MEKA 5HBMB 5I4MA 2N4DA 1NB2A 2R7UA 3N6MA 2IDEA 2ILYA 4K2XA 3JS9A 3GILA 5KFSA 2F7VA 3JSRA 1VQMS 4PCQA 2H54B 5I3PA 5G0RA 3DLJA 2IMOA 3LP1B 2C2NA 3U1NA 3QLHA 3Q83A 3MMJA 3DHXA 5K8PA 3Q2SC 4YDXA 1EETB 3K5MA 2V69A 1VIOA 4LVNP 4ZPBA 2ZE2B 3TZWA 2VZ9A 3W2WB 5IZHA 3M32B 1HQUB 1NPKA 3DOKA 2A3JA 2WB1D 1URNA 3KMQA 2QLBB 2EFQA 4QJVA 4OLOA 4IG3B 3W60A 1SQEA 1WOOA 3G8SA 4PG6A 2RRBA 1D8YA 2RIJA 3N4WA 1WHWA 1DURA 3W61A 4ILLA 1I5OB 1QAXA 3I56S 2Y0SD 1ZPVA 2R3VA 2LDYA 4KGKA 1UWAA 4CLWA 5D4PA 4I2PB 3PIPQ 1JLQA 2LQ9A 1VJWA 1UKUA 3SMZA 4OI3A 3N6LA 4C11B 2FDNA 1MNEA 1VQ6S 4WP9A 1U45A 1NCLA 1EARA 5C42B 1TL1B 1V3ZA 5FDLA 5KFOA 2RDDA 3RRGA 2HBYB 2W7PA 3M8YA 1V9OA 2RHQB 3BGFA 4TY8A 2EEYA 4NXNF 4B9NA 2CQCA 5HO4A 4K4YA 4Q8FA 1FRLA 2R7XA 4M8LA 4QW8A 1RB0A 3EDRB 1URRA 1ELOA 4DUZF 1TKDA 2HRYA 2O67A 3AT1B 2EC2A 2JJ4D 2I6WA 4P7TA 4J9QA 3A4TA 1M90T 3BDPA 3NGKA 2HBQB 2DGTA 1OSCA 2IA0A 5LJ5Y 2XLJA 4NA2A 1HI0P 5CH7B 2DH9A 4OYXA 2GAHC 5JUMA 1F1BB 1JLBA 1YX2A 2YNFA 1KSPA 5MAOA 5CYMB 3K8WA 5C25B 2MKCA 2YKAA 3QAUA 3ZZ0A 1S76D 1IKVA 2V50A 1BLUA 2GMHA 1HNVB 3DC2A 3ILOA 2AJ0A 1B4SA 2XI3A 2PFDA 2XZTB 3IAS9 2JC0A 2AW0A 2D3UA 3M2RB 4OX9F 3DRSA 2QL5B 3R5JB 3OPKA 2ZJQQ 4YOEA 1EKSA 2GX8A 2FHMA 3ITHB 2RH3A 4PQUB 1U1MA 2OI2A 4KPCA 4Z7CA 2HZAA 3ZTQA 2RQKA 4DZ6A 2DNKA 5DGBA 3KHGA 3AB4B 5J2NB 3M1VB 4DLGA 2V8DA 3Q8SB 3OJSA 2MXYA 3KLIB 4DPUA 2AZ3A 1DQAA 2F4VJ 1RABB 3OL9A 1RTHA 4MYUA 4ZVOB 1S1TA 2LEAA 3QAEA 3ET6B 3OUYB 5I3UA 2NXNA 1OSDA 3B78A 4OX6A 3RB4A 1U24A 5THWA 2QFIA 3RGIA 2YKMB 2LCWA 2W2MP 3VCDA 1GAOA 1FX4A 4CLLA 3JAMY 2X51A 3ILLA 1QM9A 4JOUA 4NZ6A 2HNZB 1F9FA 5M2RA 1JLAA 4TN2A 3SDEB 4CLTA 4DZDA 3CDAA 3IA0A 2R8KA 1FD8A 4GO7X 1F3FA 1R0AB 1FRMA 5E0OA 4ZP7A 4F7VA 1U1NA 3OTOJ 4IDKB 2YKPA 3CNQP 4NZ7A 1JKHA 2DCLA 3D68A 5GAHI 3M05A 1Y11A 4UW2A 5DDOC 2DNPA 4LF2A 4DXLA 1REVA 1KTVA 3M8PB 4FZVA 4D3GA 2FHJD 3GG1A 1SH2A 3U1MA 4WP3A 2B4VA 1GEHA 2AGOA 1GMVA 4MJKA 4WWSA 4JI2J 5IT9U 3DLKB 3HKZD 4TQSA 4F3OA 1N88A 2CJQA 1JJ2R 3Q8VA 3D4JA 2XYGB 3BR9A 3AD7C 3O8WA 5KG6A 2GVZB 5IFMA 4DR2J 4DR3J 4DR1J 4DL7A 4B9MA 2B56A 1SVDA 2HVIA 2I8EA 3OLAA 1RAOA 4X64J 1RTZA 4A46A 3D5MA 5HP1B 1WEZA 5KFMA 3PEJA 2W9CB 1U1PA 1WKJA 2GVDA 1S5ZA 3DOLB 2NXEA 1VQPS 2V4JA 2KYZA 3MCNA 4Q2LA 4N47A 4RW8A 1S0OA 3UR0A 4MAKA 2B9WA 1TKZA 2LDIA 5T7LB 2DJWA 2J8AA 3D1QA 3FBFA 5H1SV 3J7YI 3K5LA 4F0KA 1QE1B 3C16A 3LPYA 4CCHA 4NLVA 4MKYA 4XIUA 1TFYA 3NGUA 4JV5F 1YJ9S 3HP6A 1IUJA 4CT9A 3K5PA 2EG1A 1FJ7A 2GCFA 2M8HA 4BWMA 2BVZA 4M5GA 2XMMA 1FK9B 4ZPVR 4KE5A 3HSZA 3SV3A 4ES3A 2F40A 2HG4A 4I2QB 3GSIA 4USUA 3LTOA 3QT8A 3NP5A 4ZDNA 1BUXA 2HGMA 2MJNA 3HFKA 1R6YA 1CJTB 3BEGB 8AT1B 4DR4F 1S1UB 2B43A 4NCGA 1HNZJ 3P49B 6FDRA 2UXCF 2OPPB 3CCLS 1IWGA 1DY3A 1OY8A 1HYSA 3HF5A 1QJHA 4DV6J 4OJ1A 4DV1F 2OPRB 3MDFA 3QPIA 2EFOA 2CNKB 3CVKA 1WKLA 3MCMA 1YGYA 5J1EB 4L3KA 2VB6A 4OYPA 2A6OA 4X4QA 2HQ3A 2IIHA 3MPYA 1S7IA 3JQJA 2OEKA 5FIIA 1B0VA 3GJRB 2MEWA 4TLQA 3BKFA 3BZQA 3F44A 4PEOA 1GQEA 2HS4A 2J7WA 4UOCA 1JB0C 2BACA 3EVWA 5A2QU 3DRPA 1T8EA 1RU1A 2MQLA 3R8YA 2L9WA 3GQCA 3NL0A 1Q8LA 2E7XA 2JFDA 2W4CA 1SJ3P 1B0TA 1UFLA 2P9CA 3SCLE 4OV6A 1UVLA 1SJ1A 2DNNA 2MSTA 4C4WA 5I42B 2YXLA 2HNDA 2NXJA 2IAJB 3KDOA 2Y9HA 4HKQA 1HWUA 2PA8D 3TVYA 4USIA 3SQGA 3NGTA 4LIRA 1QVFR 3NKYA 4ILRA 2DXEA 3X3UA 1L3VA 1RHRB 3HHLD 1K0VA 3GV5B 3JB9k 3B8HA 1U6ZA 1C0UB 4OZLA 1ITPA 1AXQA 4Y2AA 2HKEA 5JVGQ 5KFKA 3BBBA 4LBPA 5ETMA 5DGAA 5HVHA 5KFGA 1PO6A 2C42A 4HEA9 3BF4A 3KJFB 4QU6A 1OYEA 3RBXA 2HQFA 4I7FB 4KY3A 3CJSA 2CVIA 4AXJA 1HNWF 1DJ0A 1XN9A 3D6HB 2QLXA 5DG8A 2D9PA 4DL5A 3M4XA 1X9WA 1YJUA 4OJHA 4TU8A 2XLIA 1X7VA 2OPQB 1SKUB 4M5NA 3OTOF 4M5HA 3IS9B 1QUVA 2CG8A 3SXLA 3KLFB 2C3PA 1SPBP 1U1LA 2DRDA 2LXUA 1VQKS 2UVRA 3VGVA 1S57A 4LR8A 2BE2B 1TR0A 5SUHA 1UA0A 1G1XA 1GH8A 4LREA 1VDHA 1U8SA 3LALA 3CDEA 2E7WA 4KV8B 1X4CA 2M7SA 4C11A 2GNKA 4M1KA 4P2XA 4I4BA 3DLEB 1RAIB 2H4YB 4PYDA 5KFAA 4QOTA 2H4WB 1MWYA 2E44A 4NL5A 1XNRJ 4KJIA 3M32A 2HFVA 2P6SA 4P9SA 2CIMA 2RRNA 5E33A 4O3PA 4IRKA 3SQGB 3MM5A 1RGVA 3TANA 1BQMA 4WKYA 2V4RA 2ZD1B 2N4CA 5B0GA 2EWHA 2W24A 3K17A 4ITSA 1FWPA 4AYBD 1H38A 4LQ9A 3D1OA 1P1TA 3CJ5A 3T41A 5A6PA 3CC2S 4B9UA 2Y8WA 4WYWA 4FXVA 2W2OP 4K50A 1KFDA 3RR8A 4LFBJ 4M5DB 2C28A 4QIVA 1RAFB 1C1BA 3TOQA 2X3GA 4JI4J 1NEEA 4IYQA 2MY7A 2LU2A 2OMLA 3HCXA 4LSZB 4LF5J 2BKNA 3SYZA 1FJCA 4CO2A 4U9RA 3TUJC 5C25A 3OXFA 2YNFB 4CH1A 4RLEA 4RBUA 3LW5C 4Q8EA 3R97A 3M6VA 1X31C 4ZLPA 4LQ3A 1RP5A 1ZZFA 2AF6A 3DRXA 3DXBA 3MMCB 4HI2A 4IKAA 4ZPDA 1UVKA 1X5TA 2B9YA 2LQBA 1H2TZ 4RPFA 1PAEX 3FSXA 4FYXB 1R0BG 1RHUB 4LRBA 4YB7A 2DR6A 3FBEA 3TUIC 4YEAA 3VR1A 5ETOA 3R5DA 4I69A 3PX0A 3UN2A 2J6UA 2PD1A 3KJQB 1KR4A 3HSDA 5MLCV 5A2QY 4RKUC 3FBBA 1SCJB 3IXQA 4CO1A 3AXMA 4I68A 2W01A 1F2HA 4QIFA 4ALZA 1R0CB 5D6GA 2MZ1A 3BO2A 1DQ8A 1EIYB 4LVOP 4LFCJ 1NSAA 3C46A 1LNQA 4QZVB 4C0OC 1ZZNA 1P27B 3KOAA
chains in the Genus database with same CATH topology
3R5BA 3PACA 4LFAF 3BO3A 3NLCA 1RT2B 4EYHB 3V81B 3DDNA 4QIWD 4K59A 5GADU 3P3DA 3GFYA 4ILMA 2KU7A 7FDRA 2EFGA 3S01A 2B4UA 3NCPA 4C0HA 3CMAS 2O66A 3S1TA 3EX7B 2LEPA 2C3MA 2ZBCA 1I94F 1VQSA 3GIMA 1YHQS 2XGQA 1XEZA 1IR0A 2BBEA 4EU0A 3KK2A 2K3IA 4RNFA 2AJFE 2J0QD 3FMWA 3HPOA 2WOMA 4PQAA 2R8GA 2PMZD 2MYFA 3CJKB 1S4FA 3CF5Q 3DLKA 3V6KA 5F8MA 7FD1A 4QIEA 3MM8B 1T95A 4A8KA 1IM4A 1KRPA 3PV8A 4RW4B 2HS0A 2V8VA 4XPCA 3L7OA 3PDNA 2YX7A 2VPWB 4J37A 3OSNA 2IM3A 5B0FA 5M2PA 2PI5A 1HBUB 3VAJA 1VMBA 3K7RA 4OV1A 2W8KA 4QBUA 5EUHA 4WKRA 5HROB 3AQPA 1FHTA 1MMNA 3G6YA 4OJ3A 5KFCA 3IGNA 2JEGA 3N9UC 1T05A 3NS5A 3BREA 1Y4ZB 2R7RA 2GHWA 1RTHB 2B6AA 2QSWA 1SV5A 4KO0A 4PG8A 2HMIA 1WI8A 2POKA 1IJEB 1X5PA 3M6XA 3GG0A 2AX1A 4FF1A 5A0YB 1ZBTA 1WHYA 2J9DE 2D3OR 1ZETA 1QLNA 2QSFA 1FO1A 3J7A1 2NS1B 4ECVA 3SSQA 2N82B 2GO8A 1AUDA 2CRLA 1H7XA 3V2UC 3ZZUA 2FTRA 1WHXA 3CT9A 1C0TB 3CD7A 2KXFA 3HVTB 4LFBF 2H5EA 1IKWA 1IKXA 1YTYA 4A8YA 2UUWA 1Q4RA 4Q44A 4DV0F 3T6JA 1FNXH 4F3QA 1LXNA 4OZJA 3K5NA 2A2DA 5KFIA 4E98A 3ENQA 3ZZOA 4BCAA 4C8OA 2Q66A 4F67A 3M9NB 5HL7Q 4DN0A 1T05B 1E6VB 2V8HA 2XWXA 1GX5A 4H54A 2BQ3A 2CYYA 3MR5A 1N8RT 3R1HA 3TP2A 2R4FA 3ULHA 1Q81T 4KO0B 3OL6A 2E1CA 5J2MA 1J5OB 4JI7F 4HT7A 3ZFVA 2AGQA 2R7TA 3CEDA 3CD0A 5D3GB 2CPHA 2LEBA 1IBMF 5KFXA 4NYPA 4RNOA 3TW0A 3HHKA 2KN4A 1P8GA 5J1PA 4IG0A 3PX6A 1DAXA 1HBOA 3OLBA 3OW2R 1UVIA 4DV7F 4MK7A 4CIOA 3IR6B 1JLQB 4DN9A 2VC0A 4N8NA 4I2PA 2EFPA 1L3TA 2GQQA 2K1RA 2PN6A 2QA2A 1S7HA 2ABYA 4H4MB 1D0EA 2YKMA 3PRDA 5KOXA 4U6PA 4WTYA 2Y1IA 2I0XA 4F3MA 3MGJA 5GVQA 4B3MF 4DSLA 2E1RA 4M95A 2CQ1A 2IBKA 2DGOA 3LWMA 2ZH3A 3Q8PB 1NK7A 1Z2LA 5J1NA 3CWJA 5EGYA 3H40A 4NZ0A 1HQEA 1IJFB 3FVYA 3AJ1A 4X4RA 2RF2A 1WTBA 3DRSB 4WFZA 4CO5A 4P2SA 4EZ6A 2QYCA 1GXLA 2VG7B 2FJAB 1FKOA 2VONA 1OQ6A 1XR5A 2VFVA 3LGMA 4NLWA 5JVHQ 1KVIA 3HJFA 3GIJA 2HRUA 2FVSA 1CQNA 1X4BA