1C0UB

Crystal structure of hiv-1 reverse transcriptase in complex with bm+50.0934
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
435
structure length
414
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 119
structure length 414
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0uB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uB03
2YNIA 1TKZA 3CJ4A 3BSOA 2IBKA 5KT7A 4IG3A 3UPFA 4ZVGA 4I2PB 4EEYA 5KFYA 2B5JA 1SH3A 2W9CB 1S1XA 2IM2A 2OPSA 5HP1B 1QAJA 1BQMA 3FQLA 4RU9A 2AU0A 4FBUA 3ICLA 4ZMMA 1RTDB 4U7CA 1VRUB 3BR9A 1WNEA 3DYAB 3JSMB 2IM3A 1S9GB 4IFYA 5DG8A 2JC0A 3V6KA 3I5CA 3DRSA 4MH8A 1JLAA 1JLGA 2UVVA 1LWCB 1UWBB 3IS9A 3QGIA 4MFBB 4Q0BA 1GX5A 3KK3A 3HVAA 5EWEA 2BQ3A 4IRCA 3OL9A 4ID5A 5KFBA 5F8MA 4K4TA 2B6AA 5C42B 5I42B 1RTHA 3GYNA 3GV5B 4ED0A 3V6HA 3IRXA 3KLIA 4HYKA 3PJXA 1Z4UA 2W7OA 3BSNA 3RAXA 1RT5A 1T03A 5KFOA 3DI6B 3HVTB 2OPQB 4J9KA 4RNHA 1HNIB 2ZE2B 4IFVB 3DLEB 2UVRA 1T05B 4IG0B 4PUOA 3N6MA 4KE5A 3M8QA 1S1WA 3QZ7A 2GC8A 1REVB 4YP3A 3KHGA 1RYSA 5L1IA 5KFZA 3PJWA 2IM0A 3KLHB 1YVFA 4WYLA 2D3UA 4WE1A 4MKBA 5KFWA 4Q44A 3BQ1A 5KFIA 2AGOA 4HKQA 2XGQA 2J6TA 4LSNA 3ITHB 1LWEB 4ZVFA 3LP2B 4IR9A 2WOMB 4NCGB 4F4XA 3TAMB 1RA6A 3DMJA 4LSLB 1RT2A 4NRUA 4TXSA 1C0TB 3CWJA 5KFKA 3CDWA 3H59A 4ED6A 1S9FA 3CJ2A 3G86A 3C6UB 3NAHA 5KG3A 3UQSA 2EC0A 4B3OB 4F50A 3V6DA 1DLOB 3QLHB 5HROB 4PWDB 5J1EB 2HNZA 1JLBB 3MEGA 1S4FA 5HBMB 3PZPA 4KFBA 4TY8B 5KG0A 2WHOA 1QE1A 4QWAA 5J2PA 1SH0A 4U6PA 2IM1A 1W25A 3NAIA 4K4YA 2E9ZA 3C6TB 2R2SA 2VG6A 2OPRA 1K1QA 2YNIB 2HNYB 4XO0A 1S48A 4I2PA 3V4IB 3LAMA 1JLQA 4RUAA 5KFVA 3PHEA 2OPSB 4RW8B 2FVRA 4ZVEA 1BQMB 2YNFA 5JUMA 2V0NA 1JKHA 5L1LA 1JLCA 3OHAA 4NLWA 5F8GA 3DYAA 3JSMA 4Q8EA 1S9GA 4IFYB 4O4GB 1JLAB 3Q8QB 1UWBA 4J9PA 3DOLA 4MFBA 4NLSA 1HPZB 5EUHA 3H2LA 3NGDA 3KK3B 3MR5A 2I1RA 5C42A 5I42A 2UVUA 2B6AB 4RW9B 2E9TA 2OPPB 3KK2A 1HQUB 2AGPA 3CJ3A 1JLFA 3FQKA 3OSNA 1JLEB 1LW0B 5DLGA 3DI6A 3HVTA 4ECSA 2R8KA 4IFVA 3CIZA 4XPEA 3H4DA 1T05A 4IG0A 2O5DA 1XR6A 4DEZA 1RT4B 1S1WB 2WONB 2RF2B 2RDIA 2ASDA 2YNGB 1S1VB 2BRKA 4NLGA 2JEJA 5J2MB 2QE5A 2AGQA 4J9MA 3KLHA 3GIKA 2YKNA 3OHBA 3UDLA 1FKOB 3ITHA 4LSNB 3LP2A 1HYSB 4MK9A 3PVXA 3TAMA 4LSLA 3DMJB 2UUTA 4K4WA 5DGBA 1S0MA 4JV1A 4YR3A 1RT2B 3KMQA 4NLDA 2IJNA 3C6UA 2R2TA 2FLNA 4KO0B 3DLKA 3IGVA 1SUQA 4B3OA 1TKTB 1DLOA 2BANB 5FDLA 5HROA 5J1EA 1JLBA 5C5JA 4NLVA 5HBMA 3MEGB 4TY8A 1TVRB 4KFBB 5DG9A 4RZRA 4K4ZA 3GV7B 5J2PB 3I5AA 2IAJB 3V81A 4G1QB 5KT6A 1J5OA 4ZPAA 2VA2A 1S6PB 4MK8A 4Q45A 3KK1B 4EBEA 4NLRA 2VG6B 2OPRB 1HNVB 4RW6B 3IG1B 2HNYA 2XC9A 4GC6A 1RYRA 3V4IA 4J9QA 1C0UA 4YR0A 4DL5A 1MMLA 5DQIA 3EPIA 1JLQB 4RW8A 2D41A 5KG7A 2YNFB 4O4RA 4RNMA 3GIMA 4R8UB 1JKHB 4IDKB 1JLCB 1D1UA 1KLMA 3MEEB 1RT3A 4KB7A 3CVKA 1ZTWA 4O4GA 2FVQA 3NMAA 4TQRA 4M94A 4ED1A 1HPZA 3DOLB 3KMSA 1HQEB 2J6UA 3M9NB 3T5JA 2ILYA 4RW9A 1CSJA 5KFNA 2OPPA 3GV8B 5DGAA 1HQUA 4YR2A 3KK2B 3PW0A 1JLEA 1JLFB 1LW0A 4TYBA 2W7PA 3RB0A 3LALA 4EO6A 1EP4B 1JXLA 2YKMA 3G6YA 1S0NA 3SFGA 2J6SA 4K50A 5K14B 1RT4A 2WONA 2RF2A 3HVWA 1SV5B 2IJFA 3N6NA 4ECQA 2YNGA 3V6JA 1S1VA 3TQ1A 2XCPA 4TLRA 4ZPBA 4JUZA 5J2MA 1JIHA 3KLFB 4H4OB 3H5SA 4ZP8A 4J9OA 5KFFA 4NLOA 1NNDA 1RAJA 3KLEB 2YKNB 2VG5B 4WFXA 3FFIB 3BGRB 1FKOA 3T5LA 4NLTA 3Q8PB 4I2QA 1HYSA 4FS2A 1DTTA 2ZD1A 4QWDA 3KOAA 2R2RA 3JYTB 2RKIB 1HARA 1KHWA 5KG5A 2HMIA 4DL4A 5KFEA 3H5UA 2V9WA 4KO0A 3DLKB 4K4VA 4TQSA 1SUQB 1TKTA 2BANA 2JLEA 2D3ZA 5FDLB 3BSCA 5L1KA 2FJWA 1TVRA 5KT3A 2RDJA 1EETB 4R5PB 2IAJA 3NBPB 4G1QA 3DRPA 2GIRA 3V81B 4H54A 2FLLA 1S6PA 1J5OB 5F9LA 3KK1A 1IKVB 4IRDA 1HNVA 2HNDA 3IG1A 4RW6A 3KHLA 3QYYA 4RW7A 4Y34A 4IH6A 1C0UB 3T5HA 4ZPDA 5KFMA 4DL3A 3OL7A 5KFHA 2CKWA 4K4SA 2HWHA 4O44A 3IGNA 1C2PA 4R8UA 4ZHRB 4IDKA 4URQU 4JV2A 1FKPB 3MEDA 5CYQB 3MEEA 3HKWA 3TVKA 3RAQA 3QIPB 1KLMB 2B43A 2WCXA 1RT3B 2ASLA 3IN5A 3H5XA 2W8LA 4URSA 2C22A 5KG6A 3I5BA 5KFRA 2FJVA 1S1UB 3N6LA 1HQEA 3CDUA 1D0EA 4ZP9A 3OL6A 4NLPA 2ALZA 3QO9A 4KV8B 3MECB 2YNHB 5KFAA 4KHMA 4X2BA 1EP4A 5KT5A 4ECXA 4DL2A 4Q43A 2DPIA 2ILZA 2YKMB 4KHRA 4J9RA 3CJ5A 5K14A 5J2QA 1R0AB 1XR5A 4JV0A 3GIJA 3MF5A 1SV5A 3EZUA 4KAIA 4EYIB 4ECRA 5F8IA 4ECTA 3KLFA 3DM2B 4H4OA 2W8KA 3BJYA 4GC7A 4J9LA 5KFTA 2C28A 4H4MA 3KLEA 2HAIA 4WYWA 1C1CA 4ECUA 2VG5A 3LP1B 2WB4A 3FFIA 3DRRB 3PW4A 3PR4A 4DG1A 3BGRA 3DLGB 3E01B 4ED2A 4J9SA 2XCAA 2JEIA 3HHKA 4IOBA 4I2QB 3MFHA 3D28A 5KG1A 1S1TB 2HWIA 1DTTB 4F4YA 2ZD1B 2XGPA 3JYTA 1TL3B 2RKIA 3KHHA 5C24B 2HMIB 5C25B 2FJXA 3RB3A 5T14A 1RTIB 4IH5A 4Y2AA 3QGGA 2BE2A 1RT6B 3NL0A 3Q8RB 1EETA 2VG7A 3LANA 4R5PA 3KLGA 4PQUB 3NBPA 5F9NA 1VRTB 3OLAA 3OSPA 3DRPB 3T19A 4Y3CA 3PW2A 1IKVA 1RTJB 4MKAA 3GILA 2HNDB 4TN2A 2ASJA 3BREA 3BQ2A 1TKXB 1LWFB 4RW7B 4MK7A 2FVCA 4TYAA 2IMWP 4Q8FA 1ZETA 2JEFA 1LW2B 4WXOA 1S6QB 4O44B 3MFIA 4ZHRA 1S0OA 5KFLA 5DQHA 1FKPA 5CYQA 4ZP6A 4KKOA 1KHVA 3MEDB 3H4BA 3QIPA 4WXWA 1HMVA 4RW4A 2WTFA 1IM4A 2JC1A 1TP7A 3SFUA 2R8JA 1S1UA 4WFYA 2CJQA 3EPGA 1TL1B 4IQXA 4FS1A 5D3GB 3M9MB 4KV8A 5J2NB 1OS5A 3MECA 3QO9B 2YNHA 2JEGA 5CYMB 2QV6A 2FLPA 4ECZA 4IH7A 2R8HA 4F4WA 4R0EA 3MTKA 2R2UA 3KJVA 1MU2B 3DOKB 3FSIA 4FBTA 5F8JA 1R0AA 1C1BB 5J2QB 5KFSA 4LQ3A 2IC3B 2AQ4A 3FDSA 2C2EA 5KFQA 1GX6A 4Y2CA 3QGHA 3I0RA 3I0SA 3D5MA 4M95A 3QIDA 3DM2A 3Q8SB 2W9BB 1BQNA 1DTQA 4I7FA 4H4MB 1C1CB 3LP1A 3DRRA 1NHVA 4ZP7A 2F8EX 3MR6A 2D7SA 1RT1A 3DLGA 3E01A 4DG1B 1TV6A 5HLFB 4ED3A 1S1TA 4OL8A 2BR0A 3NKYA 4RUCA 3LAKA 1TL3A 1U09A 3VQSA 1IKWB 3KLVA 4ECWA 1IKYA 1FK9B 3M8PA 5C24A 1N5YB 4KBIA 4NLUA 4O3NA 4URGA 5EWGA 5C25A 2W9AA 5DLFA 2BQRA 1RTIA 2GIQA 5KFJA 3FRZA 1RT6A 4O3PA 3SI8A 2BE2B 3RBDA 1S97A 2C2RA 3LP0B 4PQUA 2VG7B 1VRTA 3KLGB 4F4ZA 1N6QA 2WK4A 2AX1A 1RT7B 1RA7A 3CJ0A 5KFGA 4RNFA 4ICLB 5KFPA 3QZ8A 3PW7A 1N48A 1RTJA 2XI3A 2IA6A 5KFCA 2I5JA 4K4XA 2FVPA 4NZ0A 1TKXA 3UR0A 1LWFA 2DPJA 2ATLA 4ECVA 3H40A 4EO8A 1LW2A 1JX4A 1S6QA 1QUVA 5KFXA 4NLXA 4WFZA 1S9EB 2VA3A 4KKOB 4RNOA 4EYHB 4QWBA 2FVSA 1HMVB 3OLBA 4NYZA 4YQWA 4RW4B 3GIIA 5I3UB 1K1SA 3CO9A 5JXSA 3GQCA 3RBEA 3RB4A 4IR1A 3M9OB 4WZQA 3OL8A 1N4LA 1TL1A 2UUWA 2AX0A 4NLYA 4RNNA 1I6JA 5D3GA 5J2NA 4EBDA 5KFDA 1IKXB 5CYMA 5F8NA 3ISND 1TQLA 1TKZB 5F8LA 5KT2A 5DQGA 4IG3B 2V4QA 4MIAA 2W9CA 4O3QA 2B5JB 4NLQA 3MR3A 1S1XB 1MU2A 3DOKA 5HP1A 3PR5B 3KJVB 1C1BA 5EDWA 2IC3A 4O3OA 2C2DA 1RTDA 1VRUA 2XI2A 3PW5A 5L9XA 4IRKA 4QW9A 3I0RB 3I0SB 3G6XA 3DRSB 1LWCA 1JLGB 2W9BA 4J9NA 3IS9B 4QWEA 4Q0BB 4LQ9A 1BQNB 1DTQB 4I7FB 4ID5B 4XPCA 2XWYA 4IKAA 5KT4A 3KNAA 3CDEA 1RTHB 1ZTTA 2AWZA 3IRXB 3KLIB 2WRMA 1RT1B 4NRTA 4DL6A 2BRLA 5L1JA 1RT5B 1T03B 5HLFA 2E9RX 1TV6B 2OPQA 1S49A 1HNIA 5KFUA 2ZE2A 3DLEA 3KHRA 5KG4A 4QPXA 1IKWA 4DL7A 4ZVHA 1FK9A 4MIBA 1N5YA 4PUOB 1IKYB 3M8PB 4QW8A 3M8QB 4G3IA 2R8IA 1REVA 3ISNC 5DG7A 3H98A 3BSAA 3LP0A 4YMEA 3T1AA 1XR7A 1RT7A 2UVWA 1N6QB 4ICLA 4WE1B 2R8GA 5F8HA 2I5JB 1LWEA 1T94A 2ZKUA 3DDKA 2WOMA 4NCGA 3MR2A 3RB6A 4ECYA 4ED8A 1C0TA 4EBCA 4K4UA 1N56A 3BQ0A 1S9EA 1SH2A 4QWCA 5KG2A 4ED7A 3QLHA 4PWDA 5EWFA 3V6DB 1S10A 4O3RA 5I3UA 2HNZB 2OH2A 4KSEB 1QAIA 4TY9A 3H5YA 1T3NA 1QE1B 4ZPCA 1RDRA 1NHUA 3T5KA 2BQUA 4WZMA 3C6TA 4O3SA 3G6VA 2V4RA 1IKXA 3E51A
chains in the Genus database with same CATH superfamily
4UZBA 2WSFC 2IM2A 5K9FA 3NS6A 2RQ4A 2PE8A 4MFBB 3KTQA 5I42B 3GV5B 3IRXA 2IVMA 4KYZA 4U67Q 4F8RA 1NKBA 4LFBJ 1HNIB 2IPOB 2F8HA 3EDQB 2QC3A 1VS3A 1RADB 3CEDA 2CQGA 3NOGA 1QLNA 5L1IA 4KPYA 2AEFA 2MMYA 1PC4A 3QT5A 3PKMA 4HKQA 2U2FA 2XS7A 4P52A 3H59A 3NAHA 4PWDB 4HHJA 4OFZA 3PZPA 1WTBA 2R8KA 5KG0A 4U6PA 2E9ZA 1WI8A 4Q5VA 3RR8A 5MAOA 2IYIA 4K8RA 5IV4A 4LF6J 1Q0NA 1TL5A 1Q86T 3RG6A 2VB6A 4O4GB 4J9PA 4F02A 3R5DA 1C4CA 1F60B 4P75A 1VRQC 2J9DE 4ZIWA 1N0VC 2AF6A 4OYMA 3GFYA 3PIOQ 4DEZA 1S1WB 3THTA 1C4AA 3HJVA 1RE1B 2IDEA 3M32B 5GMDA 4LREA 2EWHA 4HHHA 3QRRA 4DR2J 4C3MA 2FJBB 3TAMA 2GW8A 3JTOA 4IOCQ 2BANB 2ZOMA 5A8RB 1ZS6A 1BXNA 2Q43A 2V63A 2ROPA 3D9BA 3FBFA 2HK3A 4YR0A 3BR8A 1JLQB 1LFWA 2VPZB 1MMDA 3CVKA 3DU5A 4TQRA 3QQCD 1LEOA 6FDRA 2ILYA 2L3MA 2DGXA 4PXDA 2ZH3A 2AKWB 1JLEA 1WI6A 5H9FJ 2HGMA 2YKMA 2MZQA 3BPDA 4CIOA 3SXLA 2AZ3A 1WELA 3Q0AA 4B17A 3FBCA 1U48A 4J9OA 1Q81T 4EWTA 4P10A 2RILA 4XIUA 2VFUA 1U25A 1FX4A 2HMIA 2D1CA 3N9UC 1L3VA 5L8RC 2JLEA 2Z8QA 3BSCA 1RKIA 2RIJA 4J7CA 3SBMA 2F65A 4G1QA 2V8DA 4CI0B 2FLLA 3UD3P 1LXJA 4B3MJ 4Y34A 1WC1A 4XDDA 4F0HA 3QT8A 5KG6A 1HNWF 1N32F 2CG4A 2HFZA 3BBFA 4OZ2A 4RU2A 4DX8H 1NSPA 1LWXA 1KR4A 4PYDA 4AFFA 3C14B 1OIAA 4JV0A 3OFFA 3HKZD 4ECTA 3M6VA 4YHHF 1APSA 4NEZA 3DKDA 2RT3A 3PTWA 1VJWA 2RNEA 1AB8A 4C11A 3QGGA 1NSQA 4R5PA 3KLGA 3C66A 1O5JA 4LBIA 2OELA 3BREA 4CDIA 3UO0A 3J81U 2ZM6J 5DQHA 4FVMA 1SQEA 1HMVA 4DUZJ 2PD1A 1XMQF 3MMAB 1DFDA 3JTPA 2O67A 2GHPA 5FLXY 5JVGQ 1RB0A 4LQ3A 5AE1A 2EBEA 3QGHA 1RWPB 2OKQA 2Z2LA 2R7TA 4ED3A 1S1TA 3ZZ0A 2BR0A 3CCMS 3IFEA 4DV1F 1S97A 2V34A 4F4ZA 2EVZA 3CJ0A 1RT7B 3MXHP 1AROP 2QMWA 2KTQA 4PZVA 3GJQB 4ENOA 1XNRJ 1BLUA 2HQ3A 2B56A 1P8GA 4LF8F 5DZ6A 2DNGA 1Z1ZA 3DLLQ 2R7XA 5LSRA 2DIVA 4YOEA 4NLQA 3HULA 4MYTA 2CQCA 5L9XA 3GYXB 4QQBA 3G6XA 2K1RB 1V6HA 2ZEJA 3I6PA 3HHNB 2E7XA 4JI1F 5CABA 3M8QB 3NGUA 2ACYA 3H98A 3UCUP 3BGLA 3UD5A 2PI5A 2XHWA 3GIRA 4NXNJ 3GSDA 1ZZNA 3MM9A 5F8HA 3QWUA 3MUVP 2DGWA 3MM5B 1RHQB 1IBLJ 4I1TA 3JS9A 4DR1F 1C0TA 1FXRA 1UAWA 1FJEB 1UJ5A 2M3DA 1P6TA 3HX9A 4DR7J 1H2UX 3UWTA 3HSJA 3GJRB 5ADZA 2ACMA 1SH3A 4P74A 5EHHA 4C8MA 2AU0A 3U1LA 3V6KA 2UVVA 2ZBIA 2ZH4A 3QGIA 1GX5A 4OI2A 4W4MA 4DX5A 2MQMA 4RNHA 3AA9A 2UVRA 2IDLA 4F4KA 5I3PA 3DLBA 4J90A 1AFIA 3NRBA 2MKCA 4YB1P 1Z2ZA 3Q23A 2LCWA 3QATA 4RUHA 2J6TA 2KG0A 4J9VA 2IMOA 2CQPA 1IXKA 1ZM9A 1DLOB 1M5SA 3NS7B 2UP1A 4K4YA 3VR1A 4V19J 1QDUB 3BN4A 2H48B 3K5PA 1HD0A 4DV5F 3NEKA 1Z2LA 3K5NA 1SB6A 1VGYA 4U96A 3TZYA 2RHSB 1VOMA 1Q82T 3HVRA 1EARA 2ADCA 4KQZA 3MUMP 3HO1A 4JV5F 4DLGA 1NKCA 3EZ5A 1U2RA 1KQGB 4NLGA 4ZK7M 4FYXB 1NK0A 2DJWA 2G2ZA 5E7OB 4WU2A 2GIFA 4JV1A 2A2DA 4NLDA 2ZWPA 3TUJC 1TVRB 3VAFA 5HMWA 4DQIA 3A1YG 2GJIA 3GG0A 4X65J 3OVAA 2QZ8A 2YKAA 4HL9A 3KDOA 1Y9OA 4OYIA 2VKRA 1XQIA 3W2VB 4PPZA 3PX0A 3ONQA 2XCPA 3OJSA 2Y3YA 2H54B 2GA7A 3FFIB 3X3UA 5HQMA 3JYTB 3FCWA 5AXMA 3W60A 4TQSA 3CGIA 5KT3A 4OX8A 2MDAA 3TJ8A 3IAM9 3IC1A 4KH1B 5KFMA 3HXMA 1SJFA 4DV0F 3BKUA 3AXMA 3EXCX 1D0EA 3J80Y 1IBKJ 2CZVC 1YBUA 4ELTA 1WEZA 1X4HA 3T3FA 2B51A 3WC0A 3LP1B 4M8LA 5ETMA 3DRRB 2YH1A 3HHKA 4IOBA 2EG1A 4M5HA 5E3QA 4PXCA 2GFFA 1NO8A 5DJBA 5C25B 3OR1A 1DBDA 3FEXB 3WZ0A 4GVBA 4Y2AA 4PKDB 3C2PA 4BWJA 2R7QA 3ZTRA 1NU4A 3DNCA 4WXWA 5D15A 3CCTA 2XEXA 1HBMB 2RQCA 2DB1A 2QLXA 2KFYA 2EFPA 1OSCA 2PMZD 3SEOA 4L6V3 4Y65A 2G13A 3QIDA 4KHPJ 3PO4A 2Z58B 4H4MB 1WORA 1ICEB 1RT1A 1CBKA 3PRVA 2CPYA 4B02A 4RUCA 1HBNB 1IKYA 2E1RA 1VQLS 4HI1A 1OMSA 1FVQA 4PQUA 5KFPA 2FVPA 2VPXB 3KJQB 1R8HA 2HHWA 3PEHA 1X0FA 3L9ZA 4KKOB 2H5JB 1GMVA 4QWBA 2R3VA 4DR6J 3PYGA 2XBPA 1N4LA 1FD8A 4HH1A 3ISND 4DZDA 5F8LA 4C3KA 2WZ1A 2MEWA 1RAHB 1BWEA 3TANA 3MOJB 3WDOA 4ID5B 3O3LA 1RTHB 4JB8B 2BRLA 1S49A 3KYLA 4ZS6A 4F25A 2OSQA 3M8PB 4RX6A 4LVNP 3T1AA 1S12A 1L3TA 2Y1RI 3L09A 6AT1B 4GKKJ 2ZH1A 4NZ6A 3CO0P 3H5YA 1QE1B 1WHWA 1Y4ZB 4EYIB 3E51A 1NHKL 1R8PA 3UPFA 4ZVGA 1FRKA 3ICLA 1G6BA 1ZPVA 4ZMMA 1RTDB 3D3CJ 2E1CA 2KHDA 3TNVA 5IWAF 5KFOA 1ZAWA 5AT1B 1EQMA 1UA1A 1T05B 1UVMA 4IG0B 3JSRA 3GWCA 3W5ZA 1REVB 2M0GB 5KFWA 4MYUA 2FHKA 3UE2A 4M5JA 5A2QU 2HG4A 1RT2A 4B9NA 2HS3A 3CWJA 3D66A 4HH0A 1JLBB 3DGPB 3HHLD 2HLTA 3OTEA 1FKAF 2PMHA 4FKXA 4LRDA 4C8LA 4NI2A 1K1QA 1R27B 3TX8A 2EC2A 4OZ0A 2BOAA 3QWPA 2ZJRQ 3D4JA 2XYHB 4I56A 1Q5VA 4XK8C 3EJMA 1BY9A 4LUBA 4BCAA 1NSKL 2AYBA 1MLAA 3PKYA 3VV2B 2R9LA 2QLWA 2I8EA 5DDQC 1M5PC 3CCJS 4J9MA 3AQOA 4FYDA 2ZBPA 3MWBA 2EW9A 3HHDA 6FD1A 3F44A 4B3OA 1TKTB 2YX4A 3LUYA 1X4GA 3B78A 4ANEA 2ZJQQ 1J5OA 4ZPAA 5H9EK 4MT1A 3IG1B 3HM9A 2V67A 4HTIA 2UUBF 3ZZOA 1RBAA 1OWXA 3UVJA 2V69A 2DGUA 4JI8F 4A8YA 2ZDOA 4KGZB 3T5JA 4A8QA 2OD4A 2CQ0A 1SC3B 3RB0A 5E2QA 2FGOA 4AUKA 3TA0A 2YWEA 1RT4A 2WONA 1DHMA 2X7IA 1X4BA 2IA0A 4KH0B 2BUNA 2LA4A 4Z7YA 4OYZA 5IC4B 4Y0FA 4OZJA 4HHUA 3AD8C 3CDAA 4LFCJ 4K4VA 3CCVS 3DRPA 2ZDPA 3ILOA 3W61A 3ET6B 2FIUA 3OL7A 1VIOA 4B9LA 4R8UA 1N34F 3TVKA 3MEEA 3TAPA 2XMUA 4BS2A 3H5XA 2W8LA 2C3UA 4C48A 3IBCB 2IRYA 2YKMB 3DXSX 4ES2A 5F8IA 4GRSA 4DR4F 3DM2B 4H4OA 2W8KA 2NS1B 1SBRA 3MPVA 2VG5A 3KG1A 2X1GA 3M8WA 5FJ4A 4NPOA 3R7NB 2HMIB 3HSZA 4NA3A 2OLWA 3LTOA 1RT6B 4J37A 1RTJB 4B08A 5IQ6A 4NZ7A 3QIPA 4MTPA 2IVYA 4HTJA 4WFYA 1RZMA 1FI4A 1TL1B 4IQXA 1MMNA 4Q2MA 3ENAA 1FRLA 1K47A 4Q7AA 4FXVA 2QJ3A 4DX6A 5LJ3Y 1TFWA 2IC3B 1KTVA 4OX7A 1S7HA 3KJFB 4RBTA 2Y8YA 1DTQA 4PWUA 4ZJLA 1VQ5S 2MZRA 1UEKA 3M2UB 2PA8D 3EM1A 2CPHA 4OYPA 5HLFB 4OL8A 1RWOB 1UVJA 1VISA 2W9AA 5DLFA 1B3TA 4C11B 5KOWA 3CF5Q 4CZCA 1NDLA 2RVJA 2VJVA 3KLGB 3RR7A 3VGSA 4RNFA 4ECVA 1LK7A 5DZ7A 3H40A 3M8ZA 4N41A 1HMVB 2UXBJ 3CO9A 3W8PA 2J0XA 3J81Y 2XY5A 3OTBA 4IG3B 4OV6A 2W9CA 4ZN3A 3PR5B 1VBKA 5AJ3J 1AZSA 3E3XA 4WKYA 3KNAA 2OO4A 2FD2A 1YZ6A 5E33A 5KG4A 3M30A 2OGUA 1F3VA 2QFJA 4DPTA 1Q8BA 2CQ2A 2V68A 4CM2A 1UJ6A 1GEHA 1T8EA 2LYVA 2ZH5A 3WX4A 5HVHA 4DDFA 3CMAS 4LR8A 4X4OA 4RBVA 2RS8A 2NXEA 3FZ2A 1IKXA 2UXDF 1AUSL 4B3SF 4ZOSA 2KFZA 3QJJA 4U7CA 4DPYA 3BR9A 1Q78A 2JNJA 2VHGA 5EWEA 3P8BB 2MQNA 2B4VA 2BQ3A 4K4TA 1WHYA 3FMBA 3FMWA 3KHGA 4U8YA 4M5DB 1FD2A 2QL9B 2MKHA 2VBXA 2VH7A 1VC0A 3BBCA 2MQ8A 5B0GA 3MM6B 4IR9A 2G1HA 1RA6A 3SSRA 1Q53A 2ROEA 1C0TB 2ZFHA 5GVQA 5JMNA 1NK5A 2DGTA 1KSPA 2B8PA 2N82B 5HBMB 4X4QA 4QWAA 4DPUA 4Y2KA 5CHCB 1D9FA 2OPRA 1UZHA 3C16B 4UT4A 3VWSA 5KFVA 1FEHA 1RAIB 4B3RJ 2HLUA 5F3ZA 1QVFR 2C42A 3D1HA 1HPZB 3I31A 2ZBCA 2HHHF 1U1OA 2OPPB 3I9V9 4OI6A 3CJ3A 2V8HA 3W63A 2LQ5A 3BB5A 1S6UA 3W7BA 5EN1A 1CC7A 4WF9Q 3R5CA 1BD6A 3POTB 1RWVB 8AT1B 2VL1A 1KVJA 2IJNA 2D9OA 3J7YI 5FDLA 2XZWA 3GV7B 2IAJB 2VA2A 2N4CA 3CD0A 1FESA 1SKRA 2EI5A 3TR5A 1VQ4S 1MMLA 3MHYA 2AYGA 1Y11A 2YX7A 2AW0A 1D1UA 4DX7A 2KJVA 2J9CA 1HNXF 4DR5F 2J7KA 3OXFA 1F2GA 2YWKA 4TU7A 4O0NA 1FNMA 1RUSA 2V94A 5LMUJ 2ABYA 5CH7B 3W65A 2IJRA 4ITSA 2XMMA 2WSCC 5GAHI 4USWA 1TL4A 4AQYJ 1GXTA 3P4UB 3K59A 1RBOB 2FHOB 3CE8A 3ENVA 4CTAA 1U2CA 1BUXA 1FWKA 2VBYA 5T7LA 3IGNA 5GMEA 2W1BA 4ZHRB 4IDKA 2BJ8A 4W92B 3HKWA 1FTRA 1NZAA 1AA1B 2GZOA 2EFVA 4OYBA 3GFZA 3MMJA 3DCAA 4NLPA 5D4OA 2HVIA 1R6VA 2RHQB 4B9MA 4DCJB 4ZITA 4L3NA 2N7YA 1CS4A 4QYRA 4WYWA 1C1CA 4DL0C 1WACA 3PW4A 3BGRA 1VR6A 2WAQD 4OI4A 3MFHA 2J8AA 1N33J 1MG7A 3S6EA 2HRYA 5C24B 3GU0A 1ZBTA 3MAAA 3RAMA 3A13A 1UEVA 1FFSB 3OSPA 3X1LB 2U1AA 3A3NB 3ILLA 4NXMF 5KFLA 2EPIA 4LF7F 2E1PA 3QFWA 2R8JA 4QOTA 4WBFA 2XZDB 1RSCA 3AD9C 4KV8A 5J2NB 5IFMA 4F4WA 2GCFA 2E7WA 3FSIA 2AP6A 3G82B 4ZLLA 2MZJA 1WC0A 1NPKA 1R89A 4O23A 4PXEA 4WFAQ 2FHJA 2QLFB 1WHXA 3D0HE 1JJHA 3CB4A 4URGA 2HQGA 2C3OA 2BQRA 3UN5A 2KVIA 3CCZA 7FD1A 1VC6A 1FA0A 5LM7E 2AX1A 1CQNA 2B9XA 1RWUA 1SXLA 1OYEA 2XSFA 2VQEF 2Y1JA 1X4FA 3W66A 1F5AA 2VA3A 2DRAA 2AV5A 3I82A 4LJMA 2FVSA 3BDEA 1GXLA 4KT0C 2GVZA 4X4NA 4CO5A 3CJKA 1URNA 2X3GA 1UJ4A 1YDLA 4KRWA 3I96A 1FJCA 2WVBA 1RT1B 4NRTA 1T03B 1W7WA 3CD5A 4YDXA 5KFUA 2I6WA 1HIYA 1IKYB 2AHOB 3DFEA 3QJLA 2WB1D 2KXNB 4WE1B 3W64A 3T9NA 2XNRA 3LGHA 2DR5A 2EEYA 2L48A 1T9WA 3I9ZA 2ZOFA 1HW8A 1QTNB 3I87A 4IO9Q 5HJXA 4DI6A 1NHUA 3C6TA 4DCPB 2LDIA 5D4PA 1H7WA 1VYAA 3NCRA 4I2PB 4RU9A 3FQLA 1YJ9S 4OLPA 2IM3A 1WJ9A 3I5CA 3CULA 1RHRB 1UWBB 2F63A 2VPYB 4G65A 3HVTB 4J9KA 1YGYA 2DY1A 3C8YA 3S1TA 1GK8A 4UOGA 3SZ2A 5CYJA 1Y10A 5B09A 3G86A 3C6UB 4C97A 4K59A 5DDOC 2IM1A 1VIXA 3Q89A 1GMUA 3LWMA 2UXCJ 5JUMA 3PHEA 3CSKA 3IWNC 1B7YB 1IJFB 5EUHA 4ZVRB 3GCXP 1NPRA 2OTJS 2GGPA 3PFOA 1CJTA 4KC5A 2CNOB 1PJ5A 1P1TA 1XR6A 1Y5NB 3K5LA 2H65B 2HK2A 2ZBRA 2JZ5A 1S1VB 4QIVA 2QE5A 4P72A 1FNXH 4DSLA 3KLHA 3GIKA 4LFBF 3OHBA 1OQ6A 1TUWA 1HYSB 4K2JA 5IM0B 2M7SA 5MLCV 1RT2B 1GMWA 4MKYA 1FRHA 1S6PB 2CPDA 2H5IB 4EBEA 2XLIA 2KZZA 2CVEA 4RW6B 1VCTA 1RYRA 2I2YA 2B9YA 2FPHX 1ZTWA 2A1BA 3JAMY 2CQ1A 2MJNA 3VGUA 3OUYB 1E6YA 3HSDA 2ALYB 1JXLA 3BV8A 5J2MA 5KFFA 1JQGA 5ETLA 2ATCB 3T5LA 3Q8PB 2DIUA 2IBOA 1VQKS 5KFEA 2V8PA 4DR2F 3ILJA 1I51B 2XMVA 2GIRA 2RUSA 1J5OB 1SC4B 2ZJPQ 2AJ0A 2NXUA 3DOMA 3M2VB 4ETZA 1HNVA 5DDPC 2MQLA 4ZVSB 4DN9A 4K4SA 3SYZA 3MEDA 3VVUA 3UVJB 4UW2A 1QSLA 2YQ0A 3A3PB 3I5BA 3K0JA 2Q6BA 1CC8A 2LMIA 4PABA 2KI2A 4I67A 5KFAA 4YB7A 1EP4A 1RAOA 2Y0BB 3MGJA 1NUEA 4UQGA 4UQTA 2BJ7A 3KLFA 5CZXA 2F4VJ 3PRBA 2HAIA 2DNNA 2OI2A 1RU1A 1TL3B 2RKIA 4EZ9A 5B08A 4OJGA 3ZTSA 4NL5A 3RB3A 3BF4A 4IH5A 4KIAA 2VC1A 3GLJA 2LEAA 1N5TA 3DRPB 1DAXA 1VQNS 1IKVA 1H0HB 4HEA9 5HJYA 3GILA 3BQ2A 2JL9A 7FDRA 2XLKA 3ZZPA 1S6QB 5CYQA 4ZP6A 1Q1KA 2HSEB 4ETXA 4B3MF 4CLPA 4FS1A 2QV6A 1TAQA 1OYDA 1FTCA 1KBRA 5AE2A 1SQFA 2DH8A 2W4PA 4NMLA 1NHVA 1N8RT 2ZHOA 5CQGA 2ZH2A 3DXBA 1HWJA 1ELOA 4PCQA 1V3ZA 1U6FA 4LIWA 1FFGB 1UL3A 1RA7A 4F7VA 4ZVUB 2I5JA 2ATLA 1NJXA 1NDPA 5HN0A 3O5TB 5K8NA 2KT3A 4LF9J 2EBGA 5HVFA 1I94J 1K1SA 2B8QA 3IMQJ 4WZQA 4DF8A 4NLYA 2RB7A 1X8DA 5BR8J 3CUNA 2ZM6F 1TKZB 4P6QA 4BWMA 2V4QA 2D9PA 3B54A 4DUZF 4I6YA 4LF4J 4RKUC 3DLJA 3VHQA 2HS0A 1DTQB 3KLIB 5L1JA 1PBAA 1S77D 2KN4A 2DT9A 1D8ZA 1IKWA 2C3YA 5I3QA 4ZCKA 3CJSA 2OJ3A 2RRBA 2K7JA 2MLYA 2WOMA 3BEGB 1AUDA 4TNOA 2D69A 4C8KA 2KU7A 5I3UA 2PFDA 3TARA 4V19X 2NYHA 1QJHA 1YLXA 2WVCA 3MPYA 1DQ9A 1XNRF 3CJ4A 3OTCA 2I0XA 3NS5A 2W9CB 4DCOB 2RE1A 4X64J 3JSMB 1GAOA 3TO8A 3K8WA 1T02A 2QA4S 1J5EJ 2JFKA 3MCNA 3DI6B 2UUAJ 1WC6A 4V1Ak 3W9IA 3M30B 1SJ3P 1AXQA 5THWA 3LO3A 1TK5A 1YVFA 3AA8A 3BQ1A 4H4KA 1S99A 4F4XA 3DMJA 1CJKA 4ED6A 2MKKA 5HMYA 1RHUB 4NXNF 4AL6A 5CD4A 1F6TA 1SH0A 4CNZA 1F0XA 2G2OA 1IBLF 1K0TA 1QY7A 1S48A 2P9EA 4YS2A 3BH6B 2MQPA 1KVKA 4RW8B 1JKHA 2ZUGA 3DYAA 2W4DA 5FLXU 4DR7F 3A3OB 4DPOA 3UDVA 4BC9A 4M5GA 1ZM4A 4IFVA 2BX6A 3CIZA 2I38A 5RUBA 2O5DA 1WD6A 1VC5A 2RF2B 1YJWS 2JEJA 2QN6B 4NX9A 2WSEC 1FKOB 4MK9A 2W01A 3KKFA 2UUTA 1HWUA 1FCAA 2CPFA 4AL5A 4TY8A 4K4ZA 4CWBA 2FDNA 4RUBA 2VFSA 3BH7B 2OPRB 4A8MP 2Y1IA 5EX3A 2D41A 5KG7A 2PI4A 3JXOA 3RU0A 2MGZA 5AXKA 1KLMA 2DGVA 2G9OA 1XMOJ 1AFJA 3GV8B 1YIJS 2XM3A 4PG8A 4JI5J 4QPTA 1X7VA 4HT5A 4KGKA 4I64A 2VFTA 3NCQA 3MM7A 2P2CB 4NLOA 5IXUA 1PILA 2MPUA 5A8KA 2BMBA 1B99A 2FJAB 3ZXWA 4CO4A 3SDEB 2HQIA 2R2RA 2GVDB 3W2WB 5IT9U 4KO0A 5FDLB 1WOSA 1YG0A 1EETB 3GMGA 2BZ2A 3NBPB 1M1HA 4C6AA 3VAIA 1MWYA 3RRKA 1K0VA 4B3SJ 2OFGX 1NH8A 5KFRA 2FJVA 3CJQA 1K8AT 4X65F 3A8JA 4HR2A 3PM9A 2YNHB 4KHMA 2GO9A 4GKJJ 3GIJA 1KQKA 1FRJA 4J91A 4ECRA 3CJRA 3QJPA 2V2QA 3Q22A 3KLEA 2HFVA 3H90A 4J9SA 1NK4A 1HLWA 4R0JA 2ASYA 3HFKA 2J0WA 4WIQA 3KNGA 3QRPA 1F5BA 5T14A 1XWLA 2E1AA 3WC2A 2UV8A 1S5ZA 1WWHA 4Y3CA 1B4SA 4M63A 3I55S 4TYAA 2IMWP 4Q8FA 1LW2B 2PEHA 3M9MB 3RW7A 1SJ4P 4F2SA 2R8HA 3AH6A 1MU2B 2W2OP 1C1BB 4N76A 1CQMA 3SQGA 1FHTA 1W2BR 1IBKF 3F73A 2CZ9A 3BO4A 1HBUA 1W2IA 1C1CB 2XYPB 4DFPA 3GJTB 1K44A 2BV3A 1G2EA 2VV5A 1LXNA 3ZZRA 1RWKB 1N5YB 4LSZB 4LR7A 3LP0B 1IR1A 3CCUS 2PEBA 3PW7A 3NG8A 1OY6A 2GNKA 1WG4A 2KFNA 4K4XA 2WBRA 4OZNA 3TYTA 3UNGC 3GIIA 1EAYC 3RB4A 2Q66A 2L41A 1I6JA 2MB0B 5D3GA 5F8NA 5CYMA 2LQJA 2VPWB 3KG4A 3MR3A 4F0KA 1T9UA 2XI2A 2Z30B 3CPWR 3IS9B 3RTVA 4Q0BB 3FNNA 4ELVA 1MWZA 4P2FA 1KQFB 4E2FB 3HHLC 2YH0A 4KHPF 1RAFB 2P6TA 1JMTA 2FB0A 1IJEB 5J1NA 2XS5A 1TFYA 1LWEA 3N79A 3M8RA 2VFVA 1F9FA 3HJFA 4UOCA 1R8AA 4FKYA 4CLSA 2DO4A 2OH2A 5E3CA 4WP3A 2AJ2A 4O3SA 4DLEA 1KTQA 2PGCA 5ETPA 1XC9A 5KFYA 2B5JA 5HQ8A 1Y5IB 4DR6F 1RXOB 2HQCA 5DG8A 2JC0A 2Y1LB 5ETVA 2BACA 4DR3J 5C42B 4ED0A 4F0MA 1DURA 2MKSA 2W7OA 3RBZA 2FZGB 3H8YA 1RYSA 1OJ4A 2V2KA 2G4BA 3C15B 4OLOA 4OZ1A 1VBYA 1VQMS 4LSNA 1LV5A 2KYXA 4DFKA 4NRUA 2WVFA 3UQSA 4M5NA 3Q8UA 1HBOB 3PX6A 2WHOA 1TL7B 4LF5F 1W25A 1RJJA 4WCEQ 2G0CA 3C6TB 4GKKF 1XTZA 2HNYB 1FF2A 5D0RA 4ZVEA 2FVRA 4WFBQ 1O0PA 3M1VA 2ZH8A 4B3TJ 2AJ1A 1Q79A 4DSFA 1VQ6S 2VU5A 5HVGA 3LQVA 4RWWA 2PT0A 3BYRA 1VHIA 4RWXA 4XPEA 4KGXB 2ZITA 3UD4P 4BDPA 2W2PP 2ASDA 3FGVA 1YJRA 1HW9A 3PYDA 3UDCA 1N0UA 1U1LA 3ITHA 3AXKA 3LP2A 4LSLA 3KMQA 4CP5A 4KPCA 2F9DA 5HROA 2J7WA 2QA2A 5J1EA 2XY6A 2CPZA 3IO1A 3GB0A 3TX0A 3ETOA 4MK8A 4GC6A 4CCHA 1NK8A 2CFXA 3EPIA 4NA1A 2P9GA 1R0CB 2OIHA 3CT9A 2NSCA 4PQAA 2FVQA 4M94A 4AXIA 2WVEA 2DNKA 1TKDA 2PIIA 3KUGA 1HQUA 1LW0A 3O2IA 4ILRA 2B4OA 2GGPB 3A8KA 4RO0A 2DVIA 2CJ9A 1PJ6A 3PACA 1X9MA 2HHTA 2AYEA 2QIFA 4FYYB 3PG9A 4NLTA 3AOCA 1KHWA 1O8BA 2HYIB 4L75A 1XN9A 3HPOA 3I56S 1S79A 5LOQA 2HFOA 4DL3A 3RGIA 3G8TA 5A8WB 5G0RB 4I6WA 3AAWB 4DS4A 1Y3JA 3OTDA 1EQ0A 1S1UB 3N6LA 4ZP9A 1RP5A 2H3EB 2ALZA 3MECB 1E6YB 4J9RA 5K14A 4HVZA 3US5A 1SV5A 1KDNA 2KYZA 2MQOA 4J9LA 2IHR1 2BKPA 3BDPA 4DG1A 2YQ3A 3U1NA 3ELHA 1UFKA 2B0GA 4DXLA 2QL7B 4DV4J 2LXFA 1NAQA 3PY8A 1GFWB 2BE2A 1CLFA 4ILLA 3H25A 4M5LA 2YY3A 2DHAA 2VJUA 4DV2J 3PW2A 4KGMA 2NQPA 3ZTOA 1PYTA 4DSKA 4LFCF 2EFGA 3ULHA 3QSYB 1RLDA 3MEDB 3H4BA 2VUGA 1D09B 1UFLA 2MKIA 3SFUA 2CJQA 1H74A 2JEGA 1CULA 3KJVA 1P1LA 2EKNA 3QPIA 3IA0A 2AT1B 2CWKA 2F8EX 3DLGA 3E01A 2DD8S 2ZH7A 3IBWA 4P7VA 2QX0A 3AB4B 3HP6A 2Z0GA 1HQ2A 1RTIA 4I6AA 1FXDA 4UZCA 1WTFA 2IA6A 2RAQA 4YUDA 1TKXA 3UR0A 1LWFA 4QJVA 4EO8A 2GQCA 2AMCB 5H9EJ 1U7LA 3AJ1A 4P2XA 1HNZJ 5B0EA 2B4PA 4BBYA 3OL8A 2W4CA 1YK9A 3ZO7A 4OHXA 1NSAA 1HFEL 4BC7A 3EGNA 3PNIA 3CC2S 2WRMA 1XERA 3OR2B 2E9RX 1MROA 1XNQJ 2ZE2A 1A9NB 1E6VB 1UZDA 2WVDA 2E66A 4MIBA 4PUOB 2YKPA 4UY85 3A8EA 2V50A 2XB2D 3ZC4A 4YMEA 4LFAJ 1HWIA 4CYUB 1WC3A 3DHWC 3OW2R 3CJTA 2G0IA 5ITHA 2I5JB 3TVYA 2B9WA 4ED8A 5A6WA 4JI4J 5AXNA 3NOCA 2RU9A 3W8GA 3V6DB 3L95X 4K7QA 5D6GA 1FWLA 4ZPCA 1VQPS 2GJFA 4YY3F 3FUYA 1QAJA 2UXBF 2Z4PA 1S9GB 2CAJA 2QLJB 3PIPQ 3DRSA 1JLAA 4DU7A 2Z2MA 1RT5A 5AJ3F 4B9TA 2DY9A 2LVWA 3AD7C 3RYLA 4KE5A 3JQJA 4YP3A 5KFZA 2IM0A 4UOHA 3KJNB 2WOMB 4DWIA 2ADBA 2RS2A 5KG3A 2LXIA 2HNZA 2W25A 4X4VA 4CLFA 4XO0A 1G4CA 4OZ5A 5IZHA 3L4BC 4MFBA 2OUGA 3Q83A 2AJ4A 5E3PA 4CO2A 5I42A 3KK2A 2D3O1 4ZA1A 3UCZP 1WC5A 3CTRA 2YWWA 1NB2A 1Y5LB 2Q3PA 2X1FA 3MDFA 2XHCA 1Q7YT 4MMOA 5D0EA 1FDBA 1NH7A 4QIFA 3DMJB 4FYWB 4ZLPA 1SUQA 1T9VA 3TEHB 3D6TB 2KO1A 4RZRA 3QAUA 4K2XA 3T41A 2KRRA 3KK1B 2CPXA 4NLRA 4CO0A 5DQIA 3CW2C 4C8OA 1WF2A 2DXDA 1JKHB 1IBCB 1PC5A 3FSYA 3N5BA 4KB7A 4O4GA 1PIEA 3M9NB 3MCSA 1VQSA 5C2CA 4P2MA 4B3RF 3LALA 1IM6A 1U1NA 2J6SA 3SFGA 5A0YA 2RRAA 4S0MA 3V6JA 3TQ1A 4RR5A 2BEFA 3M32A 4ZP8A 2DNQA 1TU0B 4NOHA 4DHVA 5FD1A 1KFDA 2BANA 5A8RA 2VONA 4LT6A 4JBCA 4H54A 1G7CB 2MLZA 3RBXA 1U1KA 2HNDA 3OTOJ 3QYYA 1PKUA 3VGVA 4O44A 1FJ7A 5E0OA 4URQU 2MGZB 1KLMB 3IN5A 2CVIA 3AJDA 1VK3A 3R5BA 4KJIA 2J76E 4X2BA 5ETRA 2DGQA 4C0HA 5L9NA 3EVMA 4WU3A 5D77A 2M2BA 2Q1LA 1KC8T 1RWWB 3F56A 4ECUA 5A8KB 3AY0A 3BKFA 3M2RA 3D28A 5KG1A 2XMTA 4F67A 2DHGA 2BVZA 3TOQA 2UUCJ 5LMUF 4DJBA 2GO8A 1IR2A 3PHTA 1SKWA 3NL0A 1KN6A 1VRTB 1AT1B 5IT9Y 4AQYF 1FDDA 3ZFVA 4X62J 4AYBD 4CNYA 3G8QA 1ZOTA 2WTFA 2WW8A 1RTZA 2KT2A 1YI2S 1R43A 1QUPA 4ECZA 4IQMA 5DETA 3DOKB 5F8JA 2HFNA 2A18A 5KFSA 3V5RA 4IYQA 2W9BB 5ETSA 2LXUA 2NCKL 4GO5X 1Y7PA 4USUA 2GX8A 2KH9A 4QR2A 2D7SA 1ZYQA 1UPPA 2CNNB 1FK9B 4O3NA 3P49B 3HF5A 5KFJA 4X66J 5KFGA 3H7HB 4ICLB 1Y3KA 3D7SB 1N33F 2HPUA 3K89A 2VDIA 2F7VA 2OEJA 2VQFJ 3BZQA 1S9EB 5E3RA 2QMUB 3D6HB 2CNKB 5HMZA 1WF1A 5KT2A 5DQGA 3TVZA 1WEYA 2RQMA 4MIAA 8RUCA 1S1XB 1LQ9A 2VIHA 4NMXA 2Z2YB 1JLGB 2KHCA 4HT7A 2AWZA 1F9HA 2YPYA 4FN5A 4HACA 3KHRA 4QPXA 4CH0S 1Q95G 1S4EA 4ZPVR 2HZAA 5HO4A 4OJ1A 3HI9A 2BXJA 4LRFA 1KVIA 1RT7A 4PG5A 5M2UA 3BGUA 2DR8A 3K57A 5HL7Q 4YFUA 3K5MA 2QO3A 1YSJA 4ECYA 5DRKA 3ETMA 3W9HA 3DDIA 4QWCA 4JI0J 3PYFA 2HBRB 1MSWD 2VKZG 3W1YC 1RDRA 3G4SS 4WZMA 1IWGA 4M5KA 1WOOA 2C2MB 2R4FA 3R8YA 4FBUA 2F8MA 1R8CA 2K1RA 3NGTA 3KK3A 3OL9A 3BGOP 2B6AA 1I5OB 5LMNJ 2Y0SD 4F36A 3P96A 4ED4A 3VAMA 4LBPA 3O6QA 3N6MA 3M8QA 3R6LB 3FCHA 5BYQA 1J27A 2WW4A 1U0HB 2D3UA 4AXJA 2M5YA 4OMFG 1LWEB 1M5HA 3S01A 4CQ1A 4YN3B 2EC0A 4I0WA 3EGVA 1N56A 3T1HJ 3MMBB 1NDCA 1OY9A 3ADAC 5ETTA 2CQHA 4UF4A 2XO6A 2X1AA 4CH7A 3V4IB 2NXJA 3EE3A 1DY3A 5B0DA 4FF1A 1M1GA 3BS9A 3SCJE 2YKOA 3DOLA 3R6GB 1X9SA 1DRZA 2ZVSA 2UVUA 3GPAA 4RW9B 5AXLA 1IR0A 3G9CA 3H4DA 4OHZA 2YNGB 3TUIC 2ZBQA 3Q8YA 4DBQA 1S6OA 2IY5B 4DN0A 1YJUA 1I3OB 2CJKA 1T9XA 2DXFA 4LSNB 3SCLE 3IWLA 4C98A 4LRAA 1S0MA 2LEBA 2O66A 4N77A 2FLNA 2FHJD 1FT8A 3IGVA 3UCGA 3MAHA 1DLOA 4A8XA 2DBBA 4OV1A 2I9SA 3MMCA 4O4RA 3K58A 1X5PA 3TUZC 1JNRB 5F3TA 2J0SD 3NMAA 4GMKA 1NK9A 1HQEB 5IV3A 5BJRA 2E5JA 2UXCF 4ILMA 3OPKA 4TYBA 4YB5A 4LBHA 2F9JA 3MM8B 9ATCB 2XNQA 2FQQB 4ZPBA 4ZPWR 1NNDA 4D3HA 1RAJA 3R2CJ 3ZNJ1 3S8SA 4OZLA 4FS2A 1DTTA 1S72S 4JI7J 3AT1B 2FJWA 1TVRA 5CAAA 2QTWA 2FC8A 2YQ1A 4C0OC 3TZXA 3TZWA 4RW7A 4N5SA 2K7KA 1S76D 1KOOA 1FKPB 2QA4G 2B43A 1MW7A 2A6OA 4QZVB 2CJYB 3QO9A 1TR0A 3JQMA 5FIIA 4ECXA 3NNCA 2ILZA 3ZZZA 5J2QA 1R0AB 4DV3J 1CEZA 3EZUA 1YBTA 5D78A 3FFIA 2QGFB 2CUYA 2HWIA 3JYTA 2CA9A 4JI3J 4HLBA 2EFOA 2QSFA 3LA0A 5ETOA 3N28A 2VG7A 4ALZA 4CO3A 1U6ZA 4LF5J 2EKYA 4WXOA 3MFIA 1LNQA 5B7WA 4ZVPB 1XIQA 3JB9k 1FRXA 3EYZA 2PDAA 3JSYA 1GX6A 3FRYA 2GHVC 2A3JA 3LP1A 2IFXA 3DRRA 4DG1B 3MAQA 1YJ7A 4U7UD 1TELA 5C25A 3D0IE 2F4VF 3GR0A 2ZHAA 2BE2B 1HR0J 4QR1A 4ER8A 1OPIA 2R42A 3IM9A 1FEEA 1V5VA 2DXEA 2G1DA 4YQWA 4CLYA 4RNNA 2AX0A 5KFDA 3JAMU 3PXGa 1JXVA 4XDCA 4EGLA 3KJVB 1RHKB 2HQDA 4OHWA 1LWCA 1QTMA 1Q7LB 1YJNS 2MZTA 1XK8A 3CDEA 3HCXA 2QYCA 3IRXB 2XSJA 4DL6A 4AE5A 4P73A 4Y2MA 3DLEA 1HBNA 2OMOA 3WHIA 1U26A 3TAQA 2J9EA 4OYAA 2ZOGA 5F0WA 5M2PA 2DNLA 1A7GE 4X4TA 3LWLA 2YXLA 4NCGA 1NJWA 2LLZA 1PAUB 4OQJA 2JLGA 1ZH5A 4KSEB 3GSIA 1U02A 1YBAA 2V4RA 4LF9F 1I94F 1HWKA 1WNEA 5BR8F 4N8OA 1QAYA 4ID5A 3TQEA 1RTHA 4JI6J 3PJXA 4DS5A 4LF4F 2ZE2B 1FFWB 2FUG9 2HHPA 2R7WA 3UFCX 3F0NA 4Y6IA 4Q44A 4N8NA 3TRGA 3TAMB 3IM8A 3M6XA 5BXIA 1S4FA 1X9WA 1QE1A 3CCWA 1MWQA 2H51B 2BOPA 5CA5A 5GAEI 2IYGA 2CJAA 2YNFA 3MCMA 4Q8EA 2MTLA 4FXWA 2H9ZA 1JLAB 2ZC3A 3UNYA 3H2LA 2LU1A 4M5MA 1FERA 2QA1A 1JLEB 5DLGA 4X64F 1T05A 4IG0A 2CYYA 1Q5YA 1AW0A 3LH2S 1J5EF 3CDBA 1UCNA 2N7CA 1T7PA 1UVLA 2UUAF 1YHQS 4ZLNA 4N7TA 2AD9A 4WP9A 3IWXA 1JLBA 3DGPA 2AEMA 2BDPA 1YTYA 2E5HA 4G1QB 2R7UA 3FK4A 1RWMB 1C0UA 3B8HA 2GV1A 2WBMA 4PRFA 4ANCA 5DM6Q 1BMQB 2Z2ZA 4CLUA 1FO1A 3RZAA 3ZZTA 3LW5C 1H73A 3KK2B 2MKJA 1R0BG 1IBMJ 1ZM2A 3GG1A 2VD3A 2DGOA 4USKA 5L46A 1V9OA 1VJQA 4NYOA 1HARA 4CLZA 3EMTA 4UUXA 1SUQB 1TKTA 4R5PB 1VMBA 1RK8A 2XG8A 1YZ7A 3IG1A 4RL1A 4YY3J 3T5HA 4DSEA 2HWHA 3FZBA 3RAQA 2DK2A 3LPYA 2WCXA 2ASLA 4LRCA 4GVLA 3CDUA 3QBCA 5HANA 2MSTA 1IWAA 2XYGB 3WX8A 2QL5B 4G1PA 5A0YB 1XMOF 3OXGA 3BJYA 2HEKA 2JWNA 4JI5F 2A6MA 2WB4A 3PR4A 2JEIA 1S1TB 1SPBP 4F4YA 1T0TV 3VAHA 3J7YU 4ZPTR 2XMWA 1O6XA 2HNDB 3E8OA 1WC4A 3ET6A 4WP8A 4O44B 1NLKL 2K3IA 3OD2A 2XZTB 1TP7A 4A8WA 3E2EA 2HVDA 4XAKA 3MI7X 1SL1A 2LEPA 4ZVQB 4FBTA 2B4UA 4K0KJ 2C2EA 2DHXA 3I0RA 3D5MA 3EZOA 3DM2A 2M88A 2CDQA 1BQNA 2QFIA 4B9SA 1K9MT 3JTNA 4GKJF 2PMWA 1TV6A 3M2RB 2MYFA 1U09A 2CJXB 5GAHU 5B0BA 1FE4A 2B7CB 2DHSA 1RT6A 2GHWA 3TWZA 3RBDA 1N6QA 2WK4A 3VF0B 3R3TA 1RTJA 4LVOP 3MM9B 3C46A 2FGCA 1Q16B 2IRXA 2HBQB 4RNOA 3OLBA 3VAGA 4DQPA 2DNOA 1TL1A 3R5JB 3L3CA 5HP1A 2IC3A 2C2DA 2VF3A 2R7VA 2JRSA 3GP9A 2VASA 2VDHA 3M2UA 2PO4A 5HLFA 3M7VA 3OXLA 4ZVHA 4ZN1A 4G3IA 4I68A 3IR7B 2BJ9A 3BSAA 3J81j 4X84A 1XR7A 4NEYA 4PR6A 2R7SA 3PO5A 2KVQE 2ZKUA 3MR2A 3G8SA 3J7ZT 3CC7S 3B82A 3RRGA 3IRWP 1S10A 2DEJA 2LU2A 2ZHBA 1VDHA 2QG9B 3G6VA 1YX2A 1REGX 2YNIA 2IBKA 4IG3A 4OI0A 2QYGA 1A6LA 2OPSA 1PO6A 1SVDA 2D3OR 1HHQA 1VBXA 1UWAA 3OFHA 3GFXA 1DQAA 2GAHC 4Z37A 3RAXA 4HACB 5F41A 1VHFA 3AJ2A 5H1SV 3TEGA 5G4DA 2GC8A 4QIGA 5M2RA 4MKBA 3HZGA 2CADA 2JHEA 1OO0B 4TXSA 5KFKA 1KKHA 1WG1A 3THVA 1NXIA 4OHVA 1NJIT 5J2PA 2HVEA 4CLKA 3DGVA 5L1LA 5F8GA 4DV6J 3ZZYA 4NLSA 1VLYA 2V2ZA 1WHVA 3KK3B 2B6AB 2X51A 1WKJA 4BLGA 2HVHA 4EUVA 4DR3F 4M5DA 1T9YA 4KY3A 1KP6A 4A46A 4ANDA 3UDLA 1UEUA 3TP2A 3MM6A 3BBBA 1P9YA 4YR3A 2R2TA 3DN9A 3DC2A 1L3SA 3CCQS 2N3LA 5HBMA 1YKWA 5DG9A 3H42A 5KT6A 3V81A 2BABA 2HBYB 3C16A 1UVNA 3GIMA 3LOUA 4N47A 1HPZA 3DOLB 3B6BA 4X4UA 3CMQA 5KFNA 2OPPA 5DGAA 4YR2A 4Y2IA 1EB0A 2ZH6A 4DFJA 3G6YA 4B3TF 1F2HA 4F2RA 4JI2J 1RAGB 3F41A 4TLRA 1JIHA 4ZKAA 3R5GA 3KDNA 4NASA 4C8ZA 3AODA 3POTA 3MZIA 3LGMA 3MTJA 3KOAA 2L9NA 3N5FA 2KXHA 3H5UA 1RU2A 4FP9A 3OR1B 1R31A 1SL2A 2D3ZA 4GVBB 4U8VA 1Y0HA 5L1KA 4F04B 2LP4A 3K7RA 2IAJA 3H2VE 2HHUA 2CWXA 2DTJA 3ENWA 1S57A 2NLWA 2HFSA 3MMCB 2HKEA 2RRNA 1PG5B 3TA1A 4JYAJ 2H1YA 2VOOA 3B4MA 4U9RA 2LQ8A 4KHRA 5SZTA 4ES3A 3HLUA 3EICA 1FDNA 2Z57B 2XCAA 4WFNQ 2E5LJ 1DTTB 3NNAA 3RW6A 3R9LA 3D0GE 3L7OA 1L5UA 4ERDA 4PQUB 1F3FA 2FHMA 4I69A 2MSSA 3K5OA 1J2VA 2CG8A 4RW7B 4A48A 4ATNA 2NXCA 2VFRA 1ZETA 2JEFA 4ZHRA 2RJZA 4CLTA 2FJEB 3H2UB 4XTTA 1OSDA 2HURA 1KEKA 1SCJB 3QO9B 4R0EA 3MTKA 2HGNA 1UP1A 2YWHA 5J2QB 2BJDA 4AT1B 3I0SA 1ZM3A 2YPZA 2NSBA 2QSWA 4M1KA 1NEEA 4NYPA 3D68A 2NPFA 3QMQA 3J7AN 5C24A 5EWGA 2YWGA 4A47A 2P9CA 2EFNA 2C2RA 1V3RA 2VG7B 2W2QP 3BPSP 3QZ8A 3FKBA 4DV4F 2A0FB 3OJUA 1JX4A 1QUVA 5KFXA 5K8MA 4DV2F 3IBFB 2C2KB 3K17A 5J2NA 4EBDA 1TMJA 4F4AA 1ZAXA 2DGSA 3G82A 1SJ1A 2XWYA 2V9KA 3IAS9 1KONA 2OPQA 3NGKA 4DOZA 1VQOS 1QSSA 1RHJB 4QW8A 2LA6A 2R8IA 3K8VA 1RCOB 5BYRA 2UVWA 3DDKA 3D54A 3D3BJ 5IT0A 4X4RA 1EZZB 4K4UA 1H2TZ 1V3SA 3CMES 1RCXB 1QAIA 1T3NA 3MURP 1Q8KA 4CT9A 4NI2B 4CO1A 1RAEB 5KT7A 2MY7A 3SQOP 4Z7CA 1HNZF 2BKOA 1RACB 2YKQA 2BE9B 4QR0A 1U1PA 5CCMA 1WOPA 1LWCB 3CXCR 2V6AA 3V6HA 4FF4A 4HYKA 2XSJB 1T03A 1H7XA 3DLEB 4F26A 3R97A 4DUYJ 3PJWA 2B9EA 4L76A 3UDEA 1X4DA 4WYLA 4WE1A 3B4DA 1XNQF 1FE0A 4F3QA 2QT7A 4ZIVA 4NCGB 4LFAF 4B3OB 2KB2A 4F50A 4ZJQA 3FBBA 4KFBA 4A8OA 4Q2LA 2OEMA 2VG6A 4JI4F 4I2PA 3N01A 2OMLA 1JLCA 3OHAA 2APOA 4NLWA 1UWBA 2OEKA 3MR5A 1SI9A 4FPRA 2V4JA 3T1YJ 3FQKA 2RU3A 3HVTA 4ECSA 2MZ1A 1RT4B 2WONB 1SJRA 1NK6A 2VODA 2AGQA 2DCUB 3T6JA 1GNKA 1YRUA 4P71A 1PCAA 2XWXA 3C6UA 1UETA 1FJGJ 2LFVA 2MHEA 5C5JA 3RUBL 4DV7J 4RLEA 1RLCL 2J5AA 2DNHA 4UTGA 3P3DA 4USJC 2OD6A 3TJAA 4DL5A 2JJ4D 2RD5C 2QRRA 2YNFB 2E5IA 4R8UB 3MEEB 4MAKA 3AOBA 2NPIA 2UU9J 1IQTA 4NE9C 1CSJA 2W7PA 1HWLA 1BE4A 1S0NA 5E5NA 1X5OA 4WPAA 1S1VA 3U7JA 3KWMA 1Q4RA 4H4OB 1I1GA 4QYZK 3OQ2A 2VG5B 3SMZA 4AL7A 1HYSA 4P7TA 2ZD1A 1G1XA 5IM0A 1JJCB 1TMMA 2V5HG 3M8SA 1FRMA 4KTQA 3KFWX 1GTEA 1S6PA 4QIWD 4RW6A 3MR7A 1C0UB 2CZ4A 2V8GA 2UZAA 5BYSA 2EG2A 1EKSA 3Q24A 3QIPB 1T95A 3SIPB 3U1MA 5SUHA 2HAFA 3OUYA 2CPJA 3CCLS 3KXDA 2R7RA 1TK0A 1XR5A 3Q86A 4HDGA 4PG7A 4C0BA 3MD1A 1BC6A 3CJ8A 3VAKA 4WTYA 2XS2A 2XLJA 1N36J 5HATA 3L7PA 5HSPA 3EX7B 3D1QA 3FBEA 3Q8RB 3OLAA 1UVIA 2B3TB 3M2VA 4MKAA 2FC9A 3HHEA 2BM1A 2JOQA 2VOPA 1UW9A 5T41A 2G0JA 1YWXA 1H72C 3OTOF 3KUHA 3OFEA 5CCLA 1SC1B 4DSJA 1W26A 1KFSA 1ZA1B 1U0SA 1AZSB 2AQ4A 3J7A1 4ID8A 4ZJOA 3M6WA 4Y2CA 2PFFB 4ZP7A 1SIZA 4OI3A 1TL3A 3KLVA 2HHXA 1ZA2B 2BW7A 5JVHQ 4OX6A 4R25A 3CC4S 2DH9A 4M5IA 2NXNA 1N48A 4OX9J 4DMZA 2UUCF 3VGTA 1UMJA 1TK8A 1WKLA 1S6QA 4WFZA 3PYEA 1OY8A 2CQIA 2HHSA 4DFMA 1RKJA 3RBEA 3HFZB 4X62F 2COLA 1IKXB 1TQLA 4EI2A 2RUGA 3SCKE 1VRUA 5KAKA 2VBWA 3I0RB 1U24A 3WIUA 5H9FK 2YWFA 4J9NA 4QWEA 4LQ9A 1BQNB 1URRA 1RABB 1ZTTA 3W5YA 4OHYA 1TV6B 2ZZNA 4RPFA 1VQ9S 4DL7A 5HAOA 2IVFB 1CG2A 3HMJG 2LDYA 4DF4A 1NMEB 3EUNA 1FDAA 1SKSA 1N6QB 2HZVA 7AT1B 1T94A 2RMLA 2ZZTA 2F5GA 4X66F 4PWWA 3QLHA 4FXDA 5EWFA 3HD1A 4ES1A 3T5KA 4UUWA 4NWBA 2FY8A 2VQFF 1OQ3A 4IRKA 1TKZA 3D6FB 4EEYA 3Q2SC 1IVZA 3PCOB 5HP1B 2VZ9A 4IFYA 3I4HX 4IRCA 3GYNA 3KLIA 1WSVA 3ZNUA 1N5QA 5D4NA 3O44A 3R7SB 1N5SA 2AGOA 1S7IA 4OYXA 3OV7A 1JXEA 3PEJA 3NGRA 3MPWA 1TUGB 4QBUA 1N52B 1HA1A 2PC6A 2R7OA 2BW2A 4DPWA 4L74A 2R2SA 2KZMA 2YNIB 2J0QD 5IS2A 1PJ7A 4JI0F 2OPSB 3JSMA 1HKAA 1IN0A 1NRKA 5A6PA 5KOXA 3DI6A 1S59A 5IOLA 1N5VA 1NM2A 2CNLB 3FCVA 4IUFA 3JSBA 5LMNF 4TKTA 2NZCA 1T11A 1YJVA 3PVXA 5DS7A 1KS2A 2Q6CA 3DLKA 2HRTA 4PEOA 2G2YA 4DUTA 5J2PB 1R3NA 4CTAB 1P9QC 2BJEA 1HNWJ 1N32J 3L7UA 2CRLA 2JH3A 3GE9A 3HK2A 5T7LB 4RW8A 4USMA 4IDKB 3FEYB 4PXBA 2HIQA 3T1HF 1RT3A 3IR5B 3GZ7A 2M8DB 4YHHJ 2EFQA 3NCPA 5CXTA 3EDRB 4J5OA 1IQZA 2RF2A 3N6NA 3GJSB 2NUHA 1CS4B 4QU6A 3BGRB 1FKOA 2ZVIA 3BYPA 4QWDA 3NWRA 1NCLA 4HDHA 4PYAA 1NPPA 3MAAB 3P5BP 1X0PA 3H20A 4OJHA 1RQ0A 3V81B 1BQXA 2F3JA 3QT6A 3KHLA 1XMQJ 2HBZB 2CKWA 2HHQA 3W5XA 1C2PA 3CCSS 3RRHA 1WSRA 5A76A 1CJUA 2AYMA 4OI1A 2W2MP 3T6BA 4WJBA 4KV8B 4C2MA 5LXYA 3MUTP 5C2GA 4Q43A 3CJ5A 1Q8IA 4P2SA 5KFTA 3CD7A 4YB6A 2J8SA 2KM8C 4DV1J 1F5CA 2HRUA 4ED2A 3ZZUA 3SDEA 4IO1A 2GVDA 3ZTQA 3W2WA 4KGVB 4QIEA 1ZPWX 2DR6A 4USTA 1EETA 1L3UA 3NBPA 4LF8J 3T19A 2H4YB 4JI7F 2FVCA 2DRBA 1LOUA 3EGZA 2C2ZB 3R1HA 4RW4A 2GVZB 8ATCB 1VBZA 3I32A 4FZVA 4B9VA 3CJKB 2IIHA 4DSIA 1D9AA 3J7Z5 5B0AA 1OS5A 2YNHA 3MOZA 2NYIA 2O1PA 2FLPA 3OBIA 2QLBB 5ETNA 3FDSA 4ZCMA 5DDRC 4JI1J 4IOAQ 2DYAA 4PAAA 3VZHA 4I7FA 1EJ7L 1XJWB 4N56A 3OVBA 4DV3F 2XMAA 3NKYA 2GIQA 4DR1J 1QVGR 4GO7X 1X5SA 3R5AA 2E7VA 2KL8A 5C7PA 5KFCA 3UR3C 3VQTA 4F3MA 4JI3F 1KOHA 3QSIA 1LW2A 2BE7D 5E41A 1UTAA 4EYHB 1SIWB 4NYZA 1B0PA 1O51A 2CPIA 2UUWA 4EK2A 1YQHA 2QMXA 3G96A 1MU2A 4FF2A 1C1BA 1YRXA 1NK7A 3BKTA 1U6BA 4QW9A 3I0SB 3SSQA 2O01C 2KG1A 4IKAA 5KT4A 4K5RA 3CD6S 3VTIA 1BGXT 3SSSA 1N5YA 2ZZMA 5DM7Q 3LP0A 2ZH9A 1NJYA 4L3KA 2MY8A 3P6YC 2C2OB 1U2FA 3G71S 4U7UK 2MLXA 1HR0F 4DV5J 4O3RA 3JQKA 4TY9A 4MKVA 1KD1T 3MEKA 3BSOA 3IP0A 1HD1A 2YTCA 1BQMA 1HL6A 4JV5J 4ZDNA 2KKHA 1B70B 3G6ES 3K2YA 4MH8A 1M5KC 2AZ1A 3IS9A 3A8IA 4RBUA 4Q0BA 1WDDA 1U8SA 5KFBA 4L72B 2AJFE 1Z4UA 5HI7A 2OPQB 1CJTB 3DHXA 4C3LA 5L38A 3QZ7A 4QU7A 1HHSA 5K8PA 5EGYA 2Y9HA 4DQQA 4DQSA 3KLHB 2KM8B 3R2DJ 5LXRA 1GH8A 2DH7A 1MN9A 2M8HA 4LF2A 3TA2A 3CDWA 3DRXA 5HQLA 3VVTA 3ISZA 3MEGA 2CDRB 1HHTP 2VC0A 4RUAA 2PSZA 2ZKTA 5U47A 3EWGA 4ZCIA 2YBVA 2DCLA 3NXZA 3NGDA 1PYOB 2I1RA 5C42A 1CPZA 2AGPA 1JLFA 3QT7A 1UKUA 1EKRA 4FPIA 1H3DA 4JI6F 5J2MB 1R6YA 5EX0A 4EFAC 1RBLA 2YKNA 3C15A 1UFWA 1RISA 2XMJA 1TTHB 5AE3A 2M4MA 1VLOA 2A10A 2Z56B 1HBOA 2XMKA 2F40A 4NLVA 2V2VA 4DV0J 4KFBB 1TL7A 4FNIA 4Q45A 4FYVB 3DOMB 1WDTA 2VG6B 1HNVB 3HT0A 2HNYA 1JLCB 1LK5A 4G6VB 2X1BA 4E8UA 2GJ2A 2V4JB 2JFDA 4MJKA 5LJ5Y 1EP4B 3KUEA 3VAJA 3HVWA 5DO2A 4ECQA 2XULA 3KLFB 3I4PA 2DKOB 4QCLA 2P8IA 4WFXA 4I2QA 1V5IB 4H4KC 4TU8A 2LQ9A 5KG5A 2RKIB 4I4BA 2V9WA 3EVOA 2OFHX 1SL0A 1MNEA 1JWWA 2HFUA 3Q2TC 1QM9A 4J9UE 1IKVB 2H5EA 4YEAA 4ZPDA 1X31C 1SJQA 2ZNYA 3LPEA 4A8FA 2DR7A 3BGFA 4JV2A 2BYCA 5CYQB 2OTLS 5JJBA 1WG5A 1OPZA 3NMRA 3NWGA 2DO0A 4UY8T 1UVKA 3ENQA 3NP5A 1KRPA 4K5SA 4DL2A 1H38A 3HDSA 3MF5A 4U95A 2MHNA 4KAIA 3FVYA 2W24A 1AYEA 3FJ2A 3M05A 2C28A 4E0DA 1IBMF 3GCWP 1U4BA 3BM7A 3DLHA 1KLNA 3M6UA 3HHLA 1GTHA 2ZD1B 2XGPA 4WKRA 1D3WA 3LF0A 1Y00A 1P27B 1B7FA 2NR0A 4A8KA 4MIWA 5F9NA 4CRJA 5A2QY 5ETKA 1CVJA 2ASJA 3TJ9A 3OFGA 2SXLA 2VICA 5A8WA 1KHVA 5G0RA 2HWTA 5KTQA 2JC1A 1KNZA 2DHHA 1JJ4A 1S1UA 3W9JA 3DRYA 2E29A 1FNOA 4LF6F 2HW3A 3MECA 4IH7A 3HT3A 1U1QA 4M95A 3UN3A 3Q8SB 1CJVA 1RGVA 3GR1A 5K8OA 2OHDA 1XBWA 2DNMA 3C3LA 1H98A 1LKZA 3LAKA 4ECWA 1IKWB 4KBIA 2ZC4A 4O3PA 3G87A 2MQQA 4EMDA 3R7BB 2XI3A 2FY1A 3U02A 4BHQA 2DPJA 2AEJA 5I3UB 5JXSA 4OIXA 2E1MC 1GXUA 4LIRA 5IWAJ 2CQBA 4JOUA 5EDWA 2J7UA 4O3OA 3WQPA 2K2PA 2W7AA 4PPDA 3BO2A 1NDKA 4K0KF 1HNIA 1QAXA 1VFJA 2HS4A 4DU8A 2MZSA 4G1IA 1TZ0A 1X4CA 2R8GA 1WF0A 2CQ3A 3V2UC 3UW1A 2PA3A 1CJKB 3V4MA 3BQ0A 5KG2A 4ED7A 4PWDA 2FZCB 1FRIA 2DEIA 2C3PA 1F9EB 3MPDA 1VRUB 3DYAB 4JP8A 1MN7A 2RSQA 1QSYA 5F8MA 3BSNA 3PV8A 3OR2A 4IFVB 1E6VA 4PUOA 3PDNA 1S1WA 1DARA 3VCDA 3GFHA 4FDFA 2LECA 4CYUA 2L08A 2QEXS 1SC6A 5KFIA 1VQ8S 1U47A 2MJUA 1TUVA 1S9FA 5CZVA 3CJ2A 2XTJP 3FSXA 2UUBJ 3V6DA 3QLHB 2ZWOA 2V8VA 1QD1A 4TY8B 2EK6A 3NAIA 3FC9A 4JI8J 3IXQA 3CIMA 2GQ2A 2W2NP 3QGPA 3W3SA 2KDOA 3LAMA 1JLQA 2V0NA 1S9GA 4IFYB 2RDDA 4HI2A 4USVA 2JSXA 1B0TA 4C8YA 1B0VA 2Q79A 2RDIA 3MM7B 4KR0B 3SV4A 2GQQA 4WWSA 4LRBA 4X4SA 4AD6A 1X60A 4B9UA 4K4WA 2F1FA 5DGBA 5CD4H 4KO0B 1X4AA 1FVSA 2JLFA 3MD3A 1N34J 3ILIA 1M0SA 1PYSB 2H4WB 4FVCA 5GADU 2CQDA 2XC9A 2FLOA 1XEZA 3W62A 4OYOA 2YX1A 3QFHA 3KMSA 3D1OA 4DR4J 1HI0P 3C14A 3TI0A 4DV6F 4K50A 1JK9B 2EK1A 2JVOA 3H5SA 3AB2B 3KLEB 2D74B 2Y8WA 1NBEB 1G3OA 3ZTPA 4C9DA 5D8HB 2N3OA 4DL4A 1M5VC 3DLKB 4Z2XA 4C7QA 2RDJA 2F4FA 3N0VA 3Q8VA 4O0IA 5F9LA 3KK1A 1R8BA 3RJMB 1UA0A 1JB0C 2ZNZA 2DRDA 3P5TL 5KFHA 1KWMA 3NY0A 5ETQA 1RI7A 1YJTA 5B0CA 2K06A 1RT3B 4URSA 2C22A 2L9WA 1K73T 3IR6B 3MMAA 2NUUG 2C2NA 1TAUA 3SQGB 2M52A 3UI3A 3NNHA 4C4WA 1HBUB 3C19A 2CQ4A 3AQPA 1ROFA 5GAGU 2ERRA 3AOAA 1N88A 4JI2F 3KHHA 1M5OC 2FJXA 1X4EA 3LANA 3EVWA 4ED5A 1SKUB 1ITPA 1T9TA 4ZCLA 2FTRA 4OZ3A 4MK7A 5GMKa 2HVZA 2P5VA 1S0OA 1RWXB 1CJUB 2HQFA 4F3OA 5GADI 3HSGA 1KQSR 3QNWB 4PG4A 3CCRS 5D3GB 3TUPA 5CYMB 3TW0A 2MKYA 2R2UA 2DNZA 4JYAF 1FXLA 1IUJA 5KFQA 1NKEA 2NREA 3D2WA 1PBUA 3MR6A 1ZZFA 5IC6B 3R1LA 3S7RA 1VQ7S 3WIVA 3FRZA 1PSDA 1VRTA 3R27A 3M4XA 2E5LF 2GMLA 2KRBA 4CLWA 4TLQA 3MM5A 4DQRA 2UXDJ 2DISA 4NLXA 2DNPA 4A8SA 3SV3A 3EGWB 5L39A 4RW4B 2AJQA 4IR1A 3MPUB 5D0HA 3THPA 2O3DA 2B5JB 3DOKA 2HGLA 2XY7A 2W9BA 2YVSA 4I7FB 4XPCA 4LR9A 1D9DA 3O8WA 2GMHA 4UOFA 1FK9A 1EX8A 1RAAB 4Y00A 3ISNC 2A2CA 4USHA 4EU0A 5GAGI 4ICLA 2FZKB 2KJWA 4NA2A 2KT5A 1NB7A 3NGSA 5J1PA 2E44A 4EBCA 1S9EA 1SH2A 2GAGC 3G2XA 3N4WA 2UV8G 2K8GA 1JJ2R 3OVSA 5LL6d 5B0FA 2BQUA 1ULRA 2HHHJ 2BJ1A 4L73A 1S1XA 2HZCA 3DDNA 3M1VB 1JLGA 1GQEA 3HVAA 2JDJA 1HI8A 2XQCA 1JNZB 3GYGA 2JVRA 4A4JA 4TU9A 1RWNB 3HZEA 2E5GA 3M8YA 2CPEA 3EXYA 1SQGA 2EXUA 1EHWA 2N4DA 2GMJA 1YRTA 2XGQA 3ITHB 2FYXA 4ZVFA 4ZLJA 3LP2B 2AIRB 4LSLB 4WK3A 1N54B 1F1BB 5HROB 5J1EB 1X5TA 2HHVA 3AHPA 1RHMB 1HNXJ 2DR9A 4DR5J 2JX2A 1U8WA 4CLLA 1BQMB 1WEXA 4LMZA 5E3AA 2BM0A 4ZVTB 3Q8QB 5D0GA 1ZAVA 5LSLA 2C1EB 1R7IA 2E9TA 2BA9A 1HQUB 3OSNA 1LW0B 2RQKA 1DZ5A 2BBEA 1T3OA 2B7BB 3W2VA 3PX4A 4FF3A 2BRKA 4YDDB 1L3KA 2IRUA 3OT9A 1PGZA 1U0HA 1M90T 1LFPA 4DUYF 3H0PA 3CNQP 2MXYA 3PJ9A 4E98A 1U1RA 1EIYB 1FWPA 3MEGB 1DQ8A 1VI7A 2OAUA 3MMBA 3I5AA 1U1MA 3O1LA 3V4IA 4J9QA 3J80U 4WIIA 4RNMA 2PN6A 4ED1A 5IT4A 2J6UA 4RW9A 3PW0A 2BKNA 1JLFB 5HMXA 4EO6A 5K14B 4W98A 1SV5B 2IJFA 2YNGA 4JUZA 2RH3A 1B64A 3T1YF 2NZ4A 4D3GA 2YKNB 1WUUA 1Q8LA 3VZIA 2OP5A 1DJ0A 4PG6A 4OJ3A 5K5MA 2M9KA 3T9ZA 1HI1A 4NXMJ 2XO7A 4LF7J 1PAEX 1D8YA 4IRDA 2C3MA 4IH6A 4CM0A 4X4PA 1FJGF 5GAEU 3QAEA 2X3DA 1S0VA 1GT8A 4DV7F 4EZ6A 4P9SA 2DNRA 1HBMA 5IQQA 1VQYA 1HQEA 1H2VZ 2LKZA 3OL6A 2HIYA 1GMWD 3QRQA 3WBZA 5KT5A 1CULB 3FEZA 3MM8A 2DPIA 2UU9F 1WKKA 3NLCA 4GC7A 4H4MA 3DLGB 3E01B 2K3KA 4RJVA 4NCAA 4I2QB 3DU6A 5LT5A 1YITS 1FX2A 2CJBA 2VQEJ 1RTIB 2VBZA 1BHNA 4TN2A 4DPXA 1BWVA 1TKXB 2POKA 1LWFB 3P45B 1XMBA 1FKPA 4KKOA 3AFGA 1IM4A 3UN2A 3EPGA 5D4LA 1H6KX 2J9DA 5K20B 3VALA 3D6MB 1R0AA 1M1KT 5I4MA 2M70A 1U45A 4W90B 1ACMB 4OYWA 3GTYX 1UPMB 3HFVA 1MROB 3HHLB 2ROGA 3VQSA 3M8PA 4FNHA 4NLUA 3SCIE 3SI8A 2ZUAA 1N36F 2CIMA 3GONA 2LQBA 3HD2A 4NZ0A 5LSOA 4CT8A 3KG0A 2L9DA 9RUBA 3MCOA 4Y28C 3GQCA 4WTOB 5F0UA 3M9OB 3A12A 4O3QA 3TZZA 2P6SA 1RTDA 2KXFA 4LF1A 3PW5A 3CCES 3DRSB 2DNYA 1CJVB 2BJ3A 4TVAB 3A4TA 3PFEA 3BO3A 1UW4A 1RT5B 4ELUA 4C8NA 4NCBA 4QYZJ 3D67A 1VK8A 4CH1A 2CXEA 4USIA 1REVA 5DG7A 2FJDB 3LGNA 3BN7A 1NZ8A 4DZ6A 3RB6A 4ZVOB 2DITA 4WK1A 1NJZA 2GS8A 3PRDA 5HK4A 1A0OB 4OX9F 2HNZB 2OSRA 3U27A 1U49A
chains in the Genus database with same CATH topology
1H7WA 1TKZA 3NCRA 4I2PB 4EEYA 3Q2SC 2WSFC 2IM2A 5HP1B 2R4FA 3FQLA 2VZ9A 4RU9A 4FBUA 2F8MA 1YJ9S 1R8CA 4OLPA 5K9FA 3NS6A 2IM3A 4IFYA 2RQ4A 2K1RA 2PE8A 3I5CA 3CULA 1UWBB 4MFBB 3KK3A 3I4HX 3OL9A 3KTQA 4IRCA 2B6AA 5I42B 3GYNA 3GV5B 3IRXA 3KLIA 2VPYB 2Y0SD 2IVMA 4U67Q 3P96A 4F8RA 1NKBA 3HVTB 4J9KA 1HNIB 3VAMA 1YGYA 2F8HA 3O6QA 3C8YA 3N6MA 3M8QA 1VS3A 1N5QA 5D4NA 3FCHA 3CEDA 2CQGA 3O44A 1QLNA 5BYQA 5L1IA 3S1TA 1N5SA 2D3UA 4KPYA 2MMYA 1PC4A 4AXJA 2AGOA 2M5YA 3PKMA 4HKQA 3SZ2A 4OMFG 1LWEB 2U2FA 2XS7A 1M5HA 5CYJA 3S01A 3OV7A 1JXEA 4CQ1A 3PEJA 5B09A 3H59A 3MPWA 3G86A 3C6UB 3NAHA 4QBUA 1N52B 2EC0A 1HA1A 2PC6A 4PWDB 4I0WA 4HHJA 4OFZA 2R7OA 4C97A 3PZPA 1WTBA 1N56A 5KG0A 2R8KA 4K59A 5DDOC 4U6PA 3MMBB 2IM1A 2BW2A 2E9ZA 1WI8A 1VIXA 4Q5VA 2R2SA 2CQHA 3RR8A 2KZMA 5MAOA 2X1AA 2YNIB 2IYIA 4CH7A 5IS2A 2J0QD 3V4IB 4JI0F 3LWMA 5B0DA 3PHEA 2OPSB 5JUMA 4FF1A 3CSKA 1TL5A 3IWNC 3BS9A 1Q86T 3JSMA 3SCJE 2YKOA 2VB6A 4O4GB 4J9PA 3DOLA 1IJFB 4F02A 3R5DA 1IN0A 5EUHA 1C4CA 1F60B 1X9SA 1DRZA 2J9DE 2ZVSA 1NRKA 2UVUA 4RW9B 2JEIA 5AXLA 5A6PA 5KOXA 3DI6A 1N0VC 2OTJS 2AF6A 1IR0A 2GGPA 3GFYA 3G9CA 3PFOA 4KC5A 3H4DA 1N5VA 1P1TA 1XR6A 1Y5NB 4OHZA 3PIOQ 3K5LA 4DEZA 1S1WB 3THTA 1C4AA 2JZ5A 2YNGB 3TUIC 1S1VB 4IUFA 4QIVA 3JSBA 5LMNF 2QE5A 3M32B 4TKTA 1FNXH 4DSLA 3KLHA 4DBQA 3GIKA 1S6OA 2EWHA 4LFBF 3OHBA 1OQ6A 4DN0A 1YJUA 4C3MA 2CJKA 1YJVA 2FJBB 3SCLE 4LSNB 1HYSB 3PVXA 3IWLA 4C98A 3TAMA 5DS7A 2GW8A 5IM0B 2M7SA 3JTOA 5MLCV 1S0MA 1KS2A 2LEBA 1RT2B 2O66A 2Q6CA 4IOCQ 4N77A 2FLNA 3DLKA 1FT8A 2FHJD 3IGVA 4MKYA 3UCGA 2BANB 1DLOA 2ZOMA 1FRHA 3MAHA 4A8XA 5A8RB 2DBBA 4OV1A 5J2PB 1R3NA 4CTAB 1S6PB 1P9QC 2Q43A 2BJEA 2CPDA 4EBEA 2KZZA 2XLIA 2CVEA 4RW6B 1RYRA 2ROPA 2CRLA 2JH3A 3GE9A 2I9SA 4YR0A 3BR8A 3HK2A 2I2YA 1JLQB 5T7LB 4RW8A 3MMCA 1LFWA 2B9YA 4O4RA 2VPZB 3K58A 4IDKB 2FPHX 1MMDA 1X5PA 3FEYB 2HIQA 4PXBA <