1C0UB

Crystal structure of hiv-1 reverse transcriptase in complex with bm+50.0934
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
435
structure length
414
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 119
structure length 414
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0uB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uB03
5F8MA 2R8GA 2IM1A 3DRRB 4R5PA 2ASLA 3C6TB 5CYMB 4ICLB 3QGGA 4ZMMA 4Q44A 5D3GA 3LP2A 4PQUA 4WZQA 1BQMA 1VRTB 3V81B 5DGBA 2XCPA 1C0UA 1XR5A 3DLEA 2YKMA 1R0AB 3PW0A 3CJ5A 1RTDB 3NBPA 1RT3B 4NLOA 1RAJA 3IGVA 2RF2A 2OPSA 4KKOB 3UDLA 1TP7A 3QIDA 4GC6A 1RT2B 1C1BB 1JLFA 4ZHRB 3OSNA 2B6AB 2ZE2A 5J2MA 3DYAB 2C2EA 2YNIB 3LP0B 3RAQA 5J2PB 2IAJB 2QE5A 5F8IA 2OPPB 1IKWA 1JIHA 1DTQB 3KLIB 4Q43A 4URQU 4PUOA 3BSCA 4O3SA 3DM2B 5HROB 3D28A 5L1KA 4X2BA 1T3NA 2YNHB 2WONB 3TAMA 4NLTA 2V4QA 3KHHA 2FVPA 3IG1B 4NCGB 2BE2B 2VG5A 5C24A 3KJVA 1TVRB 3IGNA 2VG5B 3KHLA 4NCGA 5HLFB 3E01A 3NKYA 4M94A 3C6UA 3ISNC 5HLFA 3GIIA 3TAMB 3V6DB 4LQ9A 4O4RA 4TYAA 2BE2A 3KJVB 1D1UA 3IG1A 2IJFA 3CVKA 3N6NA 2XGQA 4HYKA 4O44B 1RTIA 5L1IA 4RW6A 2YNHA 4ZP8A 2OPPA 3DLKA 5J2PA 4K50A 4PUOB 3LP0A 2DPIA 3T5LA 1N56A 2R2TA 4K4YA 2FVCA 2IJNA 4IRCA 2YNIA 1HNVB 3DYAA 4ECWA 5J2MB 2R8IA 2HNDB 1IKYB 4ID5B 2B6AA 2ZE2B 3CJ4A 4ZHRA 1RTDA 5F9NA 3Q8QB 3OL8A 4R8UA 3BSOA 1RT2A 3N6MA 2UVRA 1C0UB 2R2RA 4KKOA 4H4MB 2XGPA 5D3GB 1RT3A 3NBPB 4IH5A 4Q45A 2IA6A 1R0AA 3C6TA 5CYMA 2D7SA 1JLAB 3V81A 4Q0BA 5DG8A 3DRRA 4F4XA 2E9RX 1DLOA 4IG3B 5EUHA 3QGIA 3T1AA 3MR6A 4J9QA 1JLQA 4I7FA 4RW4A 1FKOB 2BANA 1N6QA 2R8KA 4IDKB 3QLHA 4MFBA 1RA6A 3I5BA 2D3ZA 2OPRB 4NLVA 3FDSA 2FVSA 2XCAA 3H5YA 2B5JA 3Q8SB 2WTFA 3TVKA 2UUWA 4JV1A 4LSNA 4KE5A 3PJXA 1DTTA 3I0SB 3VQSA 3DOLB 3BJYA 4KV8B 4IFVA 1S6QB 4QWAA 5J2QB 1RTHB 2XI3A 1RT6B 1MMLA 1SUQA 1RTJA 3MECB 3QIPA 3KHGA 3IRXB 1HYSA 2IC3A 1RYRA 5KG1A 3RAXA 4F50A 2HNZA 5KFPA 3OL9A 5KFVA 2R8JA 4J9MA 5C42B 3DMJB 4NLDA 3RB0A 2ASJA 3ITHB 1TL1B 1RT5A 3T19A 3BR9A 4ED8A 1RYSA 4IG0A 1JLGB 1TKTB 3CO9A 3GYNA 3FQLA 4MK8A 4WFYA 4DEZA 3GV7B 5I3UA 3H98A 4ECXA 1C1CA 4DG1A 3PR4A 3MEDB 1HQEA 2BRKA 3DRPA 3KHRA 3DOKB 5I42B 1T03A 2E9TA 1SV5A 2WB4A 2B43A 4ZVGA 4K4ZA 1S1TB 5KFOA 3PW4A 4IH7A 2HMIB 3KLGB 5DQIA 4ECZA 3I0RA 4XPEA 1S1XA 5DG9A 3H5UA 1T05B 4KB7A 3GQCA 1TKZA 4EYIB 2HNYB 1RT4B 2ILZA 5KT7A 4KO0B 5J1EB 4K4TA 4ED3A 2VG7B 3QO9B 5KFCA 4EEYA 3EPIA 1S97A 1IKVB 2W9AA 3CJ0A 5CYQB 1S1TA 5EWEA 4RNNA 4J9SA 3MEGB 4ECSA 1S0NA 1SV5B 1GX6A 3CJ2A 3GV5B 4J9OA 2V9WA 3HHKA 4IQXA 2XI2A 2JEFA 4Y34A 4MH8A 1N5YB 4B3OA 3HVWA 1JLGA 1TKTA 5DGAA 3SI8A 3JSMA 4ECQA 1S1WA 1VRUA 2OPQA 4IKAA 1RT7A 2YKNB 1BQNA 3KK3B 3PHEA 1JLEB 5KFKA 4YR3A 3KLHB 4K4WA 3KNAA 4MK9A 5KFZA 4ZPBA 1QAJA 2W9CA 1RT6A 1SUQB 3MR3A 4Q8FA 1S0OA 4IFVB 4KV8A 1LWEA 4RNOA 3LALA 2YNGA 4Y2CA 2IMWP 4I2PA 1EP4B 4O4GB 4WFXA 3FSIA 2VA3A 4YQWA 4G3IA 4WYWA 3QYYA 2OH2A 5F8NA 1REVB 1LW0A 1N4LA 1IM4A 3ISND 3KLEB 4RW9A 1RDRA 2GIRA 2AU0A 1FKOA 2BANB 5KFDA 2VG6A 5KFXA 4RNMA 2AWZA 4XPCA 5F8GA 1HPZB 3BREA 4IG3A 1DLOB 4O3QA 2JEJA 3DRSA 3KK2B 5KT6A 2W8LA 4ED0A 5EWGA 1JLAA 4Q0BB 4RW8B 2ALZA 3LANA 1S9FA 4F4YA 2GC8A 5KFWA 3Q8RB 3NMAA 2D41A 3PW5A 1CSJA 2VA2A 2W8KA 5KG0A 4NLQA 4R8UB 2VG6B 3KLVA 1TV6B 5K14A 4O3NA 4DL4A 1IKYA 4ID5A 1S9EA 4KAIA 4KFBB 1HNIB 1REVA 1HNVA 2IBKA 1S10A 4MIAA 4TY9A 1HQUA 4FS2A 4IR1A 4JUZA 3M9NB 5KFMA 1S4FA 4YP3A 3V6JA 1WNEA 1J5OB 1SH3A 4NLXA 4DL7A 1LWCB 1S1VB 2CKWA 1TKXA 4I2PB 3DLKB 3CDUA 3MTKA 1LWEB 4ZP6A 5KFIA 5KFEA 2J6TA 2C28A 4I2QA 4PWDA 3CDEA 3GIKA 3H40A 4H54A 4WYLA 3GILA 2W9CB 5C5JA 4J9RA 3KLHA 3V6DA 4Q8EA 4TN2A 1BQNB 1HARA 2FLNA 3E01B 4NRUA 1OS5A 1VRUB 1FK9B 4EO6A 5KG5A 3Q8PB 5C24B 3JSMB 2ILYA 3M9OB 3KMQA 1D0EA 4NLUA 1S0MA 5F9LA 4G1QA 3G6VA 3OLBA 4J9LA 4EBCA 2C2RA 4MIBA 4ZVHA 3G6XA 1U09A 2F8EX 2GIQA 3NL0A 1TQLA 4F4WA 3UQSA 3KLIA 1IKWB 2C2DA 2J6UA 3MEGA 2IAJA 3RB6A 1XR7A 3CJ3A 2ZD1B 5KFAA 4OL8A 4EO8A 3RBEA 3T5KA 1QAIA 2IM0A 4KO0A 2WHOA 1UWBA 2R2UA 1JLCB 3PR5B 1TKZB 3BGRA 1T05A 2OPSB 2CJQA 2RF2B 3KLFB 4WE1A 1K1SA 3MFHA 2YKMB 1QE1B 3DI6A 1S1UB 1KHVA 1BQMB 3LP2B 3UR0A 4FS1A 2W7PA 4ICLA 1HQEB 3MEDA 3SFGA 3EPGA 4IRKA 5I3UB 4NLRA 4R5PB 4DL2A 4LQ3A 3NGDA 3IS9A 4IG0B 5KFUA 3PZPA 4XO0A 1JLBA 3DMJA 5EWFA 3M8PA 2JC0A 4DL3A 1MU2A 3V4IB 4ED1A 4QW9A 1XR6A 2IC3B 1HYSB 4RU9A 2W7OA 4MKAA 3GIJA 3MR5A 1RTHA 3H2LA 3JYTB 1KLMA 2RKIB 3MFIA 5DQHA 3I5AA 1KLMB 2RKIA 2FJXA 4WXWA 1FKPB 4ZP7A 4DL6A 3LP1A 2BQ3A 4KHMA 4R0EA 3HVTA 3M8PB 3PW7A 2OPRA 3N6LA 3M8QB 4QWCA 4F4ZA 1JLBB 3V4IA 3NAHA 5C25A 1JKHA 2WRMA 2BQUA 4I7FB 4RW4B 2JEGA 5KFGA 2WK4A 1IKXA 5KG7A 4FBUA 2AQ4A 4IR9A 1S1UA 3DI6B 1QE1A 3V6KA 4ECVA 4ED7A 2BQRA 5KFFA 1QUVA 5KT5A 4H4MA 2W9BB 3BQ0A 3KOAA 3BSAA 3ICLA 4IH6A 1JLCA 4WE1B 3KLFA 1UWBB 2HNDA 2ASDA 2E9ZA 2FJWA 3BGRB 2ZD1A 4WXOA 5KFYA 1C2PA 3CDWA 5KFHA 4K4UA 2C22A 3BQ1A 3GV8B 3NAIA 3H5XA 4RW6B 4GC7A 1RTIB 3OHBA 3MR2A 4G1QB 2JEIA 4O44A 3BQ2A 1NNDA 4NLPA 2DPJA 2FLLA 3OLAA 3GIMA 4J9KA 4NLYA 5KFSA 5L1JA 2UVUA 4ZVFA 3C6UB 4MKBA 4DL5A 1I6JA 5F8HA 1TVRA 4IRDA 3M9MB 3IN5A 4NLWA 1FK9A 4HKQA 1YVFA 1Z4UA 4QW8A 4URGA 2EC0A 4NYZA 4K4SA 5F8JA 2XWYA 3FRZA 2V4RA 2WONA 2O5DA 2I1RA 5KFBA 3DM2A 5HROA 5KFRA 3T5HA 1K1QA 2IM2A 4TQRA 4I2QB 1LWCA 4PWDB 4ZPDA 3RB3A 4K4VA 1DTQA 4ZPAA 2RDJA 4ZVEA 2JLEA 1NHVA 4O3OA 5KG6A 5DLGA 2R8HA 1TKXB 2ATLA 4O3RA 1S1VA 1HMVA 1TL3B 1KHWA 1J5OA 4KFBA 2J6SA 3EZUA 2V0NA 1TV6A 1HQUB 1C1BA 1JLFB 1HNIA 1EETA 1S9EB 3DLGB 5K14B 5KG4A 3PJWA 3CWJA 1LWFA 3DLEB 3E51A 5KFTA 4NRTA 5T14A 3G6YA 2WOMB 4LSLA 1VRTA 5FDLA 4WZMA 4PQUB 1S6PA 2QV6A 3OHAA 3KK2A 1S6PB 2UVVA 4ECUA 5FDLB 2R2SA 5KFLA 2WOMA 4LSLB 4RW8A 1LWFB 4ED2A 4K4XA 1JXLA 3DRSB 3KMSA 3DLGA 4RW9B 3KLEA 1HPZA 1EETB 1T94A 4TY8A 3CIZA 5HBMB 4QWDA 5JXSA 4Y3CA 3RBDA 4H4OB 4WFZA 5KG2A 2FVRA 1ZETA 1LW0B 1TL3A 2RDIA 1C0TA 1HMVB 4O4GA 3T5JA 5KG3A 4ZP9A 3FFIB 1SH2A 4RNHA 4RW7B 4FBTA 2I5JB 4NLGA 1EP4A 1W25A 5HP1B 4J9NA 2YNGB 2HWHA 4IOBA 1GX5A 1JLEA 3HVAA 3QGHA 4U7CA 1N48A 2OPQB 2UVWA 1S1WB 2AX1A 2AGPA 5J2NB 4YMEA 1RA7A 4NLSA 5DG7A 4RUAA 3H4BA 4EBDA 1RT7B 2YKNA 3KK3A 4ECRA 1SH0A 4J9PA 3OL7A 2BR0A 2YNFB 4Y2AA 3MEEB 3FQKA 5JUMA 4IFYA 2FLPA 1N5YA 4B3OB 5KT4A 1RT1B 3I5CA 1LW2B 2HAIA 3V6HA 4ZPCA 5CYQA 2WCXA 1S9GB 5F8LA 2IM3A 4YR2A 1S48A 5J1EA 3KK1B 1IKVA 4JV2A 2HNYA 4QWBA 4O3PA 2XC9A 3PW2A 3QO9A 2VG7A 4TXSA 5KT3A 4YR0A 3QZ7A 4ED6A 1RT4A 3LAKA 2HMIA 4KBIA 3KK1A 4NZ0A 1ZTTA 3OL6A 1S1XB 2W9BA 3I0RB 1S9GA 3D5MA 5I42A 1T03B 3KLGA 3DRPB 4QWEA 4ECTA 4QPXA 5L1LA 3TQ1A 3UPFA 1JX4A 1C1CB 4DG1B 1LW2A 1RT1A 2FJVA 3DOKA 2HWIA 4IFYB 4EBEA 3MEEA 1IKXB 2YNFA 4URSA 1RT5B 1TL1A 5KFJA 2BRLA 4U6PA 3PVXA 2AGOA 5C42A 2ZKUA 3RB4A 1ZTWA 5KT2A 1JKHB 5C25B 3QZ8A 2HNZB 3ITHA 3M8QA 5KFQA 5J2NA 5DLFA 3IRXA 3HVTB 3SFUA 1RTJB 3MECA 3LP1B 3G86A 4RUCA 1FKPA 1S6QA 2JC1A 4RNFA 4RZRA 3QIPB 4KSEB 3HKWA 4TQSA 5HP1A 5J2QA 3DOLA 3JYTA 2I5JA 4TLRA 4RW7A 5EDWA 3BSNA 4ECYA 3FFIA 2D3UA 3I0SA 3DDKA 1S49A 1DTTB 3MF5A 5KFNA 1C0TB 4KHRA 3LAMA 4EYHB 3QLHB 4MK7A 4TYBA 4JV0A 4LSNB 4H4OA 2FVQA 1MU2B 3H5SA 5DQGA 5HBMA 2B5JB 2UUTA 3H4DA 3OSPA 1JLQB 4M95A 4TY8B 4MFBB 1NHUA 2AX0A 4IDKA 5L9XA 3H59A 1N6QB 2AGQA 3IS9B
chains in the Genus database with same CATH superfamily
1R89A 4DMZA 1KONA 2IM1A 3FEYB 3PYEA 2XG8A 4HVZA 3C6TB 3DXBA 1WTBA 2KFZA 5F3ZA 4U8YA 3CCUS 1BQMA 2FYXA 2NCKL 1RAEB 1F5CA 5IV4A 4WIIA 3VGUA 2YKMA 5DGBA 3EXYA 3BH6B 1RTDB 1WOSA 2BOAA 4NLOA 5JJBA 1X4BA 2ZZMA 1XN9A 3LA0A 1W2IA 2A6MA 3EVOA 3QT8A 1RT2B 4N8NA 3UDLA 2LA6A 4GC6A 1M1GA 4HTJA 4RKUC 3C3LA 3RZAA 3MCSA 2AJ4A 5CXTA 1DQ9A 3HJVA 3EYZA 1VBYA 2HAFA 3W65A 4A8YA 2YX7A 2EW9A 3R27A 1VGYA 1U6BA 1U7LA 2F8HA 5J2PB 2X1GA 3H42A 4JI6J 2QE5A 2OPPB 1S0VA 2JH3A 4M5GA 1TK8A 1FVSA 3ILLA 4Q43A 1F0XA 1YZ7A 4O3SA 2F1FA 3DM2B 3C15A 3QBCA 3D54A 3U02A 2UV8A 1RHMB 1T9TA 1Y7PA 2WVEA 2YNHB 4HACA 2FJAB 2WONB 4KIAA 4IUFA 1S76D 1ZM9A 3EVMA 3ZZRA 4GO5X 2FHOB 4DX7A 4K0KJ 4NCGB 1HBOA 2DTJA 1FHTA 5C24A 1TVRB 3KHLA 5A8RA 1P27B 3E01A 5HMXA 5GAGU 3K5LA 3C6UA 2HHWA 2P9GA 2PEBA 3UVJB 5A8RB 3V6DB 3GIIA 3SCLE 1GFWB 5M2RA 1K8AT 3UN5A 4M5IA 2P8IA 4HYKA 3HXMA 2XBPA 4Q7AA 3WX4A 2YNHA 1TKDA 1OQ6A 2GQQA 4GRSA 1UVIA 3LP0A 2I38A 4UQTA 4IOCQ 4DSIA 1OJ4A 2YTCA 3EWGA 1AYEA 2IJNA 2VPZB 2DRDA 3KJQB 2CNKB 2JVOA 3NGTA 3RU0A 4ECWA 2LQ5A 2PGCA 1U1PA 3THPA 3ENVA 1RT2A 3MCNA 4H4MB 1NAQA 2DHXA 4WU2A 1IQTA 4Z7CA 4IH5A 3MM6A 4Q45A 1Y3JA 4BC7A 4PEOA 2BE7D 4DCJB 2N3OA 3DRRA 4F4XA 3UCZP 3OTOF 4A8FA 2CQCA 4ILMA 1NHKL 2CQIA 2FZKB 2V4JB 2FY8A 1ELOA 3K7RA 3M05A 3O1LA 4K7QA 1TU0B 4C8NA 3WDOA 1N6QA 2R8KA 5LXRA 1NPPA 4NLVA 5AT1B 1VIOA 2FVSA 4IYQA 2B5JA 2AEJA 2JVRA 3TVKA 1L3KA 3QAUA 4GVLA 5H9FJ 3VGVA 3VHQA 1QTNB 4A8KA 1DTTA 4DR4F 1YZ6A 3I0SB 3AH6A 3FCHA 4LT6A 3BJYA 1HI1A 2BKOA 4KV8B 3FK4A 1YBAA 1WI8A 2QL7B 5FIIA 3AAWB 3PW5A 4M5KA 2XI3A 1RTHB 3VF0B 1RT6B 3MECB 3QT6A 2OSRA 4TNOA 4B9NA 3G96A 2HNZA 2OIHA 1ZZFA 3VAMA 4FF2A 5C42B 2HRUA 1XK8A 4NLDA 2BJEA 1KSPA 4LSZB 4RO0A 4A48A 1RYSA 3BDPA 4QU6A 1N5QA 4ZJQA 1R8BA 2VBYA 4DG1A 2OI2A 2R7WA 3MEDB 2BRKA 2A0FB 4M8LA 5D4PA 2MXYA 2DY9A 3DOKB 1FE4A 1JQGA 3A8JA 1KTQA 1PAEX 1XQIA 2HWTA 1N33J 4ZLPA 2CJ9A 3EVWA 3PW4A 4ITSA 1RSCA 4QCLA 1U1NA 3JQMA 4ECZA 5D8HB 1U1QA 3TOQA 3AA9A 4CLUA 1CLFA 1TKZA 4JI8J 3T41A 1R7IA 3FCWA 2G1DA 3R7NB 2HW3A 3TZZA 4K4TA 4ED3A 4DFPA 2DHAA 2VG7B 3QO9B 3P5BP 2FHKA 5KFCA 3UR3C 5DJBA 3EPIA 2ADBA 1YIJS 2GAHC 5CYQB 3DRYA 4DCPB 3OFFA 5L39A 5EWEA 4EI2A 2OEJA 4Y2IA 4RNNA 4J9SA 2QLWA 3D0GE 1TL4A 1S0NA 3QFWA 4XIUA 1GTHA 3CJ2A 3GV5B 1PJ5A 3HVRA 3HHKA 5IS2A 2R7OA 4MH8A 2F7VA 2DEJA 5DGAA 1X4AA 1OY8A 4ZJOA 1CC7A 3SV4A 3GYXB 1S1WA 3FZ2A 2OPQA 3PEHA 4W92B 3PYDA 4OYOA 2YKNB 3KK3B 1F9EB 1ZM3A 3AXMA 3PHEA 2NSBA 3VV2B 5KFKA 4YR3A 3CCLS 2VJUA 1N5VA 4ZPBA 3TZYA 4DPWA 1RT6A 2PSZA 3US5A 1PAUB 4Q8FA 1S0OA 1SIWB 2E7WA 3N28A 4KV8A 3BPSP 4CIOA 2KDOA 2MSTA 2M88A 2Y1RI 3GSDA 1FESA 3QSIA 3RBXA 2Z56B 4DV7J 3WC2A 3DNCA 3HHLB 3A3PB 4F2SA 3DFEA 2E7VA 4KRWA 1ZYQA 2POKA 4YQWA 1N0UA 4WYWA 3QYYA 2OH2A 3IAM9 1REVB 1S77D 2NUUG 3F0NA 1RDRA 1RWWB 2EG1A 2DNLA 2VG6A 5KFXA 4XPCA 2K3KA 2V4JA 5ETKA 4CO2A 6FDRA 3AB4B 2HFSA 4ID8A 5KT6A 3D6MB 3JAMU 2XZTB 3GCXP 2V2ZA 5D4OA 2YWHA 1NJYA 1HR0F 2KN4A 2KRRA 3Q8RB 2KM8C 2EI5A 3FZBA 1WACA 3J81Y 2VA2A 4X4NA 1TL7B 2CJBA 3NP5A 4NLQA 2VG6B 3KLVA 1TV6B 2MY7A 3R5GA 3GFYA 2DGOA 8ATCB 1PG5B 2K8GA 2MSSA 3FBEA 1REVA 2IBKA 1S10A 2V8PA 3NLCA 4IR1A 4JUZA 2DRAA 1PC4A 2FDNA 2WB1D 5KFMA 4AYBD 4TU7A 1QSLA 1WNEA 4N8OA 4NLXA 4DL7A 3NCRA 4NMXA 4DS4A 4PR6A 4B9UA 2VPXB 4ALZA 3W2WB 3MTKA 4FXWA 4ZP6A 4Y00A 1VQOS 1B3TA 1VISA 2Z2MA 3GIKA 4F25A 2ZH1A 1KC8T 3GILA 3CSKA 2BYCA 5K8PA 3G87A 5HMWA 5C5JA 2CZVC 2J5AA 1XMOJ 2X1FA 3V6DA 4JI5J 4Q8EA 4QR2A 2XHCA 4GO7X 3TEGA 3E01B 2WSEC 2N7YA 1OS5A 4NRUA 3J7Z5 2DH8A 4I68A 3OVAA 3QRRA 5C24B 2ILYA 2GMHA 2RH3A 3FVYA 4PXDA 1D0EA 1F9HA 2CADA 4YN3B 5MAOA 5F9LA 5HMYA 5BR8J 1S0MA 2XB2D 3OLBA 4EBCA 3TVYA 2AEMA 5F41A 2E5JA 4MIBA 2M9KA 2B56A 1U09A 3FCVA 4LF9J 4CO1A 1Y5IB 2F8EX 4PG8A 3UQSA 3RG6A 4JI7F 3Q2TC 3V2UC 1F5AA 2MYFA 2NREA 3RBEA 2DCUB 2BJ1A 4RLEA 1RAAB 3GJRB 1A6LA 1R8AA 2R2UA 2QA4G 2FC9A 1BGXT 1TKZB 2EVZA 2O1PA 2PD1A 4EWTA 2HLTA 2XSJB 3J81j 3PKMA 2YKMB 1SC6A 1FRLA 4I6AA 4KH1B 1NCLA 5E3QA 4DPXA 2MQPA 1BQMB 1UTAA 3EDQB 3T9NA 4CLWA 4FS1A 2DIVA 3F41A 4X62J 2W2MP 3MEDA 2I6WA 2PMHA 3EPGA 3VVUA 1WG1A 3LGNA 3GU0A 3ONQA 2V67A 4CH0S 3K5MA 4LQ3A 1GEHA 4NE9C 3IS9A 4UF4A 2QLBB 4FZVA 1KVJA 2JC0A 2IMOA 4DL3A 2D74B 2ZDOA 4EGLA 1B70B 4QW9A 1RUSA 1SKWA 2OSQA 2W7OA 3KJNB 3EGNA 4UY85 1OYEA 4NA1A 2VZ9A 4ZN1A 1CJVB 1RTHA 1T9UA 3PRBA 4ZS6A 3T1HF 2XNRA 1RWXB 1Q4RA 2MKHA 3POTB 2LEPA 4U7UD 1NLKL 3I5AA 1AW0A 2FJXA 3R9LA 3H0PA 2M3DA 1IN0A 1FKPB 1F3VA 2V5HG 4ZP7A 2GX8A 3OQ2A 3G6ES 3L7UA 3LP1A 3JSBA 3D0IE 3MAQA 1VBXA 3PO4A 4C2MA 3PW7A 1SIZA 2NYIA 2KM8B 3V4IA 1KDNA 3AY0A 4FNHA 1N32F 2GQCA 4CDIA 4UT4A 2JEGA 3EX7B 2VICA 1NM2A 2MJNA 4OV1A 4Z2XA 3MZIA 1IKXA 2V8GA 3FBBA 4A8OA 3AJDA 2AQ4A 4ANEA 1X4EA 2ZBIA 3MPYA 1IBMJ 4ZOSA 2Z2LA 2IRXA 4ECVA 1DZ5A 2DNHA 2BQRA 1KFSA 1QUVA 3W9HA 4H4MA 2HK3A 3BQ0A 2Q6CA 1VBZA 1NB7A 2HIQA 2EEYA 4AL5A 4NA2A 3KLFA 1R31A 3U7JA 1HI0P 2H9ZA 1TR0A 4N47A 2GJFA 1PYOB 4FF3A 1UW4A 4FN5A 3S8SA 3P49B 2X3GA 1C2PA 1IBLF 2IVYA 2D9OA 2L9NA 3T1YJ 1AROP 2OFGX 1V6HA 5A6PA 5D6GA 1F6TA 2ZBQA 3SCKE 3GV8B 5DM7Q 2XMTA 3NAIA 4DOZA 5L38A 4YHHF 4JV5J 4LIRA 4KGVB 3PM9A 3BQ2A 4A8WA 3BN7A 2PC6A 2RT3A 2FLLA 3GIMA 1GAOA 2VH7A 3VR1A 1NUEA 3AQOA 3C6UB 1HD1A 5F3TA 2EFOA 1I6JA 3T3FA 4L6V3 1ZH5A 1TVRA 5ETLA 3M9MB 2B4VA 1YVFA 3H7HB 2BKNA 3LH2S 2CZ9A 1HNXJ 4K4SA 4NYZA 5F8JA 1MLAA 1ZM4A 2BA9A 3FRZA 3PHTA 2WONA 4N7TA 4HACB 3TNVA 4XK8C 3BBBA 3C19A 3W2WA 3RBZA 4OYIA 3VZHA 3DM2A 3C15B 1WSVA 3CCTA 5K5MA 7AT1B 4TQRA 4K4VA 3H2VE 1RWUA 2QYGA 1MWYA 2C3UA 2A18A 1NHVA 5B0BA 2VB6A 4O3RA 2PO4A 1WEXA 1YK9A 2FQQB 3I55S 2ATLA 1HMVA 1TL3B 1J5OA 4LMZA 3VCDA 2C3MA 1ZAVA 3E8OA 2X51A 1TV6A 2L9WA 4DU8A 1HNIA 2DR5A 1UVJA 2CIMA 2OD6A 3F73A 3DLGB 2IPOB 5K14B 1HL6A 4KPCA 2E7XA 5KG4A 1KLNA 5D0HA 4ZCMA 3CWJA 1LWFA 4JI6F 1BXNA 5KFTA 1XMOF 2CXEA 2ZH3A 1TAUA 1UJ5A 2PN6A 3JSRA 1GXUA 1S6PB 1XEZA 2VDIA 4F4AA 2IIHA 5IV3A 2WOMA 2E5LF 3FJ2A 4BBYA 1RWOB 2OUGA 4ED4A 1VQNS 4HHJA 3N9UC 4U8VA 4K4XA 4I69A 2YPYA 3AD9C 4R0JA 2QSWA 2QLXA 3Q8VA 1T94A 1S99A 2HQCA 4TY8A 3CIZA 1VQMS 1WKJA 5JXSA 2DR8A 4WFZA 3JTNA 2MPUA 2FVRA 4RWXA 1LW0B 3Q86A 2RDIA 3T5JA 1N36J 3QGPA 5E3RA 3HFZB 1QY7A 1RACB 2KJWA 3D67A 3EDRB 4GVBA 4L76A 2CRLA 3LGHA 3OXFA 4LRFA 1FWKA 2RQMA 2I5JB 4DPUA 4FBTA 1WDTA 1H7WA 1RWMB 5CZVA 5HP1B 1NDPA 4XAKA 1UVKA 4IOBA 3KNGA 5A8WA 1HR0J 1DFDA 3D1OA 3IR6B 2QYCA 2EFVA 3Q8UA 5E5NA 1N48A 2OPQB 1S1WB 2AX1A 4WU3A 1VI7A 2MHNA 4YMEA 1BUXA 1WC5A 2JSXA 3MD1A 5CD4A 2MKKA 3H4BA 1RT7B 4LF4J 1TZ0A 4OYXA 2ZZNA 1XWLA 2V9KA 1KFDA 3CCWA 5AXLA 2C1EB 1WOPA 1VK3A 3CW2C 3H59A 3M30B 4CO4A 4NEZA 3W7BA 2YNFB 3O3LA 2CJYB 2HZAA 4IFYA 1N5YA 1RT1B 1LW2B 4W4MA 4OHZA 4ZIWA 2YKAA 2VFVA 3OXLA 3CMAS 5CYQA 2XHWA 4OZ1A 4CQ1A 4B3SJ 4KJIA 2GW8A 2OTJS 5F8LA 3H20A 4YR2A 3OFEA 3KUHA 4N41A 3QMQA 4P71A 4JI1F 1UFKA 4CM2A 7FDRA 2V8VA 1RT4A 3SQGA 2F9DA 3ZTPA 3R1LA 2XY5A 1ZTTA 4C11A 2HHHF 1FX2A 3W61A 4NA3A 1ZM2A 1XJWB 2W9BA 1S9GA 2CPIA 3MPWA 3TARA 4QWEA 4QYZK 3KLGA 3EZOA 4ECTA 3KUEA 3O2IA 5LSOA 4X4PA 2IJRA 3UPFA 2V50A 4DG1B 2XMJA 3LTOA 3J81U 4ZVSB 3MPVA 2DXFA 5IOLA 3TRGA 2L48A 5CAAA 2BZ2A 1IQZA 2ATCB 1LFWA 2G0IA 2HWIA 3MEEA 3BM7A 1FNOA 4PG6A 4URSA 1GMWA 4EBEA 4ZLLA 1XMQJ 1KWMA 3R5JB 1XBWA 5C42A 3VGSA 3H25A 4AQYF 1B7YB 3RB4A 1LFPA 2RNEA 5C25B 3EJMA 5K8OA 2HNZB 2H5EA 3QZ8A 3MMCA 2AEFA 5KFQA 5J2NA 5LMUF 5DLFA 2CQHA 2GS8A 4YB5A 3MECA 2JZ5A 2P9EA 3G86A 2HPUA 2B9EA 3DGPA 4ZPTR 2KZMA 2I2YA 1U1RA 2BOPA 4RNFA 3PFEA 3IM9A 3QIPB 1YRXA 2CDQA 5AE3A 2MQOA 4RZRA 2XMAA 4DR2J 1M5OC 4NXMJ 3JYTA 2I9SA 4ECYA 2AYEA 4G6VB 2E1PA 2XLJA 2B9XA 3BH7B 3B78A 1NDKA 3DDKA 3CD7A 1C0TB 3RYLA 1XIQA 3LOUA 3H5SA 4H4OA 2FVQA 1MU2B 1S7HA 1WHYA 3M6XA 4JV0A 3OSPA 3I6PA 5H1SV 1VRQC 1X4DA 3AJ2A 2LCWA 3QAEA 3SV3A 2RQCA 1NJXA 2WSFC 1Z2ZA 3DRRB 4WKYA 2ASLA 1R27B 2QO3A 1HHQA 2G2ZA 4JBCA 4UQGA 2HRYA 1GXLA 3MM6B 4KGZB 4Q44A 4C4WA 3LP2A 4UOHA 4U9RA 3AFGA 1QUPA 5BYQA 5H9EJ 2G0JA 2AYGA 3I82A 2HHUA 1UETA 1R0AB 2JWNA 3CJ5A 3NCPA 3NBPA 1RT3B 1UL3A 1RAJA 2CNNB 2EXUA 5G0RB 3PV8A 3GIRA 3BGFA 1B0VA 3QIDA 1LXJA 3B6BA 1C1BB 3Q24A 4F4KA 4CLFA 3K5NA 3LF0A 2R9LA 3TI0A 5J2MA 3ADAC 3G82A 1RHRB 2MLXA 2EFPA 4ZVOB 2C2EA 1CC8A 4P52A 1OYDA 3LP0B 1OY9A 5T7LB 1X4FA 3RAQA 2QLFB 4A8QA 1DTQB 2YWGA 3IM8A 1RHKB 4FYWB 1B4SA 2AP6A 2WAQD 2LA4A 4PUOA 1NRKA 3MM5A 4URQU 4EMDA 8RUCA 4ZPVR 4ZVTB 3J7ZT 5L1KA 2DHSA 2HBYB 5IT0A 1T3NA 5AE2A 6AT1B 3UVJA 5CA5A 3C46A 3KHHA 3D3CJ 1NK8A 3KXDA 1Y0HA 1WSRA 4QIEA 2LXIA 2F4VJ 5LSLA 2OEKA 3NGKA 1WHWA 4ATNA 4NCGA 1HBOB 2H4WB 1NJIT 3B54A 4M94A 3M8ZA 5HLFA 2M8HA 5ETPA 4AL7A 4LQ9A 3THVA 3ZTSA 2ZHOA 3HKZD 4MKYA 3KJVB 2IJFA 1D1UA 1IBMF 1TFYA 2FIUA 1RTIA 4FXVA 4RW6A 1N34F 2OPPA 4NX9A 2YY3A 4W98A 3TANA 1WOOA 2BM0A 5J2PA 2CQGA 2LVWA 3QATA 4K50A 4OZNA 3GMGA 1Q82T 3QRPA 1YWXA 1WF0A 3ISZA 2PA3A 1RJJA 2YKQA 2YNIA 3N01A 4P75A 3JAMY 3CJ8A 1HNVB 3DYAA 1UZDA 2R8IA 3RR8A 1IKYB 2QN6B 3D68A 2ZE2B 3CJ4A 3TJAA 4ZHRA 1RTDA 2Q43A 3TQEA 3ZO7A 4RPFA 1U0SA 4HR2A 3N6MA 4X64F 3IWXA 4UUXA 1BC6A 3I56S 2DR6A 2MZQA 3LQVA 2RUSA 4LVOP 5ETSA 3OW2R 3C6TA 3MURP 4ERDA 1JLAB 1Q8LA 3ZZUA 3LO3A 1LXNA 2E9RX 1BWEA 1DLOA 3U1LA 1NZ8A 1VQ9S 5FJ4A 2XS2A 4OI1A 1KR4A 3L3CA 3MCMA 1WD6A 4YOEA 3DU5A 3NS6A 5HI7A 2BDPA 1Q5VA 3NGSA 3R8YA 2YPZA 3UN3A 3MUVP 2MGZB 3NS7B 4ZITA 4DLGA 2D3ZA 2OPRB 1F9FA 3FDSA 2KH9A 4OYWA 2WTFA 1FRXA 2UUWA 3D1HA 3CJKA 3CDAA 4DV4F 1QVFR 4JYAF 2X7IA 4KE5A 4C8LA 3N79A 3BYPA 2AF6A 3BGLA 4O23A 3FUYA 2B4OA 4DQRA 2DCLA 1U2RA 1T9XA 2MMYA 1RBOB 5F0WA 4DLEA 1CG2A 3FSYA 1R6VA 5IWAJ 2GVZB 2BEFA 4P73A 3KHGA 2ZBCA 2LYVA 1SB6A 1RYRA 2N4DA 3RAXA 2X1BA 3DDNA 2GIFA 1R0BG 1YRUA 2ZC3A 2ZNZA 4J37A 3OL9A 4J9MA 3M1VA 3MDFA 3DMJB 3RB0A 2RDDA 2ASJA 2EFGA 3ITHB 3MTJA 4USJC 1EZZB 4IG0A 4DEZA 4WFYA 2DBBA 2WW8A 3FQLA 2GNKA 3GV7B 4B9MA 5I3UA 5IM0B 1LOUA 4B9SA 2D69A 1RABB 2DNGA 5EN1A 4J5OA 4E0DA 2IYIA 2OMOA 1Q0NA 3UCUP 2E9TA 1RWPB 2FB0A 2HGMA 4YUDA 1L5UA 1SV5A 4X62F 3Q22A 1HNZJ 4NMLA 4K4ZA 2EWHA 1S1TB 4WFBQ 2KFNA 2QIFA 3I0RA 4XPEA 1KKHA 2MLZA 5DG9A 5GAHI 3H5UA 1T05B 3G8SA 1T02A 2UXBF 1FDAA 2ZOGA 2ILZA 3TA0A 2RJZA 5J1EB 3MM7A 3TVZA 3BBCA 1NJZA 2W01A 1VQLS 4MAKA 5HVHA 4IO9Q 4KHPJ 1Q53A 1REGX 1IKVB 3MAAA 2XLIA 3CJ0A 1SC3B 2RRNA 5CD4H 3X3UA 4ECSA 1F3FA 1F5BA 1U45A 3HSZA 1YQHA 3SSQA 4HI2A 3R5BA 2MQNA 3M2RB 3F44A 3RTVA 2GCFA 2YVSA 2JEFA 3CC4S 4B3OA 4GKJJ 1RQ0A 1LK5A 2RRAA 1YLXA 1TKTA 4I4BA 2NPFA 3SI8A 4LF7J 3TAQA 2MDAA 5EX3A 2DB1A 2P9CA 3AOAA 1VRUA 2XYPB 3DGVA 1DQAA 1J2VA 2GQ2A 3MMAA 3NG8A 5B0EA 1BQNA 4P6QA 1JLEB 1RE1B 1UWAA 4HH0A 4K4WA 3KNAA 3LW5C 4WP3A 1SUQB 4CLSA 2LLZA 4Q5VA 2DGXA 5ETOA 2YKPA 3U27A 3MCOA 4IFVB 4ZLJA 2DGWA 4PXEA 4DV2F 1HWUA 4RNOA 3LALA 2YNGA 1KQSR 2B0GA 1SC1B 3M2VB 5CCMA 4WFXA 4CRJA 2AYMA 3ELHA 2QFIA 3HM9A 1BMQB 3W9IA 3OR2A 2VIHA 1HIYA 4G3IA 2Z2ZA 5DDRC 4QR0A 3J80U 2B3TB 3UNYA 1F1BB 1H38A 3KLEB 4RW9A 2BX6A 1R6YA 3PCOB 1FEHA 5FLXU 3W5YA 3PYFA 2GJIA 4DL0C 5KFDA 2YKOA 2AWZA 3V5RA 4RNMA 2ABYA 3CCQS 4MIWA 3D7SB 2VFTA 3OUYB 3MM9B 4AE5A 1TFWA 4ED0A 4B9LA 4OJHA 4RW8B 3L4BC 4UTGA 2ALZA 4NCAA 3HMJG 1WWHA 5KFWA 4CP5A 3NMAA 3MXHP 3EZ5A 1GQEA 1YDLA 1X9WA 1MWZA 2NXNA 1NKBA 4R8UB 1T95A 2G9OA 4PCQA 2CPFA 2FJDB 4C8YA 2KL8A 2QMUB 2CJAA 1H6KX 1RAOA 3RJMB 2V69A 4KFBB 4MT1A 5A2QY 4I67A 2KYXA 3BKTA 1YG0A 1FDDA 2H4YB 4OLPA 4IOAQ 1HQUA 2AIRB 4QZVB 2HRTA 2G13A 2HHXA 4YP3A 3V6JA 1SH3A 3ET6A 1QDUB 1YITS 1CJTB 5D78A 4I2PB 2VHGA 2L08A 2QX0A 3CDUA 1V3SA 1LWEB 2MTLA 2J6TA 4I2QA 4PWDA 5T41A 3CDEA 2VOOA 1RAHB 4M5HA 3P45B 2UUCF 2AZ3A 2MKJA 1IUJA 2IRYA 4KGMA 3KLHA 3KKFA 2EFNA 2NUHA 2XMMA 2HHPA 2FLNA 5K20B 4WFAQ 3Q8PB 1RLDA 3GTYX 3BN4A 4QJVA 3SCJE 5KG5A 2GGPA 1OO0B 3M9OB 3JSMB 2DGVA 2OHDA 4NLUA 1NO8A 4I6YA 3W1YC 1T9VA 2JLFA 2I0XA 3W66A 3R5DA 4E2FB 4ZVHA 3G6XA 1YTYA 3J7AN 2VBXA 2RHSB 3BKFA 4OYMA 1VQPS 3EMTA 4F4WA 3A8EA 1IKWB 2OKQA 4AD6A 2R7SA 3MEGA 2IAJA 4ANDA 2K1RA 3BO3A 4PRFA 2APOA 4LFBJ 4C0OC 4N76A 1FVQA 4YY3J 3QPIA 2IM0A 2WHOA 1JB0C 3FBCA 3OBIA 3SIPB 1JLCB 2JOQA 3MMJA 5AXNA 1ZA1B 1ACMB 3RW7A 2V8DA 1SQGA 2OPSB 4FP9A 1K0TA 2RF2B 3ZFVA 1FTRA 2CUYA 1QM9A 2DGQA 3MWBA 2DNOA 1S1UB 3CIMA 2GO9A 1KHVA 1RAFB 5HO4A 4ZA1A 4OJGA 4CH1A 2QL9B 4YB7A 3I87A 4ICLA 2HGLA 2HFOA 2HVDA 4CO0A 1F60B 5DETA 1HA1A 2MKIA 2LFVA 4NLRA 4R5PB 1U47A 3NGDA 1TL5A 5KFUA 4X4SA 3K0JA 2LXUA 1JLBA 2XM3A 2Q66A 1U4BA 2UXBJ 4WKRA 2KG0A 1TUWA 4X4TA 4NI2B 2BV3A 2ZFHA 1D3WA 5CH7B 1B64A 1FE0A 2IC3B 3N0VA 1CPZA 4RU9A 1AA1B 3JTOA 3SMZA 3H2LA 3KYLA 1IR2A 1ZPVA 2E5GA 4G65A 1YJTA 4DJBA 2J0XA 4LJMA 1KLMA 2RKIB 2QLJB 3W64A 5BJRA 4LR7A 3MFIA 2A6OA 3NNAA 4K8RA 2DNPA 2VJVA 4WXWA 1PJ6A 1RHUB 4PAAA 4D3GA 2HSEB 2CPHA 3NGUA 4B3RJ 2KVQE 4HHUA 4WTOB 1U8WA 2BQ3A 1BY9A 3M8PB 3UCGA 3OPKA 1Q81T 3NAHA 1YJNS 1JKHA 1X5TA 2CZ4A 2WRMA 4RW4B 4OI2A 2BQUA 2FJBB 2HHHJ 3I9ZA 4ILRA 5DS7A 2V2QA 4FBUA 1M5KC 3OTBA 2J9DA 3HSDA 3R3TA 3ZNJ1 4L3KA 4LF7F 3DI6B 1QE1A 1H2VZ 4FKYA 1WC4A 3W8GA 2EK6A 5LXYA 4O0NA 3I31A 5KFFA 1FWLA 1Q78A 4U67Q 4DV3J 2LQ8A 2QJ3A 2VV5A 2DHGA 4ZVQB 3BSAA 4JI8F 1XNRJ 1NPKA 4WE1B 1FF2A 2W1BA 2YXLA 2BKPA 3GG0A 2VPWB 3MD3A 2UV8G 4QOTA 3PXGa 2E9ZA 2XS5A 2FJWA 4J9VA 3BGRB 4RJVA 4B08A 3CE8A 4E8UA 3R7SB 3CCMS 1SJFA 1EKSA 3M32A 4Y2KA 1R43A 3R7BB 3CDWA 1WC0A 2AHOB 2DYAA 2N4CA 2C22A 4WPAA 1UVMA 4PXBA 1ICEB 1KN6A 5IWAF 3D0HE 4CLKA 2DVIA 3D3BJ 2Y0SD 2AJQA 1DBDA 4FF4A 4QIWD 2HBQB 2JEIA 4O44A 1NNDA 4TVAB 3S01A 3KG1A 5KOXA 4J9KA 1X60A 3I9V9 1VYAA 1MWQA 2W24A 2AD9A 1FERA 1OQ3A 2NXCA 2AT1B 3DCAA 1CBKA 3ENAA 3NOGA 5F8HA 4IRDA 4DR6F 2DXDA 2LDIA 2CDRB 1FK9A 4HKQA 1H2UX 1EB0A 1SI9A 1XERA 1Z4UA 3KG0A 5GADU 2LEAA 4DR7F 3AOBA 2VQFF 5HK4A 2V4RA 1M5VC 2O5DA 3C14A 2EK1A 2I1RA 2PT0A 5KFBA 5HROA 4ZN3A 2OO4A 3KDOA 1K1QA 1NK0A 4F02A 1YRTA 4WWSA 2HS0A 5L8RC 4KQZA 2BXJA 4ZPAA 2ZBPA 2RDJA 3RB3A 2XNQA 1VK8A 3SSSA 1FWPA 3MEKA 5KG6A 5DLGA 5A0YB 1TKXB 3TUZC 1N54B 1S1VA 2OFHX 2R8HA 5E33A 4FPRA 4F3QA 2ROGA 4AUKA 3AB2B 3EZUA 2BABA 2V0NA 2CJKA 4DQPA 1EETA 4PKDB 2IDLA 1S9EB 1OPIA 1JNRB 5J1PA 2HHVA 3AA8A 3VZIA 2MZRA 3MMBA 2QRRA 1FJEB 3G71S 1Z1ZA 1ZAWA 3E51A 5T14A 4LSLA 2ZJPQ 5FDLA 4PQUB 2QV6A 4LF8F 3RW6A 2R7RA 5EX0A 2JL9A 4I56A 1HBNB 4LBIA 3TA2A 2MB0B 4UY8T 2VC0A 1FJCA 3DRSB 4DZDA 5M2PA 1UJ6A 2DY1A 1XMBA 2FJEB 2HFZA 1PIEA 2J9EA 3N4WA 1HPZA 2A3JA 4I1TA 1L3TA 3AOCA 4Y2MA 2L41A 5L9NA 1VBKA 3W62A 4OX9J 1NDCA 2AJFE 4EU0A 5KG2A 1PO6A 3OR1B 2Y3YA 2MHEA 3G8TA 1NSAA 2DR7A 4C8KA 2XLKA 3FFIB 5K9FA 2W7AA 1CS4A 1SH2A 1EQMA 4P72A 3QJJA 1EP4A 3K8VA 4DV0F 4K5RA 1WF2A 2H65B 2HWHA 1RK8A 2K06A 3RRHA 2XMKA 3QGHA 4FVMA 4OQJA 4LIWA 1CJUB 2W2PP 5U47A 1MW7A 2EBEA 1OSCA 5GVQA 2VQEF 1RWVB 2AGPA 2FC8A 3ZC4A 1H7XA 4X4OA 1YI2S 1I5OB 2DNKA 2HVZA 4ECRA 3WX8A 2MKCA 2XYGB 3DHWC 2Q6BA 4BCAA 4ZK7M 2M4MA 2MEWA 2HQGA 3FQKA 2HLUA 3M2UA 2GVDB 4M5NA 3UD5A 3WHIA 4DUYJ 3K5OA 3TYTA 2RQKA 3I5CA 3MM8B 3MPDA 1S79A 3R2DJ 4EK2A 1B99A 4ZPCA 5GAEU 3J7YU 2DT9A 1YJVA 4L72B 1RU2A 3FNNA 4JP8A 2IM3A 1C4CA 4ETZA 2KXHA 2FHJD 3KK1B 2CVIA 1TAQA 2OEMA 4IQMA 2HNYA 4QWBA 4O3PA 4C0BA 3ZZ0A 2VKZG 4KGXB 4TXSA 3Q0AA 1Y11A 2WW4A 3NXZA 1SL0A 5IT9U 3LAKA 3OFHA 4AFFA 4DV0J 3M6WA 1T3OA 1S1XB 2DGSA 2P2CB 4P2SA 1E6VB 3VWSA 3VAJA 3D5MA 3LPYA 4OZ3A 3BBFA 3R6GB 3B4MA 5L1LA 2HS4A 3TQ1A 1JX4A 3OFGA 5D0EA 1S57A 3TO8A 5LMNF 4ZPWR 1ZZNA 4LREA 1U0HA 4MYUA 2U2FA 3TX0A 4JI7J 1TL1A 2DNNA 3G4SS 3NMRA 2BRLA 1E6YB 5E3CA 2RAQA 3HPOA 2ZKUA 3NEKA 1ZTWA 4FNIA 4M5DA 2F4VF 3BGOP 3M8QA 3L95X 3HFKA 1FNMA 4WJBA 3IRXA 1PCAA 3HVTB 4USTA 1FCAA 3SQOP 3B4DA 4YFUA 4KT0C 4WF9Q 4B02A 1F2GA 3R5AA 1ZA2B 3VQTA 3G9CA 3J7YI 4KSEB 1CJKB 3WIUA 5J2QA 3DOLA 4DV3F 1SJRA 3GLJA 4L73A 4RW7A 1HNZF 3GB0A 2ZDPA 3CJRA 5ETNA 2D3UA 4X4VA 1SJQA 5B7WA 4JB8B 4TYBA 5DQGA 4LSNB 2R7UA 2KHCA 1VQ7S 5HBMA 3C16A 2UUTA 1JLQB 4M95A 2J8AA 3BR8A 4JI4F 2ZWOA 4MFBB 5L9XA 2AX0A 4IDKA 2KU7A 3A8KA 3TP2A 3KMSA 4YB1P 5F8MA 2R8GA 3QJLA 2LMIA 1WORA 2A2DA 2BUNA 1X7VA 1SCJB 1U25A 1U6ZA 3AD7C 3CO0P 2QL5B 3QGGA 4CYUB 4PWUA 5D3GA 2VL1A 2WBMA 1VRTB 3V81B 4ANCA 2XCPA 5B0CA 4FYDA 1X31C 1XR5A 3DLEA 2KYZA 2JDJA 3HD2A 5F0UA 1EX8A 3ETMA 5A8KA 3PW0A 4I64A 2JHEA 3DLHA 1K0VA 2PE8A 4K5SA 2XS7A 1UP1A 4KKOB 3HLUA 2MY8A 1APSA 3EE3A 1JLFA 1O5JA 3EXCX 3OSNA 2B6AB 2DITA 4RBTA 2N7CA 1IR0A 2CWXA 2YQ3A 3HDSA 2F40A 3PG9A 4DR1J 2ZH5A 3PNIA 2KXNB 1ZOTA 3CJTA 1HHSA 1RAIB 4USKA 2RE1A 3KLIB 4K2JA 2Y8YA 3BSCA 4DR5J 4B3TF 3OXGA 4CTAA 4LF6F 1NEEA 3PFOA 2OAUA 4Q2LA 3ZZYA 4K0KF 4X2BA 3AT1B 3IR5B 4OZ0A 3WZ0A 5HQMA 1TK5A 2UUBF 3TAMA 4USUA 4DSJA 4Y0FA 1AZSB 1YJ7A 5CHCB 2ZH6A 2FVPA 1Q95G 3IG1B 1WHVA 1G4CA 2BE2B 2VG5A 1VMBA 3IGNA 3P96A 3W63A 3ZZTA 1NK6A 3JTPA 2KI2A 2J76E 1UPPA 3NKYA 4NL5A 5JVGQ 4OX7A 3PKYA 5RUBA 2BE2A 1GNKA 3CVKA 3IG1A 3N6NA 2XGQA 1NK9A 2BJ7A 1BE4A 2UVUA 2ZUGA 3OTDA 2CNLB 4ZP8A 2E5LJ 1TTHB 2JX2A 1HBUA 1HW8A 3DLKA 2W4CA 4LVNP 5HL7Q 2N82B 3PY8A 4IO1A 1OSDA 2D3OR 3T5LA 3HZGA 1N56A 2Q1LA 1UFLA 2K7JA 4UOFA 4K4YA 2ZHBA 1M5PC 3JXOA 2FPHX 4FVCA 3W2VA 4ES1A 1JJHA 2HVIA 1C4AA 4DX5A 3OVSA 3K8WA 1VC0A 1CVJA 1UEUA 2HNDB 4ID5B 4MMOA 1VOMA 2B6AA 4QIFA 4YS2A 2MZ1A 2HFVA 5F9NA 3BSOA 1FKAF 4LF5J 4OYPA 5AE1A 1VQYA 3CD0A 1C0UB 2R2RA 4KKOA 1K47A 1RZMA 2EKNA 2B8QA 2FZCB 3FEZA 3UDVA 2JFKA 4QR1A 4DU7A 2KO1A 5A8KB 4LFAF 5CYMA 2D7SA 2V6AA 4Q0BA 3V81A 2L3MA 1U2CA 2RQ4A 5DG8A 1Q1KA 4IG3B 4HDGA 3ZZOA 4ELTA 3QGIA 3MR6A 3VAIA 1EAYC 3VGTA 4J9QA 1HWJA 1DRZA 4LRDA 4I7FA 2CNOB 1FKOB 2BANA 2A10A 2C2MB 4DBQA 5GADI 1HNXF 1QSSA 4IDKB 3QLHA 1HBMB 4MFBA 1RA6A 2OGUA 3I5BA 2XCAA 4CLTA 2UU9F 4LF5F 5SUHA 3C16B 3H5YA 4OI4A 1NU4A 1N34J 9ATCB 4JV1A 3OVBA 4LSNA 5ETTA 4KC5A 3CDBA 3PJXA 5IQ6A 4BDPA 3IWLA 1P6TA 2F8MA 2NQPA 4LRAA 1M5SA 3M8RA 3PDNA 4H4KC 1KQFB 4DV2J 1YGYA 1JJ2R 3CULA 2W25A 1S6QB 1VCTA 4NXNF 2AZ1A 5J2QB 2OTLS 3Q2SC 2ZOFA 1MMLA 4D3HA 1RTJA 2I8EA 2YX1A 1Q79A 2KRBA 4DPOA 1Y10A 2VFRA 1HYSA 5BXIA 4USVA 5IT4A 4F50A 2P6SA 5KFPA 1NSPA 1SKUB 1OIAA 1V3RA 2R8JA 5ETVA 3BPDA 5HAOA 1RT5A 1N5TA 1ZAXA 3BR9A 4ED8A 3NRBA 1JLGB 2UXCF 1UW9A 1V5VA 3CO9A 4MK8A 4LF8J 1NJWA 2W4DA 4L74A 1C1CA 4C0HA 3J7A1 1HQEA 3KFWX 2O66A 2YH1A 1NH7A 3DRPA 1I3OB 3KHRA 5I42B 1T03A 1S12A 4QYZJ 2WB4A 4WTYA 4ZVGA 2MLYA 5KFOA 5IXUA 4IH7A 2HMIB 5DDPC 3CCRS 4ELVA 4BS2A 5DQIA 2EBGA 1N33F 1S1XA 1K9MT 3GQCA 4AXJA 2DK2A 1WKLA 4BLGA 2DHHA 4C98A 4KO0B 1O6XA 2ZZTA 4A4JA 1U26A 5DZ6A 4C48A 4EEYA 2DH7A 1S97A 2MJUA 2J0QD 2W9AA 2GO8A 3NY0A 1RADB 1UA0A 2J0SD 4GKJF 2HFUA 1KS2A 3TUJC 2VUGA 1EKRA 2XI2A 4BHQA 2ZNYA 4Y34A 2JLGA 1JXVA 4OJ1A 1W26A 1H72C 1JLGA 4F3OA 4KGKA 3R6LB 2ZEJA 4YDDB 4B9TA 4ZVPB 3A4TA 2QTWA 3SCIE 1NKEA 3HZEA 1KVIA 4IKAA 2QEXS 3H2UB 3KJFB 5HSPA 1VFJA 4RR5A 1QAJA 1FFSB 1OY6A 2DNRA 3HD1A 1IXKA 3BS9A 3BYRA 3PRDA 1Q8BA 4OLOA 5GAEI 5EGYA 1AB8A 1VLOA 1SJ3P 1XNQJ 3J80Y 5BR8F 1M0SA 4TU8A 4Y2CA 4NLWA 1FDBA 1DHMA 1EP4B 3WC0A 2UUBJ 4O4GB 2NXUA 4QPTA 1B0TA 1ULRA 2VA3A 2KT3A 1OMSA 1J5EJ 1FXDA 1UEKA 1D8YA 3AQPA 3ILIA 4C3MA 1ITPA 2AU0A 3OR1A 1HBMA 2BM1A 1FKOA 2BANB 3LGMA 1VDHA 1P1TA 4DUTA 4WCEQ 4DR1F 2D3O1 4AXIA 4DSEA 1S59A 2M0GB 2M5YA 1HPZB 4P7VA 5LMUJ 3BREA 2HZCA 4IG3A 3Q8YA 3TX8A 4X66J 2JEJA 3DRSA 3KK2B 2YQ1A 3F56A 4L75A 4XTTA 2W8LA 4DR5F 1U1LA 3RUBL 5EWGA 4Q0BB 2QA2A 1NK4A 1XMQF 3LANA 2CA9A 3TA1A 1S9FA 2EPIA 2J7UA 3NGRA 1RCOB 2V8HA 1CSJA 1Z2LA 1X4GA 1X4CA 3BDEA 1MROA 2W8KA 3TUPA 3RRGA 3NNCA 1DQ8A 5KG0A 1VHFA 2R7XA 2UXCJ 4HI1A 3CD5A 2IHR1 4F7VA 4O3NA 5EHHA 4ID5A 5LSRA 2LQJA 4OMFG 1S9EA 4KAIA 4WP8A 1PJ7A 4CT9A 2UXDJ 4TY9A 3NWGA 4M1KA 4UZCA 4CZCA 3M9NB 4FS2A 3DHXA 1S4FA 1GMUA 2HQ3A 1SKSA 3A13A 3GR1A 1U48A 1BLUA 4JI4J 2XO6A 1LWCB 1S1VB 3WBZA 1TKXA 4RX6A 3DLKB 3GFZA 4HLBA 1MSWD 1QTMA 5ETQA 5KFEA 4DZ6A 4OZJA 6FD1A 1PBUA 4PG5A 3DOMB 3OT9A 3TZXA 3N5BA 3SDEB 3QFHA 3G2XA 4H54A 4WYLA 2W9CB 2J7WA 3G8QA 3U1MA 2BJDA 1UPMB 2BBEA 2M2BA 2V2VA 1HARA 4FYYB 4YDXA 5ITHA 4EO6A 4USMA 1FK9B 2XWXA 4NWBA 2J8SA 4ENOA 4ES3A 3K57A 2B9YA 1HWLA 2KT5A 5I4MA 4MYTA 1URNA 3CCVS 2H3EB 1U6FA 4G1QA 3HT3A 3T6JA 2C2RA 2QMWA 5LJ5Y 4LFBF 2HIYA 3DXSX 4RWWA 1LNQA 2VASA 1DARA 2IBOA 4KY3A 4CTAB 2GA7A 1TQLA 5D0RA 3KLIA 1QAYA 1ZS6A 3HX9A 2IRUA 2C2DA 2J6UA 4V19J 1HNWJ 2NR0A 3RB6A 1S7IA 5DRKA 4OIXA 4X4QA 2RUGA 1YX2A 1FXLA 2ZD1B 5E7OB 2ZBRA 3D66A 2CQDA 1YBUA 3VAKA 3T5KA 2DNZA 1QAIA 3UN2A 4KO0A 1MG7A 1UWBA 2Z57B 3CMES 3BGRA 4OX9F 1VQSA 1CULA 4USHA 1VQ8S 2CJQA 2Y1JA 4KTQA 4DV6J 1WUUA 4NYOA 2V68A 4WE1A 3MFHA 2VF3A 1O51A 2UUAF 1GTEA 4PXCA 3DLJA 2CQ4A 4YB6A 1YJRA 2MQMA 2XZWA 5D15A 2F63A 2UXDF 4CH7A 2HBZB 1SBRA 2CQBA 2W7PA 2CPJA 2GHVC 1HQEB 1TMMA 4YHHJ 3CCJS 4JV5F 2OP5A 1X0FA 2BE9B 5I3QA 2HS3A 2XMVA 4XO0A 4DUYF 2EKYA 1X9SA 5EWFA 3DLLQ 4DUZJ 1JNZB 3A12A 4N77A 3IO1A 4BWMA 3X1LB 1RBLA 3M8WA 4C8MA 3OV7A 1GT8A 1HYSB 1VS3A 1IR1A 2DGTA 1VQKS 2Y1IA 3TW0A 5B0FA 3SYZA 1Q86T 3DKDA 2DGUA 3FEXB 3QQCD 1MMNA 5HJXA 3MGJA 3THTA 1N0VC 5ETRA 4QU7A 4OHVA 2LU1A 1KLMB 2RKIA 1Q16B 2B8PA 5IC6B 2PMZD 2E1CA 1G1XA 2Y8WA 2PI4A 1PBAA 1H73A 1RBAA 2WZ1A 4KHMA 4R0EA 3HVTA 5B0AA 1KVKA 4WFNQ 2ZM6J 4FYXB 5HVGA 3M8QB 4ZJLA 4QWCA 4F4ZA 4PPDA 4NASA 4I7FB 2EFQA 3PTWA 2FD2A 1V3ZA 4NOHA 1PSDA 2BW7A 4NZ6A 4U96A 3IBCB 1RLCL 2KT2A 2UZAA 2WSCC 3MI7X 4BC9A 5AJ3F 2DO0A 3VAGA 3P6YC 3TWZA 5D77A 3BO2A 1X5OA 4UUWA 3JB9k 1U1MA 3NNHA 3CTRA 4QIGA 1G7CB 1NH8A 1CULB 1SXLA 3FC9A 4CM0A 5KT5A 5FLXY 3ICLA 3HFVA 3FKBA 3OJUA 1UWBB 1A9NB 2HNDA 2ASDA 3ZTOA 4ELUA 3M6UA 4JOUA 1WDDA 3PX6A 2ZD1A 4WXOA 5GMEA 1CEZA 2BJ9A 2J0WA 5HN0A 5KFHA 2NZ4A 4N5SA 1FA0A 1S72S 4X65J 1IBKF 3HHEA 2RS8A 1HBUB 4OHWA 5BYSA 1WEYA 3MM8A 1KQGB 2K7KA 4PWWA 1FRIA 4CLYA 4G1QB 1Y4ZB 3MR2A 2DPJA 4NLPA 1JJ4A 1NPRA 2E66A 2YWEA 3EM1A 5L1JA 2YWKA 1UEVA 3KWMA 4MKBA 4ZVFA 1CQNA 2CG4A 1KOOA 2NPIA 1RI7A 2ZITA 5E3AA 4DL5A 3IRWP 2G2YA 3PEJA 3TUIC 3CUNA 3S6EA 3Q23A 4LFCJ 2CVEA 4BWJA 3IN5A 2E5HA 2HEKA 4B3MJ 4URGA 3GFHA 4NYPA 1AZSA 3VTIA 3SDEA 4DX6A 4DR3J 3DOMA 3T1HJ 2ROPA 3RAMA 4DS5A 1FJGJ 2AJ0A 3TR5A 1N8RT 3OTOJ 3T5HA 2XULA 4O0IA 3AODA 1YJWS 2DR9A 4I2QB 1LWCA 4PWDB 1QD1A 1N52B 4N56A 1S6UA 2E1MC 4DUZF 3UDEA 1Q7YT 3Q83A 1CJTA 4OI6A 2X3DA 4P2XA 3SZ2A 4X65F 1IBKJ 4S0MA 2M8DB 1U1KA 1LQ9A 1HQUB 1J27A 1JLFB 2N3LA 3DDIA 4X4RA 5B09A 1MROB 1B0PA 4C6AA 2XY6A 2RHQB 3GZ7A 4Y28C 3EGVA 1WELA 4A8SA 3UO0A 2Z0GA 5JVHQ 3DLEB 2G1HA 1ZPWX 3MR7A 1VRTA 4WZMA 4JI0J 3OHAA 3KK2A 2HURA 4Z7YA 4ECUA 5FDLB 2UVVA 4C9DA 4LSLB 1PYTA 4OZ5A 3HT0A 4RW8A 1NKCA 1VJQA 1RHQB 4ED2A 4PYAA 3MMBB 3OUYA 4CO5A 4HT7A 1JXLA 4C8ZA 2P6TA 2CQPA 3SXLA 2O67A 3UD3P 2OJ3A 1EETB 3CEDA 5GMDA 3U1NA 1Q5YA 4C3KA 5HBMB 4QWDA 3RBDA 4Y3CA 2IYGA 3M7VA 2KHDA 2MQ8A 1KBRA 1I51B 2AW0A 4CCHA 4O4GA 5KG3A 4ZP9A 4CNZA 3CJQA 4DN9A 4HHHA 2ASYA 4RW7B 2BACA 2B7CB 4DR4J 2YNGB 1FXRA 1GX5A 5D4LA 2MKSA 2HK2A 1FRJA 3HJFA 2Y0BB 1D9AA 4U7CA 3PX0A 3LWLA 2UVWA 2GMJA 3MAHA 4NLSA 1KP6A 4RUAA 3M6VA 4PYDA 3O44A 5H9FK 4M5DB 1YJ9S 4KYZA 1E6YA 3HHLD 3QSYB 3MUTP 5IT9Y 2RB7A 3HI9A 2O01C 4B3OB 4G1PA 4DDFA 1V9OA 2DIUA 1DJ0A 2HAIA 1WC1A 1CQMA 1FD8A 4DXLA 3EGZA 5SZTA 4A47A 4W90B 1E6VA 2P5VA 4UOCA 2HQDA 2E44A 2GFFA 4P2FA 1S48A 3HULA 4DR3F 1IKVA 4WK1A 5CABA 4MTPA 4PG4A 1T7PA 2BVZA 1NMEB 3RR7A 1FJGF 1DAXA 1R8HA 3QZ7A 2W2NP 2HMIA 4GKKF 3KK1A 2GHWA 1Y00A 3KG4A 3I0RB 1NDLA 5I42A 1T03B 3DRPB 1HI8A 3TZWA 4J90A 1C1CB 1KTVA 2ZC4A 1LWXA 2MKYA 1DY3A 2AV5A 1FI4A 2LQ9A 4C3LA 3M2UB 3AJ1A 1HWIA 2RD5C 2DRBA 1KD1T 5KFJA 4B9VA 1RT5B 1AFIA 4U6PA 1A0OB 2DNQA 2XO7A 4RBVA 3HSGA 5KT2A 1JKHB 3CCZA 3ITHA 1RKIA 2FZGB 3WQPA 2IVFB 3CGIA 4X84A 1AT1B 2NLWA 3SFUA 2OELA 1KNZA 1RTJB 4OI3A 1I94F 3IR7B 1S6QA 2ZKTA 3OD2A 2HGNA 3HKWA 4ZVRB 3A3OB 4U95A 1EARA 2ZWPA 1OPZA 2Y1LB 5EDWA 1HW9A 2NXJA 2Z2YB 3K17A 4QQBA 3UD4P 2Z30B 3A3NB 3FFIA 5KFNA 4DCOB 1S49A 2DISA 3IMQJ 3EGWB 4KHRA 3LAMA 5HVFA 4V1Ak 1NZAA 3QLHB 1S6OA 2F4FA 5A76A 2M70A 3H4DA 2CPXA 2HHTA 2RU9A 4OJ3A 2RU3A 1SQEA 2IDEA 2MGZA 2KG1A 1U02A 3JQJA 3R97A 5HATA 2XMUA 5LMNJ 3CC7S 4R5PA 2WBRA 2VPYB 1RXOB 4NCBA 5CYMB 4EFAC 2BW2A 4ICLB 4RUHA 3TAPA 1RP5A 4B17A 4F0HA 4ZMMA 2GV1A 4ZVUB 4EZ9A 1X8DA 3IWNC 4PQUA 2MZJA 4WZQA 1IJEB 5AXMA 1HWKA 4ES2A 1C0UA 3QRQA 4XDCA 2CPEA 4DF8A 1BD6A 3IGVA 2G0CA 2RF2A 2FGCA 2OPSA 2LU2A 3GYGA 3HCXA 2QGFB 1TP7A 4J9UE 1D09B 1GH8A 3CCES 1RTZA 5C2GA 3W2VB 4ZHRB 4UOGA 2ZE2A 4DX8H 4ER8A 1EJ7L 3ULHA 4AT1B 5ADZA 3DYAB 3IBWA 3C8YA 4H4KA 4ZCLA 5LJ3Y 3ZTQA 2YNIB 2RIJA 2MZSA 3AD8C 5A0YA 3W5ZA 4DFKA 2IAJB 2V94A 5F8IA 1RISA 3W5XA 4CT8A 1IKWA 1JIHA 2HZVA 1JK9B 2CQ1A 3Q89A 1I94J 1X5SA 5HROB 1V5IB 3D28A 2VODA 3I32A 4QBUA 3V4MA 3C14B 2QZ8A 4JI3J 2LEBA 4NLTA 1FD2A 2V4QA 4I0WA 3CD6S 4HL9A 4AQYJ 1QLNA 3O5TB 3KJVA 4DR6J 5KOWA 2VG5B 5HLFB 1RWNB 3P5TL 1SKRA 1HQ2A 3ISNC 1H74A 3TAMB 4TYAA 4O4RA 3HO1A 4OYZA 1H0HB 3AXKA 4CLLA 4O44B 2CWKA 3H90A 4ZKAA 3IA0A 2B9WA 9RUBA 2M52A 5L1IA 4OX8A 5DZ7A 1H98A 1PC5A 1P8GA 2AKWB 1FTCA 5IZHA 2WVFA 4ILLA 1SJ4P 4PUOB 1WKKA 2DPIA 4L3NA 2H51B 4EZ6A 2YH0A 3ET6B 2PFDA 2R2TA 3HSJA 3D2WA 2VKRA 1K44A 2FVCA 1EQ0A 4IRCA 1ROFA 3GJTB 5T7LA 3G82B 3W60A 5J2MB 2AJ1A 1UJ4A 2MQLA 3GR0A 1VIXA 2C3YA 3Q8QB 4B3SF 4Y65A 2VBWA 3D6HB 3OL8A 1P9QC 2ALYB 2CG8A 4R8UA 1B7FA 2UVRA 3FSXA 2XGPA 3JSYA 2FTRA 5A6WA 1NSQA 4JI0F 5D3GB 1RT3A 3NBPB 5THWA 4R25A 4CYUA 2ZH2A 1R0AA 2IA6A 3C66A 2VONA 3MOJB 1FFGB 4CWBA 2KZZA 3MHYA 2HVHA 1GXTA 2VFUA 5EUHA 5E41A 4MJKA 1T11A 3FRYA 4NEYA 2E29A 4OZLA 3T1AA 2VOPA 1JLQA 4RW4A 4ETXA 1VQ4S 2FGOA 3V6KA 3UI3A 1WEZA 5H9EK 1J5EF 3Q8SB 1EHWA 1KQKA 5ETMA 4I6WA 5J1NA 2NXEA 3S7RA 1O8BA 2Z58B 4TKTA 5HANA 4JI2J 3VQSA 3QJPA 3DOLB 2RSQA 4P2MA 1D9FA 2DO4A 2BMBA 1CJKA 4CLZA 3FBFA 1Y5NB 5B0DA 2JFDA 2KFYA 4IFVA 4QWAA 1H3DA 2C3PA 2W2OP 5BYRA 1SUQA 2UUAJ 1SVDA 3ILJA 2FUG9 3QIPA 4GKKJ 5IC4B 3D4JA 3IRXB 2IC3A 4OHYA 1OWXA 1SPBP 2CQ2A 1FDNA 3DGPB 3GJQB 5KG1A 3UE2A 4NI2A 1TUGB 4TLQA 4NZ7A 2NYHA 4PG7A 5KFVA 4F0KA 3M8YA 1K73T 4F0MA 5K8MA 3MMCB 1TL1B 3T19A 4PQAA 3K2YA 1NXIA 4K59A 3GYNA 1TKTB 1U0HB 2FHMA 3A1YG 3ETOA 3SBMA 2UP1A 4F8RA 3I4PA 4LR8A 3H98A 1Q8KA 2H54B 4M5LA 3M2RA 3OJSA 5E3PA 3PR4A 4ECXA 5D4NA 3IBFB 1U24A 2GAGC 3DC2A 1RGVA 4ZCIA 4KPYA 3O8WA 2G2OA 2PDAA 2ZH9A 2B43A 2QC3A 2HVEA 1T8EA 3R1HA 3KLGB 1FRKA 4LF2A 4LFAJ 4TU9A 2HHQA 2K2PA 2W2QP 2XTJP 3ENQA 3JS9A 1LK7A 4LF1A 5AXKA 4KB7A 4EYIB 2C2OB 1L3SA 2HNYB 2NS1B 3SQGB 1RT4B 3BZQA 1Y3KA 2J7KA 4JI2F 5KT7A 4ECQA 4A46A 1S1TA 3MEGB 1M1KT 1SV5B 1FEEA 1TUVA 2GVDA 1GX6A 3A8IA 4J9OA 5DM6Q 2V9WA 1P9YA 4IQXA 2WVDA 3NOCA 1QVGR 4P9SA 3CT9A 1N5YB 3HVWA 3IXQA 5G4DA 3PIPQ 2ZM6F 2A1BA 3JSMA 2HG4A 4U7UK 2GGPB 2CQ0A 4CLPA 2C2ZB 3M1VB 4OHXA 4ZLNA 3VAFA 3HK2A 1YBTA 3M8SA 1RT7A 1CJUA 1HFEL 4EUVA 5KAKA 2EG2A 2H5JB 1WC6A 3KLHB 2LQBA 4MK9A 5KFZA 3E2EA 4FKXA 3MR3A 1EIYB 5D0GA 3T1YF 1HHTP 3UWTA 1WHXA 1LWEA 3GG1A 5B0GA 1UZHA 5DDQC 1SL1A 1CS4B 2HQFA 2IMWP 2KVIA 3FMWA 3QT7A 4HEA9 4I2PA 1FT8A 3OTEA 4HDHA 4OI0A 2XQCA 2BJ3A 4WP9A 3FSIA 2ZVIA 2R3VA 1G6BA 4OYBA 4YEAA 3W3SA 5F8NA 3PRVA 1XC9A 1N4LA 1LW0A 1IM4A 1U8SA 3ISND 2GIRA 4HT5A 4F04B 1XNRF 3TJ9A 2H5IB 4WK3A 1HBNA 3AHPA 3BEGB 3S1TA 2B4UA 5F8GA 4JI3F 1DURA 2R7QA 1TELA 1U1OA 1FX4A 1Q7LB 1DLOB 4O3QA 2QSFA 5LM7E 3ZXWA 1TK0A 5DDOC 1JLAA 1WF1A 4LFCF 3R5CA 1PGZA 4F4YA 1YJUA 2GC8A 3P3DA 4KH0B 4FPIA 2D41A 2CPZA 3UNGC 2RILA 4KHPF 3CJSA 4OFZA 2OMLA 4DQSA 5K14A 1D9DA 4DL4A 1IKYA 1X9MA 1RCXB 3D6FB 1HNIB 2XY7A 1HNVA 1FNXH 4MIAA 1VJWA 4LRBA 1U49A 1IWAA 2V63A 3KUGA 3OR2B 1RU1A 2WVBA 4F36A 2HKEA 1J5OB 4B3MF 2CKWA 2UUCJ 4RL1A 2YWWA 2KTQA 1MNEA 1MN9A 5KFIA 2C28A 4LBPA 3H40A 2IFXA 4F2RA 1SJ1A 4DV4J 2ZVSA 2RS2A 3B8HA 4J9RA 3CPWR 2HBRB 2LKZA 4TN2A 1BQNB 4Y6IA 2E1RA 3MMAB 1VLYA 1WJ9A 1T0TV 3ZZPA 3FMBA 1VRUB 1M90T 3PO5A 1UVNA 2ACMA 3HHDA 4FF1A 2ZH7A 2A2CA 1AUSL 1QJHA 3G6VA 2VBZA 4LR9A 4J9LA 4DPTA 1RB0A 3CF5Q 1IM6A 2C42A 3VALA 2CJXB 2RVJA 2E1AA 5HQ8A 3TJ8A 3D6TB 1N32J 1X5PA 2GIQA 3UW1A 4DR2F 3NL0A 4OZ2A 2OD4A 3K58A 2VC1A 2DEIA 2F5GA 5C2CA 1XR7A 2CFXA 3CJ3A 3D1QA 2KJVA 2F65A 3M32B 2G4BA 5KFAA 4OL8A 1X0PA 4EO8A 4CO3A 4DFJA 1R8PA 2F3JA 2KB2A 4QIVA 1VQ5S 2C2NA 2C2KB 3PR5B 2HFNA 3CNQP 1T05A 5GAGI 5G0RA 1WI6A 4LRCA 3KLFB 1K1SA 2QG9B 5CZXA 4DSFA 1QE1B 3DI6A 2LP4A 5IQQA 2AMCB 3CB4A 3LUYA 4WIQA 4A8MP 3LP2B 3GE9A 3UDCA 1N88A 3UR0A 3W9JA 4DWIA 4LF6J 4DPYA 1N5SA 2H1YA 3SFGA 1MN7A 1QSYA 1PILA 5IM0A 3T6BA 5I3UB 2FHJA 3BKUA 4HTIA 3CCSS 5B08A 4DL2A 4IRKA 3IAS9 3PZPA 4IG0B 1D8ZA 2RRBA 2VD3A 1AFJA 2UU9J 4DFMA 3DMJA 3M8PA 1URRA 3O6QA 4DV5J 4JI1J 1SC4B 4P10A 1MU2A 4RBUA 1FJ7A 3V4IB 4ED1A 1XR6A 1YSJA 1WG5A 4MKAA 3GIJA 2GVZA 3MR5A 2VQFJ 2VQEJ 2YWFA 3GP9A 3JYTB 2NSCA 4NXNJ 5DQHA 5IFMA 1GMWD 3POTA 4USIA 2ZJQQ 3PX4A 4DN0A 3KDNA 2YBVA 2VU5A 3CJKB 2YQ0A 4DL6A 1VC6A 2R4FA 5FD1A 2R7TA 2CPDA 3GPAA 2OPRA 3TEHB 3N6LA 2J9CA 5MLCV 1JLBB 4DV1F 5C25A 1JJCB 1MMDA 2NZCA 5KFGA 2DXEA 1HNWF 2LDYA 2WK4A 5KG7A 4UZBA 1Y5LB 5C7PA 1UCNA 2JJ4D 4IR9A 2F9JA 2B7BB 3C2PA 1S1UA 5CQGA 2L9DA 4UW2A 4DV5F 4ED7A 1T9YA 3OTCA 4G1IA 2XEXA 3N5FA 1NK7A 2W9BB 3KOAA 4B3RF 3P8BB 4IH6A 4C11B 2CQ3A 1JLCA 2XSJA 4PZVA 2KKHA 3T9ZA 4M63A 2VFSA 2ZHAA 3HHNB 1QAXA 5JMNA 1GMVA 4LF9F 5KFYA 4DV7F 1KOHA 2K1RB 2IY5B 2D1CA 1G3OA 3GJSB 3JQKA 1IJFB 4NXMF 1XNQF 2H48B 3MPUB 4K4UA 2C3OA 4X64J 3BQ1A 5E0OA 3H5XA 4RW6B 2CAJA 4GC7A 1RTIB 1O0PA 2GZOA 4RUBA 3OHBA 4C8OA 1NSKL 3I4HX 1NBEB 2U1AA 2V34A 3QNWB 1UKUA 1HLWA 4J7CA 7FD1A 4HH1A 3OLAA 4FYVB 1RHJB 2ZUAA 4NLYA 5KFSA 4F67A 2WVCA 3GWCA 2ADCA 2EC2A 4C97A 4K2XA 3ZZZA 4E98A 3IFEA 1M1HA 2DKOB 4WBFA 4LF4F 4CI0B 4DQQA 2DNYA 4QW8A 4XDDA 2EC0A 4ZDNA 2ACYA 4X66F 4FXDA 3DLBA 1UAWA 2XWYA 4DV1J 1WTFA 2ZOMA 4FDFA 5DO2A 5HQLA 3UFCX 2ZJRQ 5KFRA 3BB5A 1TMJA 3MM5B 2IM2A 2RMLA 5I3PA 3HP6A 5GMKa 3HHLC 4ZPDA 4JYAJ 1DTQA 1G2EA 1NK5A 3RRKA 3PJ9A 2JLEA 4GVBB 4ZVEA 4O3OA 2CYYA 5HMZA 2ZH4A 5K8NA 4DSKA 2ROEA 1VC5A 1KHWA 2HYIB 4KFBA 1XTZA 2J6SA 2D9PA 2B4PA 3LPEA 2ZH8A 4AL6A 1R0CB 3ENWA 1YHQS 1X4HA 1C1BA 2Z8QA 1IBCB 4J91A 4Z37A 1UA1A 1UMJA 2XSFA 3I96A 3PIOQ 2DNMA 4F26A 2PMWA 3PJWA 3BO4A 2DD8S 2LECA 8AT1B 5M2UA 1TL7A 3BGUA 3QWUA 4NRTA 3G6YA 2WOMB 2FY1A 1HD0A 1M5HA 2PA8D 1S6PA 3MM9A 1YKWA 3MOZA 3W8PA 2K3IA 2R2SA 2DJWA 4OYAA 5KFLA 2HHSA 3L7OA 1LWFB 3L09A 3P4UB 4GMKA 4M5JA 5LL6d 4YY3F 1LV5A 3WIVA 4ED5A 3DLGA 1RKJA 3PACA 1Y9OA 1KEKA 4RW9B 3KLEA 2QMXA 2QA4S 2VDHA 3QT5A 1VHIA 1JXEA 2V2KA 3DU6A 3L7PA 5CCLA 4H4OB 4USWA 2XYHB 1ZETA 5CYJA 1TL3A 1C0TA 1HMVB 4P7TA 3M2VA 2X1AA 2IVMA 1A7GE 1S4EA 1H2TZ 1SL2A 3KTQA 2LXFA 4RNHA 4V19X 4NLGA 1HKAA 1SQFA 1WG4A 3NWRA 3HHLA 4A8XA 1W25A 4J9NA 1LEOA 5L46A 2Y9HA 1JLEA 2J9DE 1BHNA 2COLA 3HVAA 3CC2S 4LUBA 1T9WA 2B51A 4QYRA 2Z4PA 3QWPA 2HQIA 5J2NB 2GJ2A 1RA7A 5LT5A 3FGVA 5DG7A 1IBLJ 1FFWB 4EBDA 3VVTA 2YKNA 3KK3A 1SH0A 1FRMA 1ZBTA 2R7VA 3NS5A 4J9PA 3ZTRA 1AXQA 3OL7A 4ZIVA 1IVZA 2MQQA 1UFWA 3DRXA 2BR0A 4Y2AA 3EUNA 4RU2A 3MEEB 3KMQA 4KR0B 5JUMA 2FLPA 4PPZA 3D9BA 3GONA 3GFXA 5KT4A 3H8YA 4PABA 1R8CA 4DI6A 1U2FA 3V6HA 2R42A 4M5MA 4DF4A 4X4UA 2Q79A 2OLWA 3MAAB 2WCXA 4DHVA 1BWVA 1S9GB 3BF4A 4P74A 2W9CA 3GCWP 2MZTA 1F2HA 1N36F 5J1EA 3MM7B 3ZNUA 5AJ3J 1BQXA 3VAHA 1VQ6S 1JMTA 4JV2A 1JWWA 3PW2A 2XC9A 3QO9A 1W7WA 2VG7A 1LKZA 1RAGB 3L9ZA 5KT3A 3E3XA 4YR0A 4DV6F 4ED6A 4KBIA 2GHPA 2W4PA 4NZ0A 3K5PA 2FLOA 3IP0A 5A2QU 1NB2A 3OL6A 2XMWA 2PIIA 3M4XA 3DN9A 3ILOA 4QPXA 5KTQA 2QA1A 2QT7A 4OV6A 2AYBA 1LW2A 1RT1A 2FJVA 4OX6A 2JRSA 3DOKA 1L3VA 4DSLA 4DR7J 4IFYB 4LBHA 3CMQA 1IKXB 2YNFA 3PYGA 3R2CJ 2GMLA 3RGIA 3PVXA 2AGOA 3B82A 3M30A 3NCQA 1AUDA 1UVLA 4Q2MA 3SSRA 1S5ZA 3MUMP 1FRHA 2KXFA 3GSIA 3IC1A 5HJYA 3CXCR 5GAHU 4DQIA 5E2QA 1W2BR 2Q3PA 2O3DA 3SEOA 3K59A 1RWKB 2M7SA 3LP1B 2PFFB 1IWGA 4RUCA 1FKPA 1WC3A 5A8WB 2JC1A 3BV8A 5LOQA 4MKVA 2DH9A 4TQSA 2SXLA 5HP1A 3HF5A 3LWMA 4F3MA 2I5JA 2AJ2A 2XZDB 4TLRA 3BSNA 1FO1A 1CJVA 4CNYA 3I0SA 3MF5A 1DTTB 1GK8A 2CPYA 2IA0A 2PEHA 4C7QA 2QFJA 4EYHB 3K89A 4MK7A 1VR6A 4B3TJ 2BJ8A 1I1GA 1PKUA 1R3NA 2JNJA 1L3UA 2B5JB 3EICA 2PI5A 2ERRA 1P1LA 4TY8B 4ZCKA 1NHUA 2YX4A 4NPOA 4JI5F 2AGQA 2E5IA 1N6QB 1Q8IA 1KRPA 3IS9B 1PYSB
chains in the Genus database with same CATH topology
1R89A 4DMZA 1KONA 2IM1A 3FEYB 2XG8A 4HVZA 3C6TB 3DXBA 1WTBA 2KFZA 5F3ZA 3CCUS 1BQMA 5DGBA 1F5CA 4WIIA 2YKMA 3EXYA 1RTDB 4NLOA 2ZZMA 5JJBA 1X4BA 1XN9A 1W2IA 3UDLA 4N8NA 4GC6A 1RT2B 3C3LA 2LA6A 4RKUC 4HTJA 3RZAA 3MCSA 2AJ4A 5CXTA 1DQ9A 3EYZA 1VBYA 4A8YA 2YX7A 2EW9A 3R27A 1VGYA 1U6BA 1U7LA 2F8HA 5J2PB 2X1GA 2QE5A 2OPPB 1S0VA 2JH3A 1TK8A 1FVSA 4Q43A 1F0XA 4O3SA 2F1FA 3DM2B 3D54A 3U02A 2UV8A 1Y7PA 4KIAA 4IUFA 2YNHB 2FJAB 2WONB 1S76D 1ZM9A 3ZZRA 4GO5X 2FHOB 1FHTA 4NCGB 1HBOA 2DTJA 5C24A 1TVRB 3KHLA 5A8RA 1P27B 3E01A 5HMXA 5GAGU 3K5LA 3C6UA 2HHWA 2P9GA 5A8RB 3GIIA 3V6DB 3SCLE 1K8AT 5M2RA 4HYKA 3HXMA 2XBPA 4Q7AA 3WX4A 2YNHA 1TKDA 1OQ6A 2GQQA 1UVIA 3LP0A 2I38A 4UQTA 4IOCQ 4DSIA 2YTCA 2IJNA 2VPZB 2JVOA 3RU0A 4ECWA 2LQ5A 2PGCA 1U1PA 3THPA 3ENVA 1RT2A 4H4MB 1NAQA 2DHXA 4WU2A 1IQTA 4IH5A 3MM6A 4Q45A 1Y3JA 4BC7A 2N3OA 3DRRA 4F4XA 3UCZP 3OTOF 4A8FA 2CQCA 4ILMA 2CQIA 2V4JB 3K7RA 1ELOA 3M05A 3O1LA 4C8NA 3WDOA 1N6QA 2R8KA 5LXRA 4NLVA 1VIOA 2FVSA 4IYQA 2B5JA 2JVRA 3TVKA 1L3KA 3QAUA 5H9FJ 4A8KA 1DTTA 4DR4F 3I0SB 3AH6A 3FCHA 4LT6A 3BJYA 1HI1A 4KV8B 1YBAA 1WI8A 5FIIA 3AAWB 2XI3A 1RTHB 3VF0B 1RT6B 3MECB 2OSRA 4TNOA 4B9NA 3G96A 2HNZA 2OIHA 1ZZFA 3VAMA 4FF2A 5C42B 2HRUA 1XK8A 4NLDA 2BJEA 1KSPA 4A48A 1RYSA 3BDPA 4QU6A 1N5QA 1R8BA 2VBYA 4DG1A 2R7WA 3MEDB 2BRKA 5D4PA 4M8LA 2MXYA 3DOKB 1FE4A 1KTQA 2HWTA 4ZLPA 2CJ9A 3PW4A 4ITSA 4QCLA 1U1NA 4ECZA 5D8HB 1U1QA 3TOQA 3AA9A 1CLFA 1TKZA 1R7IA 2G1DA 2HW3A 4K4TA 4ED3A 4DFPA 2DHAA 2VG7B 3QO9B 5KFCA 2FHKA 3EPIA 3UR3C 5DJBA 2ADBA 1YIJS 3DRYA 5CYQB 5EWEA 5L39A 3OFFA 4RNNA 4J9SA 4Y2IA 2QLWA 3D0GE 1TL4A 1S0NA 4XIUA 1GTHA 3CJ2A 3GV5B 3HVRA 3HHKA 5IS2A 2R7OA 4MH8A 2F7VA 5DGAA 1X4AA 1CC7A 3SV4A 3GYXB 1S1WA 3FZ2A 2OPQA 3PEHA 4W92B 2YKNB 3KK3B 3PHEA 1ZM3A 2NSBA 4YR3A 5KFKA 3CCLS 1N5VA 4ZPBA 1RT6A 2PSZA 3US5A 4Q8FA 1S0OA 1SIWB 2E7WA 3N28A 4KV8A